F492716

General Info

Members Datasets Scaffolds Average Seq Length
1298 458 1088 273

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0031965|Ga0495654_0031965_1013_1987
Length 312
Sequence MPVALITGCSSGIGRALADAFKTAGYQVWATARKVEDVATLSAAGFTAVQLDVNDGHALEQLGERINQQHGGLDVLVNNAGYGAMGPLLDGGVPAMQRQFETNVFAIVGVTRALFPVLRRAKGLVVNIGSVSGVLVTPFAGAYCASKAAVHALSDALRMELAPFGIRVMEVQPGAIASSFAKNAGHEAEQLISEQSPWWPLRDGIRARAKASQDNPTPAHEFAAGLLKPGQWQPGIALDGRLAAQGIAGEGVDEAVWVGEIAVIIAILFFAVVARELAPARLRSSRRLTRLTVSVFWGGFATQREQAPSPQG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231006 Pseudomonas sp. GM17 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231008 Pseudomonas sp. GM21 Isolate Nodule
8 2511231010 Pseudomonas sp. GM25 Isolate Nodule
9 2511231011 Pseudomonas sp. GM30 Isolate Nodule
10 2511231012 Pseudomonas sp. GM33 Isolate Nodule
11 2511231014 Pseudomonas sp. GM48 Isolate Nodule
12 2511231015 Pseudomonas sp. GM49 Isolate Nodule
13 2511231016 Pseudomonas sp. GM50 Isolate Nodule
14 2511231017 Pseudomonas sp. GM55 Isolate Nodule
15 2511231018 Pseudomonas sp. GM60 Isolate Nodule
16 2511231019 Pseudomonas sp. GM67 Isolate Nodule
17 2511231020 Pseudomonas sp. GM74 Isolate Nodule
18 2511231021 Pseudomonas sp. GM78 Isolate Nodule
19 2511231022 Pseudomonas sp. GM79 Isolate Nodule
20 2511231023 Pseudomonas sp. GM80 Isolate Nodule
21 2511231031 Pseudomonas sp. GM16 Isolate Nodule
22 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
23 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
24 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
25 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
26 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
27 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
28 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
29 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
30 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
31 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
32 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
33 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
34 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
35 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
36 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
37 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
38 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
39 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
40 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
41 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
42 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
43 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
44 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
45 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
46 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
47 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
48 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
49 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
50 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
51 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
52 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
53 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
54 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
55 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
56 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
57 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
58 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
59 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
60 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
61 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
62 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
63 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
64 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
65 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
66 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
67 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
68 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
69 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
70 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
71 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
72 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
73 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
74 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
75 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
76 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
77 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
78 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
79 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
80 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
81 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
82 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
83 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
84 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
85 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
86 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
87 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
88 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
89 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
90 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
91 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
92 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
93 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
94 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
95 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
96 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
97 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
98 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
99 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
100 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
101 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
102 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
103 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
104 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
105 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
106 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
107 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
108 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
109 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
110 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
111 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
112 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
113 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
114 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
115 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
116 2765235841 Pseudomonas putida AA7 Isolate Unclassified
117 2773857670 Pseudomonas sp. 478 Isolate Unclassified
118 2773857673 Pseudomonas sp. 443 Isolate Unclassified
119 2784132063 Pseudomonas sp. 424 Isolate Unclassified
120 2784132072 Pseudomonas sp. 460 Isolate Unclassified
121 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
122 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
123 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
124 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
125 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
126 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
127 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
128 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
129 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
130 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
131 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
132 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
133 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
134 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
135 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
136 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
137 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
138 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
139 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
140 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
141 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
142 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
143 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
144 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
145 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
146 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
147 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
148 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
149 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
150 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
151 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
152 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
153 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
154 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
155 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
156 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
157 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
158 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
159 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
160 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
161 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
162 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
163 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
164 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
165 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
166 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
167 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
168 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
169 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
170 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
171 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
172 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
173 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
174 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
175 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
176 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
177 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
178 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
179 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
180 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
181 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
182 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
183 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
184 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
185 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
186 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
187 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
188 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
189 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
190 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
191 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
192 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
193 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
194 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
195 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
196 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
197 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
198 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
199 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
200 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
201 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
202 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
203 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
204 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
205 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
206 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
207 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
208 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
209 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
210 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
211 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
212 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
213 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
214 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
215 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
216 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
217 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
218 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
219 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
220 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
221 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
222 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
223 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
224 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
225 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
226 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
227 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
228 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
229 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
230 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
231 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
232 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
233 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
234 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
235 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
236 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
237 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
238 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
239 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
240 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
241 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
242 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
243 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
244 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
245 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
246 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
252 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
253 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
255 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
257 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
258 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
274 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
276 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
278 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
279 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
280 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
281 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
282 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
283 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
284 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
285 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
286 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
287 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
288 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
289 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
290 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
291 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
292 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
293 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
294 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
295 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
296 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
297 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
298 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
299 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
300 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
301 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
302 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
303 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
304 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
305 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
306 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
307 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
308 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
309 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
310 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
311 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
312 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
313 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
314 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
315 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
316 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
317 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
318 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
319 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
320 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
321 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
322 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
323 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
324 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
325 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
326 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
327 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
328 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
329 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
330 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
331 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
332 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
333 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
334 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
335 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
336 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
337 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
338 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
339 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
340 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
341 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
342 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
343 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
344 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
345 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
346 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
347 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
348 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
349 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
350 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
351 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
352 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
353 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
354 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
355 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
356 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
357 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
358 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
359 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
360 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
361 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
362 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
363 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
364 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
365 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
366 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
367 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
368 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
369 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
370 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
371 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
372 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
373 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
374 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
375 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
376 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
377 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
378 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
379 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
380 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
381 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
382 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
383 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
384 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
385 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
386 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
387 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
388 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
389 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
390 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
391 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
392 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
393 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
394 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
395 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
396 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
397 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
398 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
399 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
400 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
401 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
402 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
403 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
404 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
405 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
406 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
407 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
408 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
409 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
410 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
411 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
412 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
413 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
414 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
415 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
416 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
417 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
420 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
421 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
422 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
429 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
430 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
432 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
433 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
434 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
435 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
436 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
437 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
438 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
439 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
440 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
441 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
442 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
443 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
444 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
445 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
446 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
447 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
448 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
449 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
450 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
451 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
452 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
453 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
454 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
455 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
456 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
457 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
458 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.82
Metatranscriptomes 0
Isolates 16.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 2.08
Rhizoplane 5.39
Rhizosphere 76.19
Stem 0
Stem Tuber 0
Unclassified 11.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6269 2124908027 Bacteria 2330
2 MRS2a_Contig_755 2124908027 Bacteria 28110
3 MRS2a_Contig_9248 2124908027 Bacteria 2263
4 SwRhRL2b_contig_1611694 2162886007 Bacteria 7048
5 SwRhRL2b_contig_3290672 2162886007 Bacteria 4315
6 MRS1b_contig_7272918 2162886011 Bacteria 1346
7 JGI25162J39368_1000101 3300002737 Bacteria 94481
8 JGI25162J39368_1000200 3300002737 Bacteria 63130
9 JGI25154J39366_1005404 3300002738 Bacteria 2046
10 JGI25163J39215_1000597 3300002771 Bacteria 10046
11 JGI25163J39215_1001770 3300002771 Bacteria 2964
12 JGI25164J39214_1000097 3300002772 Bacteria 87008
13 JGI25164J39214_1000162 3300002772 Bacteria 63130
14 JGI25165J46597_1000184 3300003214 Bacteria 94481
15 JGI25165J46597_1000294 3300003214 Bacteria 63130
16 Ga0055538_1000029 3300003751 Bacteria 203858
17 Ga0055539_1000039 3300003752 Bacteria 203858
18 Ga0055533_1000049 3300003756 Bacteria 203858
19 Ga0055532_1000306 3300003758 Bacteria 29851
20 Ga0055525_1000322 3300003759 Bacteria 37351
21 Ga0055536_1000062 3300003781 Bacteria 99169
22 Ga0055536_1002879 3300003781 Bacteria 9465
23 Ga0055530_10000352 3300003791 Bacteria 41591
24 Ga0055530_10001090 3300003791 Bacteria 21342
25 Ga0055530_10002783 3300003791 Bacteria 10790
26 Ga0055540_1000363 3300003792 Bacteria 38285
27 Ga0055540_1001509 3300003792 Bacteria 13796
28 Ga0055540_1002134 3300003792 Bacteria 10790
29 Ga0055531_10001955 3300003794 Bacteria 14404
30 Ga0055541_1000026 3300003841 Bacteria 203858
31 Ga0058692_1012123 3300003856 Bacteria 2054
32 Ga0065714_10000141 3300005288 Bacteria 8970
33 Ga0065714_10002730 3300005288 Bacteria 11988
34 Ga0065714_10003596 3300005288 Bacteria 9081
35 Ga0065714_10004160 3300005288 Bacteria 6094
36 Ga0065714_10004656 3300005288 Bacteria 6890
37 Ga0065714_10008732 3300005288 Bacteria 2752
38 Ga0065714_10009951 3300005288 Bacteria 4063
39 Ga0065714_10065500 3300005288 Bacteria 9722
40 Ga0065714_10086414 3300005288 Bacteria 2100
41 Ga0065714_10101695 3300005288 Bacteria 1630
42 Ga0065714_10117601 3300005288 Bacteria 1389
43 Ga0065704_10017170 3300005289 Bacteria 1669
44 Ga0065704_10073101 3300005289 Bacteria 7580
45 Ga0065704_10093656 3300005289 Bacteria 2582
46 Ga0065704_10310272 3300005289 Bacteria 866
47 Ga0065712_10106236 3300005290 Bacteria 1921
48 Ga0070669_100000159 3300005353 Bacteria 60857
49 Ga0070669_100001980 3300005353 Bacteria 14807
50 Ga0070674_100265962 3300005356 Bacteria 1353
51 Ga0070662_100001145 3300005457 Bacteria 16258
52 Ga0068853_100005095 3300005539 Bacteria 10260
53 Ga0070665_100006134 3300005548 Bacteria 12288
54 Ga0068854_100127274 3300005578 Bacteria 1941
55 Ga0068851_10000006 3300005834 Bacteria 258116
56 Ga0075364_10042675 3300006051 Bacteria 2947
57 Ga0075364_10148441 3300006051 Bacteria 1579
58 Ga0075432_10002392 3300006058 Bacteria 6250
59 Ga0075432_10003269 3300006058 Bacteria 5473
60 Ga0075432_10034165 3300006058 Bacteria 1765
61 Ga0075432_10074437 3300006058 Bacteria 1223
62 Ga0075432_10077884 3300006058 Bacteria 1198
63 Ga0075362_10011428 3300006177 Bacteria 3497
64 Ga0079104_1000385 3300006946 Bacteria 51277
65 Ga0079104_1004015 3300006946 Bacteria 6523
66 Ga0079104_1006068 3300006946 Bacteria 4670
67 Ga0079104_1012761 3300006946 Bacteria 2620
68 Ga0099826_10028013 3300006948 Bacteria 4129
69 Ga0105251_10000702 3300009011 Bacteria 30884
70 Ga0105251_10001941 3300009011 Bacteria 16926
71 Ga0105251_10005639 3300009011 Bacteria 8132
72 Ga0105251_10008332 3300009011 Bacteria 6258
73 Ga0105251_10010264 3300009011 Bacteria 5449
74 Ga0105251_10050246 3300009011 Bacteria 1993
75 Ga0105251_10056821 3300009011 Bacteria 1851
76 Ga0105244_10000562 3300009036 Bacteria 33123
77 Ga0105244_10002462 3300009036 Bacteria 13944
78 Ga0105244_10007486 3300009036 Bacteria 6936
79 Ga0105244_10009045 3300009036 Bacteria 6163
80 Ga0105244_10014335 3300009036 Bacteria 4586
81 Ga0105244_10017030 3300009036 Bacteria 4119
82 Ga0105244_10028764 3300009036 Bacteria 2978
83 Ga0105244_10030721 3300009036 Bacteria 2856
84 Ga0105244_10058751 3300009036 Bacteria 1939
85 Ga0105244_10093424 3300009036 Bacteria 1478
86 Ga0105244_10135523 3300009036 Bacteria 1187
87 Ga0105250_10000216 3300009092 Bacteria 47921
88 Ga0105250_10003640 3300009092 Bacteria 7253
89 Ga0105250_10005501 3300009092 Bacteria 5673
90 Ga0105250_10005647 3300009092 Bacteria 5587
91 Ga0105250_10052380 3300009092 Bacteria 1637
92 Ga0105250_10067185 3300009092 Bacteria 1446
93 Ga0105243_10000136 3300009148 Bacteria 84363
94 Ga0105243_10000183 3300009148 Bacteria 73056
95 Ga0105243_10005387 3300009148 Bacteria 9984
96 Ga0105243_10022862 3300009148 Bacteria 4753
97 Ga0105243_10028662 3300009148 Bacteria 4276
98 Ga0105249_10172387 3300009553 Bacteria 2099
99 Ga0105246_10000395 3300011119 Bacteria 23407
100 Ga0105246_10008966 3300011119 Bacteria 6158
101 Ga0105246_10078954 3300011119 Bacteria 2339
102 Ga0105246_10265157 3300011119 Bacteria 1370
103 Ga0157345_1000149 3300012498 Bacteria 12124
104 Ga0157373_10001469 3300013100 Bacteria 18012
105 Ga0157373_10001638 3300013100 Bacteria 17082
106 Ga0157373_10003340 3300013100 Bacteria 12126
107 Ga0157373_10005366 3300013100 Bacteria 9630
108 Ga0157373_10013948 3300013100 Bacteria 5894
109 Ga0157373_10160561 3300013100 Bacteria 1581
110 Ga0157371_10002112 3300013102 Bacteria 19363
111 Ga0157371_10003971 3300013102 Bacteria 13115
112 Ga0157371_10009763 3300013102 Bacteria 7530
113 Ga0157371_10024731 3300013102 Bacteria 4381
114 Ga0157370_10025742 3300013104 Bacteria 5821
115 Ga0157370_10054321 3300013104 Bacteria 3818
116 Ga0157370_10209540 3300013104 Bacteria 1807
117 Ga0157369_10004824 3300013105 Bacteria 15834
118 Ga0157369_10008629 3300013105 Bacteria 11688
119 Ga0157369_10029869 3300013105 Bacteria 6019
120 Ga0163162_10000380 3300013306 Bacteria 40442
121 Ga0163162_10016404 3300013306 Bacteria 7239
122 Ga0163162_10063740 3300013306 Bacteria 3729
123 Ga0163162_10228605 3300013306 Bacteria 1990
124 Ga0163162_10306856 3300013306 Bacteria 1719
125 Ga0157372_10005253 3300013307 Bacteria 13752
126 Ga0157375_10115310 3300013308 Bacteria 2789
127 Ga0157375_10435867 3300013308 Bacteria 1476
128 Ga0182008_10004070 3300014497 Bacteria 8629
129 Ga0182008_10004398 3300014497 Bacteria 8241
130 Ga0182008_10015173 3300014497 Bacteria 4024
131 Ga0182008_10016456 3300014497 Bacteria 3843
132 Ga0182008_10020315 3300014497 Bacteria 3422
133 Ga0182008_10021159 3300014497 Bacteria 3343
134 Ga0182008_10042602 3300014497 Bacteria 2261
135 Ga0182008_10051751 3300014497 Bacteria 2037
136 Ga0182008_10054123 3300014497 Bacteria 1986
137 Ga0182008_10089507 3300014497 Bacteria 1517
138 Ga0182006_1000810 3300015261 Bacteria 20944
139 Ga0182006_1008822 3300015261 Bacteria 4556
140 Ga0182007_10000591 3300015262 Bacteria 21279
141 Ga0182007_10002324 3300015262 Bacteria 9540
142 Ga0182007_10023502 3300015262 Bacteria 2167
143 Ga0182005_1000474 3300015265 Bacteria 20805
144 Ga0182005_1002768 3300015265 Bacteria 6113
145 Ga0182005_1005483 3300015265 Bacteria 3960
146 Ga0182005_1012658 3300015265 Bacteria 2380
147 Ga0182005_1028616 3300015265 Bacteria 1519
148 Ga0182005_1039989 3300015265 Bacteria 1275
149 Ga0182005_1043999 3300015265 Bacteria 1214
150 Ga0163161_10007587 3300017792 Bacteria 7501
151 Ga0163161_10013312 3300017792 Bacteria 5721
152 Ga0163161_10017459 3300017792 Bacteria 5022
153 Ga0163161_10028387 3300017792 Bacteria 3974
154 Ga0163161_10052908 3300017792 Bacteria 2943
155 Ga0163161_10054612 3300017792 Bacteria 2899
156 Ga0163161_10179255 3300017792 Bacteria 1624
157 Ga0163161_10240627 3300017792 Bacteria 1407
158 Ga0163161_10328910 3300017792 Bacteria 1210
159 Ga0209435_101081 3300025206 Bacteria 3790
160 Ga0209760_100003 3300025207 Bacteria 257011
161 Ga0209760_100512 3300025207 Bacteria 7929
162 Ga0209784_100045 3300025224 Bacteria 203911
163 Ga0209566_100057 3300025225 Bacteria 203960
164 Ga0209674_100080 3300025226 Bacteria 203960
165 Ga0209147_100079 3300025229 Bacteria 203960
166 Ga0209563_100078 3300025230 Bacteria 203960
167 Ga0209563_100286 3300025230 Bacteria 21146
168 Ga0207427_100001 3300025231 Bacteria 1410763
169 Ga0207427_100004 3300025231 Bacteria 939600
170 Ga0209437_100003 3300025233 Bacteria 1517827
171 Ga0209437_100028 3300025233 Bacteria 540136
172 Ga0209258_100434 3300025242 Bacteria 47860
173 Ga0209646_1000286 3300025246 Bacteria 43916
174 Ga0209677_100045 3300025253 Bacteria 203960
175 Ga0209759_1033447 3300025256 Bacteria 974
176 Ga0209233_1000007 3300025261 Bacteria 1411234
177 Ga0209233_1000008 3300025261 Bacteria 1356712
178 Ga0209676_1000056 3300025292 Bacteria 361329
179 Ga0209676_1000078 3300025292 Bacteria 296293
180 Ga0209676_1000101 3300025292 Bacteria 227976
181 Ga0209676_1004836 3300025292 Bacteria 7313
182 Ga0209676_1005729 3300025292 Bacteria 6375
183 Ga0209050_1000027 3300025298 Bacteria 483261
184 Ga0209050_1000041 3300025298 Bacteria 408004
185 Ga0209050_1000181 3300025298 Bacteria 142533
186 Ga0209050_1000425 3300025298 Bacteria 77756
187 Ga0209051_1000061 3300025303 Bacteria 253485
188 Ga0209051_1000065 3300025303 Bacteria 231445
189 Ga0209051_1000085 3300025303 Bacteria 189973
190 Ga0209051_1004273 3300025303 Bacteria 8892
191 Ga0209257_1000105 3300025304 Bacteria 243729
192 Ga0209257_1015949 3300025304 Bacteria 3078
193 Ga0207656_10000023 3300025321 Bacteria 98957
194 Ga0207696_1000022 3300025711 Bacteria 427529
195 Ga0207696_1000032 3300025711 Bacteria 380071
196 Ga0207696_1000210 3300025711 Bacteria 88330
197 Ga0207696_1001211 3300025711 Bacteria 14666
198 Ga0207696_1002431 3300025711 Bacteria 9145
199 Ga0207696_1004964 3300025711 Bacteria 5613
200 Ga0207696_1036447 3300025711 Bacteria 1460
201 Ga0207655_1000021 3300025728 Bacteria 518596
202 Ga0207655_1000204 3300025728 Bacteria 103596
203 Ga0207655_1001335 3300025728 Bacteria 23251
204 Ga0207655_1002799 3300025728 Bacteria 13534
205 Ga0207655_1002873 3300025728 Bacteria 13312
206 Ga0207655_1003755 3300025728 Bacteria 11129
207 Ga0207655_1006205 3300025728 Bacteria 7961
208 Ga0207655_1006232 3300025728 Bacteria 7937
209 Ga0207655_1006500 3300025728 Bacteria 7732
210 Ga0207655_1007143 3300025728 Bacteria 7290
211 Ga0207655_1008237 3300025728 Bacteria 6643
212 Ga0207655_1046202 3300025728 Bacteria 1811
213 Ga0207655_1054934 3300025728 Bacteria 1580
214 Ga0207655_1073480 3300025728 Bacteria 1261
215 Ga0207713_1000244 3300025735 Bacteria 69698
216 Ga0207713_1000728 3300025735 Bacteria 30769
217 Ga0207713_1001876 3300025735 Bacteria 15968
218 Ga0207713_1003202 3300025735 Bacteria 11306
219 Ga0207713_1006957 3300025735 Bacteria 6785
220 Ga0207713_1006967 3300025735 Bacteria 6777
221 Ga0207713_1007394 3300025735 Bacteria 6487
222 Ga0207713_1010374 3300025735 Bacteria 5157
223 Ga0207713_1011122 3300025735 Bacteria 4923
224 Ga0207713_1011699 3300025735 Bacteria 4747
225 Ga0207713_1016002 3300025735 Bacteria 3825
226 Ga0207713_1039376 3300025735 Bacteria 1994
227 Ga0207713_1057138 3300025735 Bacteria 1510
228 Ga0207713_1071245 3300025735 Bacteria 1283
229 Ga0207713_1073938 3300025735 Bacteria 1249
230 Ga0207713_1087009 3300025735 Bacteria 1108
231 Ga0207681_10001218 3300025923 Bacteria 16567
232 Ga0207681_10005418 3300025923 Bacteria 7834
233 Ga0207706_10000677 3300025933 Bacteria 35782
234 Ga0207686_10050340 3300025934 Bacteria 2590
235 Ga0207709_10000067 3300025935 Bacteria 189188
236 Ga0207709_10000238 3300025935 Bacteria 68893
237 Ga0207709_10003244 3300025935 Bacteria 9753
238 Ga0207709_10014904 3300025935 Bacteria 4300
239 Ga0207712_10105824 3300025961 Bacteria 2100
240 Ga0207640_10115479 3300025981 Bacteria 1912
241 Ga0207639_10003715 3300026041 Bacteria 10268
242 Ga0209281_1000015 3300027111 Bacteria 590084
243 Ga0209281_1000049 3300027111 Bacteria 322274
244 Ga0209281_1011080 3300027111 Bacteria 2033
245 Ga0209371_1000197 3300027312 Bacteria 88691
246 Ga0209371_1000264 3300027312 Bacteria 61388
247 Ga0207428_10024528 3300027907 Bacteria 5064
248 Ga0207428_10030610 3300027907 Bacteria 4449
249 Ga0207428_10044218 3300027907 Bacteria 3594
250 Ga0207428_10087005 3300027907 Bacteria 2432
251 Ga0207428_10090542 3300027907 Bacteria 2376
252 Ga0207428_10098979 3300027907 Bacteria 2256
253 Ga0207428_10154305 3300027907 Bacteria 1747
254 Ga0207428_10163395 3300027907 Bacteria 1690
255 Ga0268266_10007552 3300028379 Bacteria 9793
256 Ga0268256_1000147 3300030500 Bacteria 94888
257 Ga0268256_1000150 3300030500 Bacteria 93793
258 Ga0307511_10007903 3300030521 Bacteria 10674
259 Ga0314311_1172029 3300030733 Bacteria 7521
260 Ga0307509_10092718 3300031507 Bacteria 3086
261 Ga0307408_100000950 3300031548 Bacteria 22493
262 Ga0307408_100001821 3300031548 Bacteria 15526
263 Ga0307408_100006277 3300031548 Bacteria 7891
264 Ga0307408_100007240 3300031548 Bacteria 7339
265 Ga0307408_100010104 3300031548 Bacteria 6221
266 Ga0307408_100133607 3300031548 Bacteria 1938
267 Ga0307516_10177153 3300031730 Bacteria 1868
268 Ga0307405_10000274 3300031731 Bacteria 18986
269 Ga0307405_10001031 3300031731 Bacteria 11281
270 Ga0307405_10013806 3300031731 Bacteria 4319
271 Ga0307405_10254096 3300031731 Bacteria 1309
272 Ga0307413_10067330 3300031824 Bacteria 2238
273 Ga0307406_10044776 3300031901 Bacteria 2774
274 Ga0307406_10050106 3300031901 Bacteria 2645
275 Ga0307407_10269696 3300031903 Bacteria 1174
276 Ga0307412_10001285 3300031911 Bacteria 14069
277 Ga0307412_10001493 3300031911 Bacteria 12987
278 Ga0307412_10005598 3300031911 Bacteria 7053
279 Ga0307412_10006636 3300031911 Bacteria 6555
280 Ga0307412_10008492 3300031911 Bacteria 5867
281 Ga0307412_10130988 3300031911 Bacteria 1821
282 Ga0307412_10442873 3300031911 Bacteria 1068
283 Ga0307409_100424470 3300031995 Bacteria 1276
284 Ga0307416_100066467 3300032002 Bacteria 2968
285 Ga0307416_100076703 3300032002 Bacteria 2803
286 Ga0307416_100184565 3300032002 Bacteria 1959
287 Ga0307416_100216558 3300032002 Bacteria 1832
288 Ga0307414_10012725 3300032004 Bacteria 4988
289 Ga0307414_10038006 3300032004 Bacteria 3228
290 Ga0307414_10069295 3300032004 Bacteria 2535
291 Ga0307414_10101261 3300032004 Bacteria 2168
292 Ga0307414_10143408 3300032004 Bacteria 1873
293 Ga0307411_10014484 3300032005 Bacteria 4390
294 Ga0307411_10026196 3300032005 Bacteria 3507
295 Ga0307411_10029776 3300032005 Bacteria 3339
296 Ga0307411_10357782 3300032005 Bacteria 1192
297 Ga0307411_10421660 3300032005 Bacteria 1109
298 Ga0307510_10005444 3300033180 Bacteria 15160
299 Ga0237819_01061 3300038705 Bacteria 8170
300 Ga0436363_0044187 3300039450 Bacteria 1583
301 Ga0439436_0001078 3300041404 Bacteria 7693
302 Ga0439438_000097 3300041405 Bacteria 40098
303 Ga0439438_000769 3300041405 Bacteria 14359
304 Ga0439438_001964 3300041405 Bacteria 8982
305 Ga0439438_002147 3300041405 Bacteria 8498
306 Ga0439438_003765 3300041405 Bacteria 5993
307 Ga0439438_008263 3300041405 Bacteria 3471
308 Ga0439438_008553 3300041405 Bacteria 3383
309 Ga0439438_009240 3300041405 Bacteria 3203
310 Ga0439438_011024 3300041405 Bacteria 2834
311 Ga0439438_020614 3300041405 Bacteria 1849
312 Ga0439438_062307 3300041405 Bacteria 932
313 Ga0439439_0052238 3300041406 Bacteria 1073
314 Ga0439447_001036 3300041407 Bacteria 10105
315 Ga0439447_004269 3300041407 Bacteria 4955
316 Ga0439447_007894 3300041407 Bacteria 3334
317 Ga0439447_008570 3300041407 Bacteria 3160
318 Ga0439447_011462 3300041407 Bacteria 2585
319 Ga0439447_017713 3300041407 Bacteria 1936
320 Ga0439447_017897 3300041407 Bacteria 1922
321 Ga0439447_029651 3300041407 Bacteria 1383
322 Ga0439447_036349 3300041407 Bacteria 1216
323 Ga0439447_051631 3300041407 Bacteria 980
324 Ga0439466_0000484 3300041411 Bacteria 15170
325 Ga0439466_0001105 3300041411 Bacteria 10494
326 Ga0439466_0001764 3300041411 Bacteria 8461
327 Ga0439466_0011492 3300041411 Bacteria 3276
328 Ga0439466_0012787 3300041411 Bacteria 3082
329 Ga0439466_0015937 3300041411 Bacteria 2726
330 Ga0439466_0028815 3300041411 Bacteria 1913
331 Ga0439466_0040557 3300041411 Bacteria 1556
332 Ga0439465_0010394 3300041413 Bacteria 2924
333 Ga0439431_0000648 3300041997 Bacteria 7405
334 Ga0439431_0009666 3300041997 Bacteria 2179
335 Ga0439432_003547 3300042006 Bacteria 5772
336 Ga0439432_016287 3300042006 Bacteria 2503
337 Ga0439432_019446 3300042006 Bacteria 2261
338 Ga0439432_023454 3300042006 Bacteria 2033
339 Ga0439451_002248 3300042009 Bacteria 3888
340 Ga0439451_005522 3300042009 Bacteria 2580
341 Ga0439451_005676 3300042009 Bacteria 2552
342 Ga0439451_009838 3300042009 Bacteria 1929
343 Ga0439452_000372 3300042010 Bacteria 27160
344 Ga0439452_001330 3300042010 Bacteria 10335
345 Ga0439452_001343 3300042010 Bacteria 10259
346 Ga0439452_006283 3300042010 Bacteria 3729
347 Ga0439452_015280 3300042010 Bacteria 2111
348 Ga0439452_015650 3300042010 Bacteria 2074
349 Ga0439452_018546 3300042010 Bacteria 1851
350 Ga0439456_001381 3300042013 Bacteria 4859
351 Ga0439456_002821 3300042013 Bacteria 3503
352 Ga0439456_009949 3300042013 Bacteria 1963
353 Ga0439456_015903 3300042013 Bacteria 1573
354 Ga0439456_027815 3300042013 Bacteria 1205
355 Ga0439456_037812 3300042013 Bacteria 1042
356 Ga0439463_004293 3300042016 Bacteria 3575
357 Ga0439463_005751 3300042016 Bacteria 3077
358 Ga0439463_022141 3300042016 Bacteria 1589
359 Ga0439463_032560 3300042016 Bacteria 1317
360 Ga0450911_000216 3300042115 Bacteria 22573
361 Ga0450911_002608 3300042115 Bacteria 3475
362 Ga0450911_003293 3300042115 Bacteria 2884
363 Ga0450911_003888 3300042115 Bacteria 2536
364 Ga0450911_004519 3300042115 Bacteria 2273
365 Ga0450919_001981 3300042121 Bacteria 2659
366 Ga0450919_004827 3300042121 Bacteria 1637
367 Ga0450920_002641 3300042122 Bacteria 3068
368 Ga0450922_000588 3300042124 Bacteria 3804
369 Ga0450922_000804 3300042124 Bacteria 3214
370 Ga0450923_002430 3300042125 Bacteria 2672
371 Ga0450890_003080 3300042127 Bacteria 2235
372 Ga0450900_004842 3300042136 Bacteria 1566
373 Ga0450900_006549 3300042136 Bacteria 1412
374 Ga0450900_006960 3300042136 Bacteria 1382
375 Ga0450902_001653 3300042137 Bacteria 3073
376 Ga0450902_004731 3300042137 Bacteria 2032
377 Ga0450902_023923 3300042137 Bacteria 1015
378 Ga0450903_002596 3300042138 Bacteria 3193
379 Ga0450903_002931 3300042138 Bacteria 2978
380 Ga0450903_004504 3300042138 Bacteria 2375
381 Ga0450903_005259 3300042138 Bacteria 2171
382 Ga0450903_006703 3300042138 Bacteria 1907
383 Ga0450903_007362 3300042138 Bacteria 1812
384 Ga0450904_000890 3300042139 Bacteria 4851
385 Ga0450904_001713 3300042139 Bacteria 2912
386 Ga0450905_003868 3300042142 Bacteria 1972
387 Ga0450907_000028 3300042146 Bacteria 69314
388 Ga0450907_027447 3300042146 Bacteria 965
389 Ga0450910_000425 3300042147 Bacteria 4994
390 Ga0439446_0001791 3300042156 Bacteria 5007
391 Ga0439446_0005083 3300042156 Bacteria 3367
392 Ga0439446_0011627 3300042156 Bacteria 2393
393 Ga0439446_0013421 3300042156 Bacteria 2248
394 Ga0450909_002494 3300042185 Bacteria 2605
395 Ga0450909_005794 3300042185 Bacteria 1779
396 Ga0450909_009411 3300042185 Bacteria 1426
397 Ga0439434_0000677 3300042435 Bacteria 9838
398 Ga0439434_0009914 3300042435 Bacteria 2803
399 Ga0439434_0021589 3300042435 Bacteria 1934
400 Ga0439464_0002752 3300042439 Bacteria 4362
401 Ga0439464_0009252 3300042439 Bacteria 2592
402 Ga0439464_0040780 3300042439 Bacteria 1323
403 Ga0439460_0003989 3300042461 Bacteria 3585
404 Ga0439460_0005324 3300042461 Bacteria 3153
405 Ga0450918_004851 3300042531 Bacteria 2433
406 Ga0450918_005612 3300042531 Bacteria 2252
407 Ga0450893_0001886 3300042532 Bacteria 3247
408 Ga0450901_001402 3300042533 Bacteria 2756
409 Ga0439440_0000809 3300042993 Bacteria 5421
410 Ga0439440_0001333 3300042993 Bacteria 4484
411 Ga0439440_0007206 3300042993 Bacteria 2253
412 Ga0495617_003380 3300046452 Bacteria 6012
413 Ga0495617_004581 3300046452 Bacteria 5007
414 Ga0495617_004803 3300046452 Bacteria 4873
415 Ga0495617_010526 3300046452 Bacteria 3167
416 Ga0495617_015731 3300046452 Bacteria 2560
417 Ga0495617_019232 3300046452 Bacteria 2309
418 Ga0495617_037007 3300046452 Bacteria 1635
419 Ga0495617_039401 3300046452 Bacteria 1580
420 Ga0495617_052355 3300046452 Bacteria 1356
421 Ga0495627_001493 3300046453 Bacteria 13527
422 Ga0495627_001820 3300046453 Bacteria 11351
423 Ga0495627_007010 3300046453 Bacteria 4371
424 Ga0495627_013327 3300046453 Bacteria 2893
425 Ga0495627_013827 3300046453 Bacteria 2833
426 Ga0495627_018205 3300046453 Bacteria 2374
427 Ga0495592_0023430 3300046454 Bacteria 4695
428 Ga0495603_0009598 3300046455 Bacteria 5850
429 Ga0495603_0015260 3300046455 Bacteria 4647
430 Ga0495603_0016070 3300046455 Bacteria 4525
431 Ga0495603_0098230 3300046455 Bacteria 1710
432 Ga0495590_0002001 3300046457 Bacteria 8568
433 Ga0495590_0003853 3300046457 Bacteria 6104
434 Ga0495590_0005317 3300046457 Bacteria 5111
435 Ga0495590_0014590 3300046457 Bacteria 2865
436 Ga0495590_0040915 3300046457 Bacteria 1615
437 Ga0495590_0046574 3300046457 Bacteria 1513
438 Ga0495590_0063923 3300046457 Bacteria 1288
439 Ga0495591_000019 3300046458 Bacteria 223010
440 Ga0495591_000585 3300046458 Bacteria 27658
441 Ga0495591_001116 3300046458 Bacteria 17769
442 Ga0495591_001656 3300046458 Bacteria 13415
443 Ga0495591_002086 3300046458 Bacteria 11519
444 Ga0495591_003632 3300046458 Bacteria 7855
445 Ga0495591_004280 3300046458 Bacteria 7053
446 Ga0495591_005276 3300046458 Bacteria 6030
447 Ga0495591_006452 3300046458 Bacteria 5187
448 Ga0495591_008386 3300046458 Bacteria 4237
449 Ga0495591_009047 3300046458 Bacteria 4000
450 Ga0495591_019335 3300046458 Bacteria 2282
451 Ga0495591_020548 3300046458 Bacteria 2178
452 Ga0495591_034763 3300046458 Bacteria 1480
453 Ga0495591_045830 3300046458 Bacteria 1217
454 Ga0495591_049788 3300046458 Bacteria 1150
455 Ga0495629_0112072 3300046459 Bacteria 1901
456 Ga0495638_0002428 3300046460 Bacteria 15231
457 Ga0495638_0007388 3300046460 Bacteria 7886
458 Ga0495638_0008121 3300046460 Bacteria 7465
459 Ga0495638_0010228 3300046460 Bacteria 6529
460 Ga0495638_0018600 3300046460 Bacteria 4611
461 Ga0495638_0019164 3300046460 Bacteria 4529
462 Ga0495638_0023323 3300046460 Bacteria 4047
463 Ga0495638_0026807 3300046460 Bacteria 3734
464 Ga0495638_0028064 3300046460 Bacteria 3637
465 Ga0495638_0030132 3300046460 Bacteria 3495
466 Ga0495638_0050668 3300046460 Bacteria 2592
467 Ga0495638_0059513 3300046460 Bacteria 2365
468 Ga0495638_0070174 3300046460 Bacteria 2145
469 Ga0495638_0070350 3300046460 Bacteria 2142
470 Ga0495638_0079001 3300046460 Bacteria 2001
471 Ga0495638_0099311 3300046460 Bacteria 1742
472 Ga0495638_0276808 3300046460 Bacteria 913
473 Ga0495653_0024339 3300046463 Bacteria 4880
474 Ga0495653_0028416 3300046463 Bacteria 4470
475 Ga0495650_0000839 3300046471 Bacteria 37093
476 Ga0495650_0001421 3300046471 Bacteria 23281
477 Ga0495650_0009502 3300046471 Bacteria 5522
478 Ga0495650_0009859 3300046471 Bacteria 5388
479 Ga0495650_0010432 3300046471 Bacteria 5182
480 Ga0495650_0019432 3300046471 Bacteria 3343
481 Ga0495650_0036351 3300046471 Bacteria 2156
482 Ga0495582_0071835 3300046473 Bacteria 1914
483 Ga0495605_0000030 3300046474 Bacteria 213339
484 Ga0495605_0001302 3300046474 Bacteria 16539
485 Ga0495605_0002385 3300046474 Bacteria 11647
486 Ga0495605_0004457 3300046474 Bacteria 8214
487 Ga0495605_0007896 3300046474 Bacteria 6026
488 Ga0495605_0012489 3300046474 Bacteria 4710
489 Ga0495605_0012862 3300046474 Bacteria 4631
490 Ga0495605_0022807 3300046474 Bacteria 3300
491 Ga0495605_0028727 3300046474 Bacteria 2869
492 Ga0495605_0047277 3300046474 Bacteria 2111
493 Ga0495605_0062839 3300046474 Bacteria 1773
494 Ga0495605_0079191 3300046474 Bacteria 1539
495 Ga0495605_0160961 3300046474 Bacteria 996
496 Ga0495639_0000008 3300046475 Bacteria 97096
497 Ga0495584_0002432 3300046491 Bacteria 10558
498 Ga0495584_0004593 3300046491 Bacteria 7400
499 Ga0495584_0007660 3300046491 Bacteria 5627
500 Ga0495584_0008813 3300046491 Bacteria 5216
501 Ga0495584_0014697 3300046491 Bacteria 3989
502 Ga0495584_0017744 3300046491 Bacteria 3620
503 Ga0495584_0022795 3300046491 Bacteria 3176
504 Ga0495584_0024372 3300046491 Bacteria 3068
505 Ga0495584_0024977 3300046491 Bacteria 3029
506 Ga0495584_0098973 3300046491 Bacteria 1473
507 Ga0495585_0000783 3300046492 Bacteria 28074
508 Ga0495585_0004051 3300046492 Bacteria 9644
509 Ga0495585_0006143 3300046492 Bacteria 7494
510 Ga0495585_0006806 3300046492 Bacteria 7054
511 Ga0495585_0008317 3300046492 Bacteria 6295
512 Ga0495585_0008440 3300046492 Bacteria 6242
513 Ga0495585_0009321 3300046492 Bacteria 5895
514 Ga0495585_0015879 3300046492 Bacteria 4369
515 Ga0495585_0020157 3300046492 Bacteria 3837
516 Ga0495585_0036313 3300046492 Bacteria 2780
517 Ga0495585_0051585 3300046492 Bacteria 2279
518 Ga0495594_0007848 3300046499 Bacteria 5489
519 Ga0495594_0009036 3300046499 Bacteria 5143
520 Ga0495594_0106845 3300046499 Bacteria 1576
521 Ga0495594_0140788 3300046499 Bacteria 1368
522 Ga0495596_0001734 3300046500 Bacteria 12238
523 Ga0495596_0017180 3300046500 Bacteria 3000
524 Ga0495596_0039639 3300046500 Bacteria 1860
525 Ga0495607_0000099 3300046501 Bacteria 91962
526 Ga0495607_0000807 3300046501 Bacteria 29654
527 Ga0495607_0001764 3300046501 Bacteria 18508
528 Ga0495607_0007268 3300046501 Bacteria 7684
529 Ga0495607_0008424 3300046501 Bacteria 7047
530 Ga0495607_0009301 3300046501 Bacteria 6660
531 Ga0495607_0011580 3300046501 Bacteria 5863
532 Ga0495607_0011949 3300046501 Bacteria 5751
533 Ga0495607_0014545 3300046501 Bacteria 5117
534 Ga0495607_0023760 3300046501 Bacteria 3831
535 Ga0495607_0032763 3300046501 Bacteria 3168
536 Ga0495607_0033329 3300046501 Bacteria 3134
537 Ga0495607_0037895 3300046501 Bacteria 2892
538 Ga0495607_0041169 3300046501 Bacteria 2745
539 Ga0495607_0043619 3300046501 Bacteria 2650
540 Ga0495607_0069627 3300046501 Bacteria 1968
541 Ga0495607_0070007 3300046501 Bacteria 1961
542 Ga0495607_0084547 3300046501 Bacteria 1735
543 Ga0495583_0001887 3300046506 Bacteria 19452
544 Ga0495583_0002729 3300046506 Bacteria 14618
545 Ga0495583_0003004 3300046506 Bacteria 13504
546 Ga0495583_0009036 3300046506 Bacteria 6004
547 Ga0495583_0010271 3300046506 Bacteria 5481
548 Ga0495583_0013352 3300046506 Bacteria 4585
549 Ga0495606_0000086 3300046507 Bacteria 156764
550 Ga0495606_0003630 3300046507 Bacteria 16207
551 Ga0495606_0008447 3300046507 Bacteria 8940
552 Ga0495606_0014164 3300046507 Bacteria 6242
553 Ga0495606_0014491 3300046507 Bacteria 6146
554 Ga0495606_0016017 3300046507 Bacteria 5741
555 Ga0495606_0050523 3300046507 Bacteria 2719
556 Ga0495606_0114140 3300046507 Bacteria 1625
557 Ga0495610_0002270 3300046512 Bacteria 16249
558 Ga0495610_0002902 3300046512 Bacteria 13871
559 Ga0495610_0004844 3300046512 Bacteria 9796
560 Ga0495610_0005642 3300046512 Bacteria 8824
561 Ga0495610_0006980 3300046512 Bacteria 7641
562 Ga0495610_0010119 3300046512 Bacteria 5889
563 Ga0495610_0011107 3300046512 Bacteria 5529
564 Ga0495610_0014646 3300046512 Bacteria 4599
565 Ga0495610_0029112 3300046512 Bacteria 2913
566 Ga0495610_0046166 3300046512 Bacteria 2151
567 Ga0495610_0067233 3300046512 Bacteria 1684
568 Ga0495610_0067778 3300046512 Bacteria 1675
569 Ga0495610_0135853 3300046512 Bacteria 1063
570 Ga0495616_0002518 3300046513 Bacteria 12114
571 Ga0495616_0005500 3300046513 Bacteria 7784
572 Ga0495616_0006781 3300046513 Bacteria 6904
573 Ga0495616_0007130 3300046513 Bacteria 6708
574 Ga0495616_0009560 3300046513 Bacteria 5660
575 Ga0495616_0010048 3300046513 Bacteria 5493
576 Ga0495616_0010589 3300046513 Bacteria 5329
577 Ga0495616_0019087 3300046513 Bacteria 3747
578 Ga0495616_0057853 3300046513 Bacteria 1910
579 Ga0495616_0058137 3300046513 Bacteria 1905
580 Ga0495616_0062614 3300046513 Bacteria 1821
581 Ga0495616_0076265 3300046513 Bacteria 1611
582 Ga0495620_0000052 3300046515 Bacteria 103693
583 Ga0495620_0000382 3300046515 Bacteria 30165
584 Ga0495620_0003817 3300046515 Bacteria 8594
585 Ga0495620_0004055 3300046515 Bacteria 8310
586 Ga0495620_0007452 3300046515 Bacteria 5937
587 Ga0495620_0007575 3300046515 Bacteria 5887
588 Ga0495620_0008319 3300046515 Bacteria 5576
589 Ga0495620_0010869 3300046515 Bacteria 4780
590 Ga0495620_0014286 3300046515 Bacteria 4039
591 Ga0495620_0019497 3300046515 Bacteria 3333
592 Ga0495620_0020128 3300046515 Bacteria 3265
593 Ga0495620_0029611 3300046515 Bacteria 2531
594 Ga0495630_0024875 3300046517 Bacteria 4427
595 Ga0495630_0043708 3300046517 Bacteria 3348
596 Ga0495631_0001130 3300046518 Bacteria 16536
597 Ga0495631_0001781 3300046518 Bacteria 12770
598 Ga0495631_0023435 3300046518 Bacteria 2860
599 Ga0495631_0023494 3300046518 Bacteria 2857
600 Ga0495631_0023610 3300046518 Bacteria 2849
601 Ga0495631_0040851 3300046518 Bacteria 2054
602 Ga0495632_0000146 3300046519 Bacteria 72790
603 Ga0495632_0000210 3300046519 Bacteria 59119
604 Ga0495632_0001890 3300046519 Bacteria 16791
605 Ga0495632_0003067 3300046519 Bacteria 12147
606 Ga0495632_0006290 3300046519 Bacteria 7672
607 Ga0495632_0009058 3300046519 Bacteria 6030
608 Ga0495632_0009306 3300046519 Bacteria 5931
609 Ga0495632_0010768 3300046519 Bacteria 5388
610 Ga0495632_0018205 3300046519 Bacteria 3859
611 Ga0495632_0023108 3300046519 Bacteria 3324
612 Ga0495632_0027597 3300046519 Bacteria 2972
613 Ga0495632_0027666 3300046519 Bacteria 2967
614 Ga0495632_0034901 3300046519 Bacteria 2570
615 Ga0495632_0038288 3300046519 Bacteria 2429
616 Ga0495632_0051091 3300046519 Bacteria 2036
617 Ga0495632_0060408 3300046519 Bacteria 1841
618 Ga0495632_0061296 3300046519 Bacteria 1826
619 Ga0495632_0077735 3300046519 Bacteria 1586
620 Ga0495632_0129273 3300046519 Bacteria 1176
621 Ga0495637_0001523 3300046520 Bacteria 13548
622 Ga0495637_0001644 3300046520 Bacteria 12927
623 Ga0495637_0002390 3300046520 Bacteria 10394
624 Ga0495637_0005545 3300046520 Bacteria 6407
625 Ga0495637_0006522 3300046520 Bacteria 5847
626 Ga0495637_0011187 3300046520 Bacteria 4316
627 Ga0495637_0011776 3300046520 Bacteria 4194
628 Ga0495637_0015635 3300046520 Bacteria 3559
629 Ga0495637_0017206 3300046520 Bacteria 3373
630 Ga0495637_0018126 3300046520 Bacteria 3269
631 Ga0495637_0021272 3300046520 Bacteria 2976
632 Ga0495637_0022346 3300046520 Bacteria 2885
633 Ga0495637_0026916 3300046520 Bacteria 2577
634 Ga0495637_0037075 3300046520 Bacteria 2119
635 Ga0495637_0040962 3300046520 Bacteria 1990
636 Ga0495637_0045951 3300046520 Bacteria 1849
637 Ga0495637_0056904 3300046520 Bacteria 1617
638 Ga0495643_0000197 3300046522 Bacteria 95489
639 Ga0495643_0009699 3300046522 Bacteria 5957
640 Ga0495643_0022741 3300046522 Bacteria 3570
641 Ga0495643_0023346 3300046522 Bacteria 3517
642 Ga0495643_0033872 3300046522 Bacteria 2821
643 Ga0495643_0042292 3300046522 Bacteria 2482
644 Ga0495643_0054114 3300046522 Bacteria 2150
645 Ga0495643_0085916 3300046522 Bacteria 1630
646 Ga0495643_0205352 3300046522 Bacteria 943
647 Ga0495644_0005711 3300046523 Bacteria 4856
648 Ga0495644_0014059 3300046523 Bacteria 3067
649 Ga0495644_0017143 3300046523 Bacteria 2770
650 Ga0495644_0051368 3300046523 Bacteria 1548
651 Ga0495644_0125930 3300046523 Bacteria 975
652 Ga0495648_0003674 3300046524 Bacteria 13414
653 Ga0495648_0003791 3300046524 Bacteria 13145
654 Ga0495648_0005357 3300046524 Bacteria 10680
655 Ga0495648_0005404 3300046524 Bacteria 10621
656 Ga0495648_0005877 3300046524 Bacteria 10089
657 Ga0495648_0011500 3300046524 Bacteria 6659
658 Ga0495648_0011843 3300046524 Bacteria 6543
659 Ga0495648_0012662 3300046524 Bacteria 6271
660 Ga0495648_0038354 3300046524 Bacteria 3065
661 Ga0495648_0039777 3300046524 Bacteria 2988
662 Ga0495648_0050989 3300046524 Bacteria 2524
663 Ga0495648_0065267 3300046524 Bacteria 2141
664 Ga0495648_0091888 3300046524 Bacteria 1696
665 Ga0495648_0095025 3300046524 Bacteria 1659
666 Ga0495648_0110488 3300046524 Bacteria 1497
667 Ga0495648_0145668 3300046524 Bacteria 1241
668 Ga0495648_0155568 3300046524 Bacteria 1187
669 Ga0495666_0004231 3300046526 Bacteria 7237
670 Ga0495666_0008869 3300046526 Bacteria 5037
671 Ga0495666_0038270 3300046526 Bacteria 2333
672 Ga0495666_0069562 3300046526 Bacteria 1674
673 Ga0495642_0000480 3300046528 Bacteria 20490
674 Ga0495642_0001728 3300046528 Bacteria 9404
675 Ga0495642_0002506 3300046528 Bacteria 7445
676 Ga0495654_0000814 3300046530 Bacteria 23806
677 Ga0495654_0001809 3300046530 Bacteria 14252
678 Ga0495654_0002594 3300046530 Bacteria 11538
679 Ga0495654_0005519 3300046530 Bacteria 7329
680 Ga0495654_0007045 3300046530 Bacteria 6328
681 Ga0495654_0011672 3300046530 Bacteria 4746
682 Ga0495654_0014326 3300046530 Bacteria 4221
683 Ga0495654_0016079 3300046530 Bacteria 3963
684 Ga0495654_0021171 3300046530 Bacteria 3385
685 Ga0495654_0024443 3300046530 Bacteria 3121
686 Ga0495654_0027821 3300046530 Bacteria 2893
687 Ga0495654_0029081 3300046530 Bacteria 2821
688 Ga0495654_0031270 3300046530 Bacteria 2703
689 Ga0495654_0031965 3300046530 Bacteria 2669
690 Ga0495654_0032448 3300046530 Bacteria 2647
691 Ga0495654_0041918 3300046530 Bacteria 2275
692 Ga0495654_0043481 3300046530 Bacteria 2226
693 Ga0495654_0056586 3300046530 Bacteria 1895
694 Ga0495654_0063768 3300046530 Bacteria 1763
695 Ga0495654_0100548 3300046530 Bacteria 1331
696 Ga0495654_0110081 3300046530 Bacteria 1257
697 Ga0495586_0077665 3300046535 Bacteria 1820
698 Ga0495587_0127788 3300046536 Bacteria 1453
699 Ga0495609_0000561 3300046538 Bacteria 29295
700 Ga0495609_0002378 3300046538 Bacteria 11591
701 Ga0495609_0002464 3300046538 Bacteria 11366
702 Ga0495609_0007472 3300046538 Bacteria 5449
703 Ga0495609_0007656 3300046538 Bacteria 5366
704 Ga0495609_0008373 3300046538 Bacteria 5066
705 Ga0495609_0069306 3300046538 Bacteria 1550
706 Ga0495609_0086935 3300046538 Bacteria 1362
707 Ga0495597_0000010 3300046542 Bacteria 222418
708 Ga0495597_0003683 3300046542 Bacteria 8792
709 Ga0495597_0007573 3300046542 Bacteria 5502
710 Ga0495597_0012232 3300046542 Bacteria 4146
711 Ga0495597_0029970 3300046542 Bacteria 2481
712 Ga0495597_0034033 3300046542 Bacteria 2303
713 Ga0495597_0034976 3300046542 Bacteria 2268
714 Ga0495597_0042714 3300046542 Bacteria 2020
715 Ga0495597_0059028 3300046542 Bacteria 1675
716 Ga0495597_0154374 3300046542 Bacteria 940
717 Ga0495645_0145575 3300046543 Bacteria 1650
718 Ga0495622_0000463 3300046557 Bacteria 25984
719 Ga0495622_0001045 3300046557 Bacteria 14732
720 Ga0495622_0003216 3300046557 Bacteria 7740
721 Ga0495622_0004383 3300046557 Bacteria 6570
722 Ga0495622_0005340 3300046557 Bacteria 5963
723 Ga0495622_0010277 3300046557 Bacteria 4327
724 Ga0495622_0022269 3300046557 Bacteria 2952
725 Ga0495622_0036027 3300046557 Bacteria 2308
726 Ga0495622_0054877 3300046557 Bacteria 1848
727 Ga0495633_0011965 3300046558 Bacteria 4638
728 Ga0495633_0017673 3300046558 Bacteria 3639
729 Ga0495633_0018461 3300046558 Bacteria 3542
730 Ga0495633_0035833 3300046558 Bacteria 2381
731 Ga0495656_0020745 3300046615 Bacteria 2551
732 Ga0495668_0005127 3300046616 Bacteria 9007
733 Ga0495668_0005428 3300046616 Bacteria 8653
734 Ga0495668_0010886 3300046616 Bacteria 5476
735 Ga0495668_0081095 3300046616 Bacteria 1780
736 Ga0495668_0143051 3300046616 Bacteria 1309
737 Ga0495668_0214960 3300046616 Bacteria 1053
738 Ga0495634_0006103 3300046642 Bacteria 9182
739 Ga0495634_0103821 3300046642 Bacteria 1834
740 Ga0495611_0000221 3300046648 Bacteria 39771
741 Ga0495611_0000659 3300046648 Bacteria 19696
742 Ga0495611_0004613 3300046648 Bacteria 5927
743 Ga0495611_0075184 3300046648 Bacteria 1548
744 Ga0495625_0000111 3300046660 Bacteria 124977
745 Ga0495625_0005532 3300046660 Bacteria 11483
746 Ga0495625_0010409 3300046660 Bacteria 7700
747 Ga0495625_0012215 3300046660 Bacteria 6965
748 Ga0495625_0019181 3300046660 Bacteria 5314
749 Ga0495625_0022890 3300046660 Bacteria 4781
750 Ga0495625_0040553 3300046660 Bacteria 3393
751 Ga0495625_0041822 3300046660 Bacteria 3334
752 Ga0495625_0051848 3300046660 Bacteria 2939
753 Ga0495625_0055895 3300046660 Bacteria 2812
754 Ga0495625_0073352 3300046660 Bacteria 2399
755 Ga0495625_0094406 3300046660 Bacteria 2064
756 Ga0495625_0111338 3300046660 Bacteria 1871
757 Ga0495625_0328303 3300046660 Bacteria 972
758 Ga0495635_0005286 3300046663 Bacteria 8981
759 Ga0495635_0151919 3300046663 Bacteria 1576
760 Ga0495659_0000571 3300046664 Bacteria 13548
761 Ga0495659_0002737 3300046664 Bacteria 5667
762 Ga0495659_0024378 3300046664 Bacteria 2063
763 Ga0495661_0000054 3300046665 Bacteria 138979
764 Ga0495661_0001411 3300046665 Bacteria 20118
765 Ga0495661_0022011 3300046665 Bacteria 4148
766 Ga0495661_0032856 3300046665 Bacteria 3276
767 Ga0495661_0035182 3300046665 Bacteria 3145
768 Ga0495661_0057086 3300046665 Bacteria 2332
769 Ga0495661_0061438 3300046665 Bacteria 2230
770 Ga0495661_0062490 3300046665 Bacteria 2205
771 Ga0495661_0066268 3300046665 Bacteria 2126
772 Ga0495661_0074959 3300046665 Bacteria 1967
773 Ga0495661_0098830 3300046665 Bacteria 1646
774 Ga0495588_0013404 3300046674 Bacteria 3906
775 Ga0495588_0057975 3300046674 Bacteria 2001
776 Ga0495657_0074912 3300046675 Bacteria 2201
777 Ga0495623_0016817 3300046679 Bacteria 4725
778 Ga0495623_0069355 3300046679 Bacteria 2197
779 Ga0495646_0076513 3300046680 Bacteria 1959
780 Ga0495646_0089707 3300046680 Bacteria 1778
781 Ga0495669_0029259 3300046684 Bacteria 2415
782 Ga0495613_0014546 3300046689 Bacteria 5836
783 Ga0495613_0162572 3300046689 Bacteria 1587
784 Ga0495624_0004059 3300046690 Bacteria 10772
785 Ga0495624_0063981 3300046690 Bacteria 2299
786 Ga0495670_0005463 3300046691 Bacteria 6239
787 Ga0495670_0006172 3300046691 Bacteria 5886
788 Ga0495670_0007558 3300046691 Bacteria 5342
789 Ga0495670_0007569 3300046691 Bacteria 5337
790 Ga0495670_0012894 3300046691 Bacteria 4108
791 Ga0495670_0027806 3300046691 Bacteria 2803
792 Ga0495670_0028431 3300046691 Bacteria 2772
793 Ga0495670_0037512 3300046691 Bacteria 2415
794 Ga0495670_0046399 3300046691 Bacteria 2170
795 Ga0495670_0101151 3300046691 Bacteria 1484
796 Ga0495671_0002668 3300046692 Bacteria 11188
797 Ga0495671_0006459 3300046692 Bacteria 6772
798 Ga0495671_0007287 3300046692 Bacteria 6314
799 Ga0495671_0008014 3300046692 Bacteria 5969
800 Ga0495671_0008408 3300046692 Bacteria 5811
801 Ga0495671_0009181 3300046692 Bacteria 5532
802 Ga0495671_0012626 3300046692 Bacteria 4607
803 Ga0495671_0016948 3300046692 Bacteria 3882
804 Ga0495671_0018748 3300046692 Bacteria 3668
805 Ga0495671_0021496 3300046692 Bacteria 3388
806 Ga0495671_0038106 3300046692 Bacteria 2430
807 Ga0495671_0058308 3300046692 Bacteria 1910
808 Ga0495671_0068094 3300046692 Bacteria 1750
809 Ga0495671_0103139 3300046692 Bacteria 1393
810 Ga0495649_0002674 3300046694 Bacteria 12418
811 Ga0495649_0002946 3300046694 Bacteria 11747
812 Ga0495649_0003085 3300046694 Bacteria 11402
813 Ga0495649_0003313 3300046694 Bacteria 10938
814 Ga0495649_0010245 3300046694 Bacteria 5537
815 Ga0495649_0010363 3300046694 Bacteria 5504
816 Ga0495649_0011981 3300046694 Bacteria 5064
817 Ga0495649_0013195 3300046694 Bacteria 4772
818 Ga0495649_0014096 3300046694 Bacteria 4591
819 Ga0495649_0020893 3300046694 Bacteria 3669
820 Ga0495649_0022182 3300046694 Bacteria 3552
821 Ga0495649_0025177 3300046694 Bacteria 3314
822 Ga0495649_0040191 3300046694 Bacteria 2562
823 Ga0495649_0054734 3300046694 Bacteria 2156
824 Ga0495649_0055409 3300046694 Bacteria 2142
825 Ga0495649_0086268 3300046694 Bacteria 1675
826 Ga0495649_0100617 3300046694 Bacteria 1536
827 Ga0495589_0001836 3300046794 Bacteria 12056
828 Ga0495589_0002068 3300046794 Bacteria 11363
829 Ga0495589_0002285 3300046794 Bacteria 10764
830 Ga0495589_0004070 3300046794 Bacteria 7835
831 Ga0495589_0004908 3300046794 Bacteria 7094
832 Ga0495589_0008306 3300046794 Bacteria 5424
833 Ga0495589_0021225 3300046794 Bacteria 3319
834 Ga0495589_0056137 3300046794 Bacteria 1938
835 Ga0495589_0062342 3300046794 Bacteria 1829
836 Ga0495589_0089084 3300046794 Bacteria 1498
837 Ga0495600_0007789 3300046809 Bacteria 6559
838 Ga0495600_0045095 3300046809 Bacteria 2876
839 Ga0495660_0002694 3300046810 Bacteria 11221
840 Ga0495660_0003256 3300046810 Bacteria 10088
841 Ga0495660_0004655 3300046810 Bacteria 8274
842 Ga0495660_0004984 3300046810 Bacteria 7993
843 Ga0495660_0009693 3300046810 Bacteria 5610
844 Ga0495660_0014997 3300046810 Bacteria 4479
845 Ga0495660_0016718 3300046810 Bacteria 4227
846 Ga0495660_0024204 3300046810 Bacteria 3459
847 Ga0495660_0037992 3300046810 Bacteria 2679
848 Ga0495660_0041997 3300046810 Bacteria 2528
849 Ga0495660_0046888 3300046810 Bacteria 2368
850 Ga0495660_0052642 3300046810 Bacteria 2211
851 Ga0495660_0073123 3300046810 Bacteria 1814
852 Ga0495660_0102273 3300046810 Bacteria 1473
853 Ga0495660_0118503 3300046810 Bacteria 1342
854 Ga0495581_0010306 3300047315 Bacteria 5406
855 Ga0495581_0063110 3300047315 Bacteria 2140
856 Ga0495604_0022759 3300047317 Bacteria 5002
857 Ga0495604_0043404 3300047317 Bacteria 3520
858 Ga0495604_0091716 3300047317 Bacteria 2252
859 Ga0495636_0002063 3300047318 Bacteria 7710
860 Ga0495674_0031692 3300047319 Bacteria 4800
861 Ga0495672_0001060 3300047320 Bacteria 28068
862 Ga0495672_0001146 3300047320 Bacteria 26793
863 Ga0495672_0004788 3300047320 Bacteria 10914
864 Ga0495672_0005424 3300047320 Bacteria 10121
865 Ga0495672_0006117 3300047320 Bacteria 9391
866 Ga0495672_0011166 3300047320 Bacteria 6350
867 Ga0495672_0014674 3300047320 Bacteria 5351
868 Ga0495672_0032361 3300047320 Bacteria 3254
869 Ga0495672_0056830 3300047320 Bacteria 2274
870 Ga0495672_0061392 3300047320 Bacteria 2166
871 Ga0495672_0067145 3300047320 Bacteria 2043
872 Ga0495672_0075573 3300047320 Bacteria 1894
873 Ga0495672_0093138 3300047320 Bacteria 1650
874 Ga0495672_0115516 3300047320 Bacteria 1434
875 Ga0495672_0160490 3300047320 Bacteria 1156
876 Ga0495676_0000010 3300047321 Bacteria 242637
877 Ga0495676_0014681 3300047321 Bacteria 7002
878 Ga0495676_0021598 3300047321 Bacteria 5616
879 Ga0495680_0011083 3300047322 Bacteria 8002
880 Ga0495680_0015555 3300047322 Bacteria 6562
881 Ga0495680_0037942 3300047322 Bacteria 3855
882 Ga0495680_0096827 3300047322 Bacteria 2203
883 Ga0495680_0107704 3300047322 Bacteria 2069
884 Ga0495683_0000143 3300047323 Bacteria 70181
885 Ga0495683_0003409 3300047323 Bacteria 9276
886 Ga0495683_0006649 3300047323 Bacteria 6303
887 Ga0495683_0012676 3300047323 Bacteria 4426
888 Ga0495683_0013624 3300047323 Bacteria 4249
889 Ga0495683_0013809 3300047323 Bacteria 4215
890 Ga0495683_0014896 3300047323 Bacteria 4049
891 Ga0495683_0020566 3300047323 Bacteria 3403
892 Ga0495683_0028915 3300047323 Bacteria 2832
893 Ga0495683_0045308 3300047323 Bacteria 2210
894 Ga0495687_006004 3300047443 Bacteria 7568
895 Ga0495687_007767 3300047443 Bacteria 6245
896 Ga0495687_008529 3300047443 Bacteria 5858
897 Ga0495687_009035 3300047443 Bacteria 5618
898 Ga0495675_0016652 3300047444 Bacteria 4647
899 Ga0495677_0007791 3300047445 Bacteria 3990
900 Ga0495679_001850 3300047446 Bacteria 11439
901 Ga0495679_002853 3300047446 Bacteria 8570
902 Ga0495679_003254 3300047446 Bacteria 7875
903 Ga0495679_004526 3300047446 Bacteria 6378
904 Ga0495679_005773 3300047446 Bacteria 5448
905 Ga0495679_008982 3300047446 Bacteria 4029
906 Ga0495685_073188 3300047447 Bacteria 1146
907 Ga0495673_0003351 3300047469 Bacteria 10601
908 Ga0495673_0008236 3300047469 Bacteria 5884
909 Ga0495673_0009836 3300047469 Bacteria 5254
910 Ga0495673_0010205 3300047469 Bacteria 5126
911 Ga0495673_0017981 3300047469 Bacteria 3575
912 Ga0495673_0019394 3300047469 Bacteria 3407
913 Ga0495673_0024676 3300047469 Bacteria 2899
914 Ga0495673_0024944 3300047469 Bacteria 2878
915 Ga0495673_0030103 3300047469 Bacteria 2554
916 Ga0495673_0031389 3300047469 Bacteria 2487
917 Ga0495673_0035720 3300047469 Bacteria 2286
918 Ga0495673_0037075 3300047469 Bacteria 2230
919 Ga0495673_0039551 3300047469 Bacteria 2138
920 Ga0495681_0000861 3300047470 Bacteria 23349
921 Ga0495681_0002919 3300047470 Bacteria 12082
922 Ga0495681_0005938 3300047470 Bacteria 8099
923 Ga0495681_0006253 3300047470 Bacteria 7847
924 Ga0495681_0006630 3300047470 Bacteria 7565
925 Ga0495681_0006703 3300047470 Bacteria 7514
926 Ga0495681_0008196 3300047470 Bacteria 6575
927 Ga0495681_0008907 3300047470 Bacteria 6233
928 Ga0495681_0009296 3300047470 Bacteria 6069
929 Ga0495681_0010116 3300047470 Bacteria 5737
930 Ga0495681_0010120 3300047470 Bacteria 5735
931 Ga0495681_0011064 3300047470 Bacteria 5408
932 Ga0495681_0021164 3300047470 Bacteria 3509
933 Ga0495681_0033189 3300047470 Bacteria 2589
934 Ga0495681_0034240 3300047470 Bacteria 2532
935 Ga0495681_0060548 3300047470 Bacteria 1746
936 Ga0495684_0032355 3300047471 Bacteria 4015
937 Ga0495684_0163297 3300047471 Bacteria 1660
938 Ga0495686_0010370 3300047472 Bacteria 6632
939 Ga0495686_0013557 3300047472 Bacteria 5652
940 Ga0495686_0020534 3300047472 Bacteria 4402
941 Ga0495686_0024725 3300047472 Bacteria 3943
942 Ga0495686_0100076 3300047472 Bacteria 1749
943 Ga0495686_0113876 3300047472 Bacteria 1619
944 Ga0495593_0004910 3300047673 Bacteria 7929
945 Ga0495593_0008641 3300047673 Bacteria 5921
946 Ga0495593_0051560 3300047673 Bacteria 2177
947 Ga0495593_0057478 3300047673 Bacteria 2042
948 Ga0495593_0066330 3300047673 Bacteria 1881
949 Ga0495593_0109278 3300047673 Bacteria 1412
950 Ga0495602_0008936 3300048088 Bacteria 10444
951 Ga0495602_0051776 3300048088 Bacteria 3654
952 Ga0495614_0021569 3300048089 Bacteria 2781
953 Ga0495626_0001733 3300048091 Bacteria 16641
954 Ga0495626_0002863 3300048091 Bacteria 11514
955 Ga0495626_0003488 3300048091 Bacteria 10072
956 Ga0495626_0004703 3300048091 Bacteria 8272
957 Ga0495626_0005693 3300048091 Bacteria 7208
958 Ga0495626_0007892 3300048091 Bacteria 5891
959 Ga0495626_0008253 3300048091 Bacteria 5728
960 Ga0495626_0009395 3300048091 Bacteria 5286
961 Ga0495626_0011390 3300048091 Bacteria 4706
962 Ga0495626_0012166 3300048091 Bacteria 4524
963 Ga0495626_0013746 3300048091 Bacteria 4199
964 Ga0496102_0008477 3300048905 Bacteria 8813
965 Ga0496102_0143630 3300048905 Bacteria 2239
966 Ga0496103_0005662 3300048906 Bacteria 7466
967 Ga0496107_0257371 3300048910 Bacteria 1299
968 Ga0496111_0190360 3300048914 Bacteria 1525
969 Ga0496111_0233776 3300048914 Bacteria 1365
970 Ga0496112_0665381 3300048915 Bacteria 970
971 Ga0496114_0166342 3300048917 Bacteria 1920
972 Ga0496116_0000289 3300048919 Bacteria 85507
973 Ga0496116_0001228 3300048919 Bacteria 29873
974 Ga0496116_0001880 3300048919 Bacteria 22677
975 Ga0496116_0007468 3300048919 Bacteria 9685
976 Ga0496116_0009269 3300048919 Bacteria 8416
977 Ga0496117_0001350 3300048920 Bacteria 35953
978 Ga0496117_0001993 3300048920 Bacteria 27104
979 Ga0496117_0003790 3300048920 Bacteria 17258
980 Ga0496117_0006082 3300048920 Bacteria 12378
981 Ga0496117_0007222 3300048920 Bacteria 10935
982 Ga0496117_0008688 3300048920 Bacteria 9602
983 Ga0496117_0013478 3300048920 Bacteria 7129
984 Ga0496117_0015634 3300048920 Bacteria 6451
985 Ga0496117_0021984 3300048920 Bacteria 5133
986 Ga0496117_0031815 3300048920 Bacteria 4022
987 Ga0496117_0043937 3300048920 Bacteria 3241
988 Ga0496117_0058947 3300048920 Bacteria 2655
989 Ga0496117_0084626 3300048920 Bacteria 2068
990 Ga0496118_0009447 3300048921 Bacteria 9844
991 Ga0496118_0009855 3300048921 Bacteria 9558
992 Ga0496118_0011751 3300048921 Bacteria 8510
993 Ga0496118_0012170 3300048921 Bacteria 8298
994 Ga0496118_0017797 3300048921 Bacteria 6448
995 Ga0496118_0017925 3300048921 Bacteria 6420
996 Ga0496118_0025562 3300048921 Bacteria 5057
997 Ga0496118_0026639 3300048921 Bacteria 4917
998 Ga0496118_0047707 3300048921 Bacteria 3316
999 Ga0496118_0047961 3300048921 Bacteria 3305
1000 Ga0496118_0077685 3300048921 Bacteria 2353
1001 Ga0496119_0001797 3300048922 Bacteria 24956
1002 Ga0496119_0008437 3300048922 Bacteria 9049
1003 Ga0496119_0027387 3300048922 Bacteria 3917
1004 Ga0496120_0001631 3300048923 Bacteria 26001
1005 Ga0496120_0004045 3300048923 Bacteria 12698
1006 Ga0496120_0126077 3300048923 Bacteria 1317
1007 Ga0496121_0000422 3300048924 Bacteria 83552
1008 Ga0496121_0011771 3300048924 Bacteria 9649
1009 Ga0496121_0030643 3300048924 Bacteria 4935
1010 Ga0496121_0040908 3300048924 Bacteria 4059
1011 Ga0496121_0042060 3300048924 Bacteria 3982
1012 Ga0496121_0162171 3300048924 Bacteria 1633
1013 Ga0496122_0010905 3300048925 Bacteria 9294
1014 Ga0496122_0016155 3300048925 Bacteria 7090
1015 Ga0496122_0016534 3300048925 Bacteria 6970
1016 Ga0496122_0022550 3300048925 Bacteria 5590
1017 Ga0496122_0035962 3300048925 Bacteria 4017
1018 Ga0496122_0043688 3300048925 Bacteria 3507
1019 Ga0496122_0075770 3300048925 Bacteria 2371
1020 Ga0496122_0132248 3300048925 Bacteria 1582
1021 Ga0496123_0005210 3300048926 Bacteria 13208
1022 Ga0496123_0008064 3300048926 Bacteria 9746
1023 Ga0496123_0011437 3300048926 Bacteria 7690
1024 Ga0496123_0013573 3300048926 Bacteria 6821
1025 Ga0496123_0019245 3300048926 Bacteria 5387
1026 Ga0496123_0033565 3300048926 Bacteria 3691
1027 Ga0496124_0002186 3300048927 Bacteria 26111
1028 Ga0496124_0003140 3300048927 Bacteria 20466
1029 Ga0496124_0006413 3300048927 Bacteria 12824
1030 Ga0496124_0028268 3300048927 Bacteria 5019
1031 Ga0496124_0048378 3300048927 Bacteria 3634
1032 Ga0496124_0048927 3300048927 Bacteria 3608
1033 Ga0496124_0067858 3300048927 Bacteria 2966
1034 Ga0496124_0070655 3300048927 Bacteria 2895
1035 Ga0496124_0138831 3300048927 Bacteria 1920
1036 Ga0496124_0149002 3300048927 Bacteria 1838
1037 Ga0496124_0245119 3300048927 Bacteria 1329
1038 Ga0496124_0245703 3300048927 Bacteria 1327
1039 Ga0496124_0307122 3300048927 Bacteria 1143
1040 Ga0496125_0000240 3300048928 Bacteria 112092
1041 Ga0496125_0003097 3300048928 Bacteria 20743
1042 Ga0496125_0003709 3300048928 Bacteria 18223
1043 Ga0496125_0008653 3300048928 Bacteria 10616
1044 Ga0496125_0020874 3300048928 Bacteria 6131
1045 Ga0496125_0022844 3300048928 Bacteria 5795
1046 Ga0496125_0023930 3300048928 Bacteria 5627
1047 Ga0496125_0032190 3300048928 Bacteria 4661
1048 Ga0496125_0061764 3300048928 Bacteria 3002
1049 Ga0496125_0072155 3300048928 Bacteria 2692
1050 Ga0496125_0118192 3300048928 Bacteria 1899
1051 Ga0496125_0162347 3300048928 Bacteria 1515
1052 Ga0496126_0016578 3300048929 Bacteria 7364
1053 Ga0496126_0021244 3300048929 Bacteria 6344
1054 Ga0496126_0021788 3300048929 Bacteria 6251
1055 Ga0496126_0049250 3300048929 Bacteria 3847
1056 Ga0496126_0051814 3300048929 Bacteria 3734
1057 Ga0496126_0288566 3300048929 Bacteria 1357
1058 Ga0495678_002869 3300049459 Bacteria 11132
1059 Ga0495678_003063 3300049459 Bacteria 10613
1060 Ga0495678_004559 3300049459 Bacteria 7969
1061 Ga0495678_006906 3300049459 Bacteria 5958
1062 Ga0495678_006980 3300049459 Bacteria 5925
1063 Ga0495678_007741 3300049459 Bacteria 5534
1064 Ga0495678_008437 3300049459 Bacteria 5196
1065 Ga0495678_009161 3300049459 Bacteria 4927
1066 Ga0495678_015269 3300049459 Bacteria 3541
1067 Ga0495678_017260 3300049459 Bacteria 3276
1068 Ga0495678_029010 3300049459 Bacteria 2328
1069 Ga0495678_032689 3300049459 Bacteria 2153
1070 Ga0495678_034590 3300049459 Bacteria 2077
1071 Ga0495678_036206 3300049459 Bacteria 2015
1072 Ga0495678_053513 3300049459 Bacteria 1549
1073 Ga0495678_056762 3300049459 Bacteria 1486
1074 Ga0495682_0004418 3300049460 Bacteria 6017
1075 Ga0495682_0006158 3300049460 Bacteria 4883
1076 Ga0495682_0007521 3300049460 Bacteria 4327
1077 Ga0495682_0015654 3300049460 Bacteria 2873
1078 Ga0495682_0095619 3300049460 Bacteria 1066
1079 Ga0495682_0136311 3300049460 Bacteria 877
1080 Ga0501034_0101175 3300049571 Bacteria 2876
1081 Ga0501252_001014 3300049682 Bacteria 2455
1082 Ga0501241_000760 3300049758 Bacteria 6931
1083 Ga0501226_000005 3300049853 Bacteria 271019
1084 nmdc:mga00v17_367255_c1 3300050491 Bacteria 936
1085 nmdc:mga0sz30_15786_c1 3300050516 Bacteria 2989
1086 Ga0500572_001338 3300053111 Bacteria 6846
1087 Ga0500577_0059412 3300053142 Bacteria 1465
1088 Ga0500634_0026599 3300053161 Bacteria 3151

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042136 Ga0450900_004842 Ga0450900_004842_40_864 254
2 3300042137 Ga0450902_004731 Ga0450902_004731_1144_1968 254
3 3300042142 Ga0450905_003868 Ga0450905_003868_82_906 254
4 3300042533 Ga0450901_001402 Ga0450901_001402_1850_2674 254
5 3300046524 Ga0495648_0155568 Ga0495648_0155568_33_797 254
6 3300046530 Ga0495654_0031965 Ga0495654_0031965_1013_1987 255
7 3300046694 Ga0495649_0086268 Ga0495649_0086268_367_1341 255
8 2162886007 SwRhRL2b_contig_1611694 SwRhRL2b_0263.00002240 262
9 3300005288 Ga0065714_10065500 Ga0065714_100655007 262
10 3300005289 Ga0065704_10073101 Ga0065704_100731014 262
11 3300013100 Ga0157373_10001638 Ga0157373_100016383 262
12 3300031548 Ga0307408_100006277 Ga0307408_1000062776 262
13 3300031911 Ga0307412_10006636 Ga0307412_100066364 262
14 3300041405 Ga0439438_000769 Ga0439438_000769_3764_4588 262
15 3300041407 Ga0439447_017713 Ga0439447_017713_602_1444 262
16 3300041407 Ga0439447_051631 Ga0439447_051631_107_931 262
17 3300041997 Ga0439431_0000648 Ga0439431_0000648_2896_3720 262
18 3300042006 Ga0439432_003547 Ga0439432_003547_3644_4468 262
19 3300042016 Ga0439463_004293 Ga0439463_004293_2146_2970 262
20 3300042147 Ga0450910_000425 Ga0450910_000425_3825_4649 262
21 3300042156 Ga0439446_0001791 Ga0439446_0001791_429_1253 262
22 3300046691 Ga0495670_0046399 Ga0495670_0046399_250_1041 262
23 3300031731 Ga0307405_10254096 Ga0307405_102540962 263
24 3300041405 Ga0439438_009240 Ga0439438_009240_1439_2281 263
25 3300041405 Ga0439438_011024 Ga0439438_011024_1116_1958 263
26 3300042010 Ga0439452_018546 Ga0439452_018546_340_1182 263
27 3300042185 Ga0450909_005794 Ga0450909_005794_110_952 263
28 3300048927 Ga0496124_0067858 Ga0496124_0067858_1725_2549 263
29 iso_pu_bacteria 2599185306 2599969385 265
30 iso_pu_bacteria 2599185308 2599980719 265
31 iso_pu_bacteria 2599185314 2600014596 265
32 3300006946 Ga0079104_1004015 Ga0079104_10040151 266
33 3300006948 Ga0099826_10028013 Ga0099826_100280134 266
34 3300009011 Ga0105251_10000702 Ga0105251_1000070224 266
35 3300013100 Ga0157373_10160561 Ga0157373_101605612 266
36 3300013104 Ga0157370_10054321 Ga0157370_100543213 266
37 3300013105 Ga0157369_10008629 Ga0157369_1000862911 266
38 3300027111 Ga0209281_1000015 Ga0209281_1000015319 266
39 3300048927 Ga0496124_0245119 Ga0496124_0245119_130_930 266
40 iso_pu_bacteria 2597489888 2597862235 266
41 iso_pu_bacteria 2597489889 2597867960 266
42 iso_pu_bacteria 2599185167 2599397162 266
43 iso_pu_bacteria 2599185179 2599449157 266
44 iso_pu_bacteria 2599185190 2599511100 266
45 iso_pu_bacteria 2599185191 2599519408 266
46 iso_pu_bacteria 2599185288 2599879562 266
47 iso_pu_bacteria 2599185290 2599890474 266
48 iso_pu_bacteria 2619619299 2621301623 266
49 iso_pu_bacteria 2675903420 2677897504 266
50 iso_pu_bacteria 2738541265 2738672740 266
51 iso_pu_bacteria 2738541282 2738751133 266
52 iso_pu_bacteria 2738541294 2738809020 266
53 iso_pu_bacteria 2738541303 2738860174 266
54 iso_pu_bacteria 2738541309 2738896380 266
55 iso_pu_bacteria 2816332298 2817489015 266
56 iso_pu_bacteria 2834028612 2834028918 266
57 iso_pu_bacteria 2860867994 2860868953 266
58 iso_pu_bacteria 2908446538 2908447703 266
59 iso_pu_bacteria 2929189879 2929190947 266
60 iso_pu_bacteria 2931390751 2931391937 266
61 iso_pu_bacteria 2945928738 2945929635 266
62 iso_pu_bacteria 2945961074 2945965883 266
63 iso_pu_bacteria 2946006987 2946011918 266
64 iso_pu_bacteria 2946027586 2946029193 266
65 iso_pu_bacteria 2947233263 2947235739 266
66 iso_pu_bacteria 8054285046 8054290144 266
67 iso_pu_bacteria 8054347763 8054352643 266
68 iso_pu_bacteria 8055817908 8055818964 266
69 iso_pu_bacteria 8056148874 8056149049 266
70 3300009148 Ga0105243_10000136 Ga0105243_1000013672 267
71 3300009553 Ga0105249_10172387 Ga0105249_101723872 267
72 3300013102 Ga0157371_10009763 Ga0157371_100097636 267
73 3300014497 Ga0182008_10016456 Ga0182008_100164562 267
74 3300025935 Ga0207709_10000238 Ga0207709_1000023811 267
75 3300025961 Ga0207712_10105824 Ga0207712_101058242 267
76 3300041407 Ga0439447_007894 Ga0439447_007894_2309_3133 267
77 3300041411 Ga0439466_0000484 Ga0439466_0000484_5179_6003 267
78 3300041413 Ga0439465_0010394 Ga0439465_0010394_1026_1850 267
79 3300042006 Ga0439432_019446 Ga0439432_019446_1236_2060 267
80 3300042009 Ga0439451_002248 Ga0439451_002248_2030_2854 267
81 3300042013 Ga0439456_001381 Ga0439456_001381_594_1418 267
82 3300042115 Ga0450911_004519 Ga0450911_004519_1327_2151 267
83 3300042124 Ga0450922_000588 Ga0450922_000588_2305_3129 267
84 3300042138 Ga0450903_002596 Ga0450903_002596_1677_2501 267
85 3300042146 Ga0450907_027447 Ga0450907_027447_123_947 267
86 3300042435 Ga0439434_0021589 Ga0439434_0021589_631_1455 267
87 3300042461 Ga0439460_0003989 Ga0439460_0003989_788_1612 267
88 3300042531 Ga0450918_005612 Ga0450918_005612_840_1664 267
89 3300042993 Ga0439440_0000809 Ga0439440_0000809_3707_4531 267
90 3300046457 Ga0495590_0003853 Ga0495590_0003853_1132_1956 267
91 3300046471 Ga0495650_0009502 Ga0495650_0009502_3797_4621 267
92 3300046501 Ga0495607_0000807 Ga0495607_0000807_12473_13297 267
93 3300046501 Ga0495607_0008424 Ga0495607_0008424_2276_3100 267
94 3300046501 Ga0495607_0011949 Ga0495607_0011949_1372_2196 267
95 3300046513 Ga0495616_0009560 Ga0495616_0009560_3862_4686 267
96 3300046522 Ga0495643_0033872 Ga0495643_0033872_875_1699 267
97 3300046523 Ga0495644_0051368 Ga0495644_0051368_478_1302 267
98 3300046530 Ga0495654_0100548 Ga0495654_0100548_100_924 267
99 3300046542 Ga0495597_0007573 Ga0495597_0007573_1051_1875 267
100 3300046557 Ga0495622_0054877 Ga0495622_0054877_420_1244 267
101 3300046648 Ga0495611_0004613 Ga0495611_0004613_4156_4980 267
102 3300046664 Ga0495659_0024378 Ga0495659_0024378_1108_1932 267
103 3300046665 Ga0495661_0074959 Ga0495661_0074959_82_906 267
104 3300046691 Ga0495670_0005463 Ga0495670_0005463_4307_5131 267
105 3300046694 Ga0495649_0100617 Ga0495649_0100617_154_978 267
106 3300046794 Ga0495589_0002068 Ga0495589_0002068_5583_6407 267
107 3300047318 Ga0495636_0002063 Ga0495636_0002063_5998_6822 267
108 3300047320 Ga0495672_0001146 Ga0495672_0001146_11535_12359 267
109 3300047443 Ga0495687_008529 Ga0495687_008529_1037_1861 267
110 3300048919 Ga0496116_0000289 Ga0496116_0000289_77513_78337 267
111 3300048920 Ga0496117_0007222 Ga0496117_0007222_6996_7820 267
112 3300048924 Ga0496121_0000422 Ga0496121_0000422_7218_8042 267
113 3300048925 Ga0496122_0016534 Ga0496122_0016534_2791_3615 267
114 3300048926 Ga0496123_0013573 Ga0496123_0013573_2786_3610 267
115 3300049460 Ga0495682_0095619 Ga0495682_0095619_15_839 267
116 iso_pu_bacteria 2599185155 2599328158 268
117 iso_pu_bacteria 2826581358 2826583748 268
118 iso_pu_bacteria 2842815866 2842821008 268
119 iso_pu_bacteria 2842849001 2842853473 268
120 3300003791 Ga0055530_10001090 Ga0055530_1000109015 269
121 3300003792 Ga0055540_1000363 Ga0055540_10003633 269
122 3300025292 Ga0209676_1004836 Ga0209676_10048366 269
123 3300025298 Ga0209050_1000027 Ga0209050_1000027258 269
124 3300025303 Ga0209051_1000065 Ga0209051_1000065170 269
125 3300025304 Ga0209257_1015949 Ga0209257_10159493 269
126 3300046542 Ga0495597_0059028 Ga0495597_0059028_182_1006 269
127 3300047472 Ga0495686_0020534 Ga0495686_0020534_1484_2326 269
128 iso_pu_bacteria 2919688452 2919691600 269
129 3300002738 JGI25154J39366_1005404 JGI25154J39366_10054041 270
130 3300003751 Ga0055538_1000029 Ga0055538_1000029162 270
131 3300003752 Ga0055539_1000039 Ga0055539_1000039162 270
132 3300003756 Ga0055533_1000049 Ga0055533_10000495 270
133 3300003758 Ga0055532_1000306 Ga0055532_100030618 270
134 3300003759 Ga0055525_1000322 Ga0055525_10003225 270
135 3300003841 Ga0055541_1000026 Ga0055541_10000265 270
136 3300003856 Ga0058692_1012123 Ga0058692_10121233 270
137 3300005288 Ga0065714_10003596 Ga0065714_100035966 270
138 3300005288 Ga0065714_10086414 Ga0065714_100864143 270
139 3300005289 Ga0065704_10017170 Ga0065704_100171701 270
140 3300005353 Ga0070669_100000159 Ga0070669_10000015958 270
141 3300005457 Ga0070662_100001145 Ga0070662_10000114512 270
142 3300005539 Ga0068853_100005095 Ga0068853_1000050953 270
143 3300005578 Ga0068854_100127274 Ga0068854_1001272742 270
144 3300005834 Ga0068851_10000006 Ga0068851_10000006192 270
145 3300009011 Ga0105251_10056821 Ga0105251_100568213 270
146 3300009036 Ga0105244_10093424 Ga0105244_100934242 270
147 3300009092 Ga0105250_10000216 Ga0105250_1000021625 270
148 3300009092 Ga0105250_10003640 Ga0105250_100036403 270
149 3300011119 Ga0105246_10000395 Ga0105246_100003952 270
150 3300013100 Ga0157373_10001469 Ga0157373_100014695 270
151 3300013100 Ga0157373_10005366 Ga0157373_100053664 270
152 3300013102 Ga0157371_10003971 Ga0157371_100039713 270
153 3300013102 Ga0157371_10024731 Ga0157371_100247313 270
154 3300013105 Ga0157369_10029869 Ga0157369_100298695 270
155 3300013306 Ga0163162_10306856 Ga0163162_103068562 270
156 3300013308 Ga0157375_10435867 Ga0157375_104358672 270
157 3300014497 Ga0182008_10004070 Ga0182008_100040705 270
158 3300014497 Ga0182008_10015173 Ga0182008_100151733 270
159 3300015262 Ga0182007_10002324 Ga0182007_100023248 270
160 3300017792 Ga0163161_10013312 Ga0163161_100133123 270
161 3300017792 Ga0163161_10017459 Ga0163161_100174593 270
162 3300017792 Ga0163161_10179255 Ga0163161_101792552 270
163 3300017792 Ga0163161_10240627 Ga0163161_102406272 270
164 3300025206 Ga0209435_101081 Ga0209435_1010813 270
165 3300025224 Ga0209784_100045 Ga0209784_1000455 270
166 3300025225 Ga0209566_100057 Ga0209566_1000575 270
167 3300025226 Ga0209674_100080 Ga0209674_1000805 270
168 3300025229 Ga0209147_100079 Ga0209147_1000795 270
169 3300025230 Ga0209563_100078 Ga0209563_1000785 270
170 3300025242 Ga0209258_100434 Ga0209258_1004345 270
171 3300025246 Ga0209646_1000286 Ga0209646_100028634 270
172 3300025253 Ga0209677_100045 Ga0209677_1000455 270
173 3300025256 Ga0209759_1033447 Ga0209759_10334472 270
174 3300025321 Ga0207656_10000023 Ga0207656_1000002332 270
175 3300025711 Ga0207696_1000210 Ga0207696_100021038 270
176 3300025728 Ga0207655_1003755 Ga0207655_10037556 270
177 3300025728 Ga0207655_1073480 Ga0207655_10734802 270
178 3300025735 Ga0207713_1000244 Ga0207713_100024432 270
179 3300025735 Ga0207713_1000728 Ga0207713_10007285 270
180 3300025923 Ga0207681_10005418 Ga0207681_100054188 270
181 3300025933 Ga0207706_10000677 Ga0207706_1000067716 270
182 3300025981 Ga0207640_10115479 Ga0207640_101154792 270
183 3300026041 Ga0207639_10003715 Ga0207639_100037153 270
184 3300027312 Ga0209371_1000264 Ga0209371_100026425 270
185 3300030500 Ga0268256_1000150 Ga0268256_100015056 270
186 3300031507 Ga0307509_10092718 Ga0307509_100927182 270
187 3300031731 Ga0307405_10013806 Ga0307405_100138062 270
188 3300042016 Ga0439463_005751 Ga0439463_005751_1338_2150 270
189 3300046453 Ga0495627_013327 Ga0495627_013327_1588_2400 270
190 3300046458 Ga0495591_000019 Ga0495591_000019_117039_117851 270
191 3300046458 Ga0495591_004280 Ga0495591_004280_1598_2410 270
192 3300046474 Ga0495605_0004457 Ga0495605_0004457_3184_3996 270
193 3300046474 Ga0495605_0022807 Ga0495605_0022807_1020_1832 270
194 3300046501 Ga0495607_0000099 Ga0495607_0000099_6241_7053 270
195 3300046501 Ga0495607_0001764 Ga0495607_0001764_15779_16591 270
196 3300046506 Ga0495583_0002729 Ga0495583_0002729_886_1698 270
197 3300046512 Ga0495610_0002902 Ga0495610_0002902_1526_2338 270
198 3300046512 Ga0495610_0006980 Ga0495610_0006980_3911_4723 270
199 3300046512 Ga0495610_0135853 Ga0495610_0135853_171_983 270
200 3300046515 Ga0495620_0004055 Ga0495620_0004055_4376_5188 270
201 3300046519 Ga0495632_0009306 Ga0495632_0009306_3525_4337 270
202 3300046519 Ga0495632_0051091 Ga0495632_0051091_569_1381 270
203 3300046520 Ga0495637_0045951 Ga0495637_0045951_375_1187 270
204 3300046520 Ga0495637_0056904 Ga0495637_0056904_506_1318 270
205 3300046522 Ga0495643_0054114 Ga0495643_0054114_421_1233 270
206 3300046530 Ga0495654_0005519 Ga0495654_0005519_6277_7089 270
207 3300046530 Ga0495654_0011672 Ga0495654_0011672_3157_3969 270
208 3300046530 Ga0495654_0016079 Ga0495654_0016079_402_1214 270
209 3300046530 Ga0495654_0024443 Ga0495654_0024443_1887_2699 270
210 3300046530 Ga0495654_0056586 Ga0495654_0056586_835_1647 270
211 3300046542 Ga0495597_0000010 Ga0495597_0000010_116706_117518 270
212 3300046648 Ga0495611_0075184 Ga0495611_0075184_569_1381 270
213 3300046660 Ga0495625_0094406 Ga0495625_0094406_1043_1855 270
214 3300046665 Ga0495661_0001411 Ga0495661_0001411_5436_6248 270
215 3300046665 Ga0495661_0032856 Ga0495661_0032856_1045_1857 270
216 3300046694 Ga0495649_0010245 Ga0495649_0010245_1470_2282 270
217 3300046794 Ga0495589_0004070 Ga0495589_0004070_2613_3425 270
218 3300046810 Ga0495660_0003256 Ga0495660_0003256_4243_5055 270
219 3300046810 Ga0495660_0004984 Ga0495660_0004984_874_1686 270
220 3300046810 Ga0495660_0046888 Ga0495660_0046888_592_1404 270
221 3300046810 Ga0495660_0073123 Ga0495660_0073123_638_1450 270
222 3300047446 Ga0495679_002853 Ga0495679_002853_4695_5507 270
223 3300047446 Ga0495679_003254 Ga0495679_003254_4406_5218 270
224 3300047470 Ga0495681_0006253 Ga0495681_0006253_3335_4147 270
225 3300047470 Ga0495681_0021164 Ga0495681_0021164_1601_2413 270
226 3300047472 Ga0495686_0100076 Ga0495686_0100076_499_1311 270
227 3300048920 Ga0496117_0001350 Ga0496117_0001350_8363_9175 270
228 3300048920 Ga0496117_0003790 Ga0496117_0003790_6541_7353 270
229 3300048920 Ga0496117_0006082 Ga0496117_0006082_7155_7967 270
230 3300048920 Ga0496117_0021984 Ga0496117_0021984_2915_3742 270
231 3300048921 Ga0496118_0017797 Ga0496118_0017797_4124_4936 270
232 3300048921 Ga0496118_0017925 Ga0496118_0017925_1323_2150 270
233 3300048921 Ga0496118_0025562 Ga0496118_0025562_2733_3545 270
234 3300048921 Ga0496118_0047961 Ga0496118_0047961_1690_2502 270
235 3300048922 Ga0496119_0001797 Ga0496119_0001797_5690_6502 270
236 3300048922 Ga0496119_0008437 Ga0496119_0008437_4989_5801 270
237 3300048923 Ga0496120_0001631 Ga0496120_0001631_18583_19395 270
238 3300048923 Ga0496120_0004045 Ga0496120_0004045_9535_10347 270
239 3300048924 Ga0496121_0040908 Ga0496121_0040908_785_1597 270
240 3300048925 Ga0496122_0016155 Ga0496122_0016155_5246_6058 270
241 3300048925 Ga0496122_0035962 Ga0496122_0035962_2660_3472 270
242 3300048925 Ga0496122_0043688 Ga0496122_0043688_2663_3475 270
243 3300048925 Ga0496122_0132248 Ga0496122_0132248_744_1556 270
244 3300048926 Ga0496123_0005210 Ga0496123_0005210_4242_5054 270
245 3300048926 Ga0496123_0011437 Ga0496123_0011437_1065_1877 270
246 3300048926 Ga0496123_0019245 Ga0496123_0019245_62_874 270
247 3300048926 Ga0496123_0033565 Ga0496123_0033565_2840_3652 270
248 3300048927 Ga0496124_0003140 Ga0496124_0003140_8304_9116 270
249 3300048927 Ga0496124_0048927 Ga0496124_0048927_621_1433 270
250 3300048927 Ga0496124_0138831 Ga0496124_0138831_216_1028 270
251 3300048928 Ga0496125_0003097 Ga0496125_0003097_11578_12390 270
252 3300048928 Ga0496125_0003709 Ga0496125_0003709_1107_1919 270
253 3300048928 Ga0496125_0008653 Ga0496125_0008653_9277_10089 270
254 3300048928 Ga0496125_0020874 Ga0496125_0020874_1425_2237 270
255 3300048928 Ga0496125_0023930 Ga0496125_0023930_3391_4203 270
256 3300048928 Ga0496125_0061764 Ga0496125_0061764_1457_2269 270
257 3300048928 Ga0496125_0162347 Ga0496125_0162347_227_1039 270
258 3300048929 Ga0496126_0016578 Ga0496126_0016578_4469_5281 270
259 3300048929 Ga0496126_0021788 Ga0496126_0021788_5321_6133 270
260 3300048929 Ga0496126_0051814 Ga0496126_0051814_62_874 270
261 3300048929 Ga0496126_0288566 Ga0496126_0288566_62_874 270
262 3300053161 Ga0500634_0026599 Ga0500634_0026599_1039_1851 270
263 iso_pu_bacteria 2511231004 2511253466 270
264 iso_pu_bacteria 2511231006 2511267781 270
265 iso_pu_bacteria 2511231007 2511270834 270
266 iso_pu_bacteria 2511231008 2511280067 270
267 iso_pu_bacteria 2511231010 2511291467 270
268 iso_pu_bacteria 2511231011 2511298720 270
269 iso_pu_bacteria 2511231012 2511300568 270
270 iso_pu_bacteria 2511231014 2511315542 270
271 iso_pu_bacteria 2511231015 2511320374 270
272 iso_pu_bacteria 2511231016 2511326914 270
273 iso_pu_bacteria 2511231017 2511332422 270
274 iso_pu_bacteria 2511231018 2511336467 270
275 iso_pu_bacteria 2511231019 2511347229 270
276 iso_pu_bacteria 2511231020 2511350496 270
277 iso_pu_bacteria 2511231021 2511353550 270
278 iso_pu_bacteria 2511231022 2511362316 270
279 iso_pu_bacteria 2511231023 2511370945 270
280 iso_pu_bacteria 2511231031 2511413594 270
281 iso_pu_bacteria 2511231156 2511826758 270
282 iso_pu_bacteria 2512047018 2512329315 270
283 iso_pu_bacteria 2554235341 2555667971 270
284 iso_pu_bacteria 2582580891 2583790417 270
285 iso_pu_bacteria 2597489887 2597856195 270
286 iso_pu_bacteria 2599185160 2599354970 270
287 iso_pu_bacteria 2599185161 2599361197 270
288 iso_pu_bacteria 2599185162 2599367519 270
289 iso_pu_bacteria 2599185163 2599374309 270
290 iso_pu_bacteria 2599185164 2599380076 270
291 iso_pu_bacteria 2599185165 2599386523 270
292 iso_pu_bacteria 2599185166 2599393167 270
293 iso_pu_bacteria 2599185168 2599404934 270
294 iso_pu_bacteria 2599185181 2599461804 270
295 iso_pu_bacteria 2599185182 2599467144 270
296 iso_pu_bacteria 2599185185 2599483549 270
297 iso_pu_bacteria 2599185186 2599491103 270
298 iso_pu_bacteria 2599185188 2599502889 270
299 iso_pu_bacteria 2599185212 2599615083 270
300 iso_pu_bacteria 2599185248 2599771280 270
301 iso_pu_bacteria 2599185257 2599805457 270
302 iso_pu_bacteria 2599185289 2599885948 270
303 iso_pu_bacteria 2599185291 2599897662 270
304 iso_pu_bacteria 2599185300 2599930084 270
305 iso_pu_bacteria 2599185302 2599945391 270
306 iso_pu_bacteria 2599185304 2599955663 270
307 iso_pu_bacteria 2599185305 2599961030 270
308 iso_pu_bacteria 2599185309 2599985775 270
309 iso_pu_bacteria 2599185310 2599990669 270
310 iso_pu_bacteria 2599185311 2599995987 270
311 iso_pu_bacteria 2599185312 2600001945 270
312 iso_pu_bacteria 2599185313 2600005672 270
313 iso_pu_bacteria 2599185315 2600019082 270
314 iso_pu_bacteria 2599185316 2600025559 270
315 iso_pu_bacteria 2599185317 2600027825 270
316 iso_pu_bacteria 2599185318 2600033457 270
317 iso_pu_bacteria 2599185319 2600040257 270
318 iso_pu_bacteria 2599185320 2600049374 270
319 iso_pu_bacteria 2599185321 2600055737 270
320 iso_pu_bacteria 2599185322 2600061640 270
321 iso_pu_bacteria 2599185323 2600064259 270
322 iso_pu_bacteria 2599185324 2600073499 270
323 iso_pu_bacteria 2599185325 2600077292 270
324 iso_pu_bacteria 2599185356 2600214426 270
325 iso_pu_bacteria 2600254930 2600356992 270
326 iso_pu_bacteria 2600254931 2600366218 270
327 iso_pu_bacteria 2600255313 2601774869 270
328 iso_pu_bacteria 2600255318 2601800657 270
329 iso_pu_bacteria 2603880185 2606074721 270
330 iso_pu_bacteria 2603880199 2606127584 270
331 iso_pu_bacteria 2623620443 2624478761 270
332 iso_pu_bacteria 2623620446 2624494189 270
333 iso_pu_bacteria 2643221565 2643841973 270
334 iso_pu_bacteria 2643221589 2643955376 270
335 iso_pu_bacteria 2643221602 2644023728 270
336 iso_pu_bacteria 2643221633 2644187935 270
337 iso_pu_bacteria 2643221650 2644282414 270
338 iso_pu_bacteria 2651869719 2652545594 270
339 iso_pu_bacteria 2667528170 2671089757 270
340 iso_pu_bacteria 2667528171 2671097580 270
341 iso_pu_bacteria 2667528176 2671125611 270
342 iso_pu_bacteria 2671180172 2671767807 270
343 iso_pu_bacteria 2675903515 2678265128 270
344 iso_pu_bacteria 2713897148 2715750874 270
345 iso_pu_bacteria 2713897149 2715757478 270
346 iso_pu_bacteria 2718217725 2718632646 270
347 iso_pu_bacteria 2738541271 2738689452 270
348 iso_pu_bacteria 2738543004 2739196527 270
349 iso_pu_bacteria 2738543015 2739257505 270
350 iso_pu_bacteria 2738543016 2739265226 270
351 iso_pu_bacteria 2738543025 2739314831 270
352 iso_pu_bacteria 2740892503 2743735602 270
353 iso_pu_bacteria 2744054620 2745005584 270
354 iso_pu_bacteria 2765235841 2765585900 270
355 iso_pu_bacteria 2773857670 2774120734 270
356 iso_pu_bacteria 2773857673 2774136763 270
357 iso_pu_bacteria 2784132063 2784260513 270
358 iso_pu_bacteria 2784132072 2784313428 270
359 iso_pu_bacteria 2791355520 2794595570 270
360 iso_pu_bacteria 2808606361 2808855856 270
361 iso_pu_bacteria 2808606376 2808921936 270
362 iso_pu_bacteria 2808606377 2808928818 270
363 iso_pu_bacteria 2808606378 2808935937 270
364 iso_pu_bacteria 2808606380 2808944057 270
365 iso_pu_bacteria 2808606381 2808950939 270
366 iso_pu_bacteria 2808606382 2808956823 270
367 iso_pu_bacteria 2808606383 2808964271 270
368 iso_pu_bacteria 2808606389 2808999159 270
369 iso_pu_bacteria 2808606445 2809215702 270
370 iso_pu_bacteria 2818991456 2819658317 270
371 iso_pu_bacteria 2818991464 2819702663 270
372 iso_pu_bacteria 2825651385 2825655977 270
373 iso_pu_bacteria 2842854478 2842856381 270
374 iso_pu_bacteria 2844665904 2844668476 270
375 iso_pu_bacteria 2852657418 2852662880 270
376 iso_pu_bacteria 2860339153 2860340695 270
377 iso_pu_bacteria 2878029506 2878030724 270
378 iso_pu_bacteria 2880230671 2880231639 270
379 iso_pu_bacteria 2904518522 2904520673 270
380 iso_pu_bacteria 2904550169 2904553022 270
381 iso_pu_bacteria 2912963787 2912968189 270
382 iso_pu_bacteria 2913036834 2913041736 270
383 iso_pu_bacteria 2917070673 2917071730 270
384 iso_pu_bacteria 2919063839 2919067324 270
385 iso_pu_bacteria 2919456309 2919458413 270
386 iso_pu_bacteria 2919481497 2919484675 270
387 iso_pu_bacteria 2919487758 2919492847 270
388 iso_pu_bacteria 2919697872 2919699894 270
389 iso_pu_bacteria 2923153595 2923154607 270
390 iso_pu_bacteria 2923586266 2923590382 270
391 iso_pu_bacteria 2929144301 2929149055 270
392 iso_pu_bacteria 2931369376 2931373523 270
393 iso_pu_bacteria 2931396565 2931399403 270
394 iso_pu_bacteria 2935353572 2935353903 270
395 iso_pu_bacteria 2939636861 2939636998 270
396 iso_pu_bacteria 2969304461 2969305548 270
397 iso_pu_bacteria 2974289157 2974292821 270
398 iso_pu_bacteria 2984286254 2984291426 270
399 iso_pu_bacteria 2988728565 2988730656 270
400 iso_pu_bacteria 2998139840 2998140987 270
401 iso_pu_bacteria 3007395558 3007400143 270
402 iso_pu_bacteria 3007511990 3007512298 270
403 iso_pu_bacteria 3007614139 3007618718 270
404 iso_pu_bacteria 3007619802 3007624475 270
405 iso_pu_bacteria 3007718800 3007719737 270
406 iso_pu_bacteria 3007855910 3007860875 270
407 iso_pu_bacteria 3007861166 3007863791 270
408 iso_pu_bacteria 3007866637 3007867602 270
409 iso_pu_bacteria 637000220 637318348 270
410 iso_pu_bacteria 8015687852 8015688848 270
411 iso_pu_bacteria 8019769354 8019772393 270
412 iso_pu_bacteria 8019775933 8019776560 270
413 iso_pu_bacteria 8029995093 8029999771 270
414 iso_pu_bacteria 8055770955 8055771960 270
415 iso_pu_bacteria 8055878733 8055883734 270
416 iso_pu_bacteria 8056120720 8056121698 270
417 iso_pu_bacteria 8056125926 8056130850 270
418 iso_pu_bacteria 8056155041 8056161120 270
419 iso_pu_bacteria 8056172158 8056176191 270
420 iso_pu_bacteria 8056177738 8056179741 270
421 iso_pu_bacteria 8056569372 8056569642 270
422 iso_pu_bacteria 8057798959 8057803259 270
423 2162886011 MRS1b_contig_7272918 MRS1b_0824.00000750 272
424 3300005356 Ga0070674_100265962 Ga0070674_1002659621 272
425 3300009036 Ga0105244_10000562 Ga0105244_1000056221 272
426 3300009148 Ga0105243_10022862 Ga0105243_100228625 272
427 3300011119 Ga0105246_10078954 Ga0105246_100789543 272
428 3300025728 Ga0207655_1002873 Ga0207655_100287310 272
429 3300048927 Ga0496124_0149002 Ga0496124_0149002_345_1163 272
430 iso_pu_bacteria 2554235132 2554813405 272
431 iso_pu_bacteria 2606217733 2608381419 272
432 iso_pu_bacteria 2808606379 2808941002 272
433 iso_pu_bacteria 2811994881 2812370773 272
434 iso_pu_bacteria 2823421272 2823425040 272
435 iso_pu_bacteria 2919501602 2919501757 272
436 iso_pu_bacteria 2923519811 2923524877 272
437 iso_pu_bacteria 2926063275 2926063430 272
438 iso_pu_bacteria 3007252601 3007256022 272
439 iso_pu_bacteria 3007315729 3007319907 272
440 iso_pu_bacteria 8011350971 8011351212 272
441 iso_pu_bacteria 8034962539 8034963013 272
442 3300014497 Ga0182008_10020315 Ga0182008_100203154 273
443 3300017792 Ga0163161_10052908 Ga0163161_100529083 273
444 2124908027 MRS2a_Contig_6269 MRS2a_00170070 274
445 2124908027 MRS2a_Contig_755 MRS2a_00613160 274
446 2124908027 MRS2a_Contig_9248 MRS2a_00150430 274
447 2162886007 SwRhRL2b_contig_3290672 SwRhRL2b_0208.00006910 274
448 3300002737 JGI25162J39368_1000101 JGI25162J39368_100010142 274
449 3300002737 JGI25162J39368_1000200 JGI25162J39368_10002009 274
450 3300002771 JGI25163J39215_1000597 JGI25163J39215_10005977 274
451 3300002771 JGI25163J39215_1001770 JGI25163J39215_10017701 274
452 3300002772 JGI25164J39214_1000097 JGI25164J39214_100009750 274
453 3300002772 JGI25164J39214_1000162 JGI25164J39214_100016250 274
454 3300003214 JGI25165J46597_1000184 JGI25165J46597_100018442 274
455 3300003214 JGI25165J46597_1000294 JGI25165J46597_10002949 274
456 3300003781 Ga0055536_1000062 Ga0055536_100006266 274
457 3300003781 Ga0055536_1002879 Ga0055536_10028798 274
458 3300003791 Ga0055530_10000352 Ga0055530_1000035229 274
459 3300003791 Ga0055530_10002783 Ga0055530_100027839 274
460 3300003792 Ga0055540_1001509 Ga0055540_10015093 274
461 3300003792 Ga0055540_1002134 Ga0055540_10021343 274
462 3300003794 Ga0055531_10001955 Ga0055531_1000195510 274
463 3300005288 Ga0065714_10000141 Ga0065714_100001413 274
464 3300005288 Ga0065714_10002730 Ga0065714_100027304 274
465 3300005288 Ga0065714_10004160 Ga0065714_100041604 274
466 3300005288 Ga0065714_10004656 Ga0065714_100046565 274
467 3300005288 Ga0065714_10008732 Ga0065714_100087321 274
468 3300005288 Ga0065714_10009951 Ga0065714_100099515 274
469 3300005288 Ga0065714_10101695 Ga0065714_101016952 274
470 3300005288 Ga0065714_10117601 Ga0065714_101176011 274
471 3300005289 Ga0065704_10093656 Ga0065704_100936563 274
472 3300005289 Ga0065704_10310272 Ga0065704_103102721 274
473 3300005290 Ga0065712_10106236 Ga0065712_101062362 274
474 3300005353 Ga0070669_100001980 Ga0070669_10000198011 274
475 3300005548 Ga0070665_100006134 Ga0070665_1000061343 274
476 3300006051 Ga0075364_10042675 Ga0075364_100426753 274
477 3300006051 Ga0075364_10148441 Ga0075364_101484411 274
478 3300006058 Ga0075432_10002392 Ga0075432_100023923 274
479 3300006058 Ga0075432_10003269 Ga0075432_100032695 274
480 3300006058 Ga0075432_10034165 Ga0075432_100341652 274
481 3300006058 Ga0075432_10074437 Ga0075432_100744371 274
482 3300006058 Ga0075432_10077884 Ga0075432_100778842 274
483 3300006177 Ga0075362_10011428 Ga0075362_100114283 274
484 3300006946 Ga0079104_1000385 Ga0079104_100038529 274
485 3300006946 Ga0079104_1006068 Ga0079104_10060684 274
486 3300006946 Ga0079104_1012761 Ga0079104_10127613 274
487 3300009011 Ga0105251_10001941 Ga0105251_1000194111 274
488 3300009011 Ga0105251_10005639 Ga0105251_100056393 274
489 3300009011 Ga0105251_10008332 Ga0105251_100083326 274
490 3300009011 Ga0105251_10010264 Ga0105251_100102643 274
491 3300009011 Ga0105251_10050246 Ga0105251_100502463 274
492 3300009036 Ga0105244_10002462 Ga0105244_100024629 274
493 3300009036 Ga0105244_10007486 Ga0105244_100074864 274
494 3300009036 Ga0105244_10009045 Ga0105244_100090453 274
495 3300009036 Ga0105244_10014335 Ga0105244_100143354 274
496 3300009036 Ga0105244_10017030 Ga0105244_100170303 274
497 3300009036 Ga0105244_10028764 Ga0105244_100287642 274
498 3300009036 Ga0105244_10030721 Ga0105244_100307214 274
499 3300009036 Ga0105244_10058751 Ga0105244_100587513 274
500 3300009036 Ga0105244_10135523 Ga0105244_101355231 274
501 3300009092 Ga0105250_10005501 Ga0105250_100055012 274
502 3300009092 Ga0105250_10005647 Ga0105250_100056474 274
503 3300009092 Ga0105250_10052380 Ga0105250_100523802 274
504 3300009092 Ga0105250_10067185 Ga0105250_100671851 274
505 3300009148 Ga0105243_10000183 Ga0105243_1000018328 274
506 3300009148 Ga0105243_10005387 Ga0105243_100053879 274
507 3300009148 Ga0105243_10028662 Ga0105243_100286621 274
508 3300011119 Ga0105246_10008966 Ga0105246_100089663 274
509 3300011119 Ga0105246_10265157 Ga0105246_102651571 274
510 3300012498 Ga0157345_1000149 Ga0157345_10001493 274
511 3300013100 Ga0157373_10003340 Ga0157373_100033403 274
512 3300013100 Ga0157373_10013948 Ga0157373_100139483 274
513 3300013102 Ga0157371_10002112 Ga0157371_100021123 274
514 3300013104 Ga0157370_10025742 Ga0157370_100257424 274
515 3300013104 Ga0157370_10209540 Ga0157370_102095402 274
516 3300013105 Ga0157369_10004824 Ga0157369_100048244 274
517 3300013306 Ga0163162_10000380 Ga0163162_100003806 274
518 3300013306 Ga0163162_10016404 Ga0163162_100164044 274
519 3300013306 Ga0163162_10063740 Ga0163162_100637402 274
520 3300013306 Ga0163162_10228605 Ga0163162_102286052 274
521 3300013307 Ga0157372_10005253 Ga0157372_1000525310 274
522 3300013308 Ga0157375_10115310 Ga0157375_101153103 274
523 3300014497 Ga0182008_10004398 Ga0182008_100043984 274
524 3300014497 Ga0182008_10021159 Ga0182008_100211592 274
525 3300014497 Ga0182008_10042602 Ga0182008_100426023 274
526 3300014497 Ga0182008_10051751 Ga0182008_100517513 274
527 3300014497 Ga0182008_10054123 Ga0182008_100541233 274
528 3300014497 Ga0182008_10089507 Ga0182008_100895072 274
529 3300015261 Ga0182006_1000810 Ga0182006_10008104 274
530 3300015261 Ga0182006_1008822 Ga0182006_10088224 274
531 3300015262 Ga0182007_10000591 Ga0182007_1000059119 274
532 3300015262 Ga0182007_10023502 Ga0182007_100235022 274
533 3300015265 Ga0182005_1000474 Ga0182005_100047418 274
534 3300015265 Ga0182005_1002768 Ga0182005_10027683 274
535 3300015265 Ga0182005_1005483 Ga0182005_10054833 274
536 3300015265 Ga0182005_1012658 Ga0182005_10126583 274
537 3300015265 Ga0182005_1028616 Ga0182005_10286162 274
538 3300015265 Ga0182005_1039989 Ga0182005_10399892 274
539 3300015265 Ga0182005_1043999 Ga0182005_10439992 274
540 3300017792 Ga0163161_10007587 Ga0163161_100075873 274
541 3300017792 Ga0163161_10028387 Ga0163161_100283872 274
542 3300017792 Ga0163161_10054612 Ga0163161_100546124 274
543 3300017792 Ga0163161_10328910 Ga0163161_103289102 274
544 3300025207 Ga0209760_100003 Ga0209760_100003152 274
545 3300025207 Ga0209760_100512 Ga0209760_1005121 274
546 3300025230 Ga0209563_100286 Ga0209563_10028611 274
547 3300025231 Ga0207427_100001 Ga0207427_100001171 274
548 3300025231 Ga0207427_100004 Ga0207427_100004457 274
549 3300025233 Ga0209437_100003 Ga0209437_1000031201 274
550 3300025233 Ga0209437_100028 Ga0209437_100028293 274
551 3300025261 Ga0209233_1000007 Ga0209233_1000007171 274
552 3300025261 Ga0209233_1000008 Ga0209233_10000081004 274
553 3300025292 Ga0209676_1000056 Ga0209676_1000056165 274
554 3300025292 Ga0209676_1000078 Ga0209676_1000078192 274
555 3300025292 Ga0209676_1000101 Ga0209676_1000101102 274
556 3300025292 Ga0209676_1005729 Ga0209676_10057295 274
557 3300025298 Ga0209050_1000041 Ga0209050_1000041104 274
558 3300025298 Ga0209050_1000181 Ga0209050_100018166 274
559 3300025298 Ga0209050_1000425 Ga0209050_100042514 274
560 3300025303 Ga0209051_1000061 Ga0209051_1000061165 274
561 3300025303 Ga0209051_1000085 Ga0209051_1000085104 274
562 3300025303 Ga0209051_1004273 Ga0209051_10042735 274
563 3300025304 Ga0209257_1000105 Ga0209257_100010555 274
564 3300025711 Ga0207696_1000022 Ga0207696_1000022293 274
565 3300025711 Ga0207696_1000032 Ga0207696_100003296 274
566 3300025711 Ga0207696_1001211 Ga0207696_10012114 274
567 3300025711 Ga0207696_1002431 Ga0207696_10024314 274
568 3300025711 Ga0207696_1004964 Ga0207696_10049643 274
569 3300025711 Ga0207696_1036447 Ga0207696_10364471 274
570 3300025728 Ga0207655_1000021 Ga0207655_1000021204 274
571 3300025728 Ga0207655_1000204 Ga0207655_100020441 274
572 3300025728 Ga0207655_1001335 Ga0207655_10013356 274
573 3300025728 Ga0207655_1002799 Ga0207655_10027994 274
574 3300025728 Ga0207655_1006205 Ga0207655_10062055 274
575 3300025728 Ga0207655_1006232 Ga0207655_10062323 274
576 3300025728 Ga0207655_1006500 Ga0207655_10065007 274
577 3300025728 Ga0207655_1007143 Ga0207655_10071435 274
578 3300025728 Ga0207655_1008237 Ga0207655_10082375 274
579 3300025728 Ga0207655_1046202 Ga0207655_10462022 274
580 3300025728 Ga0207655_1054934 Ga0207655_10549341 274
581 3300025735 Ga0207713_1001876 Ga0207713_10018768 274
582 3300025735 Ga0207713_1003202 Ga0207713_10032026 274
583 3300025735 Ga0207713_1006957 Ga0207713_10069575 274
584 3300025735 Ga0207713_1006967 Ga0207713_10069672 274
585 3300025735 Ga0207713_1007394 Ga0207713_10073942 274
586 3300025735 Ga0207713_1010374 Ga0207713_10103745 274
587 3300025735 Ga0207713_1011122 Ga0207713_10111226 274
588 3300025735 Ga0207713_1011699 Ga0207713_10116992 274
589 3300025735 Ga0207713_1016002 Ga0207713_10160022 274
590 3300025735 Ga0207713_1039376 Ga0207713_10393762 274
591 3300025735 Ga0207713_1057138 Ga0207713_10571382 274
592 3300025735 Ga0207713_1071245 Ga0207713_10712451 274
593 3300025735 Ga0207713_1073938 Ga0207713_10739381 274
594 3300025735 Ga0207713_1087009 Ga0207713_10870091 274
595 3300025923 Ga0207681_10001218 Ga0207681_100012184 274
596 3300025934 Ga0207686_10050340 Ga0207686_100503403 274
597 3300025935 Ga0207709_10000067 Ga0207709_1000006772 274
598 3300025935 Ga0207709_10003244 Ga0207709_100032449 274
599 3300025935 Ga0207709_10014904 Ga0207709_100149044 274
600 3300027111 Ga0209281_1000049 Ga0209281_1000049293 274
601 3300027111 Ga0209281_1011080 Ga0209281_10110801 274
602 3300027312 Ga0209371_1000197 Ga0209371_100019738 274
603 3300027907 Ga0207428_10024528 Ga0207428_100245282 274
604 3300027907 Ga0207428_10030610 Ga0207428_100306102 274
605 3300027907 Ga0207428_10044218 Ga0207428_100442185 274
606 3300027907 Ga0207428_10087005 Ga0207428_100870053 274
607 3300027907 Ga0207428_10090542 Ga0207428_100905421 274
608 3300027907 Ga0207428_10098979 Ga0207428_100989792 274
609 3300027907 Ga0207428_10154305 Ga0207428_101543053 274
610 3300027907 Ga0207428_10163395 Ga0207428_101633951 274
611 3300028379 Ga0268266_10007552 Ga0268266_100075523 274
612 3300030500 Ga0268256_1000147 Ga0268256_100014744 274
613 3300030521 Ga0307511_10007903 Ga0307511_100079038 274
614 3300030733 Ga0314311_1172029 Ga0314311_11720293 274
615 3300031548 Ga0307408_100000950 Ga0307408_1000009506 274
616 3300031548 Ga0307408_100001821 Ga0307408_1000018217 274
617 3300031548 Ga0307408_100007240 Ga0307408_1000072403 274
618 3300031548 Ga0307408_100010104 Ga0307408_1000101042 274
619 3300031548 Ga0307408_100133607 Ga0307408_1001336072 274
620 3300031730 Ga0307516_10177153 Ga0307516_101771533 274
621 3300031731 Ga0307405_10000274 Ga0307405_100002747 274
622 3300031731 Ga0307405_10001031 Ga0307405_100010315 274
623 3300031824 Ga0307413_10067330 Ga0307413_100673302 274
624 3300031901 Ga0307406_10044776 Ga0307406_100447762 274
625 3300031901 Ga0307406_10050106 Ga0307406_100501062 274
626 3300031903 Ga0307407_10269696 Ga0307407_102696962 274
627 3300031911 Ga0307412_10001285 Ga0307412_100012854 274
628 3300031911 Ga0307412_10001493 Ga0307412_100014935 274
629 3300031911 Ga0307412_10005598 Ga0307412_100055983 274
630 3300031911 Ga0307412_10008492 Ga0307412_100084923 274
631 3300031911 Ga0307412_10130988 Ga0307412_101309882 274
632 3300031911 Ga0307412_10442873 Ga0307412_104428732 274
633 3300031995 Ga0307409_100424470 Ga0307409_1004244701 274
634 3300032002 Ga0307416_100066467 Ga0307416_1000664672 274
635 3300032002 Ga0307416_100076703 Ga0307416_1000767032 274
636 3300032002 Ga0307416_100184565 Ga0307416_1001845652 274
637 3300032002 Ga0307416_100216558 Ga0307416_1002165582 274
638 3300032004 Ga0307414_10012725 Ga0307414_100127252 274
639 3300032004 Ga0307414_10038006 Ga0307414_100380063 274
640 3300032004 Ga0307414_10069295 Ga0307414_100692952 274
641 3300032004 Ga0307414_10101261 Ga0307414_101012613 274
642 3300032004 Ga0307414_10143408 Ga0307414_101434083 274
643 3300032005 Ga0307411_10014484 Ga0307411_100144841 274
644 3300032005 Ga0307411_10026196 Ga0307411_100261961 274
645 3300032005 Ga0307411_10029776 Ga0307411_100297761 274
646 3300032005 Ga0307411_10357782 Ga0307411_103577821 274
647 3300032005 Ga0307411_10421660 Ga0307411_104216601 274
648 3300033180 Ga0307510_10005444 Ga0307510_1000544411 274
649 3300038705 Ga0237819_01061 Ga0237819_01061_7202_8026 274
650 3300039450 Ga0436363_0044187 Ga0436363_0044187_108_938 274
651 3300041404 Ga0439436_0001078 Ga0439436_0001078_2004_2834 274
652 3300041405 Ga0439438_000097 Ga0439438_000097_26500_27324 274
653 3300041405 Ga0439438_001964 Ga0439438_001964_3589_4419 274
654 3300041405 Ga0439438_002147 Ga0439438_002147_6194_7018 274
655 3300041405 Ga0439438_003765 Ga0439438_003765_3826_4650 274
656 3300041405 Ga0439438_008263 Ga0439438_008263_933_1757 274
657 3300041405 Ga0439438_008553 Ga0439438_008553_1119_1943 274
658 3300041405 Ga0439438_020614 Ga0439438_020614_267_1091 274
659 3300041405 Ga0439438_062307 Ga0439438_062307_64_888 274
660 3300041406 Ga0439439_0052238 Ga0439439_0052238_119_949 274
661 3300041407 Ga0439447_001036 Ga0439447_001036_3934_4758 274
662 3300041407 Ga0439447_004269 Ga0439447_004269_2958_3788 274
663 3300041407 Ga0439447_008570 Ga0439447_008570_1260_2084 274
664 3300041407 Ga0439447_011462 Ga0439447_011462_1038_1862 274
665 3300041407 Ga0439447_017897 Ga0439447_017897_177_1001 274
666 3300041407 Ga0439447_029651 Ga0439447_029651_368_1192 274
667 3300041407 Ga0439447_036349 Ga0439447_036349_160_984 274
668 3300041411 Ga0439466_0001105 Ga0439466_0001105_4300_5130 274
669 3300041411 Ga0439466_0001764 Ga0439466_0001764_922_1746 274
670 3300041411 Ga0439466_0011492 Ga0439466_0011492_1534_2358 274
671 3300041411 Ga0439466_0012787 Ga0439466_0012787_587_1411 274
672 3300041411 Ga0439466_0015937 Ga0439466_0015937_949_1773 274
673 3300041411 Ga0439466_0028815 Ga0439466_0028815_56_880 274
674 3300041411 Ga0439466_0040557 Ga0439466_0040557_101_925 274
675 3300041997 Ga0439431_0009666 Ga0439431_0009666_352_1182 274
676 3300042006 Ga0439432_016287 Ga0439432_016287_467_1297 274
677 3300042006 Ga0439432_023454 Ga0439432_023454_278_1102 274
678 3300042009 Ga0439451_005522 Ga0439451_005522_1131_1955 274
679 3300042009 Ga0439451_005676 Ga0439451_005676_1254_2078 274
680 3300042009 Ga0439451_009838 Ga0439451_009838_612_1436 274
681 3300042010 Ga0439452_000372 Ga0439452_000372_9511_10335 274
682 3300042010 Ga0439452_001330 Ga0439452_001330_8664_9488 274
683 3300042010 Ga0439452_001343 Ga0439452_001343_4010_4834 274
684 3300042010 Ga0439452_006283 Ga0439452_006283_272_1096 274
685 3300042010 Ga0439452_015280 Ga0439452_015280_803_1627 274
686 3300042010 Ga0439452_015650 Ga0439452_015650_1020_1850 274
687 3300042013 Ga0439456_002821 Ga0439456_002821_927_1751 274
688 3300042013 Ga0439456_009949 Ga0439456_009949_414_1238 274
689 3300042013 Ga0439456_015903 Ga0439456_015903_27_851 274
690 3300042013 Ga0439456_027815 Ga0439456_027815_352_1176 274
691 3300042013 Ga0439456_037812 Ga0439456_037812_70_894 274
692 3300042016 Ga0439463_022141 Ga0439463_022141_668_1492 274
693 3300042016 Ga0439463_032560 Ga0439463_032560_131_955 274
694 3300042115 Ga0450911_000216 Ga0450911_000216_20768_21592 274
695 3300042115 Ga0450911_002608 Ga0450911_002608_1282_2106 274
696 3300042115 Ga0450911_003293 Ga0450911_003293_1887_2711 274
697 3300042115 Ga0450911_003888 Ga0450911_003888_967_1791 274
698 3300042121 Ga0450919_001981 Ga0450919_001981_1038_1862 274
699 3300042121 Ga0450919_004827 Ga0450919_004827_512_1342 274
700 3300042122 Ga0450920_002641 Ga0450920_002641_963_1787 274
701 3300042124 Ga0450922_000804 Ga0450922_000804_1082_1906 274
702 3300042125 Ga0450923_002430 Ga0450923_002430_782_1606 274
703 3300042127 Ga0450890_003080 Ga0450890_003080_341_1165 274
704 3300042136 Ga0450900_006549 Ga0450900_006549_263_1087 274
705 3300042136 Ga0450900_006960 Ga0450900_006960_360_1190 274
706 3300042137 Ga0450902_001653 Ga0450902_001653_1174_1998 274
707 3300042137 Ga0450902_023923 Ga0450902_023923_79_903 274
708 3300042138 Ga0450903_002931 Ga0450903_002931_1747_2571 274
709 3300042138 Ga0450903_004504 Ga0450903_004504_221_1045 274
710 3300042138 Ga0450903_005259 Ga0450903_005259_247_1071 274
711 3300042138 Ga0450903_006703 Ga0450903_006703_272_1096 274
712 3300042138 Ga0450903_007362 Ga0450903_007362_932_1756 274
713 3300042139 Ga0450904_000890 Ga0450904_000890_3208_4032 274
714 3300042139 Ga0450904_001713 Ga0450904_001713_973_1797 274
715 3300042146 Ga0450907_000028 Ga0450907_000028_43886_44710 274
716 3300042156 Ga0439446_0005083 Ga0439446_0005083_1428_2258 274
717 3300042156 Ga0439446_0011627 Ga0439446_0011627_271_1095 274
718 3300042156 Ga0439446_0013421 Ga0439446_0013421_850_1680 274
719 3300042185 Ga0450909_002494 Ga0450909_002494_356_1180 274
720 3300042185 Ga0450909_009411 Ga0450909_009411_196_1020 274
721 3300042435 Ga0439434_0000677 Ga0439434_0000677_2468_3292 274
722 3300042435 Ga0439434_0009914 Ga0439434_0009914_841_1671 274
723 3300042439 Ga0439464_0002752 Ga0439464_0002752_1810_2640 274
724 3300042439 Ga0439464_0009252 Ga0439464_0009252_916_1746 274
725 3300042439 Ga0439464_0040780 Ga0439464_0040780_81_911 274
726 3300042461 Ga0439460_0005324 Ga0439460_0005324_1229_2053 274
727 3300042531 Ga0450918_004851 Ga0450918_004851_1427_2251 274
728 3300042532 Ga0450893_0001886 Ga0450893_0001886_1917_2747 274
729 3300042993 Ga0439440_0001333 Ga0439440_0001333_2814_3656 274
730 3300042993 Ga0439440_0007206 Ga0439440_0007206_1093_1917 274
731 3300046452 Ga0495617_003380 Ga0495617_003380_4034_4858 274
732 3300046452 Ga0495617_004581 Ga0495617_004581_1684_2526 274
733 3300046452 Ga0495617_004803 Ga0495617_004803_1744_2568 274
734 3300046452 Ga0495617_010526 Ga0495617_010526_1857_2699 274
735 3300046452 Ga0495617_015731 Ga0495617_015731_1053_1877 274
736 3300046452 Ga0495617_019232 Ga0495617_019232_366_1190 274
737 3300046452 Ga0495617_037007 Ga0495617_037007_300_1124 274
738 3300046452 Ga0495617_039401 Ga0495617_039401_339_1163 274
739 3300046452 Ga0495617_052355 Ga0495617_052355_156_980 274
740 3300046453 Ga0495627_001493 Ga0495627_001493_10240_11064 274
741 3300046453 Ga0495627_001820 Ga0495627_001820_3438_4262 274
742 3300046453 Ga0495627_007010 Ga0495627_007010_2981_3805 274
743 3300046453 Ga0495627_013827 Ga0495627_013827_1185_2009 274
744 3300046453 Ga0495627_018205 Ga0495627_018205_1184_2008 274
745 3300046454 Ga0495592_0023430 Ga0495592_0023430_572_1396 274
746 3300046455 Ga0495603_0009598 Ga0495603_0009598_3726_4550 274
747 3300046455 Ga0495603_0015260 Ga0495603_0015260_16_840 274
748 3300046455 Ga0495603_0016070 Ga0495603_0016070_73_897 274
749 3300046455 Ga0495603_0098230 Ga0495603_0098230_384_1208 274
750 3300046457 Ga0495590_0002001 Ga0495590_0002001_1327_2151 274
751 3300046457 Ga0495590_0005317 Ga0495590_0005317_3869_4693 274
752 3300046457 Ga0495590_0014590 Ga0495590_0014590_940_1764 274
753 3300046457 Ga0495590_0040915 Ga0495590_0040915_115_939 274
754 3300046457 Ga0495590_0046574 Ga0495590_0046574_12_836 274
755 3300046457 Ga0495590_0063923 Ga0495590_0063923_132_956 274
756 3300046458 Ga0495591_000585 Ga0495591_000585_20830_21654 274
757 3300046458 Ga0495591_001116 Ga0495591_001116_8532_9356 274
758 3300046458 Ga0495591_001656 Ga0495591_001656_78_902 274
759 3300046458 Ga0495591_002086 Ga0495591_002086_4945_5769 274
760 3300046458 Ga0495591_003632 Ga0495591_003632_3560_4384 274
761 3300046458 Ga0495591_005276 Ga0495591_005276_1321_2145 274
762 3300046458 Ga0495591_006452 Ga0495591_006452_3489_4316 274
763 3300046458 Ga0495591_008386 Ga0495591_008386_2434_3258 274
764 3300046458 Ga0495591_009047 Ga0495591_009047_1202_2026 274
765 3300046458 Ga0495591_019335 Ga0495591_019335_1234_2058 274
766 3300046458 Ga0495591_020548 Ga0495591_020548_374_1198 274
767 3300046458 Ga0495591_034763 Ga0495591_034763_311_1135 274
768 3300046458 Ga0495591_045830 Ga0495591_045830_348_1172 274
769 3300046458 Ga0495591_049788 Ga0495591_049788_209_1033 274
770 3300046459 Ga0495629_0112072 Ga0495629_0112072_43_867 274
771 3300046460 Ga0495638_0002428 Ga0495638_0002428_8022_8846 274
772 3300046460 Ga0495638_0007388 Ga0495638_0007388_1227_2051 274
773 3300046460 Ga0495638_0008121 Ga0495638_0008121_6345_7169 274
774 3300046460 Ga0495638_0010228 Ga0495638_0010228_4078_4902 274
775 3300046460 Ga0495638_0018600 Ga0495638_0018600_2713_3537 274
776 3300046460 Ga0495638_0019164 Ga0495638_0019164_1418_2242 274
777 3300046460 Ga0495638_0023323 Ga0495638_0023323_1825_2649 274
778 3300046460 Ga0495638_0026807 Ga0495638_0026807_634_1458 274
779 3300046460 Ga0495638_0028064 Ga0495638_0028064_2591_3415 274
780 3300046460 Ga0495638_0030132 Ga0495638_0030132_2651_3475 274
781 3300046460 Ga0495638_0050668 Ga0495638_0050668_82_924 274
782 3300046460 Ga0495638_0059513 Ga0495638_0059513_1283_2107 274
783 3300046460 Ga0495638_0070174 Ga0495638_0070174_55_879 274
784 3300046460 Ga0495638_0070350 Ga0495638_0070350_992_1816 274
785 3300046460 Ga0495638_0079001 Ga0495638_0079001_981_1805 274
786 3300046460 Ga0495638_0099311 Ga0495638_0099311_452_1276 274
787 3300046460 Ga0495638_0276808 Ga0495638_0276808_21_845 274
788 3300046463 Ga0495653_0024339 Ga0495653_0024339_691_1515 274
789 3300046463 Ga0495653_0028416 Ga0495653_0028416_1358_2182 274
790 3300046471 Ga0495650_0000839 Ga0495650_0000839_35196_36020 274
791 3300046471 Ga0495650_0001421 Ga0495650_0001421_7143_7967 274
792 3300046471 Ga0495650_0009859 Ga0495650_0009859_867_1691 274
793 3300046471 Ga0495650_0010432 Ga0495650_0010432_3823_4665 274
794 3300046471 Ga0495650_0019432 Ga0495650_0019432_1076_1900 274
795 3300046471 Ga0495650_0036351 Ga0495650_0036351_767_1591 274
796 3300046473 Ga0495582_0071835 Ga0495582_0071835_1048_1872 274
797 3300046474 Ga0495605_0000030 Ga0495605_0000030_145885_146709 274
798 3300046474 Ga0495605_0001302 Ga0495605_0001302_15382_16206 274
799 3300046474 Ga0495605_0002385 Ga0495605_0002385_3766_4590 274
800 3300046474 Ga0495605_0007896 Ga0495605_0007896_1408_2232 274
801 3300046474 Ga0495605_0012489 Ga0495605_0012489_614_1438 274
802 3300046474 Ga0495605_0012862 Ga0495605_0012862_990_1814 274
803 3300046474 Ga0495605_0028727 Ga0495605_0028727_1228_2052 274
804 3300046474 Ga0495605_0047277 Ga0495605_0047277_621_1445 274
805 3300046474 Ga0495605_0062839 Ga0495605_0062839_495_1319 274
806 3300046474 Ga0495605_0079191 Ga0495605_0079191_245_1069 274
807 3300046474 Ga0495605_0160961 Ga0495605_0160961_98_922 274
808 3300046475 Ga0495639_0000008 Ga0495639_0000008_36430_37254 274
809 3300046491 Ga0495584_0002432 Ga0495584_0002432_4812_5636 274
810 3300046491 Ga0495584_0004593 Ga0495584_0004593_2813_3637 274
811 3300046491 Ga0495584_0007660 Ga0495584_0007660_3742_4566 274
812 3300046491 Ga0495584_0008813 Ga0495584_0008813_485_1309 274
813 3300046491 Ga0495584_0014697 Ga0495584_0014697_2175_2999 274
814 3300046491 Ga0495584_0017744 Ga0495584_0017744_1999_2823 274
815 3300046491 Ga0495584_0022795 Ga0495584_0022795_1086_1910 274
816 3300046491 Ga0495584_0024372 Ga0495584_0024372_1262_2086 274
817 3300046491 Ga0495584_0024977 Ga0495584_0024977_614_1438 274
818 3300046491 Ga0495584_0098973 Ga0495584_0098973_612_1436 274
819 3300046492 Ga0495585_0000783 Ga0495585_0000783_23281_24105 274
820 3300046492 Ga0495585_0004051 Ga0495585_0004051_2066_2890 274
821 3300046492 Ga0495585_0006143 Ga0495585_0006143_4391_5215 274
822 3300046492 Ga0495585_0006806 Ga0495585_0006806_4872_5696 274
823 3300046492 Ga0495585_0008317 Ga0495585_0008317_3545_4369 274
824 3300046492 Ga0495585_0008440 Ga0495585_0008440_3826_4650 274
825 3300046492 Ga0495585_0009321 Ga0495585_0009321_3774_4598 274
826 3300046492 Ga0495585_0015879 Ga0495585_0015879_419_1243 274
827 3300046492 Ga0495585_0020157 Ga0495585_0020157_2849_3673 274
828 3300046492 Ga0495585_0036313 Ga0495585_0036313_1253_2077 274
829 3300046492 Ga0495585_0051585 Ga0495585_0051585_841_1665 274
830 3300046499 Ga0495594_0007848 Ga0495594_0007848_3598_4422 274
831 3300046499 Ga0495594_0009036 Ga0495594_0009036_1959_2783 274
832 3300046499 Ga0495594_0106845 Ga0495594_0106845_125_949 274
833 3300046499 Ga0495594_0140788 Ga0495594_0140788_508_1332 274
834 3300046500 Ga0495596_0001734 Ga0495596_0001734_4922_5746 274
835 3300046500 Ga0495596_0017180 Ga0495596_0017180_683_1507 274
836 3300046500 Ga0495596_0039639 Ga0495596_0039639_162_986 274
837 3300046501 Ga0495607_0007268 Ga0495607_0007268_2122_2946 274
838 3300046501 Ga0495607_0009301 Ga0495607_0009301_3774_4598 274
839 3300046501 Ga0495607_0011580 Ga0495607_0011580_2027_2851 274
840 3300046501 Ga0495607_0014545 Ga0495607_0014545_570_1394 274
841 3300046501 Ga0495607_0023760 Ga0495607_0023760_1667_2491 274
842 3300046501 Ga0495607_0032763 Ga0495607_0032763_942_1766 274
843 3300046501 Ga0495607_0033329 Ga0495607_0033329_1207_2031 274
844 3300046501 Ga0495607_0037895 Ga0495607_0037895_980_1804 274
845 3300046501 Ga0495607_0041169 Ga0495607_0041169_614_1438 274
846 3300046501 Ga0495607_0043619 Ga0495607_0043619_473_1297 274
847 3300046501 Ga0495607_0069627 Ga0495607_0069627_521_1345 274
848 3300046501 Ga0495607_0070007 Ga0495607_0070007_21_845 274
849 3300046501 Ga0495607_0084547 Ga0495607_0084547_864_1688 274
850 3300046506 Ga0495583_0001887 Ga0495583_0001887_12616_13440 274
851 3300046506 Ga0495583_0003004 Ga0495583_0003004_1676_2500 274
852 3300046506 Ga0495583_0009036 Ga0495583_0009036_4199_5023 274
853 3300046506 Ga0495583_0010271 Ga0495583_0010271_926_1750 274
854 3300046506 Ga0495583_0013352 Ga0495583_0013352_1637_2461 274
855 3300046507 Ga0495606_0000086 Ga0495606_0000086_114827_115651 274
856 3300046507 Ga0495606_0003630 Ga0495606_0003630_8437_9261 274
857 3300046507 Ga0495606_0008447 Ga0495606_0008447_7719_8543 274
858 3300046507 Ga0495606_0014164 Ga0495606_0014164_3766_4608 274
859 3300046507 Ga0495606_0014491 Ga0495606_0014491_3970_4794 274
860 3300046507 Ga0495606_0016017 Ga0495606_0016017_1204_2028 274
861 3300046507 Ga0495606_0050523 Ga0495606_0050523_1744_2586 274
862 3300046507 Ga0495606_0114140 Ga0495606_0114140_127_951 274
863 3300046512 Ga0495610_0002270 Ga0495610_0002270_972_1796 274
864 3300046512 Ga0495610_0004844 Ga0495610_0004844_2692_3516 274
865 3300046512 Ga0495610_0005642 Ga0495610_0005642_988_1812 274
866 3300046512 Ga0495610_0010119 Ga0495610_0010119_1028_1852 274
867 3300046512 Ga0495610_0011107 Ga0495610_0011107_3820_4644 274
868 3300046512 Ga0495610_0014646 Ga0495610_0014646_707_1531 274
869 3300046512 Ga0495610_0029112 Ga0495610_0029112_1522_2346 274
870 3300046512 Ga0495610_0046166 Ga0495610_0046166_974_1798 274
871 3300046512 Ga0495610_0067233 Ga0495610_0067233_767_1591 274
872 3300046512 Ga0495610_0067778 Ga0495610_0067778_181_1005 274
873 3300046513 Ga0495616_0002518 Ga0495616_0002518_3782_4606 274
874 3300046513 Ga0495616_0005500 Ga0495616_0005500_3289_4113 274
875 3300046513 Ga0495616_0006781 Ga0495616_0006781_4105_4929 274
876 3300046513 Ga0495616_0007130 Ga0495616_0007130_1055_1879 274
877 3300046513 Ga0495616_0010048 Ga0495616_0010048_3885_4727 274
878 3300046513 Ga0495616_0010589 Ga0495616_0010589_1121_1945 274
879 3300046513 Ga0495616_0019087 Ga0495616_0019087_255_1079 274
880 3300046513 Ga0495616_0057853 Ga0495616_0057853_184_1008 274
881 3300046513 Ga0495616_0058137 Ga0495616_0058137_55_879 274
882 3300046513 Ga0495616_0062614 Ga0495616_0062614_154_978 274
883 3300046513 Ga0495616_0076265 Ga0495616_0076265_76_900 274
884 3300046515 Ga0495620_0000052 Ga0495620_0000052_98226_99050 274
885 3300046515 Ga0495620_0000382 Ga0495620_0000382_4051_4875 274
886 3300046515 Ga0495620_0003817 Ga0495620_0003817_872_1696 274
887 3300046515 Ga0495620_0007452 Ga0495620_0007452_4239_5063 274
888 3300046515 Ga0495620_0007575 Ga0495620_0007575_4093_4917 274
889 3300046515 Ga0495620_0008319 Ga0495620_0008319_1296_2120 274
890 3300046515 Ga0495620_0010869 Ga0495620_0010869_1031_1855 274
891 3300046515 Ga0495620_0014286 Ga0495620_0014286_1116_1940 274
892 3300046515 Ga0495620_0019497 Ga0495620_0019497_2396_3220 274
893 3300046515 Ga0495620_0020128 Ga0495620_0020128_373_1197 274
894 3300046515 Ga0495620_0029611 Ga0495620_0029611_108_932 274
895 3300046517 Ga0495630_0024875 Ga0495630_0024875_1112_1936 274
896 3300046517 Ga0495630_0043708 Ga0495630_0043708_1357_2181 274
897 3300046518 Ga0495631_0001130 Ga0495631_0001130_7790_8614 274
898 3300046518 Ga0495631_0001781 Ga0495631_0001781_10471_11295 274
899 3300046518 Ga0495631_0023435 Ga0495631_0023435_327_1151 274
900 3300046518 Ga0495631_0023494 Ga0495631_0023494_1593_2417 274
901 3300046518 Ga0495631_0023610 Ga0495631_0023610_163_987 274
902 3300046518 Ga0495631_0040851 Ga0495631_0040851_550_1374 274
903 3300046519 Ga0495632_0000146 Ga0495632_0000146_4131_4955 274
904 3300046519 Ga0495632_0000210 Ga0495632_0000210_4560_5384 274
905 3300046519 Ga0495632_0001890 Ga0495632_0001890_7871_8695 274
906 3300046519 Ga0495632_0003067 Ga0495632_0003067_7579_8403 274
907 3300046519 Ga0495632_0006290 Ga0495632_0006290_2990_3814 274
908 3300046519 Ga0495632_0009058 Ga0495632_0009058_4279_5103 274
909 3300046519 Ga0495632_0010768 Ga0495632_0010768_1031_1855 274
910 3300046519 Ga0495632_0018205 Ga0495632_0018205_970_1794 274
911 3300046519 Ga0495632_0023108 Ga0495632_0023108_1305_2129 274
912 3300046519 Ga0495632_0027597 Ga0495632_0027597_120_944 274
913 3300046519 Ga0495632_0027666 Ga0495632_0027666_1093_1917 274
914 3300046519 Ga0495632_0034901 Ga0495632_0034901_1358_2182 274
915 3300046519 Ga0495632_0038288 Ga0495632_0038288_711_1535 274
916 3300046519 Ga0495632_0060408 Ga0495632_0060408_157_981 274
917 3300046519 Ga0495632_0061296 Ga0495632_0061296_329_1153 274
918 3300046519 Ga0495632_0077735 Ga0495632_0077735_330_1154 274
919 3300046519 Ga0495632_0129273 Ga0495632_0129273_248_1072 274
920 3300046520 Ga0495637_0001523 Ga0495637_0001523_11915_12739 274
921 3300046520 Ga0495637_0001644 Ga0495637_0001644_7182_8006 274
922 3300046520 Ga0495637_0002390 Ga0495637_0002390_791_1615 274
923 3300046520 Ga0495637_0005545 Ga0495637_0005545_3734_4576 274
924 3300046520 Ga0495637_0006522 Ga0495637_0006522_4131_4973 274
925 3300046520 Ga0495637_0011187 Ga0495637_0011187_3320_4144 274
926 3300046520 Ga0495637_0011776 Ga0495637_0011776_778_1602 274
927 3300046520 Ga0495637_0015635 Ga0495637_0015635_2231_3055 274
928 3300046520 Ga0495637_0017206 Ga0495637_0017206_151_975 274
929 3300046520 Ga0495637_0018126 Ga0495637_0018126_854_1678 274
930 3300046520 Ga0495637_0021272 Ga0495637_0021272_547_1371 274
931 3300046520 Ga0495637_0022346 Ga0495637_0022346_1540_2364 274
932 3300046520 Ga0495637_0026916 Ga0495637_0026916_410_1234 274
933 3300046520 Ga0495637_0037075 Ga0495637_0037075_578_1402 274
934 3300046520 Ga0495637_0040962 Ga0495637_0040962_876_1700 274
935 3300046522 Ga0495643_0000197 Ga0495643_0000197_59505_60329 274
936 3300046522 Ga0495643_0009699 Ga0495643_0009699_207_1031 274
937 3300046522 Ga0495643_0022741 Ga0495643_0022741_2095_2919 274
938 3300046522 Ga0495643_0023346 Ga0495643_0023346_1046_1888 274
939 3300046522 Ga0495643_0042292 Ga0495643_0042292_1184_2008 274
940 3300046522 Ga0495643_0085916 Ga0495643_0085916_50_874 274
941 3300046522 Ga0495643_0205352 Ga0495643_0205352_75_899 274
942 3300046523 Ga0495644_0005711 Ga0495644_0005711_3680_4504 274
943 3300046523 Ga0495644_0014059 Ga0495644_0014059_935_1759 274
944 3300046523 Ga0495644_0017143 Ga0495644_0017143_1067_1891 274
945 3300046523 Ga0495644_0125930 Ga0495644_0125930_100_924 274
946 3300046524 Ga0495648_0003674 Ga0495648_0003674_7899_8723 274
947 3300046524 Ga0495648_0003791 Ga0495648_0003791_1176_2000 274
948 3300046524 Ga0495648_0005357 Ga0495648_0005357_2338_3162 274
949 3300046524 Ga0495648_0005404 Ga0495648_0005404_4443_5267 274
950 3300046524 Ga0495648_0005877 Ga0495648_0005877_6344_7168 274
951 3300046524 Ga0495648_0011500 Ga0495648_0011500_4515_5339 274
952 3300046524 Ga0495648_0011843 Ga0495648_0011843_5314_6138 274
953 3300046524 Ga0495648_0012662 Ga0495648_0012662_4953_5777 274
954 3300046524 Ga0495648_0038354 Ga0495648_0038354_594_1418 274
955 3300046524 Ga0495648_0039777 Ga0495648_0039777_24_848 274
956 3300046524 Ga0495648_0050989 Ga0495648_0050989_1626_2450 274
957 3300046524 Ga0495648_0065267 Ga0495648_0065267_27_851 274
958 3300046524 Ga0495648_0091888 Ga0495648_0091888_63_887 274
959 3300046524 Ga0495648_0095025 Ga0495648_0095025_734_1558 274
960 3300046524 Ga0495648_0110488 Ga0495648_0110488_132_956 274
961 3300046524 Ga0495648_0145668 Ga0495648_0145668_318_1142 274
962 3300046526 Ga0495666_0004231 Ga0495666_0004231_1084_1908 274
963 3300046526 Ga0495666_0008869 Ga0495666_0008869_3171_3995 274
964 3300046526 Ga0495666_0038270 Ga0495666_0038270_897_1721 274
965 3300046526 Ga0495666_0069562 Ga0495666_0069562_519_1343 274
966 3300046528 Ga0495642_0000480 Ga0495642_0000480_7649_8473 274
967 3300046528 Ga0495642_0001728 Ga0495642_0001728_3245_4069 274
968 3300046528 Ga0495642_0002506 Ga0495642_0002506_5600_6424 274
969 3300046530 Ga0495654_0000814 Ga0495654_0000814_7784_8608 274
970 3300046530 Ga0495654_0001809 Ga0495654_0001809_922_1746 274
971 3300046530 Ga0495654_0002594 Ga0495654_0002594_2281_3105 274
972 3300046530 Ga0495654_0007045 Ga0495654_0007045_3260_4084 274
973 3300046530 Ga0495654_0014326 Ga0495654_0014326_754_1578 274
974 3300046530 Ga0495654_0021171 Ga0495654_0021171_1331_2155 274
975 3300046530 Ga0495654_0027821 Ga0495654_0027821_1432_2256 274
976 3300046530 Ga0495654_0029081 Ga0495654_0029081_1293_2117 274
977 3300046530 Ga0495654_0031270 Ga0495654_0031270_763_1587 274
978 3300046530 Ga0495654_0032448 Ga0495654_0032448_1749_2573 274
979 3300046530 Ga0495654_0041918 Ga0495654_0041918_935_1759 274
980 3300046530 Ga0495654_0043481 Ga0495654_0043481_1244_2068 274
981 3300046530 Ga0495654_0063768 Ga0495654_0063768_417_1241 274
982 3300046530 Ga0495654_0110081 Ga0495654_0110081_372_1214 274
983 3300046535 Ga0495586_0077665 Ga0495586_0077665_31_855 274
984 3300046536 Ga0495587_0127788 Ga0495587_0127788_41_865 274
985 3300046538 Ga0495609_0000561 Ga0495609_0000561_27652_28476 274
986 3300046538 Ga0495609_0002378 Ga0495609_0002378_3739_4563 274
987 3300046538 Ga0495609_0002464 Ga0495609_0002464_2898_3722 274
988 3300046538 Ga0495609_0007472 Ga0495609_0007472_862_1686 274
989 3300046538 Ga0495609_0007656 Ga0495609_0007656_3550_4374 274
990 3300046538 Ga0495609_0008373 Ga0495609_0008373_943_1767 274
991 3300046538 Ga0495609_0069306 Ga0495609_0069306_125_949 274
992 3300046538 Ga0495609_0086935 Ga0495609_0086935_515_1339 274
993 3300046542 Ga0495597_0003683 Ga0495597_0003683_6901_7725 274
994 3300046542 Ga0495597_0012232 Ga0495597_0012232_908_1732 274
995 3300046542 Ga0495597_0029970 Ga0495597_0029970_1191_2015 274
996 3300046542 Ga0495597_0034033 Ga0495597_0034033_265_1089 274
997 3300046542 Ga0495597_0034976 Ga0495597_0034976_786_1610 274
998 3300046542 Ga0495597_0042714 Ga0495597_0042714_191_1015 274
999 3300046542 Ga0495597_0154374 Ga0495597_0154374_62_886 274
1000 3300046543 Ga0495645_0145575 Ga0495645_0145575_763_1587 274
1001 3300046557 Ga0495622_0000463 Ga0495622_0000463_1358_2182 274
1002 3300046557 Ga0495622_0001045 Ga0495622_0001045_5273_6097 274
1003 3300046557 Ga0495622_0003216 Ga0495622_0003216_154_978 274
1004 3300046557 Ga0495622_0004383 Ga0495622_0004383_3574_4398 274
1005 3300046557 Ga0495622_0005340 Ga0495622_0005340_1108_1932 274
1006 3300046557 Ga0495622_0010277 Ga0495622_0010277_995_1837 274
1007 3300046557 Ga0495622_0022269 Ga0495622_0022269_1395_2222 274
1008 3300046557 Ga0495622_0036027 Ga0495622_0036027_643_1467 274
1009 3300046558 Ga0495633_0011965 Ga0495633_0011965_3751_4575 274
1010 3300046558 Ga0495633_0017673 Ga0495633_0017673_1621_2445 274
1011 3300046558 Ga0495633_0018461 Ga0495633_0018461_2663_3487 274
1012 3300046558 Ga0495633_0035833 Ga0495633_0035833_1165_1989 274
1013 3300046615 Ga0495656_0020745 Ga0495656_0020745_578_1405 274
1014 3300046616 Ga0495668_0005127 Ga0495668_0005127_1121_1945 274
1015 3300046616 Ga0495668_0005428 Ga0495668_0005428_961_1785 274
1016 3300046616 Ga0495668_0010886 Ga0495668_0010886_3223_4065 274
1017 3300046616 Ga0495668_0081095 Ga0495668_0081095_733_1557 274
1018 3300046616 Ga0495668_0143051 Ga0495668_0143051_385_1209 274
1019 3300046616 Ga0495668_0214960 Ga0495668_0214960_169_993 274
1020 3300046642 Ga0495634_0006103 Ga0495634_0006103_3877_4701 274
1021 3300046642 Ga0495634_0103821 Ga0495634_0103821_947_1771 274
1022 3300046648 Ga0495611_0000221 Ga0495611_0000221_33170_34012 274
1023 3300046648 Ga0495611_0000659 Ga0495611_0000659_9073_9897 274
1024 3300046660 Ga0495625_0000111 Ga0495625_0000111_1997_2821 274
1025 3300046660 Ga0495625_0005532 Ga0495625_0005532_3437_4261 274
1026 3300046660 Ga0495625_0010409 Ga0495625_0010409_2475_3299 274
1027 3300046660 Ga0495625_0012215 Ga0495625_0012215_3720_4544 274
1028 3300046660 Ga0495625_0019181 Ga0495625_0019181_3616_4440 274
1029 3300046660 Ga0495625_0022890 Ga0495625_0022890_3264_4088 274
1030 3300046660 Ga0495625_0040553 Ga0495625_0040553_1258_2082 274
1031 3300046660 Ga0495625_0041822 Ga0495625_0041822_119_943 274
1032 3300046660 Ga0495625_0051848 Ga0495625_0051848_1006_1830 274
1033 3300046660 Ga0495625_0055895 Ga0495625_0055895_1244_2068 274
1034 3300046660 Ga0495625_0073352 Ga0495625_0073352_662_1486 274
1035 3300046660 Ga0495625_0111338 Ga0495625_0111338_884_1708 274
1036 3300046660 Ga0495625_0328303 Ga0495625_0328303_103_927 274
1037 3300046663 Ga0495635_0005286 Ga0495635_0005286_4101_4925 274
1038 3300046663 Ga0495635_0151919 Ga0495635_0151919_44_868 274
1039 3300046664 Ga0495659_0000571 Ga0495659_0000571_1168_1992 274
1040 3300046664 Ga0495659_0002737 Ga0495659_0002737_3754_4578 274
1041 3300046665 Ga0495661_0000054 Ga0495661_0000054_48305_49129 274
1042 3300046665 Ga0495661_0022011 Ga0495661_0022011_53_877 274
1043 3300046665 Ga0495661_0035182 Ga0495661_0035182_1239_2063 274
1044 3300046665 Ga0495661_0057086 Ga0495661_0057086_628_1452 274
1045 3300046665 Ga0495661_0061438 Ga0495661_0061438_72_896 274
1046 3300046665 Ga0495661_0062490 Ga0495661_0062490_930_1754 274
1047 3300046665 Ga0495661_0066268 Ga0495661_0066268_677_1501 274
1048 3300046665 Ga0495661_0098830 Ga0495661_0098830_458_1282 274
1049 3300046674 Ga0495588_0013404 Ga0495588_0013404_2380_3204 274
1050 3300046674 Ga0495588_0057975 Ga0495588_0057975_769_1593 274
1051 3300046675 Ga0495657_0074912 Ga0495657_0074912_595_1419 274
1052 3300046679 Ga0495623_0016817 Ga0495623_0016817_3238_4062 274
1053 3300046679 Ga0495623_0069355 Ga0495623_0069355_1006_1830 274
1054 3300046680 Ga0495646_0076513 Ga0495646_0076513_1111_1935 274
1055 3300046680 Ga0495646_0089707 Ga0495646_0089707_800_1624 274
1056 3300046684 Ga0495669_0029259 Ga0495669_0029259_757_1581 274
1057 3300046689 Ga0495613_0014546 Ga0495613_0014546_1399_2223 274
1058 3300046689 Ga0495613_0162572 Ga0495613_0162572_66_890 274
1059 3300046690 Ga0495624_0004059 Ga0495624_0004059_8602_9426 274
1060 3300046690 Ga0495624_0063981 Ga0495624_0063981_690_1514 274
1061 3300046691 Ga0495670_0006172 Ga0495670_0006172_2493_3317 274
1062 3300046691 Ga0495670_0007558 Ga0495670_0007558_277_1101 274
1063 3300046691 Ga0495670_0007569 Ga0495670_0007569_1284_2108 274
1064 3300046691 Ga0495670_0012894 Ga0495670_0012894_713_1537 274
1065 3300046691 Ga0495670_0027806 Ga0495670_0027806_1204_2028 274
1066 3300046691 Ga0495670_0028431 Ga0495670_0028431_1349_2173 274
1067 3300046691 Ga0495670_0037512 Ga0495670_0037512_1001_1825 274
1068 3300046691 Ga0495670_0101151 Ga0495670_0101151_643_1467 274
1069 3300046692 Ga0495671_0002668 Ga0495671_0002668_3410_4234 274
1070 3300046692 Ga0495671_0006459 Ga0495671_0006459_1460_2284 274
1071 3300046692 Ga0495671_0007287 Ga0495671_0007287_3545_4369 274
1072 3300046692 Ga0495671_0008014 Ga0495671_0008014_4155_4979 274
1073 3300046692 Ga0495671_0008408 Ga0495671_0008408_1053_1877 274
1074 3300046692 Ga0495671_0009181 Ga0495671_0009181_4093_4917 274
1075 3300046692 Ga0495671_0012626 Ga0495671_0012626_978_1802 274
1076 3300046692 Ga0495671_0016948 Ga0495671_0016948_2644_3468 274
1077 3300046692 Ga0495671_0018748 Ga0495671_0018748_816_1640 274
1078 3300046692 Ga0495671_0021496 Ga0495671_0021496_1460_2284 274
1079 3300046692 Ga0495671_0038106 Ga0495671_0038106_309_1133 274
1080 3300046692 Ga0495671_0058308 Ga0495671_0058308_1076_1900 274
1081 3300046692 Ga0495671_0068094 Ga0495671_0068094_780_1604 274
1082 3300046692 Ga0495671_0103139 Ga0495671_0103139_499_1323 274
1083 3300046694 Ga0495649_0002674 Ga0495649_0002674_7957_8781 274
1084 3300046694 Ga0495649_0002946 Ga0495649_0002946_7482_8306 274
1085 3300046694 Ga0495649_0003085 Ga0495649_0003085_1367_2191 274
1086 3300046694 Ga0495649_0003313 Ga0495649_0003313_6360_7184 274
1087 3300046694 Ga0495649_0010363 Ga0495649_0010363_3726_4550 274
1088 3300046694 Ga0495649_0011981 Ga0495649_0011981_185_1009 274
1089 3300046694 Ga0495649_0013195 Ga0495649_0013195_3432_4256 274
1090 3300046694 Ga0495649_0014096 Ga0495649_0014096_3705_4529 274
1091 3300046694 Ga0495649_0020893 Ga0495649_0020893_921_1745 274
1092 3300046694 Ga0495649_0022182 Ga0495649_0022182_595_1419 274
1093 3300046694 Ga0495649_0025177 Ga0495649_0025177_1590_2414 274
1094 3300046694 Ga0495649_0040191 Ga0495649_0040191_894_1718 274
1095 3300046694 Ga0495649_0054734 Ga0495649_0054734_1219_2043 274
1096 3300046694 Ga0495649_0055409 Ga0495649_0055409_1138_1962 274
1097 3300046794 Ga0495589_0001836 Ga0495589_0001836_7201_8025 274
1098 3300046794 Ga0495589_0002285 Ga0495589_0002285_8792_9616 274
1099 3300046794 Ga0495589_0004908 Ga0495589_0004908_1916_2758 274
1100 3300046794 Ga0495589_0008306 Ga0495589_0008306_3629_4453 274
1101 3300046794 Ga0495589_0021225 Ga0495589_0021225_1880_2704 274
1102 3300046794 Ga0495589_0056137 Ga0495589_0056137_1081_1905 274
1103 3300046794 Ga0495589_0062342 Ga0495589_0062342_938_1762 274
1104 3300046794 Ga0495589_0089084 Ga0495589_0089084_10_834 274
1105 3300046809 Ga0495600_0007789 Ga0495600_0007789_1060_1884 274
1106 3300046809 Ga0495600_0045095 Ga0495600_0045095_668_1492 274
1107 3300046810 Ga0495660_0002694 Ga0495660_0002694_7208_8032 274
1108 3300046810 Ga0495660_0004655 Ga0495660_0004655_3865_4689 274
1109 3300046810 Ga0495660_0009693 Ga0495660_0009693_3765_4589 274
1110 3300046810 Ga0495660_0014997 Ga0495660_0014997_2565_3389 274
1111 3300046810 Ga0495660_0016718 Ga0495660_0016718_2802_3626 274
1112 3300046810 Ga0495660_0024204 Ga0495660_0024204_2169_2993 274
1113 3300046810 Ga0495660_0037992 Ga0495660_0037992_1389_2213 274
1114 3300046810 Ga0495660_0041997 Ga0495660_0041997_1649_2473 274
1115 3300046810 Ga0495660_0052642 Ga0495660_0052642_590_1414 274
1116 3300046810 Ga0495660_0102273 Ga0495660_0102273_557_1381 274
1117 3300046810 Ga0495660_0118503 Ga0495660_0118503_208_1032 274
1118 3300047315 Ga0495581_0010306 Ga0495581_0010306_3733_4557 274
1119 3300047315 Ga0495581_0063110 Ga0495581_0063110_866_1690 274
1120 3300047317 Ga0495604_0022759 Ga0495604_0022759_321_1145 274
1121 3300047317 Ga0495604_0043404 Ga0495604_0043404_2016_2840 274
1122 3300047317 Ga0495604_0091716 Ga0495604_0091716_376_1200 274
1123 3300047319 Ga0495674_0031692 Ga0495674_0031692_3929_4753 274
1124 3300047320 Ga0495672_0001060 Ga0495672_0001060_7516_8340 274
1125 3300047320 Ga0495672_0004788 Ga0495672_0004788_1408_2232 274
1126 3300047320 Ga0495672_0005424 Ga0495672_0005424_6056_6880 274
1127 3300047320 Ga0495672_0006117 Ga0495672_0006117_1248_2072 274
1128 3300047320 Ga0495672_0011166 Ga0495672_0011166_610_1434 274
1129 3300047320 Ga0495672_0014674 Ga0495672_0014674_565_1389 274
1130 3300047320 Ga0495672_0032361 Ga0495672_0032361_1785_2645 274
1131 3300047320 Ga0495672_0056830 Ga0495672_0056830_197_1021 274
1132 3300047320 Ga0495672_0061392 Ga0495672_0061392_1272_2096 274
1133 3300047320 Ga0495672_0067145 Ga0495672_0067145_1193_2017 274
1134 3300047320 Ga0495672_0075573 Ga0495672_0075573_667_1491 274
1135 3300047320 Ga0495672_0093138 Ga0495672_0093138_671_1495 274
1136 3300047320 Ga0495672_0115516 Ga0495672_0115516_515_1339 274
1137 3300047320 Ga0495672_0160490 Ga0495672_0160490_159_983 274
1138 3300047321 Ga0495676_0000010 Ga0495676_0000010_121076_121900 274
1139 3300047321 Ga0495676_0014681 Ga0495676_0014681_4785_5609 274
1140 3300047321 Ga0495676_0021598 Ga0495676_0021598_3550_4374 274
1141 3300047322 Ga0495680_0011083 Ga0495680_0011083_3394_4218 274
1142 3300047322 Ga0495680_0015555 Ga0495680_0015555_3300_4124 274
1143 3300047322 Ga0495680_0037942 Ga0495680_0037942_2323_3147 274
1144 3300047322 Ga0495680_0096827 Ga0495680_0096827_869_1693 274
1145 3300047322 Ga0495680_0107704 Ga0495680_0107704_931_1755 274
1146 3300047323 Ga0495683_0000143 Ga0495683_0000143_63337_64161 274
1147 3300047323 Ga0495683_0003409 Ga0495683_0003409_1323_2147 274
1148 3300047323 Ga0495683_0006649 Ga0495683_0006649_4664_5488 274
1149 3300047323 Ga0495683_0012676 Ga0495683_0012676_1085_1909 274
1150 3300047323 Ga0495683_0013624 Ga0495683_0013624_3351_4175 274
1151 3300047323 Ga0495683_0013809 Ga0495683_0013809_660_1484 274
1152 3300047323 Ga0495683_0014896 Ga0495683_0014896_663_1487 274
1153 3300047323 Ga0495683_0020566 Ga0495683_0020566_1119_1943 274
1154 3300047323 Ga0495683_0028915 Ga0495683_0028915_870_1694 274
1155 3300047323 Ga0495683_0045308 Ga0495683_0045308_744_1568 274
1156 3300047443 Ga0495687_006004 Ga0495687_006004_5506_6330 274
1157 3300047443 Ga0495687_007767 Ga0495687_007767_1206_2030 274
1158 3300047443 Ga0495687_009035 Ga0495687_009035_3658_4482 274
1159 3300047444 Ga0495675_0016652 Ga0495675_0016652_2524_3348 274
1160 3300047445 Ga0495677_0007791 Ga0495677_0007791_2401_3225 274
1161 3300047446 Ga0495679_001850 Ga0495679_001850_7115_7939 274
1162 3300047446 Ga0495679_004526 Ga0495679_004526_5497_6321 274
1163 3300047446 Ga0495679_005773 Ga0495679_005773_3340_4164 274
1164 3300047446 Ga0495679_008982 Ga0495679_008982_2596_3420 274
1165 3300047447 Ga0495685_073188 Ga0495685_073188_263_1087 274
1166 3300047469 Ga0495673_0003351 Ga0495673_0003351_3917_4741 274
1167 3300047469 Ga0495673_0008236 Ga0495673_0008236_1059_1883 274
1168 3300047469 Ga0495673_0009836 Ga0495673_0009836_2888_3712 274
1169 3300047469 Ga0495673_0010205 Ga0495673_0010205_2128_2952 274
1170 3300047469 Ga0495673_0017981 Ga0495673_0017981_278_1102 274
1171 3300047469 Ga0495673_0019394 Ga0495673_0019394_1538_2362 274
1172 3300047469 Ga0495673_0024676 Ga0495673_0024676_1022_1846 274
1173 3300047469 Ga0495673_0024944 Ga0495673_0024944_1036_1860 274
1174 3300047469 Ga0495673_0030103 Ga0495673_0030103_770_1594 274
1175 3300047469 Ga0495673_0031389 Ga0495673_0031389_617_1459 274
1176 3300047469 Ga0495673_0035720 Ga0495673_0035720_716_1540 274
1177 3300047469 Ga0495673_0037075 Ga0495673_0037075_988_1812 274
1178 3300047469 Ga0495673_0039551 Ga0495673_0039551_1081_1905 274
1179 3300047470 Ga0495681_0000861 Ga0495681_0000861_10316_11140 274
1180 3300047470 Ga0495681_0002919 Ga0495681_0002919_6924_7748 274
1181 3300047470 Ga0495681_0005938 Ga0495681_0005938_5834_6658 274
1182 3300047470 Ga0495681_0006630 Ga0495681_0006630_487_1311 274
1183 3300047470 Ga0495681_0006703 Ga0495681_0006703_5372_6196 274
1184 3300047470 Ga0495681_0008196 Ga0495681_0008196_3725_4549 274
1185 3300047470 Ga0495681_0008907 Ga0495681_0008907_3718_4542 274
1186 3300047470 Ga0495681_0009296 Ga0495681_0009296_3804_4628 274
1187 3300047470 Ga0495681_0010116 Ga0495681_0010116_981_1805 274
1188 3300047470 Ga0495681_0010120 Ga0495681_0010120_4107_4931 274
1189 3300047470 Ga0495681_0011064 Ga0495681_0011064_1626_2450 274
1190 3300047470 Ga0495681_0033189 Ga0495681_0033189_1340_2164 274
1191 3300047470 Ga0495681_0034240 Ga0495681_0034240_1131_1955 274
1192 3300047470 Ga0495681_0060548 Ga0495681_0060548_586_1410 274
1193 3300047471 Ga0495684_0032355 Ga0495684_0032355_1321_2145 274
1194 3300047471 Ga0495684_0163297 Ga0495684_0163297_429_1253 274
1195 3300047472 Ga0495686_0010370 Ga0495686_0010370_4490_5314 274
1196 3300047472 Ga0495686_0013557 Ga0495686_0013557_3824_4648 274
1197 3300047472 Ga0495686_0024725 Ga0495686_0024725_2124_2948 274
1198 3300047472 Ga0495686_0113876 Ga0495686_0113876_326_1168 274
1199 3300047673 Ga0495593_0004910 Ga0495593_0004910_1080_1904 274
1200 3300047673 Ga0495593_0008641 Ga0495593_0008641_1416_2240 274
1201 3300047673 Ga0495593_0051560 Ga0495593_0051560_714_1541 274
1202 3300047673 Ga0495593_0057478 Ga0495593_0057478_610_1434 274
1203 3300047673 Ga0495593_0066330 Ga0495593_0066330_126_950 274
1204 3300047673 Ga0495593_0109278 Ga0495593_0109278_406_1230 274
1205 3300048088 Ga0495602_0008936 Ga0495602_0008936_1325_2149 274
1206 3300048088 Ga0495602_0051776 Ga0495602_0051776_717_1541 274
1207 3300048089 Ga0495614_0021569 Ga0495614_0021569_1917_2741 274
1208 3300048091 Ga0495626_0001733 Ga0495626_0001733_12183_13007 274
1209 3300048091 Ga0495626_0002863 Ga0495626_0002863_3466_4290 274
1210 3300048091 Ga0495626_0003488 Ga0495626_0003488_6305_7129 274
1211 3300048091 Ga0495626_0004703 Ga0495626_0004703_2548_3372 274
1212 3300048091 Ga0495626_0005693 Ga0495626_0005693_5988_6812 274
1213 3300048091 Ga0495626_0007892 Ga0495626_0007892_146_970 274
1214 3300048091 Ga0495626_0008253 Ga0495626_0008253_1141_1965 274
1215 3300048091 Ga0495626_0009395 Ga0495626_0009395_661_1485 274
1216 3300048091 Ga0495626_0011390 Ga0495626_0011390_3790_4614 274
1217 3300048091 Ga0495626_0012166 Ga0495626_0012166_3381_4205 274
1218 3300048091 Ga0495626_0013746 Ga0495626_0013746_300_1124 274
1219 3300048905 Ga0496102_0008477 Ga0496102_0008477_3738_4562 274
1220 3300048905 Ga0496102_0143630 Ga0496102_0143630_1115_1939 274
1221 3300048906 Ga0496103_0005662 Ga0496103_0005662_3685_4509 274
1222 3300048910 Ga0496107_0257371 Ga0496107_0257371_306_1130 274
1223 3300048914 Ga0496111_0190360 Ga0496111_0190360_132_959 274
1224 3300048914 Ga0496111_0233776 Ga0496111_0233776_443_1267 274
1225 3300048915 Ga0496112_0665381 Ga0496112_0665381_28_852 274
1226 3300048917 Ga0496114_0166342 Ga0496114_0166342_1015_1839 274
1227 3300048919 Ga0496116_0001228 Ga0496116_0001228_1569_2411 274
1228 3300048919 Ga0496116_0001880 Ga0496116_0001880_18069_18893 274
1229 3300048919 Ga0496116_0007468 Ga0496116_0007468_6879_7703 274
1230 3300048919 Ga0496116_0009269 Ga0496116_0009269_3808_4632 274
1231 3300048920 Ga0496117_0001993 Ga0496117_0001993_4678_5502 274
1232 3300048920 Ga0496117_0008688 Ga0496117_0008688_6900_7724 274
1233 3300048920 Ga0496117_0013478 Ga0496117_0013478_2250_3074 274
1234 3300048920 Ga0496117_0015634 Ga0496117_0015634_2254_3078 274
1235 3300048920 Ga0496117_0031815 Ga0496117_0031815_1108_1932 274
1236 3300048920 Ga0496117_0043937 Ga0496117_0043937_602_1426 274
1237 3300048920 Ga0496117_0058947 Ga0496117_0058947_648_1490 274
1238 3300048920 Ga0496117_0084626 Ga0496117_0084626_567_1391 274
1239 3300048921 Ga0496118_0009447 Ga0496118_0009447_5647_6471 274
1240 3300048921 Ga0496118_0009855 Ga0496118_0009855_1842_2666 274
1241 3300048921 Ga0496118_0011751 Ga0496118_0011751_3687_4511 274
1242 3300048921 Ga0496118_0012170 Ga0496118_0012170_5447_6271 274
1243 3300048921 Ga0496118_0026639 Ga0496118_0026639_646_1470 274
1244 3300048921 Ga0496118_0047707 Ga0496118_0047707_639_1481 274
1245 3300048921 Ga0496118_0077685 Ga0496118_0077685_943_1767 274
1246 3300048922 Ga0496119_0027387 Ga0496119_0027387_454_1278 274
1247 3300048923 Ga0496120_0126077 Ga0496120_0126077_234_1058 274
1248 3300048924 Ga0496121_0011771 Ga0496121_0011771_2563_3387 274
1249 3300048924 Ga0496121_0030643 Ga0496121_0030643_319_1143 274
1250 3300048924 Ga0496121_0042060 Ga0496121_0042060_74_898 274
1251 3300048924 Ga0496121_0162171 Ga0496121_0162171_450_1292 274
1252 3300048925 Ga0496122_0010905 Ga0496122_0010905_1837_2661 274
1253 3300048925 Ga0496122_0022550 Ga0496122_0022550_3656_4480 274
1254 3300048925 Ga0496122_0075770 Ga0496122_0075770_172_996 274
1255 3300048926 Ga0496123_0008064 Ga0496123_0008064_6903_7727 274
1256 3300048927 Ga0496124_0002186 Ga0496124_0002186_19707_20531 274
1257 3300048927 Ga0496124_0006413 Ga0496124_0006413_2112_2936 274
1258 3300048927 Ga0496124_0028268 Ga0496124_0028268_3852_4676 274
1259 3300048927 Ga0496124_0048378 Ga0496124_0048378_2252_3076 274
1260 3300048927 Ga0496124_0070655 Ga0496124_0070655_1093_1917 274
1261 3300048927 Ga0496124_0245703 Ga0496124_0245703_449_1273 274
1262 3300048927 Ga0496124_0307122 Ga0496124_0307122_67_891 274
1263 3300048928 Ga0496125_0000240 Ga0496125_0000240_1935_2759 274
1264 3300048928 Ga0496125_0022844 Ga0496125_0022844_4363_5187 274
1265 3300048928 Ga0496125_0032190 Ga0496125_0032190_3201_4025 274
1266 3300048928 Ga0496125_0072155 Ga0496125_0072155_1838_2662 274
1267 3300048928 Ga0496125_0118192 Ga0496125_0118192_71_895 274
1268 3300048929 Ga0496126_0021244 Ga0496126_0021244_5243_6067 274
1269 3300048929 Ga0496126_0049250 Ga0496126_0049250_2972_3796 274
1270 3300049459 Ga0495678_002869 Ga0495678_002869_6897_7721 274
1271 3300049459 Ga0495678_003063 Ga0495678_003063_8258_9082 274
1272 3300049459 Ga0495678_004559 Ga0495678_004559_3725_4549 274
1273 3300049459 Ga0495678_006906 Ga0495678_006906_4140_4964 274
1274 3300049459 Ga0495678_006980 Ga0495678_006980_2588_3412 274
1275 3300049459 Ga0495678_007741 Ga0495678_007741_619_1443 274
1276 3300049459 Ga0495678_008437 Ga0495678_008437_3523_4368 274
1277 3300049459 Ga0495678_009161 Ga0495678_009161_846_1688 274
1278 3300049459 Ga0495678_015269 Ga0495678_015269_2617_3441 274
1279 3300049459 Ga0495678_017260 Ga0495678_017260_1321_2145 274
1280 3300049459 Ga0495678_029010 Ga0495678_029010_618_1442 274
1281 3300049459 Ga0495678_032689 Ga0495678_032689_259_1083 274
1282 3300049459 Ga0495678_034590 Ga0495678_034590_613_1437 274
1283 3300049459 Ga0495678_036206 Ga0495678_036206_197_1021 274
1284 3300049459 Ga0495678_053513 Ga0495678_053513_218_1042 274
1285 3300049459 Ga0495678_056762 Ga0495678_056762_251_1075 274
1286 3300049460 Ga0495682_0004418 Ga0495682_0004418_3884_4708 274
1287 3300049460 Ga0495682_0006158 Ga0495682_0006158_305_1129 274
1288 3300049460 Ga0495682_0007521 Ga0495682_0007521_305_1129 274
1289 3300049460 Ga0495682_0015654 Ga0495682_0015654_936_1760 274
1290 3300049460 Ga0495682_0136311 Ga0495682_0136311_35_859 274
1291 3300049571 Ga0501034_0101175 Ga0501034_0101175_987_1817 274
1292 3300049682 Ga0501252_001014 Ga0501252_001014_1548_2372 274
1293 3300049758 Ga0501241_000760 Ga0501241_000760_2318_3142 274
1294 3300049853 Ga0501226_000005 Ga0501226_000005_71120_71953 274
1295 3300050491 nmdc:mga00v17_367255_c1 nmdc:mga00v17_367255_c1_44_868 274
1296 3300050516 nmdc:mga0sz30_15786_c1 nmdc:mga0sz30_15786_c1_778_1602 274
1297 3300053111 Ga0500572_001338 Ga0500572_001338_645_1469 274
1298 3300053142 Ga0500577_0059412 Ga0500577_0059412_570_1394 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

2

189

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

8

211

0.91

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

4

193

0.9

PF08659

KR

KR domain

3

176

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xtg-assembly1.cif.gz_B crystal structure of the cis-dihydrodiol naphthalene dehydrogenase nahb from pseudomonas sp. mc1 in the presence of nad+ and 2,3-dihydroxybiphenyl 0.9308 1 179
4trr-assembly2.cif.gz_G crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 0.9283 2 176
5xtf-assembly1.cif.gz_B crystal structure of the cis-dihydrodiol naphthalene dehydrogenase nahb from pseudomonas sp. mc1 0.9268 1 176
1hxh-assembly1.cif.gz_D comamonas testosteroni 3beta/17beta hydroxysteroid dehydrogenase 0.9255 2 176
7e6o-assembly1.cif.gz_A crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.919 2 177
ID Description Score Start End Superfamily
af_Q54HS2_3_244_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9548 2 237 3.40.50.720
af_B4FAP3_11_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9419 1 248 3.40.50.720
af_A0A0P0WB25_64_301_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.937 25 248 3.40.50.720
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9283 2 176 3.40.50.720
af_Q54HS2_3_244_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9282 2 237 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2R7T559-F1-model_v4 deleted 0.9943 1 232
AF-A0A6I1W6Z6-F1-model_v4 deleted 0.9905 1 272
AF-A0A7Y1QJZ9-F1-model_v4 SDR family oxidoreductase 0.9903 1 274 GO:0016491
AF-A0A2R7T559-F1-model_v4 deleted 0.9901 1 232
AF-A0A0Q0DEI9-F1-model_v4 Short chain dehydrogenase 0.99 1 274 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.11 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map