F492383

General Info

Members Datasets Scaffolds Average Seq Length
1269 453 1083 215

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1000055|Ga0055536_100005563
Length 236
Sequence MPYLSLSPVRATGRRSIAGAEVLRPILQKPTRRQASGPAPIVLAEVLDDEVNLALWRRQLPAHIVDFGALLLSLNEPLAESLSLELDTEETEPNLRGLASGFSDLQGYDGFIADVAWLVSAFSCLLGAKRVGLRLRVLDKAMCPRFHVDHVPVRLITTYAGVGSQWLREGAMDRRQLGQAEAEPTDAALIQQIASGEVALFKGEKWLGNEGFGLIHRSPQPAPGERRLILTLDWLG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231006 Pseudomonas sp. GM17 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231008 Pseudomonas sp. GM21 Isolate Nodule
8 2511231010 Pseudomonas sp. GM25 Isolate Nodule
9 2511231011 Pseudomonas sp. GM30 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231018 Pseudomonas sp. GM60 Isolate Nodule
12 2511231019 Pseudomonas sp. GM67 Isolate Nodule
13 2511231022 Pseudomonas sp. GM79 Isolate Nodule
14 2511231023 Pseudomonas sp. GM80 Isolate Nodule
15 2511231031 Pseudomonas sp. GM16 Isolate Nodule
16 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
17 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
18 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
19 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
20 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
21 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
22 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
23 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
24 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
25 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
26 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
27 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
28 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
29 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
30 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
31 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
32 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
33 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
34 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
35 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
36 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
37 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
38 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
39 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
40 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
41 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
42 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
43 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
44 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
45 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
46 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
47 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
48 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
49 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
50 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
51 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
52 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
53 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
54 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
55 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
56 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
57 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
58 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
59 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
60 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
61 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
62 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
63 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
64 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
65 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
66 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
67 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
68 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
69 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
70 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
71 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
72 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
73 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
74 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
75 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
76 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
77 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
78 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
79 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
80 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
81 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
82 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
83 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
84 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
85 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
86 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
87 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
88 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
89 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
90 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
91 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
92 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
93 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
94 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
95 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
96 2773857670 Pseudomonas sp. 478 Isolate Unclassified
97 2773857673 Pseudomonas sp. 443 Isolate Unclassified
98 2784132063 Pseudomonas sp. 424 Isolate Unclassified
99 2784132072 Pseudomonas sp. 460 Isolate Unclassified
100 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
101 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
102 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
103 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
104 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
105 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
106 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
107 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
108 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
109 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
110 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
111 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
112 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
113 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
114 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
115 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
116 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
117 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
118 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
119 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
120 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
121 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
122 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
123 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
124 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
125 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
126 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
127 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
128 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
129 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
130 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
131 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
132 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
133 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
134 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
135 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
136 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
137 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
138 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
139 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
140 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
141 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
142 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
143 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
144 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
145 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
146 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
147 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
148 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
149 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
150 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
151 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
152 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
153 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
154 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
155 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
156 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
157 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
158 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
159 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
160 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
161 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
162 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
163 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
164 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
165 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
166 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
167 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
168 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
169 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
170 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
171 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
172 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
173 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
174 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
175 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
176 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
177 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
178 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
179 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
180 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
181 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
182 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
183 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
184 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
185 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
186 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
187 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
188 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
189 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
190 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
191 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
192 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
193 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
194 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
195 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
196 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
197 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
198 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
199 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
200 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
201 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
202 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
203 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
204 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
205 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
206 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
207 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
208 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
209 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
210 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
211 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
212 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
213 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
214 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
215 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
216 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
217 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
218 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
219 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
220 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
221 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
222 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
223 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
224 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
225 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
226 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
227 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
233 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
234 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
236 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
238 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
239 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
260 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
262 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
263 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
265 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
266 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
267 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
268 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
269 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
270 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
271 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
272 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
273 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
274 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
275 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
276 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
277 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
278 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
279 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
280 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
281 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
282 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
283 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
284 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
285 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
286 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
287 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
288 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
289 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
290 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
291 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
292 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
293 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
294 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
295 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
296 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
297 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
298 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
299 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
300 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
301 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
302 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
303 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
304 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
305 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
306 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
307 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
308 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
309 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
310 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
311 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
312 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
313 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
314 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
315 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
316 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
317 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
318 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
319 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
320 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
321 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
322 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
323 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
324 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
325 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
326 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
329 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
330 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
331 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
332 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
333 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
334 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
335 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
336 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
337 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
340 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
341 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
342 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
343 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
344 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
345 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
346 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
347 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
348 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
349 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
350 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
351 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
352 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
353 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
354 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
355 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
356 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
357 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
358 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
359 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
360 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
361 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
362 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
363 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
364 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
365 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
366 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
367 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
368 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
369 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
370 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
371 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
372 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
373 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
374 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
375 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
376 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
377 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
378 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
379 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
380 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
383 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
384 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
385 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
386 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
387 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
388 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
389 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
390 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
391 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
392 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
393 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
394 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
395 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
396 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
397 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
398 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
399 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
400 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
401 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
402 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
403 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
404 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
405 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
406 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
407 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
408 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
409 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
410 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
411 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
412 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
413 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
414 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
415 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
416 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
417 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
418 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
419 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
420 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
421 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
422 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
423 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
424 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
425 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
426 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
427 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
428 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
429 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
430 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
431 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
432 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
433 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
434 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
435 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
436 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
437 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
438 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
439 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
440 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
441 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
442 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
443 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
444 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
445 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
446 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
447 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
448 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
449 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
450 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
451 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
452 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
453 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.34
Metatranscriptomes 0
Isolates 14.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.65
Nodule 1.5
Rhizoplane 4.81
Rhizosphere 78.01
Stem 0
Stem Tuber 0
Unclassified 11.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_81 2124908027 Bacteria 34847
2 SwRhRL2b_contig_3770479 2162886007 Bacteria 8179
3 MRS1b_contig_3441221 2162886011 Bacteria 2161
4 JGI25162J39368_1000133 3300002737 Bacteria 80489
5 JGI25154J39366_1006527 3300002738 Bacteria 1695
6 JGI25163J39215_1000028 3300002771 Bacteria 67700
7 JGI25163J39215_1000084 3300002771 Bacteria 40929
8 JGI25164J39214_1000107 3300002772 Bacteria 80489
9 JGI25164J39214_1000158 3300002772 Bacteria 64303
10 JGI25165J46597_1000218 3300003214 Bacteria 80489
11 JGI25165J46597_1000285 3300003214 Bacteria 64303
12 Ga0055538_1000012 3300003751 Bacteria 353826
13 Ga0055539_1000017 3300003752 Bacteria 353873
14 Ga0055533_1000021 3300003756 Bacteria 353826
15 Ga0055532_1000020 3300003758 Bacteria 270853
16 Ga0055525_1000078 3300003759 Bacteria 165788
17 Ga0055535_1003673 3300003761 Bacteria 4164
18 Ga0055536_1000055 3300003781 Bacteria 107659
19 Ga0055530_10000068 3300003791 Bacteria 92189
20 Ga0055530_10000077 3300003791 Bacteria 84280
21 Ga0055530_10006761 3300003791 Bacteria 5006
22 Ga0055540_1000106 3300003792 Bacteria 92189
23 Ga0055540_1000172 3300003792 Bacteria 64142
24 Ga0055540_1001024 3300003792 Bacteria 17948
25 Ga0055531_10001516 3300003794 Bacteria 17041
26 Ga0055541_1000012 3300003841 Bacteria 353826
27 Ga0065714_10000020 3300005288 Bacteria 22449
28 Ga0065714_10068147 3300005288 Bacteria 4931
29 Ga0065714_10138342 3300005288 Bacteria 1183
30 Ga0065714_10145382 3300005288 Bacteria 1142
31 Ga0065714_10150928 3300005288 Bacteria 1107
32 Ga0065714_10182287 3300005288 Bacteria 958
33 Ga0065704_10070235 3300005289 Bacteria 53570
34 Ga0065704_10100876 3300005289 Bacteria 2257
35 Ga0065704_10235992 3300005289 Bacteria 1029
36 Ga0065712_10067828 3300005290 Bacteria 27663
37 Ga0065712_10068961 3300005290 Bacteria 8455
38 Ga0065715_10008757 3300005293 Bacteria 3150
39 Ga0070670_100000141 3300005331 Bacteria 67499
40 Ga0070670_100000748 3300005331 Bacteria 25229
41 Ga0070682_100554252 3300005337 Bacteria 900
42 Ga0070661_100000080 3300005344 Bacteria 77046
43 Ga0070661_100086472 3300005344 Bacteria 2318
44 Ga0070669_100000330 3300005353 Bacteria 36959
45 Ga0070669_100001122 3300005353 Bacteria 19559
46 Ga0070662_100000917 3300005457 Bacteria 18030
47 Ga0068853_100001428 3300005539 Bacteria 17247
48 Ga0070665_100001733 3300005548 Bacteria 24953
49 Ga0070665_100181318 3300005548 Bacteria 2106
50 Ga0070665_100251748 3300005548 Bacteria 1767
51 Ga0070664_100000141 3300005564 Bacteria 49093
52 Ga0070664_100161781 3300005564 Bacteria 1981
53 Ga0068854_100018164 3300005578 Bacteria 4717
54 Ga0068851_10000039 3300005834 Bacteria 93193
55 Ga0075364_10009758 3300006051 Bacteria 5771
56 Ga0075364_10046997 3300006051 Bacteria 2810
57 Ga0075364_10091942 3300006051 Bacteria 2014
58 Ga0075432_10000027 3300006058 Bacteria 26985
59 Ga0075432_10001301 3300006058 Bacteria 8059
60 Ga0075432_10076856 3300006058 Bacteria 1206
61 Ga0079104_1000189 3300006946 Bacteria 86039
62 Ga0079104_1002635 3300006946 Bacteria 9356
63 Ga0099826_10095186 3300006948 Bacteria 1811
64 Ga0105251_10000414 3300009011 Bacteria 41506
65 Ga0105251_10000960 3300009011 Bacteria 25661
66 Ga0105251_10002862 3300009011 Bacteria 13026
67 Ga0105251_10003327 3300009011 Bacteria 11737
68 Ga0105251_10005014 3300009011 Bacteria 8797
69 Ga0105251_10014761 3300009011 Bacteria 4301
70 Ga0105251_10164163 3300009011 Bacteria 1001
71 Ga0105244_10000073 3300009036 Bacteria 115279
72 Ga0105244_10003009 3300009036 Bacteria 12362
73 Ga0105244_10003428 3300009036 Bacteria 11304
74 Ga0105244_10008803 3300009036 Bacteria 6268
75 Ga0105244_10011922 3300009036 Bacteria 5174
76 Ga0105244_10015923 3300009036 Bacteria 4300
77 Ga0105244_10049961 3300009036 Bacteria 2135
78 Ga0105244_10091429 3300009036 Bacteria 1496
79 Ga0105244_10128002 3300009036 Bacteria 1226
80 Ga0105250_10000247 3300009092 Bacteria 44888
81 Ga0105250_10000807 3300009092 Bacteria 18826
82 Ga0105250_10003459 3300009092 Bacteria 7476
83 Ga0105250_10016850 3300009092 Bacteria 2974
84 Ga0105250_10019024 3300009092 Bacteria 2778
85 Ga0105250_10025149 3300009092 Bacteria 2400
86 Ga0105250_10091580 3300009092 Bacteria 1237
87 Ga0105250_10110819 3300009092 Bacteria 1124
88 Ga0105243_10000132 3300009148 Bacteria 85455
89 Ga0105243_10000342 3300009148 Bacteria 50696
90 Ga0105243_10000561 3300009148 Bacteria 37573
91 Ga0105243_10012666 3300009148 Bacteria 6372
92 Ga0105242_10000617 3300009176 Bacteria 27878
93 Ga0105242_10252539 3300009176 Bacteria 1590
94 Ga0105248_10002467 3300009177 Bacteria 20555
95 Ga0105237_10000629 3300009545 Bacteria 49282
96 Ga0105237_10026023 3300009545 Bacteria 5980
97 Ga0105249_10027536 3300009553 Bacteria 5128
98 Ga0105246_10000026 3300011119 Bacteria 54296
99 Ga0105246_10000129 3300011119 Bacteria 35026
100 Ga0105246_10000841 3300011119 Bacteria 17531
101 Ga0105246_10086710 3300011119 Bacteria 2245
102 Ga0105246_10279950 3300011119 Bacteria 1337
103 Ga0157345_1000008 3300012498 Bacteria 56707
104 Ga0157373_10001130 3300013100 Bacteria 20510
105 Ga0157373_10003730 3300013100 Bacteria 11528
106 Ga0157373_10010758 3300013100 Bacteria 6733
107 Ga0157373_10011089 3300013100 Bacteria 6633
108 Ga0157373_10012306 3300013100 Bacteria 6292
109 Ga0157373_10063532 3300013100 Bacteria 2614
110 Ga0157373_10637309 3300013100 Bacteria 778
111 Ga0157371_10000432 3300013102 Bacteria 51445
112 Ga0157371_10001568 3300013102 Bacteria 23483
113 Ga0157371_10001601 3300013102 Bacteria 23216
114 Ga0157370_10018090 3300013104 Bacteria 7094
115 Ga0157370_10024282 3300013104 Bacteria 6005
116 Ga0157370_10035090 3300013104 Bacteria 4878
117 Ga0157370_10045556 3300013104 Bacteria 4207
118 Ga0157369_10000523 3300013105 Bacteria 50640
119 Ga0157369_10017073 3300013105 Bacteria 8155
120 Ga0157369_10030469 3300013105 Bacteria 5949
121 Ga0157369_10111701 3300013105 Bacteria 2904
122 Ga0157369_10176134 3300013105 Bacteria 2252
123 Ga0157369_10369733 3300013105 Bacteria 1488
124 Ga0157369_11471429 3300013105 Bacteria 693
125 Ga0163162_10000334 3300013306 Bacteria 43059
126 Ga0163162_10019136 3300013306 Bacteria 6715
127 Ga0163162_10162508 3300013306 Bacteria 2355
128 Ga0163162_10172187 3300013306 Bacteria 2290
129 Ga0163162_10228898 3300013306 Bacteria 1989
130 Ga0163162_10385240 3300013306 Bacteria 1535
131 Ga0163162_10844253 3300013306 Bacteria 1031
132 Ga0157372_10020265 3300013307 Bacteria 7172
133 Ga0157375_10001428 3300013308 Bacteria 20545
134 Ga0157375_10018769 3300013308 Bacteria 6276
135 Ga0157375_10052073 3300013308 Bacteria 4023
136 Ga0157375_10194957 3300013308 Bacteria 2181
137 Ga0182008_10000581 3300014497 Bacteria 26916
138 Ga0182008_10000618 3300014497 Bacteria 26104
139 Ga0182008_10005325 3300014497 Bacteria 7349
140 Ga0182008_10010596 3300014497 Bacteria 4930
141 Ga0182008_10011352 3300014497 Bacteria 4742
142 Ga0182008_10022202 3300014497 Bacteria 3251
143 Ga0182008_10059920 3300014497 Bacteria 1877
144 Ga0182008_10175315 3300014497 Bacteria 1084
145 Ga0182008_10228860 3300014497 Bacteria 953
146 Ga0182006_1000737 3300015261 Bacteria 22518
147 Ga0182006_1002286 3300015261 Bacteria 10586
148 Ga0182006_1003288 3300015261 Bacteria 8353
149 Ga0182006_1008753 3300015261 Bacteria 4578
150 Ga0182006_1011657 3300015261 Bacteria 3863
151 Ga0182006_1018967 3300015261 Bacteria 2900
152 Ga0182006_1057293 3300015261 Bacteria 1482
153 Ga0182006_1064489 3300015261 Bacteria 1373
154 Ga0182006_1101986 3300015261 Bacteria 1017
155 Ga0182007_10000178 3300015262 Bacteria 43223
156 Ga0182007_10004334 3300015262 Bacteria 6455
157 Ga0182007_10026193 3300015262 Bacteria 2024
158 Ga0182007_10049757 3300015262 Bacteria 1384
159 Ga0182007_10059639 3300015262 Bacteria 1251
160 Ga0182005_1000274 3300015265 Bacteria 32736
161 Ga0182005_1002162 3300015265 Bacteria 7260
162 Ga0182005_1037813 3300015265 Bacteria 1313
163 Ga0182005_1044005 3300015265 Bacteria 1214
164 Ga0182005_1047872 3300015265 Bacteria 1162
165 Ga0182005_1054127 3300015265 Bacteria 1093
166 Ga0163161_10002740 3300017792 Bacteria 12535
167 Ga0163161_10003104 3300017792 Bacteria 11719
168 Ga0163161_10007411 3300017792 Bacteria 7580
169 Ga0163161_10018157 3300017792 Bacteria 4931
170 Ga0163161_10032479 3300017792 Bacteria 3727
171 Ga0163161_10062047 3300017792 Bacteria 2722
172 Ga0163161_10125525 3300017792 Bacteria 1932
173 Ga0163161_10126850 3300017792 Bacteria 1922
174 Ga0163161_10276742 3300017792 Bacteria 1315
175 Ga0209435_100725 3300025206 Bacteria 5512
176 Ga0209760_100020 3300025207 Bacteria 169879
177 Ga0209760_100118 3300025207 Bacteria 54487
178 Ga0209784_100007 3300025224 Bacteria 747715
179 Ga0209566_100009 3300025225 Bacteria 554018
180 Ga0209674_100021 3300025226 Bacteria 629811
181 Ga0209147_100009 3300025229 Bacteria 747409
182 Ga0209563_100018 3300025230 Bacteria 747850
183 Ga0209563_100264 3300025230 Bacteria 23048
184 Ga0207427_100005 3300025231 Bacteria 797999
185 Ga0207427_100006 3300025231 Bacteria 785415
186 Ga0209437_100013 3300025233 Bacteria 785457
187 Ga0209437_100018 3300025233 Bacteria 694400
188 Ga0209258_100943 3300025242 Bacteria 14084
189 Ga0209646_1000533 3300025246 Bacteria 16647
190 Ga0209677_100012 3300025253 Bacteria 554018
191 Ga0209759_1028915 3300025256 Bacteria 1120
192 Ga0209233_1000021 3300025261 Bacteria 798078
193 Ga0209233_1000022 3300025261 Bacteria 785415
194 Ga0209676_1000015 3300025292 Bacteria 784458
195 Ga0209676_1000271 3300025292 Bacteria 108269
196 Ga0209676_1000278 3300025292 Bacteria 106516
197 Ga0209676_1001196 3300025292 Bacteria 27824
198 Ga0209050_1000030 3300025298 Bacteria 463381
199 Ga0209050_1000061 3300025298 Bacteria 321435
200 Ga0209050_1000241 3300025298 Bacteria 118446
201 Ga0209051_1000012 3300025303 Bacteria 595474
202 Ga0209051_1000203 3300025303 Bacteria 105272
203 Ga0209051_1000222 3300025303 Bacteria 95911
204 Ga0209257_1000143 3300025304 Bacteria 199975
205 Ga0209257_1033798 3300025304 Bacteria 1603
206 Ga0207656_10000009 3300025321 Bacteria 245637
207 Ga0207696_1000080 3300025711 Bacteria 199217
208 Ga0207696_1000180 3300025711 Bacteria 98909
209 Ga0207696_1000184 3300025711 Bacteria 97606
210 Ga0207696_1001250 3300025711 Bacteria 14282
211 Ga0207696_1014101 3300025711 Bacteria 2753
212 Ga0207696_1016871 3300025711 Bacteria 2432
213 Ga0207696_1023768 3300025711 Bacteria 1928
214 Ga0207696_1097105 3300025711 Bacteria 805
215 Ga0207655_1000033 3300025728 Bacteria 377066
216 Ga0207655_1000116 3300025728 Bacteria 161950
217 Ga0207655_1000261 3300025728 Bacteria 83123
218 Ga0207655_1000534 3300025728 Bacteria 48119
219 Ga0207655_1001534 3300025728 Bacteria 20925
220 Ga0207655_1002071 3300025728 Bacteria 16831
221 Ga0207655_1002298 3300025728 Bacteria 15716
222 Ga0207655_1002669 3300025728 Bacteria 14037
223 Ga0207655_1002801 3300025728 Bacteria 13530
224 Ga0207655_1003576 3300025728 Bacteria 11501
225 Ga0207655_1016165 3300025728 Bacteria 4099
226 Ga0207655_1050013 3300025728 Bacteria 1702
227 Ga0207655_1123287 3300025728 Bacteria 855
228 Ga0207713_1000312 3300025735 Bacteria 55508
229 Ga0207713_1000341 3300025735 Bacteria 51478
230 Ga0207713_1000588 3300025735 Bacteria 35973
231 Ga0207713_1001784 3300025735 Bacteria 16467
232 Ga0207713_1004620 3300025735 Bacteria 8895
233 Ga0207713_1005288 3300025735 Bacteria 8119
234 Ga0207713_1008338 3300025735 Bacteria 5981
235 Ga0207713_1009466 3300025735 Bacteria 5486
236 Ga0207713_1013386 3300025735 Bacteria 4327
237 Ga0207713_1033361 3300025735 Bacteria 2250
238 Ga0207713_1040661 3300025735 Bacteria 1949
239 Ga0207671_10000027 3300025914 Bacteria 264907
240 Ga0207649_10000007 3300025920 Bacteria 334217
241 Ga0207649_10044903 3300025920 Bacteria 2707
242 Ga0207681_10000104 3300025923 Bacteria 72277
243 Ga0207681_10004136 3300025923 Bacteria 8999
244 Ga0207650_10000044 3300025925 Bacteria 183146
245 Ga0207650_10000089 3300025925 Bacteria 120962
246 Ga0207687_10323909 3300025927 Bacteria 1248
247 Ga0207706_10000483 3300025933 Bacteria 42600
248 Ga0207706_10012015 3300025933 Bacteria 7889
249 Ga0207686_10000349 3300025934 Bacteria 32873
250 Ga0207709_10000061 3300025935 Bacteria 199097
251 Ga0207709_10000063 3300025935 Bacteria 191397
252 Ga0207709_10006853 3300025935 Bacteria 6378
253 Ga0207711_10097159 3300025941 Bacteria 2600
254 Ga0207679_10000013 3300025945 Bacteria 334197
255 Ga0207712_10054124 3300025961 Bacteria 2817
256 Ga0207639_10000091 3300026041 Bacteria 76122
257 Ga0209281_1000091 3300027111 Bacteria 242588
258 Ga0209281_1002611 3300027111 Bacteria 6938
259 Ga0209371_1001083 3300027312 Bacteria 20355
260 Ga0209282_1076432 3300027666 Bacteria 1803
261 Ga0207428_10274729 3300027907 Bacteria 1252
262 Ga0268266_10001589 3300028379 Bacteria 26538
263 Ga0268266_10415397 3300028379 Bacteria 1274
264 Ga0307517_10102067 3300028786 Bacteria 2252
265 Ga0268256_1000912 3300030500 Bacteria 20394
266 Ga0307511_10020629 3300030521 Bacteria 6234
267 Ga0307511_10041491 3300030521 Bacteria 3885
268 Ga0307511_10084189 3300030521 Bacteria 2210
269 Ga0316179_1062358 3300030734 Bacteria 1875
270 Ga0316178_1033887 3300030735 Bacteria 22142
271 Ga0316183_1070113 3300030742 Bacteria 4603
272 Ga0316181_1118357 3300030744 Bacteria 8217
273 Ga0307509_10039538 3300031507 Bacteria 5138
274 Ga0307509_10482040 3300031507 Bacteria 928
275 Ga0307408_100000577 3300031548 Bacteria 31560
276 Ga0307408_100001053 3300031548 Bacteria 21203
277 Ga0307408_100002452 3300031548 Bacteria 13010
278 Ga0307408_100014253 3300031548 Bacteria 5280
279 Ga0307405_10000816 3300031731 Bacteria 12255
280 Ga0307405_10002579 3300031731 Bacteria 8039
281 Ga0307405_10006596 3300031731 Bacteria 5722
282 Ga0307405_10065692 3300031731 Bacteria 2310
283 Ga0307405_10590857 3300031731 Bacteria 904
284 Ga0307413_10003953 3300031824 Bacteria 6354
285 Ga0307410_10202194 3300031852 Bacteria 1517
286 Ga0307406_10085574 3300031901 Bacteria 2108
287 Ga0307406_10126706 3300031901 Bacteria 1785
288 Ga0307412_10000174 3300031911 Bacteria 45787
289 Ga0307412_10001132 3300031911 Bacteria 15261
290 Ga0307412_10010193 3300031911 Bacteria 5408
291 Ga0307412_10037785 3300031911 Bacteria 3104
292 Ga0307412_10179044 3300031911 Bacteria 1592
293 Ga0307412_10284519 3300031911 Bacteria 1299
294 Ga0307412_10731055 3300031911 Bacteria 852
295 Ga0307409_100014760 3300031995 Bacteria 5096
296 Ga0307409_100040184 3300031995 Bacteria 3479
297 Ga0307416_100041878 3300032002 Bacteria 3570
298 Ga0307416_100109428 3300032002 Bacteria 2430
299 Ga0307414_10025441 3300032004 Bacteria 3792
300 Ga0307414_10055840 3300032004 Bacteria 2766
301 Ga0307411_10008775 3300032005 Bacteria 5259
302 Ga0307411_10034957 3300032005 Bacteria 3132
303 Ga0307411_10444856 3300032005 Bacteria 1082
304 Ga0307510_10000511 3300033180 Bacteria 38517
305 Ga0237819_00766 3300038705 Bacteria 10310
306 Ga0439438_000124 3300041405 Bacteria 34621
307 Ga0439438_000135 3300041405 Bacteria 33398
308 Ga0439438_000164 3300041405 Bacteria 30315
309 Ga0439438_000187 3300041405 Bacteria 27807
310 Ga0439438_000206 3300041405 Bacteria 26990
311 Ga0439438_011381 3300041405 Bacteria 2773
312 Ga0439438_011382 3300041405 Bacteria 2773
313 Ga0439438_029606 3300041405 Bacteria 1464
314 Ga0439438_033511 3300041405 Bacteria 1356
315 Ga0439438_076410 3300041405 Bacteria 824
316 Ga0439447_000072 3300041407 Bacteria 35889
317 Ga0439447_000224 3300041407 Bacteria 19892
318 Ga0439447_001709 3300041407 Bacteria 8060
319 Ga0439447_004239 3300041407 Bacteria 4970
320 Ga0439447_005323 3300041407 Bacteria 4288
321 Ga0439447_011091 3300041407 Bacteria 2646
322 Ga0439447_020061 3300041407 Bacteria 1776
323 Ga0439447_024358 3300041407 Bacteria 1567
324 Ga0439447_028088 3300041407 Bacteria 1431
325 Ga0439447_053535 3300041407 Bacteria 959
326 Ga0439461_0029694 3300041410 Bacteria 1132
327 Ga0439466_0000254 3300041411 Bacteria 20976
328 Ga0439466_0001112 3300041411 Bacteria 10479
329 Ga0439466_0001569 3300041411 Bacteria 8928
330 Ga0439466_0001836 3300041411 Bacteria 8334
331 Ga0439466_0003266 3300041411 Bacteria 6314
332 Ga0439466_0003837 3300041411 Bacteria 5799
333 Ga0439466_0004269 3300041411 Bacteria 5519
334 Ga0439466_0009760 3300041411 Bacteria 3579
335 Ga0439466_0020516 3300041411 Bacteria 2353
336 Ga0439466_0043612 3300041411 Bacteria 1489
337 Ga0439465_0017408 3300041413 Bacteria 2243
338 Ga0439431_0000017 3300041997 Bacteria 26613
339 Ga0439442_028214 3300042002 Bacteria 1170
340 Ga0439445_0004919 3300042004 Bacteria 3034
341 Ga0439445_0018360 3300042004 Bacteria 1735
342 Ga0439445_0022181 3300042004 Bacteria 1600
343 Ga0439432_000047 3300042006 Bacteria 37317
344 Ga0439432_000164 3300042006 Bacteria 22929
345 Ga0439432_000851 3300042006 Bacteria 11421
346 Ga0439432_005271 3300042006 Bacteria 4666
347 Ga0439432_020379 3300042006 Bacteria 2204
348 Ga0439432_035397 3300042006 Bacteria 1600
349 Ga0439432_088459 3300042006 Bacteria 933
350 Ga0439432_092511 3300042006 Bacteria 909
351 Ga0439451_000153 3300042009 Bacteria 12869
352 Ga0439451_001413 3300042009 Bacteria 4744
353 Ga0439451_002839 3300042009 Bacteria 3527
354 Ga0439451_005319 3300042009 Bacteria 2622
355 Ga0439451_027465 3300042009 Bacteria 1147
356 Ga0439451_029667 3300042009 Bacteria 1101
357 Ga0439451_042704 3300042009 Bacteria 909
358 Ga0439452_000203 3300042010 Bacteria 43038
359 Ga0439452_000205 3300042010 Bacteria 42858
360 Ga0439452_002241 3300042010 Bacteria 7252
361 Ga0439452_004024 3300042010 Bacteria 5011
362 Ga0439452_006179 3300042010 Bacteria 3773
363 Ga0439452_008879 3300042010 Bacteria 2994
364 Ga0439452_010582 3300042010 Bacteria 2676
365 Ga0439452_010872 3300042010 Bacteria 2632
366 Ga0439452_010873 3300042010 Bacteria 2632
367 Ga0439452_011996 3300042010 Bacteria 2476
368 Ga0439452_025147 3300042010 Bacteria 1514
369 Ga0439456_001188 3300042013 Bacteria 5171
370 Ga0439456_003376 3300042013 Bacteria 3233
371 Ga0439456_005340 3300042013 Bacteria 2604
372 Ga0439456_007949 3300042013 Bacteria 2185
373 Ga0439456_013157 3300042013 Bacteria 1720
374 Ga0439456_019745 3300042013 Bacteria 1418
375 Ga0439456_030725 3300042013 Bacteria 1149
376 Ga0439456_033816 3300042013 Bacteria 1100
377 Ga0439456_040354 3300042013 Bacteria 1010
378 Ga0439456_050832 3300042013 Bacteria 905
379 Ga0439463_000739 3300042016 Bacteria 9048
380 Ga0439463_001230 3300042016 Bacteria 6845
381 Ga0439463_002134 3300042016 Bacteria 5114
382 Ga0439463_010314 3300042016 Bacteria 2296
383 Ga0439463_112503 3300042016 Bacteria 703
384 Ga0450911_000099 3300042115 Bacteria 34952
385 Ga0450911_000407 3300042115 Bacteria 14216
386 Ga0450911_000875 3300042115 Bacteria 8130
387 Ga0450919_000297 3300042121 Bacteria 5844
388 Ga0450922_000337 3300042124 Bacteria 4996
389 Ga0450922_000423 3300042124 Bacteria 4549
390 Ga0450923_010389 3300042125 Bacteria 1651
391 Ga0450890_000090 3300042127 Bacteria 15149
392 Ga0450891_000467 3300042129 Bacteria 4223
393 Ga0450892_001516 3300042130 Bacteria 2229
394 Ga0450892_003632 3300042130 Bacteria 1267
395 Ga0450894_006237 3300042131 Bacteria 1539
396 Ga0450898_004679 3300042134 Bacteria 2034
397 Ga0450900_019285 3300042136 Bacteria 940
398 Ga0450902_000082 3300042137 Bacteria 9581
399 Ga0450902_003226 3300042137 Bacteria 2368
400 Ga0450902_008824 3300042137 Bacteria 1579
401 Ga0450902_010889 3300042137 Bacteria 1440
402 Ga0450902_034204 3300042137 Bacteria 859
403 Ga0450903_001654 3300042138 Bacteria 4132
404 Ga0450903_001942 3300042138 Bacteria 3737
405 Ga0450903_003954 3300042138 Bacteria 2546
406 Ga0450903_010280 3300042138 Bacteria 1516
407 Ga0450904_000793 3300042139 Bacteria 5339
408 Ga0450904_001561 3300042139 Bacteria 3125
409 Ga0450904_021730 3300042139 Bacteria 653
410 Ga0450905_000850 3300042142 Bacteria 3807
411 Ga0450905_002547 3300042142 Bacteria 2347
412 Ga0450889_001139 3300042144 Bacteria 2773
413 Ga0450906_000042 3300042145 Bacteria 20736
414 Ga0450906_002715 3300042145 Bacteria 3850
415 Ga0450907_000296 3300042146 Bacteria 16844
416 Ga0450907_002277 3300042146 Bacteria 3718
417 Ga0450907_003004 3300042146 Bacteria 3084
418 Ga0450907_015006 3300042146 Bacteria 1292
419 Ga0450910_000697 3300042147 Bacteria 4034
420 Ga0450910_010411 3300042147 Bacteria 1323
421 Ga0450910_013943 3300042147 Bacteria 1173
422 Ga0439446_0000498 3300042156 Bacteria 7856
423 Ga0439446_0000728 3300042156 Bacteria 6876
424 Ga0450908_001286 3300042184 Bacteria 4868
425 Ga0450908_011345 3300042184 Bacteria 1632
426 Ga0450909_000185 3300042185 Bacteria 7032
427 Ga0450909_000910 3300042185 Bacteria 4045
428 Ga0450909_003947 3300042185 Bacteria 2112
429 Ga0450909_013189 3300042185 Bacteria 1214
430 Ga0450909_018115 3300042185 Bacteria 1045
431 Ga0439434_0000007 3300042435 Bacteria 53582
432 Ga0439434_0014274 3300042435 Bacteria 2362
433 Ga0439434_0038285 3300042435 Bacteria 1469
434 Ga0439464_0000094 3300042439 Bacteria 13132
435 Ga0439460_0001432 3300042461 Bacteria 5626
436 Ga0450918_002245 3300042531 Bacteria 3668
437 Ga0450918_004471 3300042531 Bacteria 2543
438 Ga0450893_0000190 3300042532 Bacteria 8052
439 Ga0450893_0003214 3300042532 Bacteria 2569
440 Ga0450893_0022342 3300042532 Bacteria 1096
441 Ga0450901_003547 3300042533 Bacteria 1627
442 Ga0439440_0000065 3300042993 Bacteria 13383
443 Ga0439440_0000113 3300042993 Bacteria 11080
444 Ga0439440_0000565 3300042993 Bacteria 6285
445 Ga0439440_0008498 3300042993 Bacteria 2109
446 Ga0495617_000124 3300046452 Bacteria 50836
447 Ga0495617_001064 3300046452 Bacteria 12527
448 Ga0495617_011766 3300046452 Bacteria 2984
449 Ga0495617_015949 3300046452 Bacteria 2542
450 Ga0495617_026888 3300046452 Bacteria 1937
451 Ga0495617_037644 3300046452 Bacteria 1619
452 Ga0495617_050552 3300046452 Bacteria 1383
453 Ga0495617_068248 3300046452 Bacteria 1170
454 Ga0495617_070976 3300046452 Bacteria 1145
455 Ga0495627_000115 3300046453 Bacteria 99960
456 Ga0495627_000264 3300046453 Bacteria 53754
457 Ga0495627_002201 3300046453 Bacteria 9708
458 Ga0495627_002802 3300046453 Bacteria 8092
459 Ga0495627_005257 3300046453 Bacteria 5249
460 Ga0495627_006173 3300046453 Bacteria 4722
461 Ga0495627_009503 3300046453 Bacteria 3577
462 Ga0495627_055759 3300046453 Bacteria 1179
463 Ga0495592_0006742 3300046454 Bacteria 8566
464 Ga0495603_0006127 3300046455 Bacteria 7193
465 Ga0495603_0015163 3300046455 Bacteria 4662
466 Ga0495603_0027538 3300046455 Bacteria 3429
467 Ga0495603_0385474 3300046455 Bacteria 803
468 Ga0495590_0001890 3300046457 Bacteria 8853
469 Ga0495590_0016731 3300046457 Bacteria 2646
470 Ga0495590_0078572 3300046457 Bacteria 1161
471 Ga0495590_0078583 3300046457 Bacteria 1161
472 Ga0495591_000308 3300046458 Bacteria 44417
473 Ga0495591_000378 3300046458 Bacteria 37922
474 Ga0495591_000416 3300046458 Bacteria 35344
475 Ga0495591_000793 3300046458 Bacteria 22408
476 Ga0495591_002254 3300046458 Bacteria 10991
477 Ga0495591_003070 3300046458 Bacteria 8849
478 Ga0495591_005329 3300046458 Bacteria 5982
479 Ga0495591_005846 3300046458 Bacteria 5591
480 Ga0495591_010943 3300046458 Bacteria 3468
481 Ga0495591_015175 3300046458 Bacteria 2732
482 Ga0495591_016516 3300046458 Bacteria 2567
483 Ga0495638_0002320 3300046460 Bacteria 15683
484 Ga0495638_0004828 3300046460 Bacteria 10156
485 Ga0495638_0023281 3300046460 Bacteria 4052
486 Ga0495638_0034015 3300046460 Bacteria 3255
487 Ga0495638_0047954 3300046460 Bacteria 2676
488 Ga0495638_0088417 3300046460 Bacteria 1870
489 Ga0495638_0131202 3300046460 Bacteria 1471
490 Ga0495653_0000469 3300046463 Bacteria 31224
491 Ga0495653_0028377 3300046463 Bacteria 4473
492 Ga0495653_0072536 3300046463 Bacteria 2571
493 Ga0495653_0121541 3300046463 Bacteria 1860
494 Ga0495650_0000973 3300046471 Bacteria 32770
495 Ga0495650_0004032 3300046471 Bacteria 10296
496 Ga0495650_0004721 3300046471 Bacteria 9175
497 Ga0495650_0004905 3300046471 Bacteria 8939
498 Ga0495650_0009452 3300046471 Bacteria 5539
499 Ga0495650_0014363 3300046471 Bacteria 4125
500 Ga0495650_0020451 3300046471 Bacteria 3227
501 Ga0495650_0094661 3300046471 Bacteria 1130
502 Ga0495605_0000216 3300046474 Bacteria 71077
503 Ga0495605_0000513 3300046474 Bacteria 33142
504 Ga0495605_0002060 3300046474 Bacteria 12681
505 Ga0495605_0003810 3300046474 Bacteria 8944
506 Ga0495605_0005025 3300046474 Bacteria 7730
507 Ga0495605_0010975 3300046474 Bacteria 5059
508 Ga0495605_0012669 3300046474 Bacteria 4670
509 Ga0495605_0027881 3300046474 Bacteria 2920
510 Ga0495605_0039254 3300046474 Bacteria 2372
511 Ga0495605_0051978 3300046474 Bacteria 1993
512 Ga0495605_0054230 3300046474 Bacteria 1942
513 Ga0495605_0079615 3300046474 Bacteria 1534
514 Ga0495605_0106480 3300046474 Bacteria 1283
515 Ga0495605_0111589 3300046474 Bacteria 1247
516 Ga0495605_0243355 3300046474 Bacteria 771
517 Ga0495639_0000023 3300046475 Bacteria 70927
518 Ga0495639_0037329 3300046475 Bacteria 2177
519 Ga0495639_0047262 3300046475 Bacteria 1949
520 Ga0495639_0148342 3300046475 Bacteria 1130
521 Ga0495584_0000266 3300046491 Bacteria 37081
522 Ga0495584_0002127 3300046491 Bacteria 11349
523 Ga0495584_0003381 3300046491 Bacteria 8816
524 Ga0495584_0009050 3300046491 Bacteria 5142
525 Ga0495584_0012785 3300046491 Bacteria 4283
526 Ga0495584_0015885 3300046491 Bacteria 3841
527 Ga0495584_0026356 3300046491 Bacteria 2944
528 Ga0495584_0052120 3300046491 Bacteria 2059
529 Ga0495584_0056918 3300046491 Bacteria 1967
530 Ga0495584_0406940 3300046491 Bacteria 691
531 Ga0495585_0000527 3300046492 Bacteria 36115
532 Ga0495585_0001542 3300046492 Bacteria 17888
533 Ga0495585_0004546 3300046492 Bacteria 8971
534 Ga0495585_0004700 3300046492 Bacteria 8799
535 Ga0495585_0014016 3300046492 Bacteria 4681
536 Ga0495585_0029133 3300046492 Bacteria 3144
537 Ga0495585_0031727 3300046492 Bacteria 2998
538 Ga0495585_0036980 3300046492 Bacteria 2750
539 Ga0495585_0041847 3300046492 Bacteria 2568
540 Ga0495585_0206513 3300046492 Bacteria 997
541 Ga0495594_0002306 3300046499 Bacteria 9933
542 Ga0495594_0006733 3300046499 Bacteria 5909
543 Ga0495594_0009474 3300046499 Bacteria 5032
544 Ga0495594_0035892 3300046499 Bacteria 2702
545 Ga0495596_0002904 3300046500 Bacteria 8915
546 Ga0495596_0017145 3300046500 Bacteria 3003
547 Ga0495596_0030861 3300046500 Bacteria 2143
548 Ga0495607_0000113 3300046501 Bacteria 84993
549 Ga0495607_0000257 3300046501 Bacteria 57042
550 Ga0495607_0000261 3300046501 Bacteria 56378
551 Ga0495607_0000418 3300046501 Bacteria 43301
552 Ga0495607_0008186 3300046501 Bacteria 7162
553 Ga0495607_0010285 3300046501 Bacteria 6293
554 Ga0495607_0014933 3300046501 Bacteria 5048
555 Ga0495607_0016635 3300046501 Bacteria 4743
556 Ga0495607_0017175 3300046501 Bacteria 4654
557 Ga0495607_0023631 3300046501 Bacteria 3844
558 Ga0495607_0036501 3300046501 Bacteria 2960
559 Ga0495607_0044448 3300046501 Bacteria 2619
560 Ga0495607_0050850 3300046501 Bacteria 2410
561 Ga0495607_0132319 3300046501 Bacteria 1296
562 Ga0495607_0140311 3300046501 Bacteria 1247
563 Ga0495607_0197062 3300046501 Bacteria 999
564 Ga0495583_0000362 3300046506 Bacteria 71060
565 Ga0495583_0004545 3300046506 Bacteria 9868
566 Ga0495583_0006121 3300046506 Bacteria 7936
567 Ga0495583_0006943 3300046506 Bacteria 7262
568 Ga0495583_0020973 3300046506 Bacteria 3368
569 Ga0495583_0024204 3300046506 Bacteria 3056
570 Ga0495583_0060975 3300046506 Bacteria 1684
571 Ga0495583_0101023 3300046506 Bacteria 1231
572 Ga0495583_0156159 3300046506 Bacteria 943
573 Ga0495606_0001377 3300046507 Bacteria 32881
574 Ga0495606_0014692 3300046507 Bacteria 6088
575 Ga0495606_0022772 3300046507 Bacteria 4552
576 Ga0495606_0025600 3300046507 Bacteria 4221
577 Ga0495606_0035084 3300046507 Bacteria 3433
578 Ga0495606_0038012 3300046507 Bacteria 3260
579 Ga0495606_0075500 3300046507 Bacteria 2109
580 Ga0495606_0086629 3300046507 Bacteria 1935
581 Ga0495606_0095060 3300046507 Bacteria 1825
582 Ga0495606_0119432 3300046507 Bacteria 1579
583 Ga0495606_0246398 3300046507 Bacteria 993
584 Ga0495610_0001264 3300046512 Bacteria 22650
585 Ga0495610_0001667 3300046512 Bacteria 19534
586 Ga0495610_0004270 3300046512 Bacteria 10629
587 Ga0495610_0010914 3300046512 Bacteria 5604
588 Ga0495610_0017102 3300046512 Bacteria 4145
589 Ga0495610_0019652 3300046512 Bacteria 3772
590 Ga0495610_0022680 3300046512 Bacteria 3429
591 Ga0495610_0023106 3300046512 Bacteria 3388
592 Ga0495610_0033751 3300046512 Bacteria 2642
593 Ga0495610_0078761 3300046512 Bacteria 1518
594 Ga0495610_0090071 3300046512 Bacteria 1392
595 Ga0495616_0000369 3300046513 Bacteria 35160
596 Ga0495616_0001175 3300046513 Bacteria 18490
597 Ga0495616_0002682 3300046513 Bacteria 11666
598 Ga0495616_0004433 3300046513 Bacteria 8841
599 Ga0495616_0005206 3300046513 Bacteria 8043
600 Ga0495616_0005875 3300046513 Bacteria 7490
601 Ga0495616_0009145 3300046513 Bacteria 5812
602 Ga0495616_0039460 3300046513 Bacteria 2418
603 Ga0495616_0072494 3300046513 Bacteria 1663
604 Ga0495616_0076488 3300046513 Bacteria 1608
605 Ga0495616_0212998 3300046513 Bacteria 844
606 Ga0495620_0000044 3300046515 Bacteria 110431
607 Ga0495620_0000339 3300046515 Bacteria 32584
608 Ga0495620_0000746 3300046515 Bacteria 19999
609 Ga0495620_0009278 3300046515 Bacteria 5238
610 Ga0495620_0021207 3300046515 Bacteria 3158
611 Ga0495620_0026442 3300046515 Bacteria 2729
612 Ga0495620_0051689 3300046515 Bacteria 1748
613 Ga0495628_0467341 3300046516 Bacteria 914
614 Ga0495630_0005928 3300046517 Bacteria 8640
615 Ga0495630_0193990 3300046517 Bacteria 1549
616 Ga0495631_0000056 3300046518 Bacteria 69858
617 Ga0495631_0000194 3300046518 Bacteria 41639
618 Ga0495631_0002932 3300046518 Bacteria 9449
619 Ga0495631_0016779 3300046518 Bacteria 3480
620 Ga0495631_0019186 3300046518 Bacteria 3209
621 Ga0495631_0020135 3300046518 Bacteria 3121
622 Ga0495631_0026723 3300046518 Bacteria 2647
623 Ga0495631_0044419 3300046518 Bacteria 1958
624 Ga0495631_0052936 3300046518 Bacteria 1772
625 Ga0495631_0091342 3300046518 Bacteria 1311
626 Ga0495632_0000326 3300046519 Bacteria 45910
627 Ga0495632_0000454 3300046519 Bacteria 39007
628 Ga0495632_0004614 3300046519 Bacteria 9327
629 Ga0495632_0005936 3300046519 Bacteria 7958
630 Ga0495632_0014000 3300046519 Bacteria 4552
631 Ga0495632_0024439 3300046519 Bacteria 3208
632 Ga0495632_0025713 3300046519 Bacteria 3110
633 Ga0495632_0027718 3300046519 Bacteria 2963
634 Ga0495632_0029233 3300046519 Bacteria 2871
635 Ga0495632_0109556 3300046519 Bacteria 1297
636 Ga0495632_0158051 3300046519 Bacteria 1045
637 Ga0495632_0188978 3300046519 Bacteria 941
638 Ga0495637_0000299 3300046520 Bacteria 38328
639 Ga0495637_0000352 3300046520 Bacteria 35099
640 Ga0495637_0001408 3300046520 Bacteria 14224
641 Ga0495637_0002974 3300046520 Bacteria 9114
642 Ga0495637_0003518 3300046520 Bacteria 8304
643 Ga0495637_0005637 3300046520 Bacteria 6355
644 Ga0495637_0007730 3300046520 Bacteria 5315
645 Ga0495637_0015623 3300046520 Bacteria 3561
646 Ga0495637_0018280 3300046520 Bacteria 3253
647 Ga0495637_0027082 3300046520 Bacteria 2568
648 Ga0495637_0086218 3300046520 Bacteria 1245
649 Ga0495637_0102697 3300046520 Bacteria 1115
650 Ga0495637_0106715 3300046520 Bacteria 1089
651 Ga0495643_0002533 3300046522 Bacteria 14326
652 Ga0495643_0004873 3300046522 Bacteria 9242
653 Ga0495643_0010085 3300046522 Bacteria 5827
654 Ga0495643_0026550 3300046522 Bacteria 3267
655 Ga0495643_0029758 3300046522 Bacteria 3053
656 Ga0495643_0037518 3300046522 Bacteria 2657
657 Ga0495643_0089889 3300046522 Bacteria 1585
658 Ga0495643_0094375 3300046522 Bacteria 1540
659 Ga0495644_0006145 3300046523 Bacteria 4668
660 Ga0495644_0008721 3300046523 Bacteria 3900
661 Ga0495648_0000458 3300046524 Bacteria 44202
662 Ga0495648_0001229 3300046524 Bacteria 25613
663 Ga0495648_0002025 3300046524 Bacteria 19213
664 Ga0495648_0010706 3300046524 Bacteria 6966
665 Ga0495648_0025318 3300046524 Bacteria 4019
666 Ga0495648_0030127 3300046524 Bacteria 3593
667 Ga0495648_0034438 3300046524 Bacteria 3295
668 Ga0495648_0038580 3300046524 Bacteria 3052
669 Ga0495648_0043954 3300046524 Bacteria 2793
670 Ga0495648_0048217 3300046524 Bacteria 2624
671 Ga0495648_0091522 3300046524 Bacteria 1701
672 Ga0495648_0215573 3300046524 Bacteria 950
673 Ga0495648_0236141 3300046524 Bacteria 891
674 Ga0495666_0000115 3300046526 Bacteria 33493
675 Ga0495666_0004760 3300046526 Bacteria 6864
676 Ga0495666_0010942 3300046526 Bacteria 4524
677 Ga0495666_0012480 3300046526 Bacteria 4235
678 Ga0495666_0118250 3300046526 Bacteria 1242
679 Ga0495666_0135019 3300046526 Bacteria 1151
680 Ga0495642_0000113 3300046528 Bacteria 45816
681 Ga0495642_0000773 3300046528 Bacteria 15604
682 Ga0495654_0000317 3300046530 Bacteria 42247
683 Ga0495654_0000372 3300046530 Bacteria 38835
684 Ga0495654_0003460 3300046530 Bacteria 9651
685 Ga0495654_0004777 3300046530 Bacteria 7966
686 Ga0495654_0007260 3300046530 Bacteria 6207
687 Ga0495654_0009191 3300046530 Bacteria 5419
688 Ga0495654_0010388 3300046530 Bacteria 5066
689 Ga0495654_0011641 3300046530 Bacteria 4752
690 Ga0495654_0020965 3300046530 Bacteria 3403
691 Ga0495654_0021378 3300046530 Bacteria 3366
692 Ga0495654_0022093 3300046530 Bacteria 3308
693 Ga0495654_0034025 3300046530 Bacteria 2575
694 Ga0495654_0040303 3300046530 Bacteria 2328
695 Ga0495654_0042524 3300046530 Bacteria 2255
696 Ga0495654_0069031 3300046530 Bacteria 1679
697 Ga0495654_0109837 3300046530 Bacteria 1259
698 Ga0495654_0125919 3300046530 Bacteria 1154
699 Ga0495654_0254263 3300046530 Bacteria 730
700 Ga0495587_0000310 3300046536 Bacteria 34799
701 Ga0495609_0000284 3300046538 Bacteria 46858
702 Ga0495609_0000854 3300046538 Bacteria 22482
703 Ga0495609_0001504 3300046538 Bacteria 15388
704 Ga0495609_0003533 3300046538 Bacteria 8909
705 Ga0495609_0005087 3300046538 Bacteria 7008
706 Ga0495609_0010965 3300046538 Bacteria 4329
707 Ga0495609_0011342 3300046538 Bacteria 4246
708 Ga0495609_0012709 3300046538 Bacteria 3991
709 Ga0495609_0014635 3300046538 Bacteria 3684
710 Ga0495609_0047258 3300046538 Bacteria 1926
711 Ga0495609_0160732 3300046538 Bacteria 952
712 Ga0495597_0000463 3300046542 Bacteria 34575
713 Ga0495597_0002086 3300046542 Bacteria 13310
714 Ga0495597_0003185 3300046542 Bacteria 9804
715 Ga0495597_0003938 3300046542 Bacteria 8369
716 Ga0495597_0011680 3300046542 Bacteria 4253
717 Ga0495597_0029161 3300046542 Bacteria 2521
718 Ga0495597_0046511 3300046542 Bacteria 1922
719 Ga0495597_0180437 3300046542 Bacteria 853
720 Ga0495597_0196237 3300046542 Bacteria 810
721 Ga0495622_0000986 3300046557 Bacteria 15258
722 Ga0495622_0008525 3300046557 Bacteria 4748
723 Ga0495622_0025543 3300046557 Bacteria 2758
724 Ga0495622_0130362 3300046557 Bacteria 1145
725 Ga0495622_0141398 3300046557 Bacteria 1092
726 Ga0495622_0148970 3300046557 Bacteria 1059
727 Ga0495622_0239272 3300046557 Bacteria 800
728 Ga0495633_0000201 3300046558 Bacteria 76414
729 Ga0495633_0000604 3300046558 Bacteria 34384
730 Ga0495633_0006707 3300046558 Bacteria 6775
731 Ga0495633_0023450 3300046558 Bacteria 3058
732 Ga0495633_0081180 3300046558 Bacteria 1509
733 Ga0495656_0079213 3300046615 Bacteria 1478
734 Ga0495656_0150215 3300046615 Bacteria 1124
735 Ga0495656_0178877 3300046615 Bacteria 1041
736 Ga0495656_0190640 3300046615 Bacteria 1012
737 Ga0495668_0000839 3300046616 Bacteria 34821
738 Ga0495668_0006724 3300046616 Bacteria 7486
739 Ga0495668_0024445 3300046616 Bacteria 3435
740 Ga0495668_0031340 3300046616 Bacteria 2997
741 Ga0495668_0120034 3300046616 Bacteria 1438
742 Ga0495634_0000515 3300046642 Bacteria 37813
743 Ga0495634_0006530 3300046642 Bacteria 8852
744 Ga0495611_0000098 3300046648 Bacteria 60447
745 Ga0495611_0001715 3300046648 Bacteria 10638
746 Ga0495611_0004017 3300046648 Bacteria 6409
747 Ga0495611_0020536 3300046648 Bacteria 2844
748 Ga0495611_0097685 3300046648 Bacteria 1361
749 Ga0495611_0130611 3300046648 Bacteria 1171
750 Ga0495611_0188276 3300046648 Bacteria 963
751 Ga0495625_0003294 3300046660 Bacteria 16293
752 Ga0495625_0005164 3300046660 Bacteria 12046
753 Ga0495625_0007513 3300046660 Bacteria 9470
754 Ga0495625_0010676 3300046660 Bacteria 7567
755 Ga0495625_0013793 3300046660 Bacteria 6476
756 Ga0495625_0024138 3300046660 Bacteria 4633
757 Ga0495625_0053034 3300046660 Bacteria 2902
758 Ga0495625_0216019 3300046660 Bacteria 1258
759 Ga0495625_0293462 3300046660 Bacteria 1042
760 Ga0495625_0334874 3300046660 Bacteria 960
761 Ga0495625_0407195 3300046660 Bacteria 848
762 Ga0495625_0453942 3300046660 Bacteria 791
763 Ga0495635_0000201 3300046663 Bacteria 37681
764 Ga0495635_0159737 3300046663 Bacteria 1534
765 Ga0495659_0000090 3300046664 Bacteria 40033
766 Ga0495659_0003362 3300046664 Bacteria 5127
767 Ga0495659_0005974 3300046664 Bacteria 3848
768 Ga0495659_0050399 3300046664 Bacteria 1514
769 Ga0495661_0000480 3300046665 Bacteria 42106
770 Ga0495661_0000664 3300046665 Bacteria 34477
771 Ga0495661_0005873 3300046665 Bacteria 8674
772 Ga0495661_0020419 3300046665 Bacteria 4323
773 Ga0495661_0055247 3300046665 Bacteria 2380
774 Ga0495661_0072711 3300046665 Bacteria 2005
775 Ga0495661_0089736 3300046665 Bacteria 1751
776 Ga0495661_0107967 3300046665 Bacteria 1555
777 Ga0495661_0275180 3300046665 Bacteria 850
778 Ga0495588_0061816 3300046674 Bacteria 1940
779 Ga0495588_0094526 3300046674 Bacteria 1567
780 Ga0495588_0099404 3300046674 Bacteria 1528
781 Ga0495588_0121443 3300046674 Bacteria 1377
782 Ga0495657_0014526 3300046675 Bacteria 5778
783 Ga0495623_0001314 3300046679 Bacteria 16912
784 Ga0495623_0004455 3300046679 Bacteria 9195
785 Ga0495646_0024194 3300046680 Bacteria 3824
786 Ga0495646_0031362 3300046680 Bacteria 3312
787 Ga0495669_0213266 3300046684 Bacteria 924
788 Ga0495613_0015568 3300046689 Bacteria 5657
789 Ga0495613_0048602 3300046689 Bacteria 3133
790 Ga0495624_0000569 3300046690 Bacteria 28994
791 Ga0495670_0000097 3300046691 Bacteria 37989
792 Ga0495670_0000246 3300046691 Bacteria 25111
793 Ga0495670_0002649 3300046691 Bacteria 8837
794 Ga0495670_0009024 3300046691 Bacteria 4906
795 Ga0495670_0012278 3300046691 Bacteria 4210
796 Ga0495670_0043491 3300046691 Bacteria 2241
797 Ga0495670_0060728 3300046691 Bacteria 1899
798 Ga0495670_0180859 3300046691 Bacteria 1113
799 Ga0495671_0000258 3300046692 Bacteria 44869
800 Ga0495671_0002546 3300046692 Bacteria 11463
801 Ga0495671_0004547 3300046692 Bacteria 8267
802 Ga0495671_0006553 3300046692 Bacteria 6716
803 Ga0495671_0011160 3300046692 Bacteria 4955
804 Ga0495671_0015813 3300046692 Bacteria 4038
805 Ga0495671_0017021 3300046692 Bacteria 3872
806 Ga0495671_0024141 3300046692 Bacteria 3170
807 Ga0495671_0029932 3300046692 Bacteria 2791
808 Ga0495671_0063789 3300046692 Bacteria 1814
809 Ga0495671_0104195 3300046692 Bacteria 1385
810 Ga0495671_0167594 3300046692 Bacteria 1068
811 Ga0495671_0364116 3300046692 Bacteria 693
812 Ga0495649_0001022 3300046694 Bacteria 21966
813 Ga0495649_0004235 3300046694 Bacteria 9409
814 Ga0495649_0005455 3300046694 Bacteria 8080
815 Ga0495649_0006700 3300046694 Bacteria 7145
816 Ga0495649_0011232 3300046694 Bacteria 5262
817 Ga0495649_0015595 3300046694 Bacteria 4320
818 Ga0495649_0041274 3300046694 Bacteria 2524
819 Ga0495649_0065682 3300046694 Bacteria 1947
820 Ga0495649_0099185 3300046694 Bacteria 1549
821 Ga0495649_0134435 3300046694 Bacteria 1304
822 Ga0495649_0311445 3300046694 Bacteria 800
823 Ga0495589_0000181 3300046794 Bacteria 55674
824 Ga0495589_0000229 3300046794 Bacteria 47221
825 Ga0495589_0000716 3300046794 Bacteria 21461
826 Ga0495589_0008955 3300046794 Bacteria 5207
827 Ga0495589_0014843 3300046794 Bacteria 4007
828 Ga0495589_0026526 3300046794 Bacteria 2934
829 Ga0495589_0033271 3300046794 Bacteria 2590
830 Ga0495589_0064834 3300046794 Bacteria 1791
831 Ga0495589_0119154 3300046794 Bacteria 1271
832 Ga0495589_0189637 3300046794 Bacteria 973
833 Ga0495600_0012842 3300046809 Bacteria 5246
834 Ga0495660_0000087 3300046810 Bacteria 98971
835 Ga0495660_0001070 3300046810 Bacteria 19730
836 Ga0495660_0001462 3300046810 Bacteria 16145
837 Ga0495660_0003515 3300046810 Bacteria 9667
838 Ga0495660_0003726 3300046810 Bacteria 9358
839 Ga0495660_0004857 3300046810 Bacteria 8093
840 Ga0495660_0006769 3300046810 Bacteria 6758
841 Ga0495660_0007083 3300046810 Bacteria 6607
842 Ga0495660_0014078 3300046810 Bacteria 4634
843 Ga0495660_0018350 3300046810 Bacteria 4022
844 Ga0495660_0026975 3300046810 Bacteria 3251
845 Ga0495660_0036114 3300046810 Bacteria 2757
846 Ga0495660_0041930 3300046810 Bacteria 2530
847 Ga0495660_0045990 3300046810 Bacteria 2394
848 Ga0495660_0078354 3300046810 Bacteria 1737
849 Ga0495660_0094834 3300046810 Bacteria 1544
850 Ga0495660_0109179 3300046810 Bacteria 1413
851 Ga0495660_0128713 3300046810 Bacteria 1272
852 Ga0495660_0150639 3300046810 Bacteria 1149
853 Ga0495660_0205868 3300046810 Bacteria 936
854 Ga0495581_0011551 3300047315 Bacteria 5108
855 Ga0495604_0001188 3300047317 Bacteria 21481
856 Ga0495604_0003976 3300047317 Bacteria 11756
857 Ga0495604_0067068 3300047317 Bacteria 2727
858 Ga0495636_0008548 3300047318 Bacteria 4040
859 Ga0495636_0148418 3300047318 Bacteria 1050
860 Ga0495636_0168504 3300047318 Bacteria 989
861 Ga0495674_0007599 3300047319 Bacteria 10358
862 Ga0495672_0001272 3300047320 Bacteria 25235
863 Ga0495672_0002320 3300047320 Bacteria 17645
864 Ga0495672_0003053 3300047320 Bacteria 14666
865 Ga0495672_0003486 3300047320 Bacteria 13443
866 Ga0495672_0003929 3300047320 Bacteria 12468
867 Ga0495672_0003942 3300047320 Bacteria 12425
868 Ga0495672_0009533 3300047320 Bacteria 7024
869 Ga0495672_0009988 3300047320 Bacteria 6807
870 Ga0495672_0011213 3300047320 Bacteria 6336
871 Ga0495672_0018815 3300047320 Bacteria 4574
872 Ga0495672_0084753 3300047320 Bacteria 1757
873 Ga0495672_0108274 3300047320 Bacteria 1495
874 Ga0495672_0108586 3300047320 Bacteria 1492
875 Ga0495672_0198238 3300047320 Bacteria 1005
876 Ga0495672_0231706 3300047320 Bacteria 906
877 Ga0495676_0003819 3300047321 Bacteria 13694
878 Ga0495676_0006990 3300047321 Bacteria 10358
879 Ga0495680_0001279 3300047322 Bacteria 27450
880 Ga0495680_0010849 3300047322 Bacteria 8104
881 Ga0495680_0087730 3300047322 Bacteria 2339
882 Ga0495680_0275887 3300047322 Bacteria 1186
883 Ga0495683_0000141 3300047323 Bacteria 70994
884 Ga0495683_0000295 3300047323 Bacteria 43033
885 Ga0495683_0003587 3300047323 Bacteria 9015
886 Ga0495683_0004169 3300047323 Bacteria 8269
887 Ga0495683_0004313 3300047323 Bacteria 8107
888 Ga0495683_0031384 3300047323 Bacteria 2708
889 Ga0495683_0075598 3300047323 Bacteria 1649
890 Ga0495683_0097215 3300047323 Bacteria 1419
891 Ga0495683_0129964 3300047323 Bacteria 1188
892 Ga0495683_0165846 3300047323 Bacteria 1018
893 Ga0495687_001610 3300047443 Bacteria 20347
894 Ga0495687_003131 3300047443 Bacteria 12353
895 Ga0495675_0004914 3300047444 Bacteria 8140
896 Ga0495677_0002416 3300047445 Bacteria 7337
897 Ga0495679_000387 3300047446 Bacteria 33710
898 Ga0495679_001227 3300047446 Bacteria 15209
899 Ga0495679_001845 3300047446 Bacteria 11463
900 Ga0495679_003034 3300047446 Bacteria 8248
901 Ga0495679_003100 3300047446 Bacteria 8137
902 Ga0495679_009598 3300047446 Bacteria 3861
903 Ga0495679_011786 3300047446 Bacteria 3358
904 Ga0495679_012309 3300047446 Bacteria 3260
905 Ga0495679_035214 3300047446 Bacteria 1588
906 Ga0495679_078861 3300047446 Bacteria 938
907 Ga0495685_014252 3300047447 Bacteria 2701
908 Ga0495673_0000286 3300047469 Bacteria 68088
909 Ga0495673_0000634 3300047469 Bacteria 34564
910 Ga0495673_0003805 3300047469 Bacteria 9752
911 Ga0495673_0006038 3300047469 Bacteria 7193
912 Ga0495673_0009287 3300047469 Bacteria 5452
913 Ga0495673_0015491 3300047469 Bacteria 3927
914 Ga0495673_0019044 3300047469 Bacteria 3446
915 Ga0495673_0020823 3300047469 Bacteria 3256
916 Ga0495673_0023141 3300047469 Bacteria 3029
917 Ga0495673_0040540 3300047469 Bacteria 2102
918 Ga0495673_0044126 3300047469 Bacteria 1990
919 Ga0495673_0056965 3300047469 Bacteria 1688
920 Ga0495673_0067092 3300047469 Bacteria 1519
921 Ga0495673_0106633 3300047469 Bacteria 1125
922 Ga0495681_0000168 3300047470 Bacteria 54934
923 Ga0495681_0000238 3300047470 Bacteria 45615
924 Ga0495681_0000320 3300047470 Bacteria 38212
925 Ga0495681_0004280 3300047470 Bacteria 9778
926 Ga0495681_0004576 3300047470 Bacteria 9420
927 Ga0495681_0005089 3300047470 Bacteria 8862
928 Ga0495681_0007227 3300047470 Bacteria 7137
929 Ga0495681_0007663 3300047470 Bacteria 6861
930 Ga0495681_0019440 3300047470 Bacteria 3709
931 Ga0495681_0027175 3300047470 Bacteria 2965
932 Ga0495681_0027488 3300047470 Bacteria 2941
933 Ga0495681_0089614 3300047470 Bacteria 1360
934 Ga0495681_0106257 3300047470 Bacteria 1221
935 Ga0495681_0108697 3300047470 Bacteria 1203
936 Ga0495681_0120613 3300047470 Bacteria 1125
937 Ga0495681_0124047 3300047470 Bacteria 1105
938 Ga0495681_0217573 3300047470 Bacteria 767
939 Ga0495684_0006807 3300047471 Bacteria 8877
940 Ga0495684_0135222 3300047471 Bacteria 1850
941 Ga0495686_0001012 3300047472 Bacteria 34088
942 Ga0495686_0003755 3300047472 Bacteria 12920
943 Ga0495686_0032973 3300047472 Bacteria 3347
944 Ga0495686_0173385 3300047472 Bacteria 1253
945 Ga0495593_0004195 3300047673 Bacteria 8569
946 Ga0495593_0009446 3300047673 Bacteria 5658
947 Ga0495593_0014954 3300047673 Bacteria 4405
948 Ga0495602_0000508 3300048088 Bacteria 36202
949 Ga0495614_0092660 3300048089 Bacteria 1315
950 Ga0495626_0000401 3300048091 Bacteria 44320
951 Ga0495626_0000488 3300048091 Bacteria 40010
952 Ga0495626_0001979 3300048091 Bacteria 15149
953 Ga0495626_0005500 3300048091 Bacteria 7377
954 Ga0495626_0013439 3300048091 Bacteria 4254
955 Ga0495626_0017923 3300048091 Bacteria 3568
956 Ga0495626_0020150 3300048091 Bacteria 3327
957 Ga0495626_0028048 3300048091 Bacteria 2732
958 Ga0495626_0030694 3300048091 Bacteria 2590
959 Ga0495626_0034626 3300048091 Bacteria 2415
960 Ga0495626_0066233 3300048091 Bacteria 1633
961 Ga0495626_0113695 3300048091 Bacteria 1169
962 Ga0496102_0000304 3300048905 Bacteria 62749
963 Ga0496103_0000544 3300048906 Bacteria 30291
964 Ga0496103_0087803 3300048906 Bacteria 1961
965 Ga0496106_0056693 3300048909 Bacteria 2962
966 Ga0496106_0212047 3300048909 Bacteria 1543
967 Ga0496110_0251636 3300048913 Bacteria 1608
968 Ga0496112_0015332 3300048915 Bacteria 7147
969 Ga0496114_0035776 3300048917 Bacteria 4102
970 Ga0496115_0109112 3300048918 Bacteria 2272
971 Ga0496116_0000295 3300048919 Bacteria 84486
972 Ga0496116_0000761 3300048919 Bacteria 40895
973 Ga0496116_0000831 3300048919 Bacteria 39048
974 Ga0496116_0001051 3300048919 Bacteria 33568
975 Ga0496116_0005914 3300048919 Bacteria 11224
976 Ga0496116_0005932 3300048919 Bacteria 11202
977 Ga0496117_0000514 3300048920 Bacteria 63841
978 Ga0496117_0000605 3300048920 Bacteria 58733
979 Ga0496117_0001501 3300048920 Bacteria 33410
980 Ga0496117_0004709 3300048920 Bacteria 14812
981 Ga0496117_0017490 3300048920 Bacteria 5985
982 Ga0496117_0028146 3300048920 Bacteria 4356
983 Ga0496117_0051857 3300048920 Bacteria 2895
984 Ga0496117_0070052 3300048920 Bacteria 2358
985 Ga0496117_0095466 3300048920 Bacteria 1900
986 Ga0496117_0134276 3300048920 Bacteria 1494
987 Ga0496117_0161783 3300048920 Bacteria 1310
988 Ga0496118_0001223 3300048921 Bacteria 39530
989 Ga0496118_0001495 3300048921 Bacteria 34900
990 Ga0496118_0072717 3300048921 Bacteria 2467
991 Ga0496118_0077583 3300048921 Bacteria 2355
992 Ga0496118_0114770 3300048921 Bacteria 1775
993 Ga0496118_0200756 3300048921 Bacteria 1181
994 Ga0496118_0207146 3300048921 Bacteria 1155
995 Ga0496119_0037865 3300048922 Bacteria 3125
996 Ga0496119_0037914 3300048922 Bacteria 3122
997 Ga0496119_0208380 3300048922 Bacteria 1007
998 Ga0496120_0011574 3300048923 Bacteria 6059
999 Ga0496120_0032212 3300048923 Bacteria 3162
1000 Ga0496120_0073580 3300048923 Bacteria 1869
1001 Ga0496120_0156294 3300048923 Bacteria 1141
1002 Ga0496120_0221050 3300048923 Bacteria 905
1003 Ga0496121_0000679 3300048924 Bacteria 63412
1004 Ga0496121_0001884 3300048924 Bacteria 33652
1005 Ga0496121_0026548 3300048924 Bacteria 5451
1006 Ga0496121_0115715 3300048924 Bacteria 2035
1007 Ga0496121_0153095 3300048924 Bacteria 1694
1008 Ga0496121_0207572 3300048924 Bacteria 1390
1009 Ga0496121_0280267 3300048924 Bacteria 1140
1010 Ga0496122_0001433 3300048925 Bacteria 38586
1011 Ga0496122_0006304 3300048925 Bacteria 13675
1012 Ga0496122_0025784 3300048925 Bacteria 5091
1013 Ga0496122_0056926 3300048925 Bacteria 2909
1014 Ga0496122_0083959 3300048925 Bacteria 2205
1015 Ga0496122_0088794 3300048925 Bacteria 2116
1016 Ga0496122_0108212 3300048925 Bacteria 1834
1017 Ga0496122_0127568 3300048925 Bacteria 1624
1018 Ga0496122_0235659 3300048925 Bacteria 1036
1019 Ga0496122_0270186 3300048925 Bacteria 937
1020 Ga0496123_0000692 3300048926 Bacteria 55502
1021 Ga0496123_0001506 3300048926 Bacteria 32273
1022 Ga0496123_0024126 3300048926 Bacteria 4632
1023 Ga0496123_0056915 3300048926 Bacteria 2550
1024 Ga0496123_0063419 3300048926 Bacteria 2361
1025 Ga0496123_0063583 3300048926 Bacteria 2356
1026 Ga0496123_0133726 3300048926 Bacteria 1368
1027 Ga0496123_0148553 3300048926 Bacteria 1268
1028 Ga0496124_0001880 3300048927 Bacteria 28906
1029 Ga0496124_0002805 3300048927 Bacteria 22075
1030 Ga0496124_0030851 3300048927 Bacteria 4749
1031 Ga0496124_0043535 3300048927 Bacteria 3859
1032 Ga0496124_0112797 3300048927 Bacteria 2185
1033 Ga0496124_0119069 3300048927 Bacteria 2112
1034 Ga0496124_0119846 3300048927 Bacteria 2104
1035 Ga0496124_0185743 3300048927 Bacteria 1595
1036 Ga0496124_0329656 3300048927 Bacteria 1089
1037 Ga0496124_0711189 3300048927 Bacteria 635
1038 Ga0496125_0000616 3300048928 Bacteria 60331
1039 Ga0496125_0001198 3300048928 Bacteria 39047
1040 Ga0496125_0003676 3300048928 Bacteria 18328
1041 Ga0496125_0009596 3300048928 Bacteria 9901
1042 Ga0496125_0016654 3300048928 Bacteria 7048
1043 Ga0496125_0048854 3300048928 Bacteria 3522
1044 Ga0496125_0102199 3300048928 Bacteria 2107
1045 Ga0496125_0105877 3300048928 Bacteria 2054
1046 Ga0496125_0105950 3300048928 Bacteria 2053
1047 Ga0496125_0156335 3300048928 Bacteria 1557
1048 Ga0496126_0070097 3300048929 Bacteria 3124
1049 Ga0496126_0129343 3300048929 Bacteria 2183
1050 Ga0496126_0153975 3300048929 Bacteria 1968
1051 Ga0496126_0236104 3300048929 Bacteria 1529
1052 Ga0495678_000054 3300049459 Bacteria 153487
1053 Ga0495678_000533 3300049459 Bacteria 36896
1054 Ga0495678_000950 3300049459 Bacteria 25128
1055 Ga0495678_002375 3300049459 Bacteria 12905
1056 Ga0495678_002740 3300049459 Bacteria 11574
1057 Ga0495678_003617 3300049459 Bacteria 9423
1058 Ga0495678_011423 3300049459 Bacteria 4254
1059 Ga0495678_015468 3300049459 Bacteria 3508
1060 Ga0495678_017718 3300049459 Bacteria 3218
1061 Ga0495678_021497 3300049459 Bacteria 2840
1062 Ga0495678_030108 3300049459 Bacteria 2274
1063 Ga0495678_032101 3300049459 Bacteria 2181
1064 Ga0495678_062782 3300049459 Bacteria 1389
1065 Ga0495678_072004 3300049459 Bacteria 1264
1066 Ga0495678_103357 3300049459 Bacteria 984
1067 Ga0495682_0000547 3300049460 Bacteria 25943
1068 Ga0495682_0002766 3300049460 Bacteria 8123
1069 Ga0495682_0014595 3300049460 Bacteria 2978
1070 Ga0495682_0015690 3300049460 Bacteria 2870
1071 Ga0495682_0015691 3300049460 Bacteria 2870
1072 Ga0495682_0047089 3300049460 Bacteria 1573
1073 Ga0495682_0071967 3300049460 Bacteria 1244
1074 Ga0495682_0104703 3300049460 Bacteria 1014
1075 Ga0501240_000106 3300049673 Bacteria 5382
1076 Ga0501241_000051 3300049758 Bacteria 31350
1077 Ga0501269_000421 3300049766 Bacteria 9584
1078 nmdc:mga00v17_63234_c1 3300050491 Bacteria 2279
1079 Ga0500572_000498 3300053111 Bacteria 13480
1080 Ga0500621_000935 3300053126 Bacteria 6155
1081 Ga0500568_0072764 3300053139 Bacteria 1314
1082 Ga0500586_127041 3300053145 Bacteria 884
1083 Ga0500634_0035907 3300053161 Bacteria 2698

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10000629 Ga0105237_1000062914 178
2 3300013104 Ga0157370_10024282 Ga0157370_100242824 178
3 3300025914 Ga0207671_10000027 Ga0207671_1000002785 178
4 iso_pu_bacteria 2512047018 2512325398 191
5 3300046530 Ga0495654_0034025 Ga0495654_0034025_1960_2538 192
6 3300005289 Ga0065704_10070235 Ga0065704_1007023510 193
7 3300046530 Ga0495654_0254263 Ga0495654_0254263_27_611 194
8 3300047320 Ga0495672_0084753 Ga0495672_0084753_935_1519 194
9 3300047469 Ga0495673_0000634 Ga0495673_0000634_4094_4678 194
10 3300048927 Ga0496124_0711189 Ga0496124_0711189_21_605 194
11 3300046474 Ga0495605_0243355 Ga0495605_0243355_169_756 195
12 3300046491 Ga0495584_0026356 Ga0495584_0026356_2342_2929 195
13 3300046491 Ga0495584_0406940 Ga0495584_0406940_16_603 195
14 3300046542 Ga0495597_0180437 Ga0495597_0180437_251_838 195
15 3300047320 Ga0495672_0198238 Ga0495672_0198238_16_603 195
16 3300046501 Ga0495607_0000113 Ga0495607_0000113_29101_29751 196
17 3300047320 Ga0495672_0003053 Ga0495672_0003053_2691_3341 196
18 3300042144 Ga0450889_001139 Ga0450889_001139_1687_2337 197
19 3300042130 Ga0450892_001516 Ga0450892_001516_1605_2204 199
20 3300042139 Ga0450904_021730 Ga0450904_021730_12_611 199
21 3300048920 Ga0496117_0095466 Ga0496117_0095466_613_1212 199
22 iso_pu_bacteria 8056120720 8056125871 201
23 3300046452 Ga0495617_026888 Ga0495617_026888_985_1629 202
24 3300048927 Ga0496124_0001880 Ga0496124_0001880_3446_4063 202
25 iso_pu_bacteria 3007872151 3007873136 202
26 iso_pu_bacteria 8056137416 8056142992 202
27 3300046524 Ga0495648_0001229 Ga0495648_0001229_21519_22130 203
28 3300048929 Ga0496126_0129343 Ga0496126_0129343_1388_2002 204
29 3300042137 Ga0450902_000082 Ga0450902_000082_4404_5033 205
30 3300042533 Ga0450901_003547 Ga0450901_003547_393_1022 205
31 3300046512 Ga0495610_0023106 Ga0495610_0023106_15_632 205
32 iso_pu_bacteria 2923153595 2923159756 205
33 3300009036 Ga0105244_10049961 Ga0105244_100499612 206
34 3300027312 Ga0209371_1001083 Ga0209371_100108311 206
35 3300030500 Ga0268256_1000912 Ga0268256_100091210 206
36 3300046513 Ga0495616_0212998 Ga0495616_0212998_204_830 206
37 3300048925 Ga0496122_0025784 Ga0496122_0025784_3874_4524 206
38 3300048926 Ga0496123_0024126 Ga0496123_0024126_429_1079 206
39 iso_pu_bacteria 8056172158 8056177188 206
40 3300006051 Ga0075364_10009758 Ga0075364_100097582 207
41 3300009011 Ga0105251_10164163 Ga0105251_101641632 207
42 3300013105 Ga0157369_10000523 Ga0157369_100005236 207
43 3300046513 Ga0495616_0039460 Ga0495616_0039460_195_839 207
44 3300046810 Ga0495660_0094834 Ga0495660_0094834_47_691 207
45 3300047446 Ga0495679_003100 Ga0495679_003100_5563_6207 207
46 3300048928 Ga0496125_0105950 Ga0496125_0105950_1417_2040 207
47 3300050491 nmdc:mga00v17_63234_c1 nmdc:mga00v17_63234_c1_1525_2169 207
48 iso_pu_bacteria 2718217725 2718636853 207
49 iso_pu_bacteria 2990196909 2990197797 207
50 3300046501 Ga0495607_0197062 Ga0495607_0197062_221_865 208
51 iso_pu_bacteria 2511231023 2511367469 208
52 iso_pu_bacteria 2511231031 2511412546 208
53 iso_pu_bacteria 2738543025 2739312256 208
54 iso_pu_bacteria 2969304461 2969310458 208
55 iso_pu_bacteria 3007614139 3007619317 208
56 3300046474 Ga0495605_0000216 Ga0495605_0000216_15363_16013 209
57 3300049459 Ga0495678_000054 Ga0495678_000054_75219_75869 209
58 iso_pu_bacteria 3007855910 3007859435 209
59 iso_pu_bacteria 3007866637 3007871827 209
60 3300048920 Ga0496117_0070052 Ga0496117_0070052_1560_2222 210
61 iso_pu_bacteria 2511231010 2511289777 210
62 iso_pu_bacteria 2511231011 2511293370 210
63 iso_pu_bacteria 2597489888 2597866874 210
64 iso_pu_bacteria 2597489889 2597872713 210
65 iso_pu_bacteria 2599185155 2599327884 210
66 iso_pu_bacteria 2599185167 2599401017 210
67 iso_pu_bacteria 2599185179 2599449637 210
68 iso_pu_bacteria 2599185189 2599505971 210
69 iso_pu_bacteria 2599185190 2599511709 210
70 iso_pu_bacteria 2599185191 2599516696 210
71 iso_pu_bacteria 2599185288 2599879260 210
72 iso_pu_bacteria 2599185290 2599893212 210
73 iso_pu_bacteria 2599185303 2599948793 210
74 iso_pu_bacteria 2600255296 2601693219 210
75 iso_pu_bacteria 2600255318 2601798311 210
76 iso_pu_bacteria 2603880185 2606077205 210
77 iso_pu_bacteria 2603880199 2606129549 210
78 iso_pu_bacteria 2619619299 2621296622 210
79 iso_pu_bacteria 2623620443 2624483655 210
80 iso_pu_bacteria 2643221571 2643873437 210
81 iso_pu_bacteria 2643221713 2644624548 210
82 iso_pu_bacteria 2675903420 2677900528 210
83 iso_pu_bacteria 2713897148 2715749589 210
84 iso_pu_bacteria 2713897149 2715754600 210
85 iso_pu_bacteria 2721755607 2723251586 210
86 iso_pu_bacteria 2738541265 2738673555 210
87 iso_pu_bacteria 2738541282 2738751948 210
88 iso_pu_bacteria 2738541294 2738807477 210
89 iso_pu_bacteria 2738541303 2738860989 210
90 iso_pu_bacteria 2738541309 2738894837 210
91 iso_pu_bacteria 2773857673 2774136434 210
92 iso_pu_bacteria 2784132063 2784261569 210
93 iso_pu_bacteria 2808606385 2808976378 210
94 iso_pu_bacteria 2808606388 2808994162 210
95 iso_pu_bacteria 2816332298 2817494267 210
96 iso_pu_bacteria 2818991456 2819655375 210
97 iso_pu_bacteria 2834028612 2834031172 210
98 iso_pu_bacteria 2842826826 2842828526 210
99 iso_pu_bacteria 2842832357 2842833700 210
100 iso_pu_bacteria 2842837860 2842838121 210
101 iso_pu_bacteria 2842843487 2842845933 210
102 iso_pu_bacteria 2852612431 2852616573 210
103 iso_pu_bacteria 2852657418 2852660056 210
104 iso_pu_bacteria 2852667396 2852671541 210
105 iso_pu_bacteria 2860867994 2860873245 210
106 iso_pu_bacteria 2878029506 2878029660 210
107 iso_pu_bacteria 2880230671 2880236240 210
108 iso_pu_bacteria 2904518522 2904518710 210
109 iso_pu_bacteria 2908446538 2908452839 210
110 iso_pu_bacteria 2919063839 2919068136 210
111 iso_pu_bacteria 2919385768 2919388950 210
112 iso_pu_bacteria 2919487758 2919487880 210
113 iso_pu_bacteria 2929189879 2929195374 210
114 iso_pu_bacteria 2931390751 2931390886 210
115 iso_pu_bacteria 2945928738 2945930693 210
116 iso_pu_bacteria 2945961074 2945967091 210
117 iso_pu_bacteria 2946006987 2946013033 210
118 iso_pu_bacteria 2946027586 2946028124 210
119 iso_pu_bacteria 2947233263 2947234656 210
120 iso_pu_bacteria 2974289157 2974293838 210
121 iso_pu_bacteria 2998139840 2998139989 210
122 iso_pu_bacteria 3007718800 3007723115 210
123 iso_pu_bacteria 3007861166 3007864856 210
124 iso_pu_bacteria 8029995093 8029995264 210
125 iso_pu_bacteria 8054285046 8054290195 210
126 iso_pu_bacteria 8054347763 8054349364 210
127 iso_pu_bacteria 8054503363 8054503493 210
128 iso_pu_bacteria 8055817908 8055824131 210
129 iso_pu_bacteria 8056131705 8056131831 210
130 iso_pu_bacteria 8056148874 8056151273 210
131 iso_pu_bacteria 8056161164 8056163847 210
132 iso_pu_bacteria 8056166840 8056171062 210
133 iso_pu_bacteria 8056569372 8056570712 210
134 3300031548 Ga0307408_100000577 Ga0307408_1000005774 211
135 3300031911 Ga0307412_10037785 Ga0307412_100377854 211
136 3300041405 Ga0439438_033511 Ga0439438_033511_447_1097 211
137 3300041407 Ga0439447_000072 Ga0439447_000072_3159_3809 211
138 3300041411 Ga0439466_0009760 Ga0439466_0009760_467_1117 211
139 3300042009 Ga0439451_029667 Ga0439451_029667_129_779 211
140 3300046492 Ga0495585_0206513 Ga0495585_0206513_125_760 211
141 iso_pu_bacteria 2651869719 2652547593 211
142 iso_pu_bacteria 8015687852 8015693850 211
143 2162886011 MRS1b_contig_3441221 MRS1b_0743.00002150 212
144 3300005290 Ga0065712_10067828 Ga0065712_1006782816 212
145 3300005548 Ga0070665_100001733 Ga0070665_1000017334 212
146 3300006058 Ga0075432_10076856 Ga0075432_100768562 212
147 3300006946 Ga0079104_1002635 Ga0079104_10026357 212
148 3300009092 Ga0105250_10000247 Ga0105250_1000024736 212
149 3300012498 Ga0157345_1000008 Ga0157345_10000089 212
150 3300013306 Ga0163162_10000334 Ga0163162_1000033432 212
151 3300013308 Ga0157375_10194957 Ga0157375_101949572 212
152 3300017792 Ga0163161_10003104 Ga0163161_1000310411 212
153 3300025711 Ga0207696_1001250 Ga0207696_10012509 212
154 3300025728 Ga0207655_1016165 Ga0207655_10161654 212
155 3300025728 Ga0207655_1123287 Ga0207655_11232872 212
156 3300027111 Ga0209281_1002611 Ga0209281_10026116 212
157 3300028379 Ga0268266_10001589 Ga0268266_100015894 212
158 3300030521 Ga0307511_10084189 Ga0307511_100841892 212
159 3300031911 Ga0307412_10284519 Ga0307412_102845192 212
160 3300033180 Ga0307510_10000511 Ga0307510_1000051133 212
161 3300041411 Ga0439466_0000254 Ga0439466_0000254_3779_4441 212
162 3300046452 Ga0495617_001064 Ga0495617_001064_3192_3836 212
163 3300046452 Ga0495617_011766 Ga0495617_011766_353_997 212
164 3300046452 Ga0495617_015949 Ga0495617_015949_1256_1900 212
165 3300046452 Ga0495617_068248 Ga0495617_068248_384_1028 212
166 3300046453 Ga0495627_000264 Ga0495627_000264_3273_3917 212
167 3300046453 Ga0495627_002201 Ga0495627_002201_7130_7774 212
168 3300046453 Ga0495627_006173 Ga0495627_006173_1942_2586 212
169 3300046458 Ga0495591_000308 Ga0495591_000308_3259_3903 212
170 3300046458 Ga0495591_000378 Ga0495591_000378_31929_32573 212
171 3300046458 Ga0495591_000416 Ga0495591_000416_31404_32048 212
172 3300046458 Ga0495591_003070 Ga0495591_003070_1930_2574 212
173 3300046458 Ga0495591_005846 Ga0495591_005846_3096_3740 212
174 3300046458 Ga0495591_010943 Ga0495591_010943_846_1490 212
175 3300046458 Ga0495591_016516 Ga0495591_016516_1035_1679 212
176 3300046460 Ga0495638_0004828 Ga0495638_0004828_6182_6826 212
177 3300046460 Ga0495638_0023281 Ga0495638_0023281_1968_2612 212
178 3300046460 Ga0495638_0047954 Ga0495638_0047954_1983_2627 212
179 3300046463 Ga0495653_0028377 Ga0495653_0028377_1286_1930 212
180 3300046471 Ga0495650_0009452 Ga0495650_0009452_3269_3913 212
181 3300046471 Ga0495650_0014363 Ga0495650_0014363_2451_3095 212
182 3300046471 Ga0495650_0094661 Ga0495650_0094661_342_986 212
183 3300046474 Ga0495605_0003810 Ga0495605_0003810_6264_6908 212
184 3300046474 Ga0495605_0051978 Ga0495605_0051978_922_1566 212
185 3300046474 Ga0495605_0079615 Ga0495605_0079615_192_836 212
186 3300046491 Ga0495584_0009050 Ga0495584_0009050_1880_2524 212
187 3300046491 Ga0495584_0015885 Ga0495584_0015885_1273_1917 212
188 3300046491 Ga0495584_0052120 Ga0495584_0052120_438_1082 212
189 3300046492 Ga0495585_0001542 Ga0495585_0001542_13976_14620 212
190 3300046492 Ga0495585_0004546 Ga0495585_0004546_1899_2543 212
191 3300046492 Ga0495585_0004700 Ga0495585_0004700_6216_6860 212
192 3300046492 Ga0495585_0029133 Ga0495585_0029133_742_1386 212
193 3300046492 Ga0495585_0031727 Ga0495585_0031727_1881_2525 212
194 3300046500 Ga0495596_0002904 Ga0495596_0002904_1799_2443 212
195 3300046500 Ga0495596_0017145 Ga0495596_0017145_1551_2195 212
196 3300046500 Ga0495596_0030861 Ga0495596_0030861_465_1109 212
197 3300046501 Ga0495607_0000418 Ga0495607_0000418_1988_2632 212
198 3300046501 Ga0495607_0016635 Ga0495607_0016635_1852_2496 212
199 3300046501 Ga0495607_0036501 Ga0495607_0036501_1791_2435 212
200 3300046501 Ga0495607_0044448 Ga0495607_0044448_73_717 212
201 3300046506 Ga0495583_0004545 Ga0495583_0004545_3281_3925 212
202 3300046507 Ga0495606_0001377 Ga0495606_0001377_30345_30989 212
203 3300046507 Ga0495606_0014692 Ga0495606_0014692_1033_1677 212
204 3300046507 Ga0495606_0022772 Ga0495606_0022772_1717_2361 212
205 3300046507 Ga0495606_0035084 Ga0495606_0035084_969_1613 212
206 3300046507 Ga0495606_0119432 Ga0495606_0119432_145_789 212
207 3300046507 Ga0495606_0246398 Ga0495606_0246398_241_885 212
208 3300046512 Ga0495610_0001264 Ga0495610_0001264_7364_8008 212
209 3300046512 Ga0495610_0001667 Ga0495610_0001667_3238_3882 212
210 3300046512 Ga0495610_0078761 Ga0495610_0078761_176_820 212
211 3300046513 Ga0495616_0000369 Ga0495616_0000369_3304_3948 212
212 3300046513 Ga0495616_0002682 Ga0495616_0002682_1944_2588 212
213 3300046513 Ga0495616_0005875 Ga0495616_0005875_1946_2590 212
214 3300046513 Ga0495616_0076488 Ga0495616_0076488_245_889 212
215 3300046515 Ga0495620_0000339 Ga0495620_0000339_6266_6910 212
216 3300046515 Ga0495620_0000746 Ga0495620_0000746_16450_17094 212
217 3300046515 Ga0495620_0009278 Ga0495620_0009278_3077_3721 212
218 3300046515 Ga0495620_0026442 Ga0495620_0026442_184_828 212
219 3300046515 Ga0495620_0051689 Ga0495620_0051689_114_758 212
220 3300046518 Ga0495631_0000194 Ga0495631_0000194_34146_34790 212
221 3300046518 Ga0495631_0019186 Ga0495631_0019186_1769_2413 212
222 3300046518 Ga0495631_0020135 Ga0495631_0020135_716_1360 212
223 3300046518 Ga0495631_0026723 Ga0495631_0026723_1791_2435 212
224 3300046519 Ga0495632_0000326 Ga0495632_0000326_3451_4095 212
225 3300046519 Ga0495632_0004614 Ga0495632_0004614_1967_2611 212
226 3300046519 Ga0495632_0014000 Ga0495632_0014000_477_1121 212
227 3300046519 Ga0495632_0027718 Ga0495632_0027718_1443_2087 212
228 3300046519 Ga0495632_0029233 Ga0495632_0029233_343_987 212
229 3300046519 Ga0495632_0109556 Ga0495632_0109556_385_1029 212
230 3300046519 Ga0495632_0158051 Ga0495632_0158051_320_964 212
231 3300046519 Ga0495632_0188978 Ga0495632_0188978_59_703 212
232 3300046520 Ga0495637_0000299 Ga0495637_0000299_3284_3928 212
233 3300046520 Ga0495637_0002974 Ga0495637_0002974_1862_2506 212
234 3300046520 Ga0495637_0007730 Ga0495637_0007730_2842_3486 212
235 3300046520 Ga0495637_0018280 Ga0495637_0018280_645_1289 212
236 3300046520 Ga0495637_0027082 Ga0495637_0027082_205_849 212
237 3300046520 Ga0495637_0086218 Ga0495637_0086218_395_1039 212
238 3300046520 Ga0495637_0106715 Ga0495637_0106715_124_768 212
239 3300046522 Ga0495643_0002533 Ga0495643_0002533_1886_2530 212
240 3300046522 Ga0495643_0004873 Ga0495643_0004873_6676_7320 212
241 3300046522 Ga0495643_0037518 Ga0495643_0037518_1811_2455 212
242 3300046523 Ga0495644_0008721 Ga0495644_0008721_1295_1939 212
243 3300046524 Ga0495648_0000458 Ga0495648_0000458_3250_3894 212
244 3300046524 Ga0495648_0010706 Ga0495648_0010706_3200_3844 212
245 3300046524 Ga0495648_0025318 Ga0495648_0025318_2753_3397 212
246 3300046524 Ga0495648_0034438 Ga0495648_0034438_791_1435 212
247 3300046524 Ga0495648_0038580 Ga0495648_0038580_1951_2595 212
248 3300046524 Ga0495648_0048217 Ga0495648_0048217_1852_2496 212
249 3300046530 Ga0495654_0000372 Ga0495654_0000372_31369_32013 212
250 3300046530 Ga0495654_0007260 Ga0495654_0007260_3365_4009 212
251 3300046530 Ga0495654_0010388 Ga0495654_0010388_2492_3136 212
252 3300046530 Ga0495654_0042524 Ga0495654_0042524_1065_1709 212
253 3300046538 Ga0495609_0000854 Ga0495609_0000854_1845_2489 212
254 3300046538 Ga0495609_0003533 Ga0495609_0003533_1720_2364 212
255 3300046538 Ga0495609_0010965 Ga0495609_0010965_3361_4005 212
256 3300046538 Ga0495609_0012709 Ga0495609_0012709_1667_2311 212
257 3300046538 Ga0495609_0014635 Ga0495609_0014635_1161_1805 212
258 3300046538 Ga0495609_0160732 Ga0495609_0160732_60_704 212
259 3300046542 Ga0495597_0000463 Ga0495597_0000463_31930_32574 212
260 3300046542 Ga0495597_0029161 Ga0495597_0029161_1058_1702 212
261 3300046557 Ga0495622_0000986 Ga0495622_0000986_7930_8574 212
262 3300046558 Ga0495633_0000604 Ga0495633_0000604_2006_2650 212
263 3300046558 Ga0495633_0023450 Ga0495633_0023450_485_1189 212
264 3300046615 Ga0495656_0190640 Ga0495656_0190640_350_994 212
265 3300046616 Ga0495668_0000839 Ga0495668_0000839_1909_2553 212
266 3300046616 Ga0495668_0024445 Ga0495668_0024445_644_1288 212
267 3300046616 Ga0495668_0031340 Ga0495668_0031340_627_1271 212
268 3300046648 Ga0495611_0000098 Ga0495611_0000098_9933_10577 212
269 3300046648 Ga0495611_0020536 Ga0495611_0020536_1484_2128 212
270 3300046648 Ga0495611_0097685 Ga0495611_0097685_154_798 212
271 3300046648 Ga0495611_0130611 Ga0495611_0130611_248_892 212
272 3300046660 Ga0495625_0003294 Ga0495625_0003294_6656_7300 212
273 3300046660 Ga0495625_0007513 Ga0495625_0007513_6779_7423 212
274 3300046660 Ga0495625_0010676 Ga0495625_0010676_1816_2460 212
275 3300046660 Ga0495625_0053034 Ga0495625_0053034_352_996 212
276 3300046660 Ga0495625_0216019 Ga0495625_0216019_206_850 212
277 3300046660 Ga0495625_0453942 Ga0495625_0453942_53_697 212
278 3300046665 Ga0495661_0005873 Ga0495661_0005873_6279_6923 212
279 3300046665 Ga0495661_0055247 Ga0495661_0055247_444_1088 212
280 3300046665 Ga0495661_0275180 Ga0495661_0275180_15_659 212
281 3300046674 Ga0495588_0099404 Ga0495588_0099404_237_881 212
282 3300046691 Ga0495670_0000097 Ga0495670_0000097_34139_34783 212
283 3300046692 Ga0495671_0002546 Ga0495671_0002546_8902_9546 212
284 3300046692 Ga0495671_0004547 Ga0495671_0004547_2885_3529 212
285 3300046692 Ga0495671_0015813 Ga0495671_0015813_92_736 212
286 3300046692 Ga0495671_0029932 Ga0495671_0029932_195_839 212
287 3300046692 Ga0495671_0104195 Ga0495671_0104195_510_1154 212
288 3300046692 Ga0495671_0167594 Ga0495671_0167594_300_944 212
289 3300046694 Ga0495649_0004235 Ga0495649_0004235_6811_7455 212
290 3300046694 Ga0495649_0005455 Ga0495649_0005455_1055_1699 212
291 3300046694 Ga0495649_0006700 Ga0495649_0006700_6410_7054 212
292 3300046694 Ga0495649_0015595 Ga0495649_0015595_92_736 212
293 3300046694 Ga0495649_0065682 Ga0495649_0065682_706_1350 212
294 3300046794 Ga0495589_0000181 Ga0495589_0000181_48551_49195 212
295 3300046794 Ga0495589_0064834 Ga0495589_0064834_620_1264 212
296 3300046794 Ga0495589_0119154 Ga0495589_0119154_589_1233 212
297 3300046810 Ga0495660_0001070 Ga0495660_0001070_17093_17737 212
298 3300046810 Ga0495660_0003515 Ga0495660_0003515_7135_7779 212
299 3300046810 Ga0495660_0003726 Ga0495660_0003726_6703_7347 212
300 3300046810 Ga0495660_0007083 Ga0495660_0007083_3322_3966 212
301 3300046810 Ga0495660_0026975 Ga0495660_0026975_647_1291 212
302 3300046810 Ga0495660_0036114 Ga0495660_0036114_1488_2132 212
303 3300046810 Ga0495660_0041930 Ga0495660_0041930_195_839 212
304 3300046810 Ga0495660_0128713 Ga0495660_0128713_262_906 212
305 3300047320 Ga0495672_0002320 Ga0495672_0002320_4159_4863 212
306 3300047320 Ga0495672_0108274 Ga0495672_0108274_93_737 212
307 3300047320 Ga0495672_0108586 Ga0495672_0108586_150_794 212
308 3300047321 Ga0495676_0006990 Ga0495676_0006990_6409_7053 212
309 3300047322 Ga0495680_0275887 Ga0495680_0275887_330_974 212
310 3300047323 Ga0495683_0003587 Ga0495683_0003587_1846_2490 212
311 3300047323 Ga0495683_0004169 Ga0495683_0004169_1732_2376 212
312 3300047323 Ga0495683_0004313 Ga0495683_0004313_5467_6111 212
313 3300047323 Ga0495683_0031384 Ga0495683_0031384_715_1359 212
314 3300047446 Ga0495679_001227 Ga0495679_001227_1916_2560 212
315 3300047446 Ga0495679_003034 Ga0495679_003034_5596_6240 212
316 3300047446 Ga0495679_035214 Ga0495679_035214_738_1382 212
317 3300047446 Ga0495679_078861 Ga0495679_078861_124_768 212
318 3300047469 Ga0495673_0006038 Ga0495673_0006038_5552_6196 212
319 3300047469 Ga0495673_0015491 Ga0495673_0015491_1832_2476 212
320 3300047469 Ga0495673_0040540 Ga0495673_0040540_62_706 212
321 3300047469 Ga0495673_0044126 Ga0495673_0044126_106_750 212
322 3300047469 Ga0495673_0056965 Ga0495673_0056965_891_1535 212
323 3300047469 Ga0495673_0106633 Ga0495673_0106633_322_966 212
324 3300047470 Ga0495681_0000238 Ga0495681_0000238_1880_2524 212
325 3300047470 Ga0495681_0004280 Ga0495681_0004280_1845_2489 212
326 3300047470 Ga0495681_0005089 Ga0495681_0005089_6347_6991 212
327 3300047470 Ga0495681_0106257 Ga0495681_0106257_129_773 212
328 3300047470 Ga0495681_0108697 Ga0495681_0108697_127_771 212
329 3300047470 Ga0495681_0124047 Ga0495681_0124047_320_964 212
330 3300047472 Ga0495686_0003755 Ga0495686_0003755_8977_9621 212
331 3300047472 Ga0495686_0032973 Ga0495686_0032973_717_1361 212
332 3300048091 Ga0495626_0001979 Ga0495626_0001979_11212_11856 212
333 3300048091 Ga0495626_0005500 Ga0495626_0005500_4807_5451 212
334 3300048091 Ga0495626_0013439 Ga0495626_0013439_1157_1801 212
335 3300048091 Ga0495626_0017923 Ga0495626_0017923_2454_3098 212
336 3300048091 Ga0495626_0020150 Ga0495626_0020150_829_1473 212
337 3300048091 Ga0495626_0034626 Ga0495626_0034626_392_1036 212
338 3300048091 Ga0495626_0066233 Ga0495626_0066233_487_1131 212
339 3300048919 Ga0496116_0000761 Ga0496116_0000761_6888_7532 212
340 3300049459 Ga0495678_002375 Ga0495678_002375_3325_3969 212
341 3300049459 Ga0495678_002740 Ga0495678_002740_8921_9565 212
342 3300049459 Ga0495678_003617 Ga0495678_003617_1927_2571 212
343 3300049459 Ga0495678_015468 Ga0495678_015468_1889_2533 212
344 3300049459 Ga0495678_017718 Ga0495678_017718_1864_2508 212
345 3300049459 Ga0495678_021497 Ga0495678_021497_395_1039 212
346 3300049459 Ga0495678_062782 Ga0495678_062782_332_976 212
347 3300049459 Ga0495678_103357 Ga0495678_103357_254_958 212
348 3300049460 Ga0495682_0000547 Ga0495682_0000547_24601_25245 212
349 3300049460 Ga0495682_0071967 Ga0495682_0071967_159_803 212
350 3300049758 Ga0501241_000051 Ga0501241_000051_28810_29454 212
351 3300049766 Ga0501269_000421 Ga0501269_000421_1756_2400 212
352 3300053111 Ga0500572_000498 Ga0500572_000498_10931_11575 212
353 3300053126 Ga0500621_000935 Ga0500621_000935_25_669 212
354 3300053145 Ga0500586_127041 Ga0500586_127041_88_732 212
355 iso_pu_bacteria 2511231004 2511253563 212
356 iso_pu_bacteria 2511231007 2511269858 212
357 iso_pu_bacteria 2511231008 2511275822 212
358 iso_pu_bacteria 2511231016 2511325168 212
359 iso_pu_bacteria 2511231018 2511337596 212
360 iso_pu_bacteria 2511231019 2511345418 212
361 iso_pu_bacteria 2511231022 2511364348 212
362 iso_pu_bacteria 2599185188 2599503699 212
363 iso_pu_bacteria 2599185289 2599887772 212
364 iso_pu_bacteria 2599185291 2599899537 212
365 iso_pu_bacteria 2599185300 2599933134 212
366 iso_pu_bacteria 2599185302 2599942120 212
367 iso_pu_bacteria 2599185304 2599955101 212
368 iso_pu_bacteria 2599185305 2599962187 212
369 iso_pu_bacteria 2599185306 2599966299 212
370 iso_pu_bacteria 2599185308 2599977148 212
371 iso_pu_bacteria 2599185309 2599984506 212
372 iso_pu_bacteria 2599185310 2599990788 212
373 iso_pu_bacteria 2599185311 2599995040 212
374 iso_pu_bacteria 2599185312 2600000710 212
375 iso_pu_bacteria 2599185313 2600007121 212
376 iso_pu_bacteria 2599185314 2600011419 212
377 iso_pu_bacteria 2599185315 2600019559 212
378 iso_pu_bacteria 2599185320 2600049695 212
379 iso_pu_bacteria 2599185321 2600054069 212
380 iso_pu_bacteria 2599185324 2600072103 212
381 iso_pu_bacteria 2623620446 2624495232 212
382 iso_pu_bacteria 2643221633 2644184243 212
383 iso_pu_bacteria 2643221650 2644282985 212
384 iso_pu_bacteria 2667528170 2671092041 212
385 iso_pu_bacteria 2675903515 2678266380 212
386 iso_pu_bacteria 2744054620 2745007610 212
387 iso_pu_bacteria 2773857670 2774118115 212
388 iso_pu_bacteria 2784132072 2784316883 212
389 iso_pu_bacteria 2791355520 2794599008 212
390 iso_pu_bacteria 2808606377 2808928204 212
391 iso_pu_bacteria 2808606381 2808950614 212
392 iso_pu_bacteria 2808606382 2808961590 212
393 iso_pu_bacteria 2808606445 2809217464 212
394 iso_pu_bacteria 2826581358 2826581652 212
395 iso_pu_bacteria 2842815866 2842817164 212
396 iso_pu_bacteria 2842849001 2842851950 212
397 iso_pu_bacteria 2860339153 2860341961 212
398 iso_pu_bacteria 2919697872 2919702491 212
399 iso_pu_bacteria 2923586266 2923589205 212
400 iso_pu_bacteria 2931396565 2931398358 212
401 iso_pu_bacteria 2988728565 2988731721 212
402 iso_pu_bacteria 3007419365 3007419513 212
403 iso_pu_bacteria 3007511990 3007517416 212
404 iso_pu_bacteria 3007619802 3007622640 212
405 iso_pu_bacteria 8019769354 8019769535 212
406 iso_pu_bacteria 8019775933 8019779713 212
407 iso_pu_bacteria 8057798959 8057802174 212
408 3300002737 JGI25162J39368_1000133 JGI25162J39368_100013360 213
409 3300002771 JGI25163J39215_1000028 JGI25163J39215_100002810 213
410 3300002772 JGI25164J39214_1000107 JGI25164J39214_100010760 213
411 3300003214 JGI25165J46597_1000218 JGI25165J46597_100021860 213
412 3300025207 Ga0209760_100020 Ga0209760_100020140 213
413 3300025231 Ga0207427_100006 Ga0207427_100006188 213
414 3300025233 Ga0209437_100013 Ga0209437_100013188 213
415 3300025261 Ga0209233_1000022 Ga0209233_1000022188 213
416 3300030742 Ga0316183_1070113 Ga0316183_10701136 213
417 3300031507 Ga0307509_10482040 Ga0307509_104820402 213
418 3300031731 Ga0307405_10006596 Ga0307405_100065963 213
419 3300031995 Ga0307409_100014760 Ga0307409_1000147606 213
420 3300041405 Ga0439438_000124 Ga0439438_000124_31925_32566 213
421 3300041405 Ga0439438_000164 Ga0439438_000164_1762_2403 213
422 3300041407 Ga0439447_028088 Ga0439447_028088_264_905 213
423 3300041410 Ga0439461_0029694 Ga0439461_0029694_183_824 213
424 3300041411 Ga0439466_0001569 Ga0439466_0001569_2792_3433 213
425 3300042004 Ga0439445_0022181 Ga0439445_0022181_782_1423 213
426 3300042006 Ga0439432_000851 Ga0439432_000851_6558_7199 213
427 3300042010 Ga0439452_006179 Ga0439452_006179_2592_3233 213
428 3300042010 Ga0439452_008879 Ga0439452_008879_541_1182 213
429 3300042185 Ga0450909_000185 Ga0450909_000185_1001_1642 213
430 3300046491 Ga0495584_0000266 Ga0495584_0000266_32984_33658 213
431 3300046506 Ga0495583_0020973 Ga0495583_0020973_1938_2612 213
432 3300046810 Ga0495660_0014078 Ga0495660_0014078_705_1379 213
433 3300047470 Ga0495681_0007227 Ga0495681_0007227_2929_3573 213
434 3300048915 Ga0496112_0015332 Ga0496112_0015332_2538_3179 213
435 3300049459 Ga0495678_032101 Ga0495678_032101_1298_1972 213
436 iso_pu_bacteria 2511231156 2511827867 213
437 iso_pu_bacteria 2808606361 2808858419 213
438 iso_pu_bacteria 2808606376 2808925849 213
439 iso_pu_bacteria 2808606378 2808938552 213
440 iso_pu_bacteria 2808606380 2808947910 213
441 iso_pu_bacteria 2808606383 2808966904 213
442 iso_pu_bacteria 2808606389 2809001734 213
443 iso_pu_bacteria 2913036834 2913042787 213
444 iso_pu_bacteria 2919481497 2919487204 213
445 iso_pu_bacteria 2931369376 2931372429 213
446 iso_pu_bacteria 8056155041 8056159984 213
447 3300002738 JGI25154J39366_1006527 JGI25154J39366_10065272 214
448 3300003751 Ga0055538_1000012 Ga0055538_1000012164 214
449 3300003752 Ga0055539_1000017 Ga0055539_1000017164 214
450 3300003756 Ga0055533_1000021 Ga0055533_1000021164 214
451 3300003758 Ga0055532_1000020 Ga0055532_100002078 214
452 3300003759 Ga0055525_1000078 Ga0055525_100007835 214
453 3300003761 Ga0055535_1003673 Ga0055535_10036734 214
454 3300003791 Ga0055530_10006761 Ga0055530_100067616 214
455 3300003792 Ga0055540_1000172 Ga0055540_100017216 214
456 3300003794 Ga0055531_10001516 Ga0055531_1000151612 214
457 3300003841 Ga0055541_1000012 Ga0055541_1000012164 214
458 3300005289 Ga0065704_10100876 Ga0065704_101008762 214
459 3300005290 Ga0065712_10068961 Ga0065712_100689617 214
460 3300005331 Ga0070670_100000141 Ga0070670_10000014154 214
461 3300005331 Ga0070670_100000748 Ga0070670_1000007485 214
462 3300005337 Ga0070682_100554252 Ga0070682_1005542521 214
463 3300005344 Ga0070661_100000080 Ga0070661_10000008029 214
464 3300005344 Ga0070661_100086472 Ga0070661_1000864722 214
465 3300005353 Ga0070669_100000330 Ga0070669_10000033014 214
466 3300005353 Ga0070669_100001122 Ga0070669_1000011227 214
467 3300005457 Ga0070662_100000917 Ga0070662_10000091715 214
468 3300005539 Ga0068853_100001428 Ga0068853_10000142814 214
469 3300005548 Ga0070665_100181318 Ga0070665_1001813182 214
470 3300005548 Ga0070665_100251748 Ga0070665_1002517481 214
471 3300005564 Ga0070664_100000141 Ga0070664_10000014129 214
472 3300005564 Ga0070664_100161781 Ga0070664_1001617811 214
473 3300005578 Ga0068854_100018164 Ga0068854_1000181646 214
474 3300005834 Ga0068851_10000039 Ga0068851_1000003944 214
475 3300006051 Ga0075364_10046997 Ga0075364_100469973 214
476 3300006051 Ga0075364_10091942 Ga0075364_100919422 214
477 3300009011 Ga0105251_10000414 Ga0105251_100004146 214
478 3300009011 Ga0105251_10002862 Ga0105251_1000286212 214
479 3300009011 Ga0105251_10003327 Ga0105251_100033278 214
480 3300009011 Ga0105251_10014761 Ga0105251_100147613 214
481 3300009036 Ga0105244_10000073 Ga0105244_1000007363 214
482 3300009036 Ga0105244_10003009 Ga0105244_100030099 214
483 3300009036 Ga0105244_10003428 Ga0105244_100034283 214
484 3300009036 Ga0105244_10011922 Ga0105244_100119226 214
485 3300009036 Ga0105244_10015923 Ga0105244_100159232 214
486 3300009036 Ga0105244_10091429 Ga0105244_100914291 214
487 3300009092 Ga0105250_10000807 Ga0105250_100008078 214
488 3300009092 Ga0105250_10003459 Ga0105250_100034596 214
489 3300009092 Ga0105250_10016850 Ga0105250_100168503 214
490 3300009092 Ga0105250_10019024 Ga0105250_100190242 214
491 3300009092 Ga0105250_10025149 Ga0105250_100251492 214
492 3300009092 Ga0105250_10091580 Ga0105250_100915802 214
493 3300009092 Ga0105250_10110819 Ga0105250_101108192 214
494 3300009148 Ga0105243_10000342 Ga0105243_1000034217 214
495 3300009148 Ga0105243_10012666 Ga0105243_100126662 214
496 3300009176 Ga0105242_10000617 Ga0105242_1000061713 214
497 3300009177 Ga0105248_10002467 Ga0105248_1000246711 214
498 3300009545 Ga0105237_10026023 Ga0105237_100260232 214
499 3300011119 Ga0105246_10000026 Ga0105246_1000002645 214
500 3300011119 Ga0105246_10000129 Ga0105246_1000012910 214
501 3300011119 Ga0105246_10000841 Ga0105246_100008419 214
502 3300011119 Ga0105246_10086710 Ga0105246_100867102 214
503 3300013100 Ga0157373_10003730 Ga0157373_1000373011 214
504 3300013100 Ga0157373_10010758 Ga0157373_100107584 214
505 3300013100 Ga0157373_10011089 Ga0157373_100110893 214
506 3300013100 Ga0157373_10012306 Ga0157373_100123066 214
507 3300013100 Ga0157373_10063532 Ga0157373_100635322 214
508 3300013100 Ga0157373_10637309 Ga0157373_106373091 214
509 3300013102 Ga0157371_10001568 Ga0157371_1000156819 214
510 3300013105 Ga0157369_10017073 Ga0157369_100170739 214
511 3300013105 Ga0157369_10030469 Ga0157369_100304695 214
512 3300013105 Ga0157369_10111701 Ga0157369_101117013 214
513 3300013105 Ga0157369_10369733 Ga0157369_103697332 214
514 3300013105 Ga0157369_11471429 Ga0157369_114714291 214
515 3300013306 Ga0163162_10162508 Ga0163162_101625083 214
516 3300013306 Ga0163162_10172187 Ga0163162_101721872 214
517 3300013306 Ga0163162_10385240 Ga0163162_103852402 214
518 3300013307 Ga0157372_10020265 Ga0157372_100202652 214
519 3300013308 Ga0157375_10001428 Ga0157375_100014283 214
520 3300013308 Ga0157375_10018769 Ga0157375_100187693 214
521 3300013308 Ga0157375_10052073 Ga0157375_100520732 214
522 3300014497 Ga0182008_10000581 Ga0182008_100005818 214
523 3300014497 Ga0182008_10000618 Ga0182008_100006186 214
524 3300014497 Ga0182008_10022202 Ga0182008_100222023 214
525 3300015261 Ga0182006_1002286 Ga0182006_10022867 214
526 3300015261 Ga0182006_1008753 Ga0182006_10087535 214
527 3300015261 Ga0182006_1057293 Ga0182006_10572932 214
528 3300015262 Ga0182007_10004334 Ga0182007_100043343 214
529 3300015262 Ga0182007_10049757 Ga0182007_100497572 214
530 3300015262 Ga0182007_10059639 Ga0182007_100596392 214
531 3300015265 Ga0182005_1044005 Ga0182005_10440051 214
532 3300015265 Ga0182005_1047872 Ga0182005_10478722 214
533 3300017792 Ga0163161_10007411 Ga0163161_100074113 214
534 3300017792 Ga0163161_10018157 Ga0163161_100181571 214
535 3300017792 Ga0163161_10032479 Ga0163161_100324795 214
536 3300017792 Ga0163161_10125525 Ga0163161_101255252 214
537 3300017792 Ga0163161_10126850 Ga0163161_101268502 214
538 3300017792 Ga0163161_10276742 Ga0163161_102767422 214
539 3300025206 Ga0209435_100725 Ga0209435_1007255 214
540 3300025224 Ga0209784_100007 Ga0209784_100007164 214
541 3300025225 Ga0209566_100009 Ga0209566_100009164 214
542 3300025226 Ga0209674_100021 Ga0209674_100021164 214
543 3300025229 Ga0209147_100009 Ga0209147_100009164 214
544 3300025230 Ga0209563_100018 Ga0209563_100018164 214
545 3300025230 Ga0209563_100264 Ga0209563_10026421 214
546 3300025242 Ga0209258_100943 Ga0209258_1009435 214
547 3300025246 Ga0209646_1000533 Ga0209646_100053311 214
548 3300025253 Ga0209677_100012 Ga0209677_100012164 214
549 3300025256 Ga0209759_1028915 Ga0209759_10289152 214
550 3300025292 Ga0209676_1000015 Ga0209676_1000015176 214
551 3300025292 Ga0209676_1000278 Ga0209676_100027832 214
552 3300025298 Ga0209050_1000030 Ga0209050_1000030262 214
553 3300025303 Ga0209051_1000012 Ga0209051_1000012503 214
554 3300025304 Ga0209257_1000143 Ga0209257_100014394 214
555 3300025321 Ga0207656_10000009 Ga0207656_10000009168 214
556 3300025711 Ga0207696_1000080 Ga0207696_1000080139 214
557 3300025711 Ga0207696_1000180 Ga0207696_100018043 214
558 3300025711 Ga0207696_1000184 Ga0207696_100018436 214
559 3300025711 Ga0207696_1014101 Ga0207696_10141014 214
560 3300025711 Ga0207696_1016871 Ga0207696_10168713 214
561 3300025711 Ga0207696_1023768 Ga0207696_10237682 214
562 3300025728 Ga0207655_1000116 Ga0207655_1000116108 214
563 3300025728 Ga0207655_1000261 Ga0207655_100026136 214
564 3300025728 Ga0207655_1000534 Ga0207655_100053435 214
565 3300025728 Ga0207655_1001534 Ga0207655_10015342 214
566 3300025728 Ga0207655_1002071 Ga0207655_10020714 214
567 3300025728 Ga0207655_1002298 Ga0207655_10022986 214
568 3300025728 Ga0207655_1002669 Ga0207655_10026694 214
569 3300025735 Ga0207713_1000312 Ga0207713_100031234 214
570 3300025735 Ga0207713_1000341 Ga0207713_100034142 214
571 3300025735 Ga0207713_1000588 Ga0207713_100058830 214
572 3300025735 Ga0207713_1008338 Ga0207713_10083386 214
573 3300025735 Ga0207713_1009466 Ga0207713_10094664 214
574 3300025735 Ga0207713_1013386 Ga0207713_10133865 214
575 3300025735 Ga0207713_1033361 Ga0207713_10333612 214
576 3300025735 Ga0207713_1040661 Ga0207713_10406611 214
577 3300025920 Ga0207649_10000007 Ga0207649_1000000789 214
578 3300025920 Ga0207649_10044903 Ga0207649_100449032 214
579 3300025923 Ga0207681_10000104 Ga0207681_1000010451 214
580 3300025923 Ga0207681_10004136 Ga0207681_100041367 214
581 3300025925 Ga0207650_10000044 Ga0207650_1000004453 214
582 3300025925 Ga0207650_10000089 Ga0207650_1000008955 214
583 3300025933 Ga0207706_10000483 Ga0207706_100004839 214
584 3300025933 Ga0207706_10012015 Ga0207706_100120152 214
585 3300025934 Ga0207686_10000349 Ga0207686_100003494 214
586 3300025935 Ga0207709_10000061 Ga0207709_1000006140 214
587 3300025935 Ga0207709_10006853 Ga0207709_100068538 214
588 3300025941 Ga0207711_10097159 Ga0207711_100971592 214
589 3300025945 Ga0207679_10000013 Ga0207679_10000013215 214
590 3300026041 Ga0207639_10000091 Ga0207639_1000009160 214
591 3300028379 Ga0268266_10415397 Ga0268266_104153972 214
592 3300030521 Ga0307511_10041491 Ga0307511_100414914 214
593 3300030734 Ga0316179_1062358 Ga0316179_10623583 214
594 3300030735 Ga0316178_1033887 Ga0316178_10338877 214
595 3300031507 Ga0307509_10039538 Ga0307509_100395382 214
596 3300031548 Ga0307408_100014253 Ga0307408_1000142532 214
597 3300031731 Ga0307405_10002579 Ga0307405_100025796 214
598 3300031731 Ga0307405_10065692 Ga0307405_100656922 214
599 3300031731 Ga0307405_10590857 Ga0307405_105908572 214
600 3300031911 Ga0307412_10001132 Ga0307412_1000113214 214
601 3300031911 Ga0307412_10010193 Ga0307412_100101936 214
602 3300031911 Ga0307412_10179044 Ga0307412_101790443 214
603 3300031911 Ga0307412_10731055 Ga0307412_107310552 214
604 3300032002 Ga0307416_100109428 Ga0307416_1001094282 214
605 3300032004 Ga0307414_10025441 Ga0307414_100254413 214
606 3300032005 Ga0307411_10008775 Ga0307411_100087752 214
607 3300032005 Ga0307411_10444856 Ga0307411_104448562 214
608 3300038705 Ga0237819_00766 Ga0237819_00766_3265_3915 214
609 3300041405 Ga0439438_011381 Ga0439438_011381_1800_2450 214
610 3300041405 Ga0439438_011382 Ga0439438_011382_1800_2450 214
611 3300041407 Ga0439447_004239 Ga0439447_004239_581_1231 214
612 3300041407 Ga0439447_011091 Ga0439447_011091_1373_2017 214
613 3300041411 Ga0439466_0004269 Ga0439466_0004269_2153_2803 214
614 3300042002 Ga0439442_028214 Ga0439442_028214_122_772 214
615 3300042004 Ga0439445_0004919 Ga0439445_0004919_2265_2915 214
616 3300042006 Ga0439432_000047 Ga0439432_000047_30269_30913 214
617 3300042006 Ga0439432_020379 Ga0439432_020379_397_1047 214
618 3300042009 Ga0439451_001413 Ga0439451_001413_94_744 214
619 3300042010 Ga0439452_000203 Ga0439452_000203_14515_15165 214
620 3300042010 Ga0439452_010582 Ga0439452_010582_1480_2130 214
621 3300042115 Ga0450911_000407 Ga0450911_000407_9990_10640 214
622 3300042131 Ga0450894_006237 Ga0450894_006237_801_1445 214
623 3300042134 Ga0450898_004679 Ga0450898_004679_1179_1823 214
624 3300042136 Ga0450900_019285 Ga0450900_019285_187_837 214
625 3300042138 Ga0450903_003954 Ga0450903_003954_614_1264 214
626 3300042139 Ga0450904_000793 Ga0450904_000793_677_1348 214
627 3300042139 Ga0450904_001561 Ga0450904_001561_1433_2083 214
628 3300042145 Ga0450906_000042 Ga0450906_000042_4011_4661 214
629 3300042146 Ga0450907_002277 Ga0450907_002277_88_738 214
630 3300042531 Ga0450918_002245 Ga0450918_002245_1681_2331 214
631 3300042532 Ga0450893_0000190 Ga0450893_0000190_1901_2551 214
632 3300046452 Ga0495617_050552 Ga0495617_050552_633_1283 214
633 3300046453 Ga0495627_002802 Ga0495627_002802_931_1575 214
634 3300046454 Ga0495592_0006742 Ga0495592_0006742_6186_6836 214
635 3300046457 Ga0495590_0001890 Ga0495590_0001890_1939_2589 214
636 3300046458 Ga0495591_002254 Ga0495591_002254_962_1606 214
637 3300046460 Ga0495638_0131202 Ga0495638_0131202_631_1281 214
638 3300046463 Ga0495653_0000469 Ga0495653_0000469_3933_4583 214
639 3300046471 Ga0495650_0004905 Ga0495650_0004905_1797_2447 214
640 3300046501 Ga0495607_0000261 Ga0495607_0000261_3263_3913 214
641 3300046501 Ga0495607_0008186 Ga0495607_0008186_542_1186 214
642 3300046501 Ga0495607_0140311 Ga0495607_0140311_98_742 214
643 3300046506 Ga0495583_0006121 Ga0495583_0006121_1412_2056 214
644 3300046507 Ga0495606_0025600 Ga0495606_0025600_2652_3296 214
645 3300046507 Ga0495606_0075500 Ga0495606_0075500_1286_1930 214
646 3300046507 Ga0495606_0095060 Ga0495606_0095060_187_831 214
647 3300046512 Ga0495610_0010914 Ga0495610_0010914_3544_4188 214
648 3300046512 Ga0495610_0033751 Ga0495610_0033751_1445_2089 214
649 3300046513 Ga0495616_0004433 Ga0495616_0004433_1737_2387 214
650 3300046515 Ga0495620_0021207 Ga0495620_0021207_1538_2182 214
651 3300046518 Ga0495631_0052936 Ga0495631_0052936_108_752 214
652 3300046518 Ga0495631_0091342 Ga0495631_0091342_588_1238 214
653 3300046519 Ga0495632_0025713 Ga0495632_0025713_922_1566 214
654 3300046524 Ga0495648_0091522 Ga0495648_0091522_10_654 214
655 3300046526 Ga0495666_0010942 Ga0495666_0010942_3584_4234 214
656 3300046530 Ga0495654_0004777 Ga0495654_0004777_1421_2065 214
657 3300046530 Ga0495654_0009191 Ga0495654_0009191_1295_1939 214
658 3300046530 Ga0495654_0022093 Ga0495654_0022093_1060_1710 214
659 3300046530 Ga0495654_0069031 Ga0495654_0069031_874_1518 214
660 3300046642 Ga0495634_0006530 Ga0495634_0006530_6335_6985 214
661 3300046663 Ga0495635_0159737 Ga0495635_0159737_745_1395 214
662 3300046665 Ga0495661_0000480 Ga0495661_0000480_32041_32685 214
663 3300046665 Ga0495661_0020419 Ga0495661_0020419_1452_2096 214
664 3300046674 Ga0495588_0094526 Ga0495588_0094526_267_917 214
665 3300046680 Ga0495646_0031362 Ga0495646_0031362_906_1556 214
666 3300046689 Ga0495613_0015568 Ga0495613_0015568_2974_3624 214
667 3300046690 Ga0495624_0000569 Ga0495624_0000569_6727_7377 214
668 3300046692 Ga0495671_0006553 Ga0495671_0006553_4513_5163 214
669 3300046794 Ga0495589_0026526 Ga0495589_0026526_1396_2040 214
670 3300046794 Ga0495589_0189637 Ga0495589_0189637_173_817 214
671 3300046809 Ga0495600_0012842 Ga0495600_0012842_3869_4519 214
672 3300046810 Ga0495660_0006769 Ga0495660_0006769_5392_6036 214
673 3300047317 Ga0495604_0067068 Ga0495604_0067068_1364_2014 214
674 3300047320 Ga0495672_0001272 Ga0495672_0001272_21501_22151 214
675 3300047321 Ga0495676_0003819 Ga0495676_0003819_1721_2371 214
676 3300047322 Ga0495680_0001279 Ga0495680_0001279_1609_2259 214
677 3300047446 Ga0495679_001845 Ga0495679_001845_9525_10169 214
678 3300047446 Ga0495679_011786 Ga0495679_011786_1036_1680 214
679 3300047446 Ga0495679_012309 Ga0495679_012309_1503_2147 214
680 3300047470 Ga0495681_0000168 Ga0495681_0000168_1871_2521 214
681 3300047470 Ga0495681_0027175 Ga0495681_0027175_1338_1982 214
682 3300047470 Ga0495681_0027488 Ga0495681_0027488_651_1295 214
683 3300047471 Ga0495684_0006807 Ga0495684_0006807_1863_2513 214
684 3300047673 Ga0495593_0014954 Ga0495593_0014954_2694_3344 214
685 3300048088 Ga0495602_0000508 Ga0495602_0000508_1942_2592 214
686 3300048909 Ga0496106_0212047 Ga0496106_0212047_198_848 214
687 3300048919 Ga0496116_0001051 Ga0496116_0001051_29737_30387 214
688 3300048919 Ga0496116_0005932 Ga0496116_0005932_6517_7167 214
689 3300048920 Ga0496117_0000514 Ga0496117_0000514_50992_51636 214
690 3300048920 Ga0496117_0001501 Ga0496117_0001501_3122_3772 214
691 3300048920 Ga0496117_0017490 Ga0496117_0017490_578_1228 214
692 3300048920 Ga0496117_0028146 Ga0496117_0028146_2538_3182 214
693 3300048920 Ga0496117_0051857 Ga0496117_0051857_957_1601 214
694 3300048920 Ga0496117_0134276 Ga0496117_0134276_654_1307 214
695 3300048920 Ga0496117_0161783 Ga0496117_0161783_558_1208 214
696 3300048921 Ga0496118_0001495 Ga0496118_0001495_31099_31749 214
697 3300048921 Ga0496118_0072717 Ga0496118_0072717_1240_1890 214
698 3300048921 Ga0496118_0077583 Ga0496118_0077583_806_1450 214
699 3300048921 Ga0496118_0207146 Ga0496118_0207146_75_728 214
700 3300048922 Ga0496119_0037865 Ga0496119_0037865_1019_1669 214
701 3300048922 Ga0496119_0037914 Ga0496119_0037914_1771_2415 214
702 3300048923 Ga0496120_0011574 Ga0496120_0011574_4104_4748 214
703 3300048923 Ga0496120_0032212 Ga0496120_0032212_950_1594 214
704 3300048923 Ga0496120_0073580 Ga0496120_0073580_330_974 214
705 3300048923 Ga0496120_0156294 Ga0496120_0156294_40_684 214
706 3300048924 Ga0496121_0001884 Ga0496121_0001884_31142_31792 214
707 3300048924 Ga0496121_0115715 Ga0496121_0115715_1302_1946 214
708 3300048924 Ga0496121_0153095 Ga0496121_0153095_155_805 214
709 3300048925 Ga0496122_0056926 Ga0496122_0056926_1581_2225 214
710 3300048925 Ga0496122_0083959 Ga0496122_0083959_1138_1782 214
711 3300048925 Ga0496122_0088794 Ga0496122_0088794_382_1032 214
712 3300048925 Ga0496122_0108212 Ga0496122_0108212_1093_1737 214
713 3300048925 Ga0496122_0127568 Ga0496122_0127568_771_1421 214
714 3300048925 Ga0496122_0235659 Ga0496122_0235659_41_685 214
715 3300048925 Ga0496122_0270186 Ga0496122_0270186_135_779 214
716 3300048926 Ga0496123_0001506 Ga0496123_0001506_29760_30410 214
717 3300048926 Ga0496123_0056915 Ga0496123_0056915_462_1106 214
718 3300048926 Ga0496123_0063419 Ga0496123_0063419_1377_2021 214
719 3300048926 Ga0496123_0063583 Ga0496123_0063583_95_739 214
720 3300048926 Ga0496123_0133726 Ga0496123_0133726_437_1087 214
721 3300048926 Ga0496123_0148553 Ga0496123_0148553_409_1053 214
722 3300048927 Ga0496124_0002805 Ga0496124_0002805_9084_9728 214
723 3300048927 Ga0496124_0112797 Ga0496124_0112797_1020_1664 214
724 3300048927 Ga0496124_0119069 Ga0496124_0119069_1181_1831 214
725 3300048927 Ga0496124_0119846 Ga0496124_0119846_73_723 214
726 3300048927 Ga0496124_0185743 Ga0496124_0185743_50_694 214
727 3300048928 Ga0496125_0000616 Ga0496125_0000616_8707_9351 214
728 3300048928 Ga0496125_0003676 Ga0496125_0003676_16323_16967 214
729 3300048928 Ga0496125_0016654 Ga0496125_0016654_1763_2413 214
730 3300048928 Ga0496125_0048854 Ga0496125_0048854_1558_2202 214
731 3300048928 Ga0496125_0102199 Ga0496125_0102199_1223_1867 214
732 3300048928 Ga0496125_0105877 Ga0496125_0105877_1321_1965 214
733 3300048929 Ga0496126_0070097 Ga0496126_0070097_1635_2279 214
734 3300048929 Ga0496126_0236104 Ga0496126_0236104_152_796 214
735 3300049459 Ga0495678_030108 Ga0495678_030108_1474_2124 214
736 3300049460 Ga0495682_0002766 Ga0495682_0002766_5717_6367 214
737 3300049673 Ga0501240_000106 Ga0501240_000106_2156_2806 214
738 3300053161 Ga0500634_0035907 Ga0500634_0035907_1463_2107 214
739 iso_pu_bacteria 8056177738 8056182273 214
740 3300002771 JGI25163J39215_1000084 JGI25163J39215_100008433 215
741 3300002772 JGI25164J39214_1000158 JGI25164J39214_100015845 215
742 3300003214 JGI25165J46597_1000285 JGI25165J46597_100028545 215
743 3300006946 Ga0079104_1000189 Ga0079104_100018927 215
744 3300006948 Ga0099826_10095186 Ga0099826_100951863 215
745 3300009148 Ga0105243_10000132 Ga0105243_1000013234 215
746 3300009553 Ga0105249_10027536 Ga0105249_100275363 215
747 3300013102 Ga0157371_10001601 Ga0157371_1000160115 215
748 3300014497 Ga0182008_10059920 Ga0182008_100599202 215
749 3300015261 Ga0182006_1018967 Ga0182006_10189673 215
750 3300025207 Ga0209760_100118 Ga0209760_10011844 215
751 3300025231 Ga0207427_100005 Ga0207427_100005569 215
752 3300025233 Ga0209437_100018 Ga0209437_100018479 215
753 3300025261 Ga0209233_1000021 Ga0209233_1000021569 215
754 3300025935 Ga0207709_10000063 Ga0207709_1000006345 215
755 3300025961 Ga0207712_10054124 Ga0207712_100541242 215
756 3300027111 Ga0209281_1000091 Ga0209281_100009128 215
757 3300027666 Ga0209282_1076432 Ga0209282_10764323 215
758 3300030744 Ga0316181_1118357 Ga0316181_11183576 215
759 3300042129 Ga0450891_000467 Ga0450891_000467_2116_2787 215
760 3300048919 Ga0496116_0000295 Ga0496116_0000295_39041_39742 215
761 3300048920 Ga0496117_0000605 Ga0496117_0000605_44701_45402 215
762 3300048921 Ga0496118_0200756 Ga0496118_0200756_221_922 215
763 3300048923 Ga0496120_0221050 Ga0496120_0221050_74_775 215
764 3300048924 Ga0496121_0000679 Ga0496121_0000679_18052_18753 215
765 3300048925 Ga0496122_0006304 Ga0496122_0006304_5397_6098 215
766 3300048926 Ga0496123_0000692 Ga0496123_0000692_44512_45213 215
767 3300048928 Ga0496125_0156335 Ga0496125_0156335_707_1408 215
768 iso_pu_bacteria 2554235341 2555673077 215
769 iso_pu_bacteria 2599185160 2599355716 215
770 iso_pu_bacteria 2599185161 2599362882 215
771 iso_pu_bacteria 2599185162 2599368812 215
772 iso_pu_bacteria 2599185163 2599375991 215
773 iso_pu_bacteria 2599185164 2599380822 215
774 iso_pu_bacteria 2599185165 2599387662 215
775 iso_pu_bacteria 2599185166 2599394849 215
776 iso_pu_bacteria 2599185168 2599406614 215
777 iso_pu_bacteria 2599185181 2599462550 215
778 iso_pu_bacteria 2599185182 2599468028 215
779 iso_pu_bacteria 2599185186 2599491567 215
780 iso_pu_bacteria 2599185356 2600215174 215
781 iso_pu_bacteria 2600255313 2601775340 215
782 iso_pu_bacteria 2667528171 2671099523 215
783 iso_pu_bacteria 2818991464 2819704669 215
784 iso_pu_bacteria 2917070673 2917076978 215
785 iso_pu_bacteria 2935353572 2935358053 215
786 iso_pu_bacteria 637000220 637323507 215
787 2124908027 MRS2a_Contig_81 MRS2a_00665270 216
788 2162886007 SwRhRL2b_contig_3770479 SwRhRL2b_0155.00003820 216
789 3300003781 Ga0055536_1000055 Ga0055536_100005563 216
790 3300003791 Ga0055530_10000068 Ga0055530_1000006831 216
791 3300003791 Ga0055530_10000077 Ga0055530_1000007717 216
792 3300003792 Ga0055540_1000106 Ga0055540_100010646 216
793 3300003792 Ga0055540_1001024 Ga0055540_10010242 216
794 3300005288 Ga0065714_10000020 Ga0065714_100000209 216
795 3300005288 Ga0065714_10068147 Ga0065714_100681471 216
796 3300005288 Ga0065714_10138342 Ga0065714_101383422 216
797 3300005288 Ga0065714_10145382 Ga0065714_101453822 216
798 3300005288 Ga0065714_10150928 Ga0065714_101509282 216
799 3300005288 Ga0065714_10182287 Ga0065714_101822872 216
800 3300005289 Ga0065704_10235992 Ga0065704_102359921 216
801 3300005293 Ga0065715_10008757 Ga0065715_100087572 216
802 3300006058 Ga0075432_10000027 Ga0075432_100000274 216
803 3300006058 Ga0075432_10001301 Ga0075432_100013013 216
804 3300009011 Ga0105251_10000960 Ga0105251_1000096011 216
805 3300009011 Ga0105251_10005014 Ga0105251_100050144 216
806 3300009036 Ga0105244_10008803 Ga0105244_100088035 216
807 3300009036 Ga0105244_10128002 Ga0105244_101280021 216
808 3300009148 Ga0105243_10000561 Ga0105243_1000056125 216
809 3300009176 Ga0105242_10252539 Ga0105242_102525392 216
810 3300011119 Ga0105246_10279950 Ga0105246_102799502 216
811 3300013100 Ga0157373_10001130 Ga0157373_1000113018 216
812 3300013102 Ga0157371_10000432 Ga0157371_1000043245 216
813 3300013104 Ga0157370_10018090 Ga0157370_100180904 216
814 3300013104 Ga0157370_10035090 Ga0157370_100350904 216
815 3300013104 Ga0157370_10045556 Ga0157370_100455562 216
816 3300013105 Ga0157369_10176134 Ga0157369_101761343 216
817 3300013306 Ga0163162_10019136 Ga0163162_100191364 216
818 3300013306 Ga0163162_10228898 Ga0163162_102288983 216
819 3300013306 Ga0163162_10844253 Ga0163162_108442532 216
820 3300014497 Ga0182008_10005325 Ga0182008_100053257 216
821 3300014497 Ga0182008_10010596 Ga0182008_100105967 216
822 3300014497 Ga0182008_10011352 Ga0182008_100113526 216
823 3300014497 Ga0182008_10175315 Ga0182008_101753152 216
824 3300014497 Ga0182008_10228860 Ga0182008_102288602 216
825 3300015261 Ga0182006_1000737 Ga0182006_100073720 216
826 3300015261 Ga0182006_1003288 Ga0182006_10032889 216
827 3300015261 Ga0182006_1011657 Ga0182006_10116572 216
828 3300015261 Ga0182006_1064489 Ga0182006_10644892 216
829 3300015261 Ga0182006_1101986 Ga0182006_11019862 216
830 3300015262 Ga0182007_10000178 Ga0182007_1000017836 216
831 3300015262 Ga0182007_10026193 Ga0182007_100261932 216
832 3300015265 Ga0182005_1000274 Ga0182005_10002745 216
833 3300015265 Ga0182005_1002162 Ga0182005_10021627 216
834 3300015265 Ga0182005_1037813 Ga0182005_10378132 216
835 3300015265 Ga0182005_1054127 Ga0182005_10541272 216
836 3300017792 Ga0163161_10002740 Ga0163161_100027408 216
837 3300017792 Ga0163161_10062047 Ga0163161_100620472 216
838 3300025292 Ga0209676_1000271 Ga0209676_100027136 216
839 3300025292 Ga0209676_1001196 Ga0209676_100119623 216
840 3300025298 Ga0209050_1000061 Ga0209050_1000061250 216
841 3300025298 Ga0209050_1000241 Ga0209050_100024145 216
842 3300025303 Ga0209051_1000203 Ga0209051_100020334 216
843 3300025303 Ga0209051_1000222 Ga0209051_100022231 216
844 3300025304 Ga0209257_1033798 Ga0209257_10337982 216
845 3300025711 Ga0207696_1097105 Ga0207696_10971051 216
846 3300025728 Ga0207655_1000033 Ga0207655_1000033302 216
847 3300025728 Ga0207655_1002801 Ga0207655_10028018 216
848 3300025728 Ga0207655_1003576 Ga0207655_10035767 216
849 3300025728 Ga0207655_1050013 Ga0207655_10500133 216
850 3300025735 Ga0207713_1001784 Ga0207713_10017843 216
851 3300025735 Ga0207713_1004620 Ga0207713_10046209 216
852 3300025735 Ga0207713_1005288 Ga0207713_10052883 216
853 3300025927 Ga0207687_10323909 Ga0207687_103239093 216
854 3300027907 Ga0207428_10274729 Ga0207428_102747292 216
855 3300028786 Ga0307517_10102067 Ga0307517_101020672 216
856 3300030521 Ga0307511_10020629 Ga0307511_100206294 216
857 3300031548 Ga0307408_100001053 Ga0307408_1000010534 216
858 3300031548 Ga0307408_100002452 Ga0307408_1000024529 216
859 3300031731 Ga0307405_10000816 Ga0307405_100008168 216
860 3300031824 Ga0307413_10003953 Ga0307413_100039536 216
861 3300031852 Ga0307410_10202194 Ga0307410_102021942 216
862 3300031901 Ga0307406_10085574 Ga0307406_100855742 216
863 3300031901 Ga0307406_10126706 Ga0307406_101267062 216
864 3300031911 Ga0307412_10000174 Ga0307412_1000017437 216
865 3300031995 Ga0307409_100040184 Ga0307409_1000401843 216
866 3300032002 Ga0307416_100041878 Ga0307416_1000418782 216
867 3300032004 Ga0307414_10055840 Ga0307414_100558402 216
868 3300032005 Ga0307411_10034957 Ga0307411_100349574 216
869 3300041405 Ga0439438_000135 Ga0439438_000135_26835_27485 216
870 3300041405 Ga0439438_000187 Ga0439438_000187_19836_20486 216
871 3300041405 Ga0439438_000206 Ga0439438_000206_26158_26832 216
872 3300041405 Ga0439438_029606 Ga0439438_029606_771_1421 216
873 3300041405 Ga0439438_076410 Ga0439438_076410_100_750 216
874 3300041407 Ga0439447_000224 Ga0439447_000224_18333_18983 216
875 3300041407 Ga0439447_001709 Ga0439447_001709_2354_3004 216
876 3300041407 Ga0439447_005323 Ga0439447_005323_3105_3779 216
877 3300041407 Ga0439447_020061 Ga0439447_020061_971_1621 216
878 3300041407 Ga0439447_024358 Ga0439447_024358_211_861 216
879 3300041407 Ga0439447_053535 Ga0439447_053535_88_738 216
880 3300041411 Ga0439466_0001112 Ga0439466_0001112_7271_7921 216
881 3300041411 Ga0439466_0001836 Ga0439466_0001836_782_1432 216
882 3300041411 Ga0439466_0003266 Ga0439466_0003266_159_809 216
883 3300041411 Ga0439466_0003837 Ga0439466_0003837_3535_4209 216
884 3300041411 Ga0439466_0020516 Ga0439466_0020516_171_821 216
885 3300041411 Ga0439466_0043612 Ga0439466_0043612_129_779 216
886 3300041413 Ga0439465_0017408 Ga0439465_0017408_1451_2101 216
887 3300041997 Ga0439431_0000017 Ga0439431_0000017_20052_20702 216
888 3300042004 Ga0439445_0018360 Ga0439445_0018360_964_1614 216
889 3300042006 Ga0439432_000164 Ga0439432_000164_16953_17603 216
890 3300042006 Ga0439432_005271 Ga0439432_005271_1093_1743 216
891 3300042006 Ga0439432_035397 Ga0439432_035397_801_1475 216
892 3300042006 Ga0439432_088459 Ga0439432_088459_103_753 216
893 3300042006 Ga0439432_092511 Ga0439432_092511_225_875 216
894 3300042009 Ga0439451_000153 Ga0439451_000153_1258_1908 216
895 3300042009 Ga0439451_002839 Ga0439451_002839_2685_3335 216
896 3300042009 Ga0439451_005319 Ga0439451_005319_218_868 216
897 3300042009 Ga0439451_027465 Ga0439451_027465_151_801 216
898 3300042009 Ga0439451_042704 Ga0439451_042704_109_759 216
899 3300042010 Ga0439452_000205 Ga0439452_000205_26133_26807 216
900 3300042010 Ga0439452_002241 Ga0439452_002241_2852_3502 216
901 3300042010 Ga0439452_004024 Ga0439452_004024_3898_4548 216
902 3300042010 Ga0439452_010872 Ga0439452_010872_1786_2436 216
903 3300042010 Ga0439452_010873 Ga0439452_010873_1786_2436 216
904 3300042010 Ga0439452_011996 Ga0439452_011996_473_1123 216
905 3300042010 Ga0439452_025147 Ga0439452_025147_266_916 216
906 3300042013 Ga0439456_001188 Ga0439456_001188_778_1428 216
907 3300042013 Ga0439456_003376 Ga0439456_003376_1037_1687 216
908 3300042013 Ga0439456_005340 Ga0439456_005340_564_1262 216
909 3300042013 Ga0439456_007949 Ga0439456_007949_1277_1927 216
910 3300042013 Ga0439456_013157 Ga0439456_013157_478_1128 216
911 3300042013 Ga0439456_019745 Ga0439456_019745_605_1255 216
912 3300042013 Ga0439456_030725 Ga0439456_030725_28_678 216
913 3300042013 Ga0439456_033816 Ga0439456_033816_210_860 216
914 3300042013 Ga0439456_040354 Ga0439456_040354_81_731 216
915 3300042013 Ga0439456_050832 Ga0439456_050832_197_847 216
916 3300042016 Ga0439463_000739 Ga0439463_000739_2559_3209 216
917 3300042016 Ga0439463_001230 Ga0439463_001230_2870_3520 216
918 3300042016 Ga0439463_002134 Ga0439463_002134_3666_4364 216
919 3300042016 Ga0439463_010314 Ga0439463_010314_1384_2034 216
920 3300042016 Ga0439463_112503 Ga0439463_112503_25_675 216
921 3300042115 Ga0450911_000099 Ga0450911_000099_3993_4649 216
922 3300042115 Ga0450911_000875 Ga0450911_000875_4040_4690 216
923 3300042121 Ga0450919_000297 Ga0450919_000297_2322_2972 216
924 3300042124 Ga0450922_000337 Ga0450922_000337_3568_4218 216
925 3300042124 Ga0450922_000423 Ga0450922_000423_95_745 216
926 3300042125 Ga0450923_010389 Ga0450923_010389_928_1578 216
927 3300042127 Ga0450890_000090 Ga0450890_000090_11110_11760 216
928 3300042130 Ga0450892_003632 Ga0450892_003632_47_697 216
929 3300042137 Ga0450902_003226 Ga0450902_003226_1521_2171 216
930 3300042137 Ga0450902_008824 Ga0450902_008824_30_704 216
931 3300042137 Ga0450902_010889 Ga0450902_010889_600_1250 216
932 3300042137 Ga0450902_034204 Ga0450902_034204_194_844 216
933 3300042138 Ga0450903_001654 Ga0450903_001654_693_1343 216
934 3300042138 Ga0450903_001942 Ga0450903_001942_1755_2405 216
935 3300042138 Ga0450903_010280 Ga0450903_010280_769_1419 216
936 3300042142 Ga0450905_000850 Ga0450905_000850_2343_2993 216
937 3300042142 Ga0450905_002547 Ga0450905_002547_311_961 216
938 3300042145 Ga0450906_002715 Ga0450906_002715_1461_2111 216
939 3300042146 Ga0450907_000296 Ga0450907_000296_197_847 216
940 3300042146 Ga0450907_003004 Ga0450907_003004_2380_3030 216
941 3300042146 Ga0450907_015006 Ga0450907_015006_446_1096 216
942 3300042147 Ga0450910_000697 Ga0450910_000697_2922_3572 216
943 3300042147 Ga0450910_010411 Ga0450910_010411_575_1225 216
944 3300042147 Ga0450910_013943 Ga0450910_013943_499_1149 216
945 3300042156 Ga0439446_0000498 Ga0439446_0000498_4005_4655 216
946 3300042156 Ga0439446_0000728 Ga0439446_0000728_60_710 216
947 3300042184 Ga0450908_001286 Ga0450908_001286_778_1428 216
948 3300042184 Ga0450908_011345 Ga0450908_011345_628_1302 216
949 3300042185 Ga0450909_000910 Ga0450909_000910_3203_3853 216
950 3300042185 Ga0450909_003947 Ga0450909_003947_1295_1945 216
951 3300042185 Ga0450909_013189 Ga0450909_013189_97_747 216
952 3300042185 Ga0450909_018115 Ga0450909_018115_139_813 216
953 3300042435 Ga0439434_0000007 Ga0439434_0000007_48999_49649 216
954 3300042435 Ga0439434_0014274 Ga0439434_0014274_553_1203 216
955 3300042435 Ga0439434_0038285 Ga0439434_0038285_516_1166 216
956 3300042439 Ga0439464_0000094 Ga0439464_0000094_11033_11683 216
957 3300042461 Ga0439460_0001432 Ga0439460_0001432_2559_3209 216
958 3300042531 Ga0450918_004471 Ga0450918_004471_629_1279 216
959 3300042532 Ga0450893_0003214 Ga0450893_0003214_1409_2059 216
960 3300042532 Ga0450893_0022342 Ga0450893_0022342_322_972 216
961 3300042993 Ga0439440_0000065 Ga0439440_0000065_8841_9491 216
962 3300042993 Ga0439440_0000113 Ga0439440_0000113_2866_3564 216
963 3300042993 Ga0439440_0000565 Ga0439440_0000565_1629_2279 216
964 3300042993 Ga0439440_0008498 Ga0439440_0008498_538_1188 216
965 3300046452 Ga0495617_000124 Ga0495617_000124_16619_17269 216
966 3300046452 Ga0495617_037644 Ga0495617_037644_868_1518 216
967 3300046452 Ga0495617_070976 Ga0495617_070976_79_729 216
968 3300046453 Ga0495627_000115 Ga0495627_000115_15596_16249 216
969 3300046453 Ga0495627_005257 Ga0495627_005257_1525_2175 216
970 3300046453 Ga0495627_009503 Ga0495627_009503_875_1525 216
971 3300046453 Ga0495627_055759 Ga0495627_055759_90_740 216
972 3300046455 Ga0495603_0006127 Ga0495603_0006127_2465_3115 216
973 3300046455 Ga0495603_0015163 Ga0495603_0015163_769_1419 216
974 3300046455 Ga0495603_0027538 Ga0495603_0027538_1165_1815 216
975 3300046455 Ga0495603_0385474 Ga0495603_0385474_34_684 216
976 3300046457 Ga0495590_0016731 Ga0495590_0016731_1573_2223 216
977 3300046457 Ga0495590_0078572 Ga0495590_0078572_216_866 216
978 3300046457 Ga0495590_0078583 Ga0495590_0078583_174_824 216
979 3300046458 Ga0495591_000793 Ga0495591_000793_18582_19232 216
980 3300046458 Ga0495591_005329 Ga0495591_005329_2576_3226 216
981 3300046458 Ga0495591_015175 Ga0495591_015175_166_816 216
982 3300046460 Ga0495638_0002320 Ga0495638_0002320_3222_3872 216
983 3300046460 Ga0495638_0034015 Ga0495638_0034015_528_1202 216
984 3300046460 Ga0495638_0088417 Ga0495638_0088417_827_1477 216
985 3300046463 Ga0495653_0072536 Ga0495653_0072536_615_1265 216
986 3300046463 Ga0495653_0121541 Ga0495653_0121541_813_1478 216
987 3300046471 Ga0495650_0000973 Ga0495650_0000973_3437_4087 216
988 3300046471 Ga0495650_0004032 Ga0495650_0004032_6073_6723 216
989 3300046471 Ga0495650_0004721 Ga0495650_0004721_3241_3891 216
990 3300046471 Ga0495650_0020451 Ga0495650_0020451_429_1079 216
991 3300046474 Ga0495605_0000513 Ga0495605_0000513_17143_17796 216
992 3300046474 Ga0495605_0002060 Ga0495605_0002060_8966_9616 216
993 3300046474 Ga0495605_0005025 Ga0495605_0005025_3641_4291 216
994 3300046474 Ga0495605_0010975 Ga0495605_0010975_3737_4387 216
995 3300046474 Ga0495605_0012669 Ga0495605_0012669_1925_2575 216
996 3300046474 Ga0495605_0027881 Ga0495605_0027881_783_1433 216
997 3300046474 Ga0495605_0039254 Ga0495605_0039254_169_819 216
998 3300046474 Ga0495605_0054230 Ga0495605_0054230_891_1541 216
999 3300046474 Ga0495605_0106480 Ga0495605_0106480_290_940 216
1000 3300046474 Ga0495605_0111589 Ga0495605_0111589_435_1085 216
1001 3300046475 Ga0495639_0000023 Ga0495639_0000023_66476_67126 216
1002 3300046475 Ga0495639_0037329 Ga0495639_0037329_74_724 216
1003 3300046475 Ga0495639_0047262 Ga0495639_0047262_254_904 216
1004 3300046475 Ga0495639_0148342 Ga0495639_0148342_10_660 216
1005 3300046491 Ga0495584_0002127 Ga0495584_0002127_7594_8244 216
1006 3300046491 Ga0495584_0003381 Ga0495584_0003381_4243_4893 216
1007 3300046491 Ga0495584_0012785 Ga0495584_0012785_987_1637 216
1008 3300046491 Ga0495584_0056918 Ga0495584_0056918_837_1493 216
1009 3300046492 Ga0495585_0000527 Ga0495585_0000527_4473_5129 216
1010 3300046492 Ga0495585_0014016 Ga0495585_0014016_458_1108 216
1011 3300046492 Ga0495585_0036980 Ga0495585_0036980_1670_2320 216
1012 3300046492 Ga0495585_0041847 Ga0495585_0041847_848_1498 216
1013 3300046499 Ga0495594_0002306 Ga0495594_0002306_3108_3758 216
1014 3300046499 Ga0495594_0006733 Ga0495594_0006733_3172_3822 216
1015 3300046499 Ga0495594_0009474 Ga0495594_0009474_1271_1921 216
1016 3300046499 Ga0495594_0035892 Ga0495594_0035892_435_1085 216
1017 3300046501 Ga0495607_0000257 Ga0495607_0000257_32824_33474 216
1018 3300046501 Ga0495607_0010285 Ga0495607_0010285_72_722 216
1019 3300046501 Ga0495607_0014933 Ga0495607_0014933_3397_4047 216
1020 3300046501 Ga0495607_0017175 Ga0495607_0017175_3189_3839 216
1021 3300046501 Ga0495607_0023631 Ga0495607_0023631_1555_2205 216
1022 3300046501 Ga0495607_0050850 Ga0495607_0050850_1532_2182 216
1023 3300046501 Ga0495607_0132319 Ga0495607_0132319_102_752 216
1024 3300046506 Ga0495583_0000362 Ga0495583_0000362_43741_44391 216
1025 3300046506 Ga0495583_0006943 Ga0495583_0006943_891_1541 216
1026 3300046506 Ga0495583_0024204 Ga0495583_0024204_112_762 216
1027 3300046506 Ga0495583_0060975 Ga0495583_0060975_144_794 216
1028 3300046506 Ga0495583_0101023 Ga0495583_0101023_333_983 216
1029 3300046506 Ga0495583_0156159 Ga0495583_0156159_222_872 216
1030 3300046507 Ga0495606_0038012 Ga0495606_0038012_682_1332 216
1031 3300046507 Ga0495606_0086629 Ga0495606_0086629_468_1124 216
1032 3300046512 Ga0495610_0004270 Ga0495610_0004270_8612_9262 216
1033 3300046512 Ga0495610_0017102 Ga0495610_0017102_1033_1689 216
1034 3300046512 Ga0495610_0019652 Ga0495610_0019652_2587_3237 216
1035 3300046512 Ga0495610_0022680 Ga0495610_0022680_595_1245 216
1036 3300046512 Ga0495610_0090071 Ga0495610_0090071_182_832 216
1037 3300046513 Ga0495616_0001175 Ga0495616_0001175_5015_5665 216
1038 3300046513 Ga0495616_0005206 Ga0495616_0005206_1445_2095 216
1039 3300046513 Ga0495616_0009145 Ga0495616_0009145_916_1566 216
1040 3300046513 Ga0495616_0072494 Ga0495616_0072494_961_1617 216
1041 3300046515 Ga0495620_0000044 Ga0495620_0000044_74569_75219 216
1042 3300046516 Ga0495628_0467341 Ga0495628_0467341_85_735 216
1043 3300046517 Ga0495630_0005928 Ga0495630_0005928_4419_5084 216
1044 3300046517 Ga0495630_0193990 Ga0495630_0193990_858_1508 216
1045 3300046518 Ga0495631_0000056 Ga0495631_0000056_52247_52897 216
1046 3300046518 Ga0495631_0002932 Ga0495631_0002932_2114_2764 216
1047 3300046518 Ga0495631_0016779 Ga0495631_0016779_1976_2626 216
1048 3300046518 Ga0495631_0044419 Ga0495631_0044419_1283_1933 216
1049 3300046519 Ga0495632_0000454 Ga0495632_0000454_32373_33023 216
1050 3300046519 Ga0495632_0005936 Ga0495632_0005936_3243_3893 216
1051 3300046519 Ga0495632_0024439 Ga0495632_0024439_1319_1975 216
1052 3300046520 Ga0495637_0000352 Ga0495637_0000352_33534_34184 216
1053 3300046520 Ga0495637_0001408 Ga0495637_0001408_5691_6347 216
1054 3300046520 Ga0495637_0003518 Ga0495637_0003518_4181_4831 216
1055 3300046520 Ga0495637_0005637 Ga0495637_0005637_1309_1959 216
1056 3300046520 Ga0495637_0015623 Ga0495637_0015623_2082_2732 216
1057 3300046520 Ga0495637_0102697 Ga0495637_0102697_442_1092 216
1058 3300046522 Ga0495643_0010085 Ga0495643_0010085_1211_1861 216
1059 3300046522 Ga0495643_0026550 Ga0495643_0026550_457_1107 216
1060 3300046522 Ga0495643_0029758 Ga0495643_0029758_339_989 216
1061 3300046522 Ga0495643_0089889 Ga0495643_0089889_713_1363 216
1062 3300046522 Ga0495643_0094375 Ga0495643_0094375_83_739 216
1063 3300046523 Ga0495644_0006145 Ga0495644_0006145_1776_2426 216
1064 3300046524 Ga0495648_0002025 Ga0495648_0002025_3761_4411 216
1065 3300046524 Ga0495648_0030127 Ga0495648_0030127_1521_2171 216
1066 3300046524 Ga0495648_0043954 Ga0495648_0043954_1522_2172 216
1067 3300046524 Ga0495648_0215573 Ga0495648_0215573_272_922 216
1068 3300046524 Ga0495648_0236141 Ga0495648_0236141_147_797 216
1069 3300046526 Ga0495666_0000115 Ga0495666_0000115_3195_3860 216
1070 3300046526 Ga0495666_0004760 Ga0495666_0004760_3226_3876 216
1071 3300046526 Ga0495666_0012480 Ga0495666_0012480_975_1625 216
1072 3300046526 Ga0495666_0118250 Ga0495666_0118250_122_787 216
1073 3300046526 Ga0495666_0135019 Ga0495666_0135019_106_756 216
1074 3300046528 Ga0495642_0000113 Ga0495642_0000113_3958_4608 216
1075 3300046528 Ga0495642_0000773 Ga0495642_0000773_3941_4591 216
1076 3300046530 Ga0495654_0000317 Ga0495654_0000317_34387_35037 216
1077 3300046530 Ga0495654_0003460 Ga0495654_0003460_3615_4265 216
1078 3300046530 Ga0495654_0011641 Ga0495654_0011641_108_758 216
1079 3300046530 Ga0495654_0020965 Ga0495654_0020965_252_902 216
1080 3300046530 Ga0495654_0021378 Ga0495654_0021378_1296_1946 216
1081 3300046530 Ga0495654_0040303 Ga0495654_0040303_1044_1700 216
1082 3300046530 Ga0495654_0109837 Ga0495654_0109837_429_1079 216
1083 3300046530 Ga0495654_0125919 Ga0495654_0125919_78_728 216
1084 3300046536 Ga0495587_0000310 Ga0495587_0000310_20070_20720 216
1085 3300046538 Ga0495609_0000284 Ga0495609_0000284_43739_44389 216
1086 3300046538 Ga0495609_0001504 Ga0495609_0001504_13481_14131 216
1087 3300046538 Ga0495609_0005087 Ga0495609_0005087_916_1566 216
1088 3300046538 Ga0495609_0011342 Ga0495609_0011342_3014_3664 216
1089 3300046538 Ga0495609_0047258 Ga0495609_0047258_377_1027 216
1090 3300046542 Ga0495597_0002086 Ga0495597_0002086_10596_11246 216
1091 3300046542 Ga0495597_0003185 Ga0495597_0003185_3110_3760 216
1092 3300046542 Ga0495597_0003938 Ga0495597_0003938_1272_1922 216
1093 3300046542 Ga0495597_0011680 Ga0495597_0011680_2831_3487 216
1094 3300046542 Ga0495597_0046511 Ga0495597_0046511_1045_1695 216
1095 3300046542 Ga0495597_0196237 Ga0495597_0196237_112_762 216
1096 3300046557 Ga0495622_0008525 Ga0495622_0008525_2826_3476 216
1097 3300046557 Ga0495622_0025543 Ga0495622_0025543_896_1546 216
1098 3300046557 Ga0495622_0130362 Ga0495622_0130362_318_968 216
1099 3300046557 Ga0495622_0141398 Ga0495622_0141398_17_667 216
1100 3300046557 Ga0495622_0148970 Ga0495622_0148970_160_810 216
1101 3300046557 Ga0495622_0239272 Ga0495622_0239272_45_695 216
1102 3300046558 Ga0495633_0000201 Ga0495633_0000201_32120_32770 216
1103 3300046558 Ga0495633_0006707 Ga0495633_0006707_1914_2564 216
1104 3300046558 Ga0495633_0081180 Ga0495633_0081180_691_1341 216
1105 3300046615 Ga0495656_0079213 Ga0495656_0079213_78_728 216
1106 3300046615 Ga0495656_0150215 Ga0495656_0150215_71_721 216
1107 3300046615 Ga0495656_0178877 Ga0495656_0178877_238_888 216
1108 3300046616 Ga0495668_0006724 Ga0495668_0006724_3220_3870 216
1109 3300046616 Ga0495668_0120034 Ga0495668_0120034_89_739 216
1110 3300046642 Ga0495634_0000515 Ga0495634_0000515_34004_34654 216
1111 3300046648 Ga0495611_0001715 Ga0495611_0001715_9090_9740 216
1112 3300046648 Ga0495611_0004017 Ga0495611_0004017_5524_6174 216
1113 3300046648 Ga0495611_0188276 Ga0495611_0188276_241_891 216
1114 3300046660 Ga0495625_0005164 Ga0495625_0005164_7516_8166 216
1115 3300046660 Ga0495625_0013793 Ga0495625_0013793_125_775 216
1116 3300046660 Ga0495625_0024138 Ga0495625_0024138_3258_3908 216
1117 3300046660 Ga0495625_0293462 Ga0495625_0293462_155_805 216
1118 3300046660 Ga0495625_0334874 Ga0495625_0334874_283_939 216
1119 3300046660 Ga0495625_0407195 Ga0495625_0407195_78_728 216
1120 3300046663 Ga0495635_0000201 Ga0495635_0000201_33766_34416 216
1121 3300046664 Ga0495659_0000090 Ga0495659_0000090_3795_4445 216
1122 3300046664 Ga0495659_0003362 Ga0495659_0003362_1337_1987 216
1123 3300046664 Ga0495659_0005974 Ga0495659_0005974_2176_2826 216
1124 3300046664 Ga0495659_0050399 Ga0495659_0050399_201_851 216
1125 3300046665 Ga0495661_0000664 Ga0495661_0000664_30784_31434 216
1126 3300046665 Ga0495661_0072711 Ga0495661_0072711_1256_1906 216
1127 3300046665 Ga0495661_0089736 Ga0495661_0089736_823_1473 216
1128 3300046665 Ga0495661_0107967 Ga0495661_0107967_714_1364 216
1129 3300046674 Ga0495588_0061816 Ga0495588_0061816_1148_1798 216
1130 3300046674 Ga0495588_0121443 Ga0495588_0121443_66_716 216
1131 3300046675 Ga0495657_0014526 Ga0495657_0014526_1970_2635 216
1132 3300046679 Ga0495623_0001314 Ga0495623_0001314_63_728 216
1133 3300046679 Ga0495623_0004455 Ga0495623_0004455_5398_6048 216
1134 3300046680 Ga0495646_0024194 Ga0495646_0024194_2815_3465 216
1135 3300046684 Ga0495669_0213266 Ga0495669_0213266_155_805 216
1136 3300046689 Ga0495613_0048602 Ga0495613_0048602_2059_2709 216
1137 3300046691 Ga0495670_0000246 Ga0495670_0000246_3950_4600 216
1138 3300046691 Ga0495670_0002649 Ga0495670_0002649_4261_4911 216
1139 3300046691 Ga0495670_0009024 Ga0495670_0009024_1825_2475 216
1140 3300046691 Ga0495670_0012278 Ga0495670_0012278_3222_3872 216
1141 3300046691 Ga0495670_0043491 Ga0495670_0043491_669_1319 216
1142 3300046691 Ga0495670_0060728 Ga0495670_0060728_213_863 216
1143 3300046691 Ga0495670_0180859 Ga0495670_0180859_37_687 216
1144 3300046692 Ga0495671_0000258 Ga0495671_0000258_3924_4574 216
1145 3300046692 Ga0495671_0011160 Ga0495671_0011160_1940_2590 216
1146 3300046692 Ga0495671_0017021 Ga0495671_0017021_991_1641 216
1147 3300046692 Ga0495671_0024141 Ga0495671_0024141_525_1175 216
1148 3300046692 Ga0495671_0063789 Ga0495671_0063789_1059_1709 216
1149 3300046692 Ga0495671_0364116 Ga0495671_0364116_10_666 216
1150 3300046694 Ga0495649_0001022 Ga0495649_0001022_4797_5447 216
1151 3300046694 Ga0495649_0011232 Ga0495649_0011232_828_1478 216
1152 3300046694 Ga0495649_0041274 Ga0495649_0041274_657_1307 216
1153 3300046694 Ga0495649_0099185 Ga0495649_0099185_201_857 216
1154 3300046694 Ga0495649_0134435 Ga0495649_0134435_537_1187 216
1155 3300046694 Ga0495649_0311445 Ga0495649_0311445_31_681 216
1156 3300046794 Ga0495589_0000229 Ga0495589_0000229_3352_4002 216
1157 3300046794 Ga0495589_0000716 Ga0495589_0000716_18055_18705 216
1158 3300046794 Ga0495589_0008955 Ga0495589_0008955_2809_3459 216
1159 3300046794 Ga0495589_0014843 Ga0495589_0014843_258_908 216
1160 3300046794 Ga0495589_0033271 Ga0495589_0033271_489_1139 216
1161 3300046810 Ga0495660_0000087 Ga0495660_0000087_21382_22032 216
1162 3300046810 Ga0495660_0001462 Ga0495660_0001462_4098_4748 216
1163 3300046810 Ga0495660_0004857 Ga0495660_0004857_4366_5016 216
1164 3300046810 Ga0495660_0018350 Ga0495660_0018350_2977_3627 216
1165 3300046810 Ga0495660_0045990 Ga0495660_0045990_848_1498 216
1166 3300046810 Ga0495660_0078354 Ga0495660_0078354_229_879 216
1167 3300046810 Ga0495660_0109179 Ga0495660_0109179_222_872 216
1168 3300046810 Ga0495660_0150639 Ga0495660_0150639_164_820 216
1169 3300046810 Ga0495660_0205868 Ga0495660_0205868_46_696 216
1170 3300047315 Ga0495581_0011551 Ga0495581_0011551_692_1342 216
1171 3300047317 Ga0495604_0001188 Ga0495604_0001188_12189_12839 216
1172 3300047317 Ga0495604_0003976 Ga0495604_0003976_9314_9979 216
1173 3300047318 Ga0495636_0008548 Ga0495636_0008548_1499_2149 216
1174 3300047318 Ga0495636_0148418 Ga0495636_0148418_104_754 216
1175 3300047318 Ga0495636_0168504 Ga0495636_0168504_276_926 216
1176 3300047319 Ga0495674_0007599 Ga0495674_0007599_4025_4675 216
1177 3300047320 Ga0495672_0003486 Ga0495672_0003486_8907_9557 216
1178 3300047320 Ga0495672_0003929 Ga0495672_0003929_2417_3067 216
1179 3300047320 Ga0495672_0003942 Ga0495672_0003942_8274_8924 216
1180 3300047320 Ga0495672_0009533 Ga0495672_0009533_3271_3921 216
1181 3300047320 Ga0495672_0009988 Ga0495672_0009988_3110_3760 216
1182 3300047320 Ga0495672_0011213 Ga0495672_0011213_1599_2249 216
1183 3300047320 Ga0495672_0018815 Ga0495672_0018815_2335_2985 216
1184 3300047320 Ga0495672_0231706 Ga0495672_0231706_135_785 216
1185 3300047322 Ga0495680_0010849 Ga0495680_0010849_3184_3849 216
1186 3300047322 Ga0495680_0087730 Ga0495680_0087730_909_1559 216
1187 3300047323 Ga0495683_0000141 Ga0495683_0000141_43664_44314 216
1188 3300047323 Ga0495683_0000295 Ga0495683_0000295_36405_37055 216
1189 3300047323 Ga0495683_0075598 Ga0495683_0075598_119_769 216
1190 3300047323 Ga0495683_0097215 Ga0495683_0097215_160_810 216
1191 3300047323 Ga0495683_0129964 Ga0495683_0129964_160_810 216
1192 3300047323 Ga0495683_0165846 Ga0495683_0165846_144_794 216
1193 3300047443 Ga0495687_001610 Ga0495687_001610_19253_19903 216
1194 3300047443 Ga0495687_003131 Ga0495687_003131_990_1640 216
1195 3300047444 Ga0495675_0004914 Ga0495675_0004914_1966_2616 216
1196 3300047445 Ga0495677_0002416 Ga0495677_0002416_2780_3430 216
1197 3300047446 Ga0495679_000387 Ga0495679_000387_28976_29626 216
1198 3300047446 Ga0495679_009598 Ga0495679_009598_2821_3471 216
1199 3300047447 Ga0495685_014252 Ga0495685_014252_1476_2126 216
1200 3300047469 Ga0495673_0000286 Ga0495673_0000286_16898_17548 216
1201 3300047469 Ga0495673_0003805 Ga0495673_0003805_13_663 216
1202 3300047469 Ga0495673_0009287 Ga0495673_0009287_4542_5192 216
1203 3300047469 Ga0495673_0019044 Ga0495673_0019044_2559_3209 216
1204 3300047469 Ga0495673_0020823 Ga0495673_0020823_2007_2657 216
1205 3300047469 Ga0495673_0023141 Ga0495673_0023141_1977_2627 216
1206 3300047469 Ga0495673_0067092 Ga0495673_0067092_467_1117 216
1207 3300047470 Ga0495681_0000320 Ga0495681_0000320_3134_3784 216
1208 3300047470 Ga0495681_0004576 Ga0495681_0004576_3941_4591 216
1209 3300047470 Ga0495681_0007663 Ga0495681_0007663_4218_4868 216
1210 3300047470 Ga0495681_0019440 Ga0495681_0019440_1689_2345 216
1211 3300047470 Ga0495681_0089614 Ga0495681_0089614_311_961 216
1212 3300047470 Ga0495681_0120613 Ga0495681_0120613_141_791 216
1213 3300047470 Ga0495681_0217573 Ga0495681_0217573_58_708 216
1214 3300047471 Ga0495684_0135222 Ga0495684_0135222_713_1378 216
1215 3300047472 Ga0495686_0001012 Ga0495686_0001012_27113_27769 216
1216 3300047472 Ga0495686_0173385 Ga0495686_0173385_169_819 216
1217 3300047673 Ga0495593_0004195 Ga0495593_0004195_3024_3689 216
1218 3300047673 Ga0495593_0009446 Ga0495593_0009446_2081_2731 216
1219 3300048089 Ga0495614_0092660 Ga0495614_0092660_28_678 216
1220 3300048091 Ga0495626_0000401 Ga0495626_0000401_32096_32746 216
1221 3300048091 Ga0495626_0000488 Ga0495626_0000488_35565_36215 216
1222 3300048091 Ga0495626_0028048 Ga0495626_0028048_1134_1784 216
1223 3300048091 Ga0495626_0030694 Ga0495626_0030694_801_1451 216
1224 3300048091 Ga0495626_0113695 Ga0495626_0113695_345_995 216
1225 3300048905 Ga0496102_0000304 Ga0496102_0000304_48705_49355 216
1226 3300048906 Ga0496103_0000544 Ga0496103_0000544_3146_3796 216
1227 3300048906 Ga0496103_0087803 Ga0496103_0087803_306_956 216
1228 3300048909 Ga0496106_0056693 Ga0496106_0056693_1445_2095 216
1229 3300048913 Ga0496110_0251636 Ga0496110_0251636_279_929 216
1230 3300048917 Ga0496114_0035776 Ga0496114_0035776_877_1527 216
1231 3300048918 Ga0496115_0109112 Ga0496115_0109112_1533_2183 216
1232 3300048919 Ga0496116_0000831 Ga0496116_0000831_3798_4448 216
1233 3300048919 Ga0496116_0005914 Ga0496116_0005914_3606_4256 216
1234 3300048920 Ga0496117_0004709 Ga0496117_0004709_3774_4424 216
1235 3300048921 Ga0496118_0001223 Ga0496118_0001223_35248_35898 216
1236 3300048921 Ga0496118_0114770 Ga0496118_0114770_982_1632 216
1237 3300048922 Ga0496119_0208380 Ga0496119_0208380_223_873 216
1238 3300048924 Ga0496121_0026548 Ga0496121_0026548_329_979 216
1239 3300048924 Ga0496121_0207572 Ga0496121_0207572_708_1358 216
1240 3300048924 Ga0496121_0280267 Ga0496121_0280267_302_952 216
1241 3300048925 Ga0496122_0001433 Ga0496122_0001433_3812_4462 216
1242 3300048927 Ga0496124_0030851 Ga0496124_0030851_3145_3795 216
1243 3300048927 Ga0496124_0043535 Ga0496124_0043535_655_1305 216
1244 3300048927 Ga0496124_0329656 Ga0496124_0329656_137_787 216
1245 3300048928 Ga0496125_0001198 Ga0496125_0001198_34434_35084 216
1246 3300048928 Ga0496125_0009596 Ga0496125_0009596_3097_3747 216
1247 3300048929 Ga0496126_0153975 Ga0496126_0153975_111_761 216
1248 3300049459 Ga0495678_000533 Ga0495678_000533_32253_32903 216
1249 3300049459 Ga0495678_000950 Ga0495678_000950_3876_4526 216
1250 3300049459 Ga0495678_011423 Ga0495678_011423_2689_3339 216
1251 3300049459 Ga0495678_072004 Ga0495678_072004_253_909 216
1252 3300049460 Ga0495682_0014595 Ga0495682_0014595_653_1303 216
1253 3300049460 Ga0495682_0015690 Ga0495682_0015690_1640_2290 216
1254 3300049460 Ga0495682_0015691 Ga0495682_0015691_1640_2290 216
1255 3300049460 Ga0495682_0047089 Ga0495682_0047089_810_1460 216
1256 3300049460 Ga0495682_0104703 Ga0495682_0104703_124_777 216
1257 3300053139 Ga0500568_0072764 Ga0500568_0072764_611_1267 216
1258 iso_pu_bacteria 2511231006 2511266489 216
1259 iso_pu_bacteria 2582580891 2583795495 216
1260 iso_pu_bacteria 2597489887 2597861121 216
1261 iso_pu_bacteria 2599185185 2599487244 216
1262 iso_pu_bacteria 2599185257 2599804408 216
1263 iso_pu_bacteria 2600254931 2600363295 216
1264 iso_pu_bacteria 2671180172 2671771416 216
1265 iso_pu_bacteria 2740892503 2743740660 216
1266 iso_pu_bacteria 2844665904 2844667348 216
1267 iso_pu_bacteria 2984286254 2984286358 216
1268 iso_pu_bacteria 3007395558 3007399146 216
1269 iso_pu_bacteria 8055770955 8055777112 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08856

DUF1826

Protein of unknown function (DUF1826)

37

233

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ey2-assembly1.cif.gz_A human homogentisate dioxygenase with fe(ii) 0.7392 106 208
3nst-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans 0.7238 107 208
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.722 107 210
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.7153 107 209
2i45-assembly1.cif.gz_A crystal structure of protein nmb1881 from neisseria meningitidis 0.7046 107 209
ID Description Score Start End Superfamily
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7271 107 208 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7153 107 209 2.60.120.10
af_I1MCK0_15_334_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.6888 106 207 2.60.120.330
af_A0A0R0FWJ8_13_315_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.6856 106 210 2.60.120.330
5cu1A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6685 107 210 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0P9ZW43-F1-model_v4 Uncharacterized protein 0.9976 92 210
AF-F3G2R7-F1-model_v4 DUF1826 domain-containing protein 0.9918 36 210
AF-A0A6I0CPA1-F1-model_v4 deleted 0.9847 5 210
AF-A0A3D9K0L4-F1-model_v4 deleted 0.9822 1 210
AF-A0A2A5RGC9-F1-model_v4 deleted 0.981 1 210

Feature Viewer

pLDDT pTM Quality
94.11 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map