F492340

General Info

Members Datasets Scaffolds Average Seq Length
1264 432 1074 190

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2511231007|2511271347
Length 205
Sequence SGLLVICLGLAACQGSNPYIATSNPLPPAPPQAAGTFDRSAYPAAPRDYGRYRSWAWLNGHLPPGTAWADSEQVAEAVSNALDQRGLRPLHDNRPADLLVSADLRLETRLRQVQDGSGYGGGYGGGYYGGGYNRYGSGYGMYNTVPVIRTYQVQVVVVRVDLFDASTGQPVWSASAETSSQGNQSERADALREAVEKAMSAYPPS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231031 Pseudomonas sp. GM16 Isolate Nodule
20 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
21 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
22 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
23 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
24 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
25 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
26 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
27 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
28 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
29 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
30 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
31 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
32 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
33 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
34 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
35 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
36 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
37 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
38 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
39 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
40 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
41 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
42 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
43 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
44 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
45 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
46 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
47 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
48 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
49 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
50 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
51 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
52 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
53 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
54 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
55 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
56 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
57 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
58 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
59 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
60 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
61 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
62 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
63 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
64 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
65 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
66 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
67 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
68 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
69 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
70 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
71 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
72 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
73 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
74 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
75 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
76 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
77 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
78 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
79 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
80 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
81 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
82 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
83 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
84 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
85 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
86 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
87 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
88 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
89 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
90 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
91 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
92 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
93 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
94 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
95 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
96 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
97 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
98 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
99 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
100 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
101 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
102 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
103 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
104 2773857670 Pseudomonas sp. 478 Isolate Unclassified
105 2773857673 Pseudomonas sp. 443 Isolate Unclassified
106 2784132063 Pseudomonas sp. 424 Isolate Unclassified
107 2784132072 Pseudomonas sp. 460 Isolate Unclassified
108 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
109 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
110 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
111 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
112 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
113 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
114 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
115 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
116 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
117 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
118 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
119 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
120 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
121 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
122 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
123 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
124 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
125 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
126 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
127 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
128 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
129 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
130 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
131 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
132 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
133 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
134 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
135 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
136 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
137 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
138 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
139 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
140 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
141 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
142 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
143 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
144 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
145 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
146 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
147 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
148 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
149 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
150 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
151 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
152 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
153 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
154 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
155 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
156 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
157 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
158 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
159 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
160 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
161 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
162 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
163 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
164 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
165 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
166 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
167 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
168 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
169 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
170 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
171 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
172 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
173 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
174 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
175 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
176 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
177 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
178 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
179 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
180 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
181 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
182 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
183 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
184 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
185 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
186 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
187 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
188 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
189 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
190 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
191 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
192 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
193 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
194 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
195 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
196 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
197 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
198 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
199 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
200 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
201 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
202 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
203 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
204 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
205 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
206 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
207 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
208 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
209 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
210 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
211 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
212 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
213 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
214 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
215 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
216 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
217 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
218 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
219 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
220 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
221 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
222 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
223 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
224 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
225 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
226 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
227 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
228 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
230 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
231 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
232 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
233 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
251 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
252 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
253 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
254 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
257 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
258 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
259 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
260 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
265 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
266 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
267 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
268 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
269 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
270 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
271 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
272 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
273 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
274 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
275 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
276 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
277 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
278 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
279 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
280 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
281 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
282 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
283 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
284 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
285 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
286 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
287 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
288 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
289 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
290 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
291 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
292 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
293 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
294 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
295 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
296 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
297 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
298 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
299 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
300 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
301 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
302 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
305 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
306 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
307 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
310 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
311 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
312 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
313 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
314 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
315 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
316 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
319 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
320 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
321 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
322 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
323 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
324 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
325 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
329 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
330 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
331 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
332 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
333 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
334 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
335 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
336 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
337 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
338 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
339 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
340 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
341 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
342 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
343 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
344 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
345 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
346 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
347 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
348 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
349 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
350 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
351 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
352 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
353 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
354 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
355 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
356 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
357 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
358 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
359 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
360 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
361 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
362 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
365 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
368 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
369 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
370 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
371 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
372 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
373 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
374 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
375 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
376 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
377 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
378 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
379 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
380 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
381 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
382 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
383 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
384 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
385 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
386 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
387 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
388 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
389 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
390 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
391 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
392 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
393 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
394 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
395 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
396 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
397 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
398 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
399 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
400 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
401 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
402 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
403 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
404 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
405 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
406 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
407 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
408 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
409 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
410 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
413 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
414 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
415 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
416 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
417 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
418 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
419 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
420 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
421 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
422 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
423 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
424 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
425 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
426 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
427 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
428 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
429 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
430 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
431 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
432 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.89
Metatranscriptomes 0.08
Isolates 15.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.51
Nodule 2.06
Rhizoplane 5.62
Rhizosphere 79.27
Stem 0
Stem Tuber 0
Unclassified 8.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1516 2124908027 Bacteria 1895
2 MRS2a_Contig_791 2124908027 Bacteria 27910
3 JGI24741J21665_1014804 3300001915 Bacteria 1296
4 JGI25162J39368_1000195 3300002737 Bacteria 63625
5 JGI25162J39368_1001071 3300002737 Bacteria 16696
6 JGI25163J39215_1000123 3300002771 Bacteria 32339
7 JGI25163J39215_1000353 3300002771 Bacteria 15237
8 JGI25164J39214_1000225 3300002772 Bacteria 44028
9 JGI25164J39214_1000567 3300002772 Bacteria 16696
10 JGI25165J46597_1000291 3300003214 Bacteria 63625
11 JGI25165J46597_1001135 3300003214 Bacteria 16696
12 rootH1_10140646 3300003323 Bacteria 3060
13 Ga0055536_1000245 3300003781 Bacteria 43183
14 Ga0055536_1000299 3300003781 Bacteria 37245
15 Ga0055536_1001194 3300003781 Bacteria 16130
16 Ga0055530_10000340 3300003791 Bacteria 42245
17 Ga0055530_10000375 3300003791 Bacteria 40449
18 Ga0055530_10001838 3300003791 Bacteria 14619
19 Ga0055530_10009095 3300003791 Bacteria 3866
20 Ga0055540_1000162 3300003792 Bacteria 66694
21 Ga0055540_1000992 3300003792 Bacteria 18332
22 Ga0055540_1001362 3300003792 Bacteria 14648
23 Ga0055531_10000734 3300003794 Bacteria 27738
24 Ga0065714_10003643 3300005288 Bacteria 6464
25 Ga0065714_10005368 3300005288 Bacteria 7216
26 Ga0065714_10007939 3300005288 Bacteria 3127
27 Ga0065714_10008542 3300005288 Bacteria 3215
28 Ga0065714_10019801 3300005288 Bacteria 1181
29 Ga0065714_10023278 3300005288 Bacteria 1301
30 Ga0065714_10064979 3300005288 Bacteria 14510
31 Ga0065714_10093459 3300005288 Bacteria 1846
32 Ga0065714_10106764 3300005288 Bacteria 1493
33 Ga0065714_10108617 3300005288 Bacteria 1498
34 Ga0065714_10124951 3300005288 Bacteria 1306
35 Ga0065714_10202672 3300005288 Bacteria 890
36 Ga0065704_10001021 3300005289 Bacteria 14735
37 Ga0065704_10137717 3300005289 Bacteria 1551
38 Ga0065704_10340018 3300005289 Bacteria 825
39 Ga0065712_10069777 3300005290 Bacteria 6716
40 Ga0065715_10002636 3300005293 Bacteria 10823
41 Ga0070661_100540092 3300005344 Bacteria 937
42 Ga0070669_100000487 3300005353 Bacteria 30089
43 Ga0070669_100029076 3300005353 Bacteria 3982
44 Ga0070662_100000294 3300005457 Bacteria 29537
45 Ga0070662_100021890 3300005457 Bacteria 4369
46 Ga0068853_100001403 3300005539 Bacteria 17391
47 Ga0070665_100247608 3300005548 Bacteria 1783
48 Ga0070665_100351967 3300005548 Bacteria 1478
49 Ga0070664_100000135 3300005564 Bacteria 49349
50 Ga0068854_100016166 3300005578 Bacteria 4966
51 Ga0068851_10000004 3300005834 Bacteria 269685
52 Ga0075364_10042942 3300006051 Bacteria 2938
53 Ga0075364_10083882 3300006051 Bacteria 2109
54 Ga0075364_10146011 3300006051 Bacteria 1593
55 Ga0075364_10254572 3300006051 Bacteria 1193
56 Ga0075432_10001366 3300006058 Bacteria 7928
57 Ga0075432_10001932 3300006058 Bacteria 6877
58 Ga0075432_10019196 3300006058 Bacteria 2334
59 Ga0075432_10025418 3300006058 Bacteria 2032
60 Ga0075432_10034724 3300006058 Bacteria 1752
61 Ga0075432_10089623 3300006058 Bacteria 1124
62 Ga0075432_10293630 3300006058 Bacteria 672
63 Ga0075362_10006469 3300006177 Bacteria 4370
64 Ga0075362_10025178 3300006177 Bacteria 2530
65 Ga0075362_10287899 3300006177 Bacteria 813
66 Ga0075436_100126417 3300006914 Bacteria 1791
67 Ga0075436_100199074 3300006914 Bacteria 1418
68 Ga0075436_100219908 3300006914 Bacteria 1347
69 Ga0075436_100354514 3300006914 Bacteria 1058
70 Ga0079104_1000580 3300006946 Bacteria 36883
71 Ga0079104_1001511 3300006946 Bacteria 15449
72 Ga0079104_1001815 3300006946 Bacteria 13178
73 Ga0099826_10003389 3300006948 Bacteria 10787
74 Ga0105251_10000378 3300009011 Bacteria 43722
75 Ga0105251_10002442 3300009011 Bacteria 14621
76 Ga0105251_10015169 3300009011 Bacteria 4222
77 Ga0105251_10116327 3300009011 Bacteria 1216
78 Ga0105251_10126789 3300009011 Bacteria 1158
79 Ga0105251_10170395 3300009011 Bacteria 981
80 Ga0105251_10245100 3300009011 Bacteria 807
81 Ga0105251_10293614 3300009011 Bacteria 736
82 Ga0105244_10001726 3300009036 Bacteria 17210
83 Ga0105244_10015386 3300009036 Bacteria 4389
84 Ga0105244_10044877 3300009036 Bacteria 2276
85 Ga0105244_10085054 3300009036 Bacteria 1561
86 Ga0105244_10094371 3300009036 Bacteria 1469
87 Ga0105244_10122158 3300009036 Bacteria 1261
88 Ga0105244_10125839 3300009036 Bacteria 1239
89 Ga0105244_10127813 3300009036 Bacteria 1227
90 Ga0105250_10001438 3300009092 Bacteria 12844
91 Ga0105250_10003050 3300009092 Bacteria 8090
92 Ga0105250_10005748 3300009092 Bacteria 5525
93 Ga0105250_10028647 3300009092 Bacteria 2243
94 Ga0105250_10045551 3300009092 Bacteria 1759
95 Ga0105250_10228604 3300009092 Bacteria 791
96 Ga0105243_10000225 3300009148 Bacteria 65179
97 Ga0105243_10001399 3300009148 Bacteria 21339
98 Ga0105243_10012262 3300009148 Bacteria 6482
99 Ga0105243_10474482 3300009148 Bacteria 1179
100 Ga0105242_10000147 3300009176 Bacteria 51733
101 Ga0105248_10053025 3300009177 Bacteria 4551
102 Ga0105237_10000613 3300009545 Bacteria 49795
103 Ga0105237_10167975 3300009545 Bacteria 2193
104 Ga0105249_10149629 3300009553 Bacteria 2246
105 Ga0105246_10001581 3300011119 Bacteria 13546
106 Ga0105246_10002727 3300011119 Bacteria 10680
107 Ga0105246_10062259 3300011119 Bacteria 2599
108 Ga0105246_10068698 3300011119 Bacteria 2486
109 Ga0105246_10100253 3300011119 Bacteria 2107
110 Ga0157345_1000032 3300012498 Bacteria 34992
111 Ga0157347_1001892 3300012502 Bacteria 1720
112 Ga0157373_10000305 3300013100 Bacteria 39678
113 Ga0157373_10000478 3300013100 Bacteria 31776
114 Ga0157373_10033746 3300013100 Bacteria 3678
115 Ga0157373_10037185 3300013100 Bacteria 3491
116 Ga0157373_10052278 3300013100 Bacteria 2908
117 Ga0157373_10116434 3300013100 Bacteria 1878
118 Ga0157373_10158868 3300013100 Bacteria 1590
119 Ga0157371_10001273 3300013102 Bacteria 26580
120 Ga0157371_10006721 3300013102 Bacteria 9403
121 Ga0157371_10092732 3300013102 Bacteria 2140
122 Ga0157371_10919627 3300013102 Bacteria 664
123 Ga0157370_10006519 3300013104 Bacteria 12851
124 Ga0157370_10054670 3300013104 Bacteria 3806
125 Ga0157370_10085482 3300013104 Bacteria 2963
126 Ga0157370_10137029 3300013104 Bacteria 2281
127 Ga0157370_10146380 3300013104 Bacteria 2200
128 Ga0157370_10179659 3300013104 Bacteria 1967
129 Ga0157369_10001544 3300013105 Bacteria 28184
130 Ga0157369_10007873 3300013105 Bacteria 12251
131 Ga0157369_10013513 3300013105 Bacteria 9227
132 Ga0157369_10026419 3300013105 Bacteria 6440
133 Ga0157369_10237392 3300013105 Bacteria 1904
134 Ga0157369_10356640 3300013105 Bacteria 1518
135 Ga0163162_10000902 3300013306 Bacteria 27672
136 Ga0163162_10031477 3300013306 Bacteria 5262
137 Ga0163162_10322823 3300013306 Bacteria 1676
138 Ga0157372_10001315 3300013307 Bacteria 26899
139 Ga0157375_10017331 3300013308 Bacteria 6498
140 Ga0157375_10134225 3300013308 Bacteria 2597
141 Ga0157375_10229532 3300013308 Bacteria 2015
142 Ga0157375_10917686 3300013308 Bacteria 1019
143 Ga0182008_10000453 3300014497 Bacteria 31306
144 Ga0182008_10002202 3300014497 Bacteria 12361
145 Ga0182008_10002414 3300014497 Bacteria 11731
146 Ga0182008_10002864 3300014497 Bacteria 10679
147 Ga0182008_10017285 3300014497 Bacteria 3743
148 Ga0182008_10044094 3300014497 Bacteria 2219
149 Ga0182008_10049856 3300014497 Bacteria 2078
150 Ga0182008_10075904 3300014497 Bacteria 1653
151 Ga0182006_1000793 3300015261 Bacteria 21248
152 Ga0182006_1001458 3300015261 Bacteria 14249
153 Ga0182006_1002320 3300015261 Bacteria 10464
154 Ga0182006_1014703 3300015261 Bacteria 3369
155 Ga0182006_1027091 3300015261 Bacteria 2342
156 Ga0182006_1031338 3300015261 Bacteria 2143
157 Ga0182006_1034725 3300015261 Bacteria 2015
158 Ga0182006_1077023 3300015261 Bacteria 1224
159 Ga0182007_10000283 3300015262 Bacteria 33739
160 Ga0182007_10001167 3300015262 Bacteria 14237
161 Ga0182005_1001424 3300015265 Bacteria 9648
162 Ga0182005_1001482 3300015265 Bacteria 9396
163 Ga0182005_1005798 3300015265 Bacteria 3833
164 Ga0182005_1006559 3300015265 Bacteria 3542
165 Ga0182005_1020678 3300015265 Bacteria 1809
166 Ga0182005_1030345 3300015265 Bacteria 1473
167 Ga0182005_1032121 3300015265 Bacteria 1429
168 Ga0182005_1032123 3300015265 Bacteria 1429
169 Ga0182005_1039057 3300015265 Bacteria 1291
170 Ga0182005_1059753 3300015265 Bacteria 1041
171 Ga0163161_10001721 3300017792 Bacteria 16042
172 Ga0163161_10007200 3300017792 Bacteria 7689
173 Ga0163161_10007727 3300017792 Bacteria 7440
174 Ga0163161_10021991 3300017792 Bacteria 4486
175 Ga0163161_10033596 3300017792 Bacteria 3665
176 Ga0163161_10067577 3300017792 Bacteria 2610
177 Ga0163161_10069642 3300017792 Bacteria 2571
178 Ga0163161_10087252 3300017792 Bacteria 2304
179 Ga0163161_10838506 3300017792 Bacteria 775
180 Ga0163161_10846363 3300017792 Bacteria 772
181 Ga0206356_10475313 3300020070 Bacteria 710
182 Ga0209760_100009 3300025207 Bacteria 207878
183 Ga0209760_100031 3300025207 Bacteria 141487
184 Ga0209563_101238 3300025230 Bacteria 7044
185 Ga0207427_100016 3300025231 Bacteria 538697
186 Ga0207427_100067 3300025231 Bacteria 164839
187 Ga0209437_100011 3300025233 Bacteria 818520
188 Ga0209437_100016 3300025233 Bacteria 710118
189 Ga0209233_1000019 3300025261 Bacteria 818520
190 Ga0209233_1000156 3300025261 Bacteria 164839
191 Ga0209675_1002460 3300025291 Bacteria 9509
192 Ga0209676_1000025 3300025292 Bacteria 577569
193 Ga0209676_1000096 3300025292 Bacteria 240620
194 Ga0209676_1000426 3300025292 Bacteria 73938
195 Ga0209676_1004102 3300025292 Bacteria 8314
196 Ga0209050_1000386 3300025298 Bacteria 83132
197 Ga0209050_1000500 3300025298 Bacteria 66746
198 Ga0209050_1001481 3300025298 Bacteria 25025
199 Ga0209050_1001681 3300025298 Bacteria 22213
200 Ga0209051_1000089 3300025303 Bacteria 175572
201 Ga0209051_1000206 3300025303 Bacteria 104064
202 Ga0209051_1000381 3300025303 Bacteria 63284
203 Ga0209051_1011342 3300025303 Bacteria 4407
204 Ga0209257_1000034 3300025304 Bacteria 662719
205 Ga0209257_1005409 3300025304 Bacteria 8983
206 Ga0207656_10000007 3300025321 Bacteria 289154
207 Ga0207696_1000085 3300025711 Bacteria 195968
208 Ga0207696_1000494 3300025711 Bacteria 33110
209 Ga0207696_1001699 3300025711 Bacteria 11431
210 Ga0207696_1014199 3300025711 Bacteria 2741
211 Ga0207696_1028463 3300025711 Bacteria 1714
212 Ga0207655_1000946 3300025728 Bacteria 30094
213 Ga0207655_1002034 3300025728 Bacteria 17088
214 Ga0207655_1002956 3300025728 Bacteria 13061
215 Ga0207655_1006576 3300025728 Bacteria 7670
216 Ga0207655_1015301 3300025728 Bacteria 4273
217 Ga0207655_1023986 3300025728 Bacteria 3005
218 Ga0207655_1024897 3300025728 Bacteria 2921
219 Ga0207655_1024935 3300025728 Bacteria 2918
220 Ga0207655_1040242 3300025728 Bacteria 2020
221 Ga0207655_1057299 3300025728 Bacteria 1531
222 Ga0207655_1064139 3300025728 Bacteria 1403
223 Ga0207655_1094583 3300025728 Bacteria 1044
224 Ga0207655_1165736 3300025728 Bacteria 687
225 Ga0207713_1000323 3300025735 Bacteria 54106
226 Ga0207713_1000494 3300025735 Bacteria 40630
227 Ga0207713_1001693 3300025735 Bacteria 17049
228 Ga0207713_1002389 3300025735 Bacteria 13716
229 Ga0207713_1003397 3300025735 Bacteria 10879
230 Ga0207713_1006219 3300025735 Bacteria 7315
231 Ga0207713_1012218 3300025735 Bacteria 4612
232 Ga0207713_1026211 3300025735 Bacteria 2676
233 Ga0207713_1028690 3300025735 Bacteria 2505
234 Ga0207681_10005475 3300025923 Bacteria 7796
235 Ga0207706_10000178 3300025933 Bacteria 70787
236 Ga0207706_10008048 3300025933 Bacteria 9729
237 Ga0207709_10000022 3300025935 Bacteria 383573
238 Ga0207709_10000634 3300025935 Bacteria 28758
239 Ga0207709_10030967 3300025935 Bacteria 3118
240 Ga0207709_10036406 3300025935 Bacteria 2916
241 Ga0207711_10289370 3300025941 Bacteria 1510
242 Ga0207640_10022649 3300025981 Bacteria 3763
243 Ga0207639_10012481 3300026041 Bacteria 5918
244 Ga0209281_1000033 3300027111 Bacteria 383539
245 Ga0209281_1000159 3300027111 Bacteria 161872
246 Ga0209281_1005994 3300027111 Bacteria 3242
247 Ga0207428_10018645 3300027907 Bacteria 5924
248 Ga0207428_10024997 3300027907 Bacteria 5008
249 Ga0207428_10127380 3300027907 Bacteria 1950
250 Ga0207428_10137810 3300027907 Bacteria 1865
251 Ga0207428_10200258 3300027907 Bacteria 1503
252 Ga0207428_10325475 3300027907 Bacteria 1135
253 Ga0207428_10420964 3300027907 Bacteria 976
254 Ga0268266_10165062 3300028379 Bacteria 2005
255 Ga0268266_10225673 3300028379 Bacteria 1723
256 Ga0307511_10015716 3300030521 Bacteria 7320
257 Ga0307511_10137412 3300030521 Bacteria 1450
258 Ga0316178_1061639 3300030735 Bacteria 10321
259 Ga0316183_1117811 3300030742 Bacteria 1658
260 Ga0316181_1193545 3300030744 Bacteria 2501
261 Ga0316182_1068518 3300030745 Bacteria 1688
262 Ga0307408_100003590 3300031548 Bacteria 10562
263 Ga0307408_100004864 3300031548 Bacteria 9048
264 Ga0307408_100007276 3300031548 Bacteria 7321
265 Ga0307408_100020723 3300031548 Bacteria 4440
266 Ga0307408_100097671 3300031548 Bacteria 2231
267 Ga0307516_10549209 3300031730 Bacteria 809
268 Ga0307405_10000313 3300031731 Bacteria 18014
269 Ga0307405_10001799 3300031731 Bacteria 9177
270 Ga0307405_10121569 3300031731 Bacteria 1787
271 Ga0307413_10023944 3300031824 Bacteria 3318
272 Ga0307406_10030197 3300031901 Bacteria 3288
273 Ga0307406_10192428 3300031901 Bacteria 1494
274 Ga0307406_10308679 3300031901 Bacteria 1218
275 Ga0307407_10206763 3300031903 Bacteria 1319
276 Ga0307412_10000602 3300031911 Bacteria 21185
277 Ga0307412_10001254 3300031911 Bacteria 14314
278 Ga0307412_10002113 3300031911 Bacteria 11025
279 Ga0307412_10004782 3300031911 Bacteria 7560
280 Ga0307412_10011649 3300031911 Bacteria 5100
281 Ga0307412_10051566 3300031911 Bacteria 2719
282 Ga0307409_100237256 3300031995 Bacteria 1657
283 Ga0307416_100127028 3300032002 Bacteria 2286
284 Ga0307416_101000594 3300032002 Bacteria 939
285 Ga0307414_10004291 3300032004 Bacteria 7741
286 Ga0307414_10565204 3300032004 Bacteria 1015
287 Ga0307411_10018373 3300032005 Bacteria 4008
288 Ga0307411_10134156 3300032005 Bacteria 1814
289 Ga0307510_10001007 3300033180 Bacteria 29876
290 Ga0439438_000469 3300041405 Bacteria 18244
291 Ga0439438_000761 3300041405 Bacteria 14436
292 Ga0439438_000803 3300041405 Bacteria 14033
293 Ga0439438_000848 3300041405 Bacteria 13663
294 Ga0439438_000939 3300041405 Bacteria 12989
295 Ga0439438_003074 3300041405 Bacteria 6861
296 Ga0439438_009695 3300041405 Bacteria 3100
297 Ga0439438_020093 3300041405 Bacteria 1878
298 Ga0439438_022912 3300041405 Bacteria 1727
299 Ga0439438_028023 3300041405 Bacteria 1517
300 Ga0439447_000296 3300041407 Bacteria 17686
301 Ga0439447_000888 3300041407 Bacteria 10911
302 Ga0439447_001154 3300041407 Bacteria 9610
303 Ga0439447_001171 3300041407 Bacteria 9554
304 Ga0439447_001226 3300041407 Bacteria 9353
305 Ga0439447_003636 3300041407 Bacteria 5440
306 Ga0439447_009168 3300041407 Bacteria 3016
307 Ga0439447_010654 3300041407 Bacteria 2719
308 Ga0439447_052861 3300041407 Bacteria 966
309 Ga0439447_055348 3300041407 Bacteria 940
310 Ga0439461_0017957 3300041410 Bacteria 1380
311 Ga0439466_0000206 3300041411 Bacteria 23238
312 Ga0439466_0001873 3300041411 Bacteria 8234
313 Ga0439466_0002777 3300041411 Bacteria 6853
314 Ga0439466_0003071 3300041411 Bacteria 6494
315 Ga0439466_0003089 3300041411 Bacteria 6473
316 Ga0439466_0007959 3300041411 Bacteria 3996
317 Ga0439466_0011332 3300041411 Bacteria 3299
318 Ga0439466_0024015 3300041411 Bacteria 2140
319 Ga0439466_0029746 3300041411 Bacteria 1877
320 Ga0439466_0036129 3300041411 Bacteria 1669
321 Ga0439466_0048985 3300041411 Bacteria 1388
322 Ga0439466_0064897 3300041411 Bacteria 1170
323 Ga0439465_0002562 3300041413 Bacteria 5916
324 Ga0451797_0393665 3300041453 Bacteria 722
325 Ga0439431_0051455 3300041997 Bacteria 1068
326 Ga0439445_0028228 3300042004 Bacteria 1445
327 Ga0439445_0160075 3300042004 Bacteria 657
328 Ga0439432_000312 3300042006 Bacteria 17556
329 Ga0439432_000941 3300042006 Bacteria 10965
330 Ga0439432_001657 3300042006 Bacteria 8339
331 Ga0439432_002405 3300042006 Bacteria 7059
332 Ga0439432_005404 3300042006 Bacteria 4603
333 Ga0439432_009764 3300042006 Bacteria 3338
334 Ga0439432_018567 3300042006 Bacteria 2322
335 Ga0439432_022736 3300042006 Bacteria 2070
336 Ga0439432_047896 3300042006 Bacteria 1340
337 Ga0439432_101984 3300042006 Bacteria 857
338 Ga0439451_002028 3300042009 Bacteria 4064
339 Ga0439451_029237 3300042009 Bacteria 1109
340 Ga0439451_033652 3300042009 Bacteria 1030
341 Ga0439451_034132 3300042009 Bacteria 1023
342 Ga0439451_039682 3300042009 Bacteria 945
343 Ga0439451_046263 3300042009 Bacteria 871
344 Ga0439452_000279 3300042010 Bacteria 33718
345 Ga0439452_000951 3300042010 Bacteria 13001
346 Ga0439452_002701 3300042010 Bacteria 6428
347 Ga0439452_005328 3300042010 Bacteria 4150
348 Ga0439452_012515 3300042010 Bacteria 2410
349 Ga0439452_015149 3300042010 Bacteria 2122
350 Ga0439452_032201 3300042010 Bacteria 1282
351 Ga0439452_050780 3300042010 Bacteria 950
352 Ga0439452_062506 3300042010 Bacteria 831
353 Ga0439456_001262 3300042013 Bacteria 5032
354 Ga0439456_001645 3300042013 Bacteria 4509
355 Ga0439456_004272 3300042013 Bacteria 2897
356 Ga0439456_008501 3300042013 Bacteria 2121
357 Ga0439456_026386 3300042013 Bacteria 1235
358 Ga0439456_036935 3300042013 Bacteria 1054
359 Ga0439456_048252 3300042013 Bacteria 929
360 Ga0439456_048864 3300042013 Bacteria 923
361 Ga0439463_000080 3300042016 Bacteria 22262
362 Ga0439463_001572 3300042016 Bacteria 6014
363 Ga0439463_012811 3300042016 Bacteria 2061
364 Ga0439463_019003 3300042016 Bacteria 1711
365 Ga0439463_022565 3300042016 Bacteria 1575
366 Ga0439463_029225 3300042016 Bacteria 1388
367 Ga0439463_111036 3300042016 Bacteria 708
368 Ga0450911_000222 3300042115 Bacteria 22157
369 Ga0450911_005909 3300042115 Bacteria 1859
370 Ga0450911_020044 3300042115 Bacteria 874
371 Ga0450919_000020 3300042121 Bacteria 12646
372 Ga0450919_002131 3300042121 Bacteria 2576
373 Ga0450922_000241 3300042124 Bacteria 5911
374 Ga0450922_000451 3300042124 Bacteria 4410
375 Ga0450890_000104 3300042127 Bacteria 14011
376 Ga0450900_015203 3300042136 Bacteria 1033
377 Ga0450902_006134 3300042137 Bacteria 1834
378 Ga0450902_007934 3300042137 Bacteria 1651
379 Ga0450902_017050 3300042137 Bacteria 1185
380 Ga0450902_021638 3300042137 Bacteria 1063
381 Ga0450903_000565 3300042138 Bacteria 7608
382 Ga0450903_003618 3300042138 Bacteria 2668
383 Ga0450903_005487 3300042138 Bacteria 2123
384 Ga0450903_011872 3300042138 Bacteria 1398
385 Ga0450903_021548 3300042138 Bacteria 995
386 Ga0450903_023232 3300042138 Bacteria 954
387 Ga0450904_006737 3300042139 Bacteria 1145
388 Ga0450905_022066 3300042142 Bacteria 944
389 Ga0450906_000142 3300042145 Bacteria 13113
390 Ga0450906_003193 3300042145 Bacteria 3544
391 Ga0450906_018998 3300042145 Bacteria 1232
392 Ga0450907_000023 3300042146 Bacteria 73314
393 Ga0450907_000578 3300042146 Bacteria 9859
394 Ga0450907_005189 3300042146 Bacteria 2205
395 Ga0450910_005315 3300042147 Bacteria 1752
396 Ga0450910_021055 3300042147 Bacteria 986
397 Ga0439446_0001501 3300042156 Bacteria 5338
398 Ga0439446_0003188 3300042156 Bacteria 4042
399 Ga0439446_0070722 3300042156 Bacteria 1067
400 Ga0439446_0100160 3300042156 Bacteria 916
401 Ga0450908_006854 3300042184 Bacteria 2155
402 Ga0450909_001313 3300042185 Bacteria 3458
403 Ga0450909_014289 3300042185 Bacteria 1169
404 Ga0450909_015610 3300042185 Bacteria 1121
405 Ga0439434_0000059 3300042435 Bacteria 26864
406 Ga0439434_0049460 3300042435 Bacteria 1301
407 Ga0439464_0039154 3300042439 Bacteria 1347
408 Ga0439460_0000742 3300042461 Bacteria 7298
409 Ga0439460_0000763 3300042461 Bacteria 7239
410 Ga0439460_0131771 3300042461 Bacteria 824
411 Ga0450918_009312 3300042531 Bacteria 1723
412 Ga0450893_0035801 3300042532 Bacteria 896
413 Ga0439440_0010751 3300042993 Bacteria 1919
414 Ga0439440_0035044 3300042993 Bacteria 1202
415 Ga0439440_0067356 3300042993 Bacteria 925
416 Ga0495617_000430 3300046452 Bacteria 22663
417 Ga0495617_001678 3300046452 Bacteria 9516
418 Ga0495617_001977 3300046452 Bacteria 8571
419 Ga0495617_007392 3300046452 Bacteria 3811
420 Ga0495617_036928 3300046452 Bacteria 1637
421 Ga0495617_039563 3300046452 Bacteria 1577
422 Ga0495617_078127 3300046452 Bacteria 1085
423 Ga0495617_154004 3300046452 Bacteria 730
424 Ga0495617_170985 3300046452 Bacteria 686
425 Ga0495617_183524 3300046452 Bacteria 657
426 Ga0495627_000549 3300046453 Bacteria 30961
427 Ga0495627_002395 3300046453 Bacteria 9101
428 Ga0495627_002672 3300046453 Bacteria 8356
429 Ga0495627_002942 3300046453 Bacteria 7820
430 Ga0495627_058441 3300046453 Bacteria 1145
431 Ga0495627_121848 3300046453 Bacteria 736
432 Ga0495592_0002303 3300046454 Bacteria 13477
433 Ga0495603_0002644 3300046455 Bacteria 10567
434 Ga0495603_0013095 3300046455 Bacteria 5013
435 Ga0495603_0018910 3300046455 Bacteria 4170
436 Ga0495603_0416260 3300046455 Bacteria 770
437 Ga0495590_0000854 3300046457 Bacteria 13735
438 Ga0495590_0002734 3300046457 Bacteria 7281
439 Ga0495590_0004857 3300046457 Bacteria 5378
440 Ga0495590_0007724 3300046457 Bacteria 4131
441 Ga0495590_0041635 3300046457 Bacteria 1601
442 Ga0495590_0048472 3300046457 Bacteria 1482
443 Ga0495590_0134147 3300046457 Bacteria 891
444 Ga0495590_0182007 3300046457 Bacteria 768
445 Ga0495591_000235 3300046458 Bacteria 53944
446 Ga0495591_000620 3300046458 Bacteria 26619
447 Ga0495591_000952 3300046458 Bacteria 19793
448 Ga0495591_001093 3300046458 Bacteria 18060
449 Ga0495591_002038 3300046458 Bacteria 11735
450 Ga0495591_002945 3300046458 Bacteria 9091
451 Ga0495591_006903 3300046458 Bacteria 4922
452 Ga0495591_007291 3300046458 Bacteria 4729
453 Ga0495591_011493 3300046458 Bacteria 3351
454 Ga0495591_011596 3300046458 Bacteria 3325
455 Ga0495591_026098 3300046458 Bacteria 1822
456 Ga0495591_031637 3300046458 Bacteria 1585
457 Ga0495591_035730 3300046458 Bacteria 1451
458 Ga0495591_038774 3300046458 Bacteria 1369
459 Ga0495591_057105 3300046458 Bacteria 1047
460 Ga0495591_080964 3300046458 Bacteria 827
461 Ga0495591_084743 3300046458 Bacteria 803
462 Ga0495629_0002904 3300046459 Bacteria 13071
463 Ga0495638_0000542 3300046460 Bacteria 43515
464 Ga0495638_0000910 3300046460 Bacteria 30212
465 Ga0495638_0006340 3300046460 Bacteria 8617
466 Ga0495638_0008163 3300046460 Bacteria 7443
467 Ga0495638_0010326 3300046460 Bacteria 6493
468 Ga0495638_0013873 3300046460 Bacteria 5465
469 Ga0495638_0015498 3300046460 Bacteria 5116
470 Ga0495638_0022258 3300046460 Bacteria 4161
471 Ga0495638_0079718 3300046460 Bacteria 1990
472 Ga0495638_0121194 3300046460 Bacteria 1545
473 Ga0495638_0143430 3300046460 Bacteria 1391
474 Ga0495638_0153076 3300046460 Bacteria 1336
475 Ga0495638_0210834 3300046460 Bacteria 1091
476 Ga0495638_0226059 3300046460 Bacteria 1043
477 Ga0495638_0227859 3300046460 Bacteria 1038
478 Ga0495638_0233264 3300046460 Bacteria 1022
479 Ga0495638_0369473 3300046460 Bacteria 752
480 Ga0495653_0001536 3300046463 Bacteria 18054
481 Ga0495653_0072543 3300046463 Bacteria 2570
482 Ga0495653_0144164 3300046463 Bacteria 1671
483 Ga0495650_0003654 3300046471 Bacteria 11040
484 Ga0495650_0005533 3300046471 Bacteria 8164
485 Ga0495650_0009188 3300046471 Bacteria 5658
486 Ga0495650_0015235 3300046471 Bacteria 3952
487 Ga0495650_0032302 3300046471 Bacteria 2342
488 Ga0495650_0057735 3300046471 Bacteria 1569
489 Ga0495650_0060623 3300046471 Bacteria 1518
490 Ga0495650_0071928 3300046471 Bacteria 1354
491 Ga0495650_0137906 3300046471 Bacteria 885
492 Ga0495580_0450706 3300046472 Bacteria 863
493 Ga0495580_0600970 3300046472 Bacteria 727
494 Ga0495582_0007839 3300046473 Bacteria 5900
495 Ga0495605_0001094 3300046474 Bacteria 18064
496 Ga0495605_0001632 3300046474 Bacteria 14494
497 Ga0495605_0003210 3300046474 Bacteria 9807
498 Ga0495605_0006070 3300046474 Bacteria 6980
499 Ga0495605_0007968 3300046474 Bacteria 5996
500 Ga0495605_0009353 3300046474 Bacteria 5508
501 Ga0495605_0010100 3300046474 Bacteria 5289
502 Ga0495605_0019719 3300046474 Bacteria 3596
503 Ga0495605_0044461 3300046474 Bacteria 2195
504 Ga0495605_0063296 3300046474 Bacteria 1765
505 Ga0495605_0117319 3300046474 Bacteria 1209
506 Ga0495605_0255151 3300046474 Bacteria 750
507 Ga0495639_0000045 3300046475 Bacteria 54350
508 Ga0495639_0019939 3300046475 Bacteria 2927
509 Ga0495639_0072404 3300046475 Bacteria 1593
510 Ga0495664_0656245 3300046477 Bacteria 621
511 Ga0495584_0001095 3300046491 Bacteria 16820
512 Ga0495584_0001647 3300046491 Bacteria 13128
513 Ga0495584_0001817 3300046491 Bacteria 12388
514 Ga0495584_0002629 3300046491 Bacteria 10130
515 Ga0495584_0002793 3300046491 Bacteria 9746
516 Ga0495584_0005985 3300046491 Bacteria 6407
517 Ga0495584_0026592 3300046491 Bacteria 2931
518 Ga0495584_0027284 3300046491 Bacteria 2893
519 Ga0495584_0036659 3300046491 Bacteria 2477
520 Ga0495584_0193673 3300046491 Bacteria 1033
521 Ga0495584_0217001 3300046491 Bacteria 972
522 Ga0495584_0301267 3300046491 Bacteria 814
523 Ga0495585_0000748 3300046492 Bacteria 28801
524 Ga0495585_0001365 3300046492 Bacteria 19315
525 Ga0495585_0002379 3300046492 Bacteria 13499
526 Ga0495585_0002556 3300046492 Bacteria 12895
527 Ga0495585_0016382 3300046492 Bacteria 4293
528 Ga0495585_0069994 3300046492 Bacteria 1914
529 Ga0495585_0085867 3300046492 Bacteria 1700
530 Ga0495585_0286103 3300046492 Bacteria 814
531 Ga0495594_0066285 3300046499 Bacteria 2003
532 Ga0495594_0080686 3300046499 Bacteria 1816
533 Ga0495594_0119613 3300046499 Bacteria 1488
534 Ga0495596_0000585 3300046500 Bacteria 22744
535 Ga0495596_0023903 3300046500 Bacteria 2477
536 Ga0495607_0001968 3300046501 Bacteria 17330
537 Ga0495607_0002853 3300046501 Bacteria 13686
538 Ga0495607_0004142 3300046501 Bacteria 10801
539 Ga0495607_0006092 3300046501 Bacteria 8529
540 Ga0495607_0006561 3300046501 Bacteria 8179
541 Ga0495607_0008230 3300046501 Bacteria 7135
542 Ga0495607_0025006 3300046501 Bacteria 3717
543 Ga0495607_0036499 3300046501 Bacteria 2960
544 Ga0495607_0063952 3300046501 Bacteria 2079
545 Ga0495607_0098422 3300046501 Bacteria 1571
546 Ga0495607_0102876 3300046501 Bacteria 1526
547 Ga0495607_0114803 3300046501 Bacteria 1422
548 Ga0495607_0121726 3300046501 Bacteria 1368
549 Ga0495607_0140807 3300046501 Bacteria 1244
550 Ga0495607_0145450 3300046501 Bacteria 1218
551 Ga0495607_0178985 3300046501 Bacteria 1064
552 Ga0495607_0282315 3300046501 Bacteria 787
553 Ga0495607_0322347 3300046501 Bacteria 720
554 Ga0495583_0001460 3300046506 Bacteria 23844
555 Ga0495583_0002338 3300046506 Bacteria 16471
556 Ga0495583_0002939 3300046506 Bacteria 13731
557 Ga0495583_0026635 3300046506 Bacteria 2862
558 Ga0495583_0035558 3300046506 Bacteria 2376
559 Ga0495583_0068725 3300046506 Bacteria 1561
560 Ga0495583_0146834 3300046506 Bacteria 979
561 Ga0495606_0001304 3300046507 Bacteria 34367
562 Ga0495606_0001668 3300046507 Bacteria 28854
563 Ga0495606_0004686 3300046507 Bacteria 13513
564 Ga0495606_0005046 3300046507 Bacteria 12849
565 Ga0495606_0020888 3300046507 Bacteria 4810
566 Ga0495606_0025669 3300046507 Bacteria 4214
567 Ga0495606_0042717 3300046507 Bacteria 3029
568 Ga0495606_0084429 3300046507 Bacteria 1966
569 Ga0495606_0110339 3300046507 Bacteria 1660
570 Ga0495606_0288376 3300046507 Bacteria 894
571 Ga0495610_0001104 3300046512 Bacteria 24556
572 Ga0495610_0002996 3300046512 Bacteria 13596
573 Ga0495610_0004751 3300046512 Bacteria 9905
574 Ga0495610_0005125 3300046512 Bacteria 9417
575 Ga0495610_0006111 3300046512 Bacteria 8395
576 Ga0495610_0007258 3300046512 Bacteria 7425
577 Ga0495610_0012148 3300046512 Bacteria 5205
578 Ga0495610_0033032 3300046512 Bacteria 2679
579 Ga0495610_0102067 3300046512 Bacteria 1283
580 Ga0495610_0139960 3300046512 Bacteria 1042
581 Ga0495610_0145996 3300046512 Bacteria 1013
582 Ga0495610_0162337 3300046512 Bacteria 943
583 Ga0495610_0175807 3300046512 Bacteria 894
584 Ga0495616_0000505 3300046513 Bacteria 29552
585 Ga0495616_0000706 3300046513 Bacteria 24753
586 Ga0495616_0001234 3300046513 Bacteria 17986
587 Ga0495616_0007653 3300046513 Bacteria 6461
588 Ga0495616_0009837 3300046513 Bacteria 5568
589 Ga0495616_0011334 3300046513 Bacteria 5117
590 Ga0495616_0015912 3300046513 Bacteria 4170
591 Ga0495616_0049006 3300046513 Bacteria 2119
592 Ga0495616_0057706 3300046513 Bacteria 1913
593 Ga0495616_0263279 3300046513 Bacteria 737
594 Ga0495620_0000355 3300046515 Bacteria 31797
595 Ga0495620_0003566 3300046515 Bacteria 8897
596 Ga0495620_0005462 3300046515 Bacteria 7085
597 Ga0495620_0033581 3300046515 Bacteria 2328
598 Ga0495620_0066763 3300046515 Bacteria 1481
599 Ga0495620_0081305 3300046515 Bacteria 1310
600 Ga0495620_0113279 3300046515 Bacteria 1073
601 Ga0495628_0097825 3300046516 Bacteria 2267
602 Ga0495630_0002068 3300046517 Bacteria 13950
603 Ga0495630_0025822 3300046517 Bacteria 4345
604 Ga0495630_0044082 3300046517 Bacteria 3333
605 Ga0495630_0352950 3300046517 Bacteria 1125
606 Ga0495631_0000532 3300046518 Bacteria 25537
607 Ga0495631_0002497 3300046518 Bacteria 10351
608 Ga0495631_0002978 3300046518 Bacteria 9376
609 Ga0495631_0028894 3300046518 Bacteria 2527
610 Ga0495631_0094973 3300046518 Bacteria 1283
611 Ga0495631_0106110 3300046518 Bacteria 1208
612 Ga0495631_0152363 3300046518 Bacteria 992
613 Ga0495631_0211130 3300046518 Bacteria 829
614 Ga0495631_0283176 3300046518 Bacteria 706
615 Ga0495632_0000408 3300046519 Bacteria 40601
616 Ga0495632_0000497 3300046519 Bacteria 37001
617 Ga0495632_0000714 3300046519 Bacteria 30107
618 Ga0495632_0003573 3300046519 Bacteria 10962
619 Ga0495632_0005134 3300046519 Bacteria 8739
620 Ga0495632_0010125 3300046519 Bacteria 5613
621 Ga0495632_0014780 3300046519 Bacteria 4403
622 Ga0495632_0018272 3300046519 Bacteria 3850
623 Ga0495632_0018632 3300046519 Bacteria 3804
624 Ga0495632_0023794 3300046519 Bacteria 3265
625 Ga0495632_0117762 3300046519 Bacteria 1243
626 Ga0495632_0222826 3300046519 Bacteria 852
627 Ga0495637_0001312 3300046520 Bacteria 14928
628 Ga0495637_0001344 3300046520 Bacteria 14757
629 Ga0495637_0001653 3300046520 Bacteria 12889
630 Ga0495637_0003145 3300046520 Bacteria 8809
631 Ga0495637_0003163 3300046520 Bacteria 8787
632 Ga0495637_0003450 3300046520 Bacteria 8400
633 Ga0495637_0004759 3300046520 Bacteria 7000
634 Ga0495637_0005825 3300046520 Bacteria 6239
635 Ga0495637_0023558 3300046520 Bacteria 2796
636 Ga0495637_0025805 3300046520 Bacteria 2645
637 Ga0495637_0059331 3300046520 Bacteria 1574
638 Ga0495637_0110226 3300046520 Bacteria 1067
639 Ga0495637_0114485 3300046520 Bacteria 1042
640 Ga0495637_0118707 3300046520 Bacteria 1019
641 Ga0495643_0004192 3300046522 Bacteria 10214
642 Ga0495643_0005087 3300046522 Bacteria 8993
643 Ga0495643_0008424 3300046522 Bacteria 6527
644 Ga0495643_0009871 3300046522 Bacteria 5901
645 Ga0495643_0030259 3300046522 Bacteria 3025
646 Ga0495643_0078461 3300046522 Bacteria 1723
647 Ga0495643_0134542 3300046522 Bacteria 1238
648 Ga0495643_0152113 3300046522 Bacteria 1145
649 Ga0495643_0164920 3300046522 Bacteria 1087
650 Ga0495643_0203683 3300046522 Bacteria 948
651 Ga0495643_0290180 3300046522 Bacteria 749
652 Ga0495644_0000278 3300046523 Bacteria 23512
653 Ga0495644_0000335 3300046523 Bacteria 21541
654 Ga0495644_0002163 3300046523 Bacteria 7891
655 Ga0495644_0004669 3300046523 Bacteria 5382
656 Ga0495644_0009204 3300046523 Bacteria 3806
657 Ga0495644_0016087 3300046523 Bacteria 2865
658 Ga0495644_0022515 3300046523 Bacteria 2402
659 Ga0495648_0000735 3300046524 Bacteria 34912
660 Ga0495648_0002706 3300046524 Bacteria 16013
661 Ga0495648_0004227 3300046524 Bacteria 12319
662 Ga0495648_0005719 3300046524 Bacteria 10266
663 Ga0495648_0006344 3300046524 Bacteria 9671
664 Ga0495648_0012158 3300046524 Bacteria 6439
665 Ga0495648_0015495 3300046524 Bacteria 5533
666 Ga0495648_0022456 3300046524 Bacteria 4343
667 Ga0495648_0050052 3300046524 Bacteria 2556
668 Ga0495648_0135186 3300046524 Bacteria 1305
669 Ga0495648_0144104 3300046524 Bacteria 1250
670 Ga0495648_0224613 3300046524 Bacteria 923
671 Ga0495648_0293154 3300046524 Bacteria 765
672 Ga0495666_0001356 3300046526 Bacteria 11871
673 Ga0495666_0004282 3300046526 Bacteria 7202
674 Ga0495666_0011341 3300046526 Bacteria 4446
675 Ga0495666_0035480 3300046526 Bacteria 2431
676 Ga0495642_0000051 3300046528 Bacteria 71226
677 Ga0495642_0000120 3300046528 Bacteria 45031
678 Ga0495642_0000765 3300046528 Bacteria 15753
679 Ga0495652_0383431 3300046529 Bacteria 999
680 Ga0495654_0000613 3300046530 Bacteria 28376
681 Ga0495654_0000786 3300046530 Bacteria 24451
682 Ga0495654_0001854 3300046530 Bacteria 14066
683 Ga0495654_0002395 3300046530 Bacteria 12099
684 Ga0495654_0003771 3300046530 Bacteria 9178
685 Ga0495654_0012390 3300046530 Bacteria 4581
686 Ga0495654_0014270 3300046530 Bacteria 4233
687 Ga0495654_0017111 3300046530 Bacteria 3817
688 Ga0495654_0036639 3300046530 Bacteria 2464
689 Ga0495654_0048359 3300046530 Bacteria 2087
690 Ga0495654_0051118 3300046530 Bacteria 2017
691 Ga0495654_0058383 3300046530 Bacteria 1862
692 Ga0495654_0063591 3300046530 Bacteria 1766
693 Ga0495654_0070627 3300046530 Bacteria 1655
694 Ga0495654_0076383 3300046530 Bacteria 1578
695 Ga0495654_0113234 3300046530 Bacteria 1235
696 Ga0495654_0114570 3300046530 Bacteria 1226
697 Ga0495654_0123951 3300046530 Bacteria 1166
698 Ga0495654_0182523 3300046530 Bacteria 908
699 Ga0495586_0031461 3300046535 Bacteria 2843
700 Ga0495587_0005946 3300046536 Bacteria 7955
701 Ga0495587_0008447 3300046536 Bacteria 6618
702 Ga0495587_0388886 3300046536 Bacteria 775
703 Ga0495609_0000505 3300046538 Bacteria 31398
704 Ga0495609_0003591 3300046538 Bacteria 8817
705 Ga0495609_0003855 3300046538 Bacteria 8431
706 Ga0495609_0012662 3300046538 Bacteria 3999
707 Ga0495609_0029214 3300046538 Bacteria 2511
708 Ga0495609_0029348 3300046538 Bacteria 2504
709 Ga0495609_0030642 3300046538 Bacteria 2447
710 Ga0495609_0031918 3300046538 Bacteria 2393
711 Ga0495609_0123269 3300046538 Bacteria 1113
712 Ga0495609_0218757 3300046538 Bacteria 791
713 Ga0495597_0000659 3300046542 Bacteria 28075
714 Ga0495597_0004856 3300046542 Bacteria 7247
715 Ga0495597_0005573 3300046542 Bacteria 6644
716 Ga0495597_0006485 3300046542 Bacteria 6051
717 Ga0495597_0007229 3300046542 Bacteria 5657
718 Ga0495597_0059753 3300046542 Bacteria 1663
719 Ga0495597_0092375 3300046542 Bacteria 1283
720 Ga0495597_0094062 3300046542 Bacteria 1269
721 Ga0495597_0120444 3300046542 Bacteria 1094
722 Ga0495597_0121200 3300046542 Bacteria 1090
723 Ga0495597_0133842 3300046542 Bacteria 1026
724 Ga0495645_0055176 3300046543 Bacteria 2885
725 Ga0495645_0100041 3300046543 Bacteria 2062
726 Ga0495622_0000609 3300046557 Bacteria 20745
727 Ga0495622_0000876 3300046557 Bacteria 16456
728 Ga0495622_0002174 3300046557 Bacteria 9556
729 Ga0495622_0002824 3300046557 Bacteria 8287
730 Ga0495622_0025953 3300046557 Bacteria 2738
731 Ga0495622_0067221 3300046557 Bacteria 1656
732 Ga0495622_0090311 3300046557 Bacteria 1407
733 Ga0495622_0092759 3300046557 Bacteria 1386
734 Ga0495622_0114010 3300046557 Bacteria 1236
735 Ga0495622_0168053 3300046557 Bacteria 987
736 Ga0495622_0172828 3300046557 Bacteria 971
737 Ga0495622_0249253 3300046557 Bacteria 781
738 Ga0495633_0001604 3300046558 Bacteria 17147
739 Ga0495633_0002456 3300046558 Bacteria 13074
740 Ga0495633_0062845 3300046558 Bacteria 1738
741 Ga0495633_0203475 3300046558 Bacteria 908
742 Ga0495633_0214865 3300046558 Bacteria 881
743 Ga0495656_0013996 3300046615 Bacteria 2998
744 Ga0495656_0061773 3300046615 Bacteria 1637
745 Ga0495656_0356126 3300046615 Bacteria 759
746 Ga0495656_0451336 3300046615 Bacteria 677
747 Ga0495668_0000891 3300046616 Bacteria 33605
748 Ga0495668_0004367 3300046616 Bacteria 10085
749 Ga0495668_0009461 3300046616 Bacteria 5986
750 Ga0495668_0350296 3300046616 Bacteria 810
751 Ga0495634_0000750 3300046642 Bacteria 31392
752 Ga0495634_0329135 3300046642 Bacteria 918
753 Ga0495611_0000849 3300046648 Bacteria 16738
754 Ga0495611_0004755 3300046648 Bacteria 5836
755 Ga0495611_0007230 3300046648 Bacteria 4718
756 Ga0495611_0109247 3300046648 Bacteria 1287
757 Ga0495611_0164379 3300046648 Bacteria 1037
758 Ga0495611_0295218 3300046648 Bacteria 747
759 Ga0495625_0002381 3300046660 Bacteria 20439
760 Ga0495625_0003130 3300046660 Bacteria 16900
761 Ga0495625_0004955 3300046660 Bacteria 12375
762 Ga0495625_0005765 3300046660 Bacteria 11198
763 Ga0495625_0005941 3300046660 Bacteria 10984
764 Ga0495625_0010097 3300046660 Bacteria 7843
765 Ga0495625_0010920 3300046660 Bacteria 7461
766 Ga0495625_0047837 3300046660 Bacteria 3083
767 Ga0495625_0049210 3300046660 Bacteria 3031
768 Ga0495625_0103982 3300046660 Bacteria 1947
769 Ga0495625_0116052 3300046660 Bacteria 1826
770 Ga0495625_0391181 3300046660 Bacteria 870
771 Ga0495635_0000942 3300046663 Bacteria 19194
772 Ga0495635_0004007 3300046663 Bacteria 10228
773 Ga0495659_0000458 3300046664 Bacteria 15217
774 Ga0495659_0001610 3300046664 Bacteria 7594
775 Ga0495659_0012469 3300046664 Bacteria 2753
776 Ga0495659_0032353 3300046664 Bacteria 1830
777 Ga0495661_0001713 3300046665 Bacteria 17741
778 Ga0495661_0012119 3300046665 Bacteria 5827
779 Ga0495661_0020069 3300046665 Bacteria 4370
780 Ga0495661_0047205 3300046665 Bacteria 2623
781 Ga0495661_0067662 3300046665 Bacteria 2097
782 Ga0495661_0076646 3300046665 Bacteria 1939
783 Ga0495661_0105999 3300046665 Bacteria 1573
784 Ga0495661_0180909 3300046665 Bacteria 1117
785 Ga0495661_0198193 3300046665 Bacteria 1053
786 Ga0495661_0204894 3300046665 Bacteria 1030
787 Ga0495588_0002784 3300046674 Bacteria 7512
788 Ga0495588_0003759 3300046674 Bacteria 6640
789 Ga0495588_0004795 3300046674 Bacteria 5983
790 Ga0495588_0062850 3300046674 Bacteria 1925
791 Ga0495588_0130742 3300046674 Bacteria 1324
792 Ga0495623_0001433 3300046679 Bacteria 16174
793 Ga0495623_0056963 3300046679 Bacteria 2459
794 Ga0495646_0022501 3300046680 Bacteria 3975
795 Ga0495646_0061393 3300046680 Bacteria 2238
796 Ga0495646_0069599 3300046680 Bacteria 2075
797 Ga0495669_0014373 3300046684 Bacteria 3384
798 Ga0495669_0050707 3300046684 Bacteria 1862
799 Ga0495613_0003245 3300046689 Bacteria 12169
800 Ga0495613_0009363 3300046689 Bacteria 7267
801 Ga0495613_0038996 3300046689 Bacteria 3522
802 Ga0495624_0000185 3300046690 Bacteria 46826
803 Ga0495670_0000480 3300046691 Bacteria 18930
804 Ga0495670_0000635 3300046691 Bacteria 16779
805 Ga0495670_0002033 3300046691 Bacteria 9970
806 Ga0495670_0005203 3300046691 Bacteria 6402
807 Ga0495670_0005291 3300046691 Bacteria 6348
808 Ga0495670_0008543 3300046691 Bacteria 5041
809 Ga0495670_0081537 3300046691 Bacteria 1648
810 Ga0495670_0171881 3300046691 Bacteria 1141
811 Ga0495671_0002528 3300046692 Bacteria 11498
812 Ga0495671_0003222 3300046692 Bacteria 10133
813 Ga0495671_0003462 3300046692 Bacteria 9684
814 Ga0495671_0003499 3300046692 Bacteria 9630
815 Ga0495671_0003565 3300046692 Bacteria 9501
816 Ga0495671_0007398 3300046692 Bacteria 6265
817 Ga0495671_0010675 3300046692 Bacteria 5081
818 Ga0495671_0014619 3300046692 Bacteria 4219
819 Ga0495671_0029099 3300046692 Bacteria 2840
820 Ga0495671_0054579 3300046692 Bacteria 1980
821 Ga0495671_0207548 3300046692 Bacteria 949
822 Ga0495649_0000280 3300046694 Bacteria 44939
823 Ga0495649_0001421 3300046694 Bacteria 18097
824 Ga0495649_0002090 3300046694 Bacteria 14348
825 Ga0495649_0002306 3300046694 Bacteria 13547
826 Ga0495649_0004805 3300046694 Bacteria 8752
827 Ga0495649_0005293 3300046694 Bacteria 8241
828 Ga0495649_0007239 3300046694 Bacteria 6798
829 Ga0495649_0017472 3300046694 Bacteria 4045
830 Ga0495649_0030998 3300046694 Bacteria 2950
831 Ga0495649_0056597 3300046694 Bacteria 2116
832 Ga0495649_0127189 3300046694 Bacteria 1345
833 Ga0495649_0183636 3300046694 Bacteria 1090
834 Ga0495649_0237431 3300046694 Bacteria 939
835 Ga0495649_0275888 3300046694 Bacteria 859
836 Ga0495589_0000425 3300046794 Bacteria 31317
837 Ga0495589_0001733 3300046794 Bacteria 12392
838 Ga0495589_0003297 3300046794 Bacteria 8760
839 Ga0495589_0003427 3300046794 Bacteria 8582
840 Ga0495589_0003543 3300046794 Bacteria 8440
841 Ga0495589_0012424 3300046794 Bacteria 4409
842 Ga0495589_0087542 3300046794 Bacteria 1512
843 Ga0495589_0104838 3300046794 Bacteria 1366
844 Ga0495589_0183881 3300046794 Bacteria 990
845 Ga0495600_0020768 3300046809 Bacteria 4201
846 Ga0495600_0267791 3300046809 Bacteria 1084
847 Ga0495660_0000504 3300046810 Bacteria 32167
848 Ga0495660_0002191 3300046810 Bacteria 12580
849 Ga0495660_0003326 3300046810 Bacteria 9972
850 Ga0495660_0004183 3300046810 Bacteria 8769
851 Ga0495660_0006728 3300046810 Bacteria 6786
852 Ga0495660_0012390 3300046810 Bacteria 4948
853 Ga0495660_0015278 3300046810 Bacteria 4436
854 Ga0495660_0015942 3300046810 Bacteria 4336
855 Ga0495660_0059820 3300046810 Bacteria 2048
856 Ga0495660_0064925 3300046810 Bacteria 1949
857 Ga0495660_0070228 3300046810 Bacteria 1860
858 Ga0495660_0094619 3300046810 Bacteria 1546
859 Ga0495660_0097012 3300046810 Bacteria 1522
860 Ga0495660_0150540 3300046810 Bacteria 1149
861 Ga0495581_0018020 3300047315 Bacteria 4102
862 Ga0495581_0072651 3300047315 Bacteria 1990
863 Ga0495604_0008827 3300047317 Bacteria 7967
864 Ga0495604_0015208 3300047317 Bacteria 6142
865 Ga0495604_0090291 3300047317 Bacteria 2275
866 Ga0495604_0180777 3300047317 Bacteria 1475
867 Ga0495636_0002742 3300047318 Bacteria 6789
868 Ga0495636_0054345 3300047318 Bacteria 1682
869 Ga0495636_0150725 3300047318 Bacteria 1043
870 Ga0495674_0016688 3300047319 Bacteria 6851
871 Ga0495674_0935736 3300047319 Bacteria 667
872 Ga0495672_0000726 3300047320 Bacteria 36268
873 Ga0495672_0001739 3300047320 Bacteria 21032
874 Ga0495672_0002678 3300047320 Bacteria 16033
875 Ga0495672_0003682 3300047320 Bacteria 12953
876 Ga0495672_0006719 3300047320 Bacteria 8828
877 Ga0495672_0039643 3300047320 Bacteria 2863
878 Ga0495672_0081174 3300047320 Bacteria 1806
879 Ga0495672_0162724 3300047320 Bacteria 1145
880 Ga0495672_0163141 3300047320 Bacteria 1143
881 Ga0495672_0168241 3300047320 Bacteria 1120
882 Ga0495672_0189793 3300047320 Bacteria 1034
883 Ga0495672_0228887 3300047320 Bacteria 913
884 Ga0495672_0311970 3300047320 Bacteria 741
885 Ga0495676_0000884 3300047321 Bacteria 25009
886 Ga0495676_0002813 3300047321 Bacteria 15680
887 Ga0495680_0000764 3300047322 Bacteria 36065
888 Ga0495680_0001910 3300047322 Bacteria 21867
889 Ga0495680_0007264 3300047322 Bacteria 10194
890 Ga0495680_0049517 3300047322 Bacteria 3290
891 Ga0495680_0152514 3300047322 Bacteria 1683
892 Ga0495683_0000452 3300047323 Bacteria 32302
893 Ga0495683_0001666 3300047323 Bacteria 14164
894 Ga0495683_0011900 3300047323 Bacteria 4574
895 Ga0495683_0024113 3300047323 Bacteria 3123
896 Ga0495683_0030097 3300047323 Bacteria 2771
897 Ga0495683_0040252 3300047323 Bacteria 2360
898 Ga0495683_0046739 3300047323 Bacteria 2172
899 Ga0495683_0054649 3300047323 Bacteria 1989
900 Ga0495683_0063104 3300047323 Bacteria 1831
901 Ga0495683_0099669 3300047323 Bacteria 1398
902 Ga0495683_0118182 3300047323 Bacteria 1260
903 Ga0495687_000721 3300047443 Bacteria 36612
904 Ga0495687_002191 3300047443 Bacteria 16254
905 Ga0495687_007933 3300047443 Bacteria 6167
906 Ga0495687_137773 3300047443 Bacteria 854
907 Ga0495675_0043499 3300047444 Bacteria 2861
908 Ga0495675_0090052 3300047444 Bacteria 1925
909 Ga0495675_0303164 3300047444 Bacteria 948
910 Ga0495677_0002347 3300047445 Bacteria 7437
911 Ga0495679_000791 3300047446 Bacteria 20116
912 Ga0495679_001945 3300047446 Bacteria 11029
913 Ga0495679_002683 3300047446 Bacteria 8893
914 Ga0495679_004486 3300047446 Bacteria 6418
915 Ga0495685_054193 3300047447 Bacteria 1357
916 Ga0495673_0000759 3300047469 Bacteria 30614
917 Ga0495673_0000890 3300047469 Bacteria 27481
918 Ga0495673_0001076 3300047469 Bacteria 23960
919 Ga0495673_0001612 3300047469 Bacteria 17512
920 Ga0495673_0001742 3300047469 Bacteria 16600
921 Ga0495673_0002437 3300047469 Bacteria 13100
922 Ga0495673_0004482 3300047469 Bacteria 8722
923 Ga0495673_0004780 3300047469 Bacteria 8382
924 Ga0495673_0009779 3300047469 Bacteria 5272
925 Ga0495673_0010321 3300047469 Bacteria 5089
926 Ga0495673_0041930 3300047469 Bacteria 2057
927 Ga0495673_0080556 3300047469 Bacteria 1349
928 Ga0495673_0085165 3300047469 Bacteria 1301
929 Ga0495673_0126151 3300047469 Bacteria 1009
930 Ga0495673_0224647 3300047469 Bacteria 693
931 Ga0495681_0000457 3300047470 Bacteria 31283
932 Ga0495681_0000508 3300047470 Bacteria 29718
933 Ga0495681_0001277 3300047470 Bacteria 19065
934 Ga0495681_0001758 3300047470 Bacteria 15974
935 Ga0495681_0002933 3300047470 Bacteria 12049
936 Ga0495681_0005638 3300047470 Bacteria 8343
937 Ga0495681_0008252 3300047470 Bacteria 6545
938 Ga0495681_0010534 3300047470 Bacteria 5593
939 Ga0495681_0036081 3300047470 Bacteria 2448
940 Ga0495681_0077574 3300047470 Bacteria 1490
941 Ga0495681_0083422 3300047470 Bacteria 1422
942 Ga0495681_0090883 3300047470 Bacteria 1348
943 Ga0495681_0150770 3300047470 Bacteria 975
944 Ga0495684_0009073 3300047471 Bacteria 7681
945 Ga0495684_0286204 3300047471 Bacteria 1187
946 Ga0495686_0003060 3300047472 Bacteria 14823
947 Ga0495686_0035971 3300047472 Bacteria 3179
948 Ga0495686_0063766 3300047472 Bacteria 2282
949 Ga0495686_0205058 3300047472 Bacteria 1129
950 Ga0495686_0292762 3300047472 Bacteria 901
951 Ga0495593_0024309 3300047673 Bacteria 3359
952 Ga0495593_0038234 3300047673 Bacteria 2592
953 Ga0495593_0054162 3300047673 Bacteria 2115
954 Ga0495593_0123223 3300047673 Bacteria 1318
955 Ga0495593_0223979 3300047673 Bacteria 943
956 Ga0495593_0347346 3300047673 Bacteria 741
957 Ga0495602_0000848 3300048088 Bacteria 29417
958 Ga0495615_0101112 3300048090 Bacteria 815
959 Ga0495626_0000710 3300048091 Bacteria 31405
960 Ga0495626_0000726 3300048091 Bacteria 30830
961 Ga0495626_0000732 3300048091 Bacteria 30608
962 Ga0495626_0000908 3300048091 Bacteria 26124
963 Ga0495626_0001790 3300048091 Bacteria 16232
964 Ga0495626_0001861 3300048091 Bacteria 15824
965 Ga0495626_0001975 3300048091 Bacteria 15179
966 Ga0495626_0012148 3300048091 Bacteria 4527
967 Ga0495626_0014509 3300048091 Bacteria 4060
968 Ga0495626_0018375 3300048091 Bacteria 3511
969 Ga0495626_0076361 3300048091 Bacteria 1495
970 Ga0495626_0289213 3300048091 Bacteria 649
971 Ga0496102_0000419 3300048905 Bacteria 48952
972 Ga0496102_0368355 3300048905 Bacteria 1352
973 Ga0496103_0001964 3300048906 Bacteria 13296
974 Ga0496105_0232094 3300048908 Bacteria 1499
975 Ga0496106_0052454 3300048909 Bacteria 3077
976 Ga0496106_0260609 3300048909 Bacteria 1387
977 Ga0496110_0049402 3300048913 Bacteria 3690
978 Ga0496110_0751198 3300048913 Bacteria 878
979 Ga0496111_0328662 3300048914 Bacteria 1132
980 Ga0496111_0429670 3300048914 Bacteria 975
981 Ga0496112_0900895 3300048915 Bacteria 806
982 Ga0496113_0577934 3300048916 Bacteria 900
983 Ga0496114_0237846 3300048917 Bacteria 1601
984 Ga0496115_0205678 3300048918 Bacteria 1626
985 Ga0496116_0000338 3300048919 Bacteria 75100
986 Ga0496116_0001012 3300048919 Bacteria 34285
987 Ga0496116_0003185 3300048919 Bacteria 16434
988 Ga0496116_0004365 3300048919 Bacteria 13523
989 Ga0496116_0024581 3300048919 Bacteria 4450
990 Ga0496116_0035753 3300048919 Bacteria 3485
991 Ga0496116_0313485 3300048919 Bacteria 739
992 Ga0496117_0000712 3300048920 Bacteria 52613
993 Ga0496117_0002877 3300048920 Bacteria 20895
994 Ga0496117_0008362 3300048920 Bacteria 9842
995 Ga0496117_0055131 3300048920 Bacteria 2779
996 Ga0496117_0088204 3300048920 Bacteria 2007
997 Ga0496117_0128663 3300048920 Bacteria 1539
998 Ga0496117_0147427 3300048920 Bacteria 1398
999 Ga0496117_0169789 3300048920 Bacteria 1267
1000 Ga0496118_0004004 3300048921 Bacteria 17933
1001 Ga0496118_0004826 3300048921 Bacteria 15721
1002 Ga0496118_0006763 3300048921 Bacteria 12470
1003 Ga0496118_0007506 3300048921 Bacteria 11532
1004 Ga0496118_0020135 3300048921 Bacteria 5929
1005 Ga0496118_0042497 3300048921 Bacteria 3584
1006 Ga0496118_0166112 3300048921 Bacteria 1356
1007 Ga0496119_0093383 3300048922 Bacteria 1704
1008 Ga0496119_0264039 3300048922 Bacteria 862
1009 Ga0496120_0001345 3300048923 Bacteria 30280
1010 Ga0496120_0063614 3300048923 Bacteria 2051
1011 Ga0496121_0000713 3300048924 Bacteria 61654
1012 Ga0496121_0001802 3300048924 Bacteria 34607
1013 Ga0496121_0005084 3300048924 Bacteria 17154
1014 Ga0496121_0012192 3300048924 Bacteria 9423
1015 Ga0496121_0021552 3300048924 Bacteria 6305
1016 Ga0496121_0200581 3300048924 Bacteria 1422
1017 Ga0496121_0403479 3300048924 Bacteria 894
1018 Ga0496122_0003076 3300048925 Bacteria 22461
1019 Ga0496122_0006201 3300048925 Bacteria 13867
1020 Ga0496122_0017264 3300048925 Bacteria 6761
1021 Ga0496122_0055722 3300048925 Bacteria 2954
1022 Ga0496123_0004296 3300048926 Bacteria 15141
1023 Ga0496123_0006317 3300048926 Bacteria 11517
1024 Ga0496124_0001071 3300048927 Bacteria 43253
1025 Ga0496124_0001277 3300048927 Bacteria 38265
1026 Ga0496124_0003709 3300048927 Bacteria 18440
1027 Ga0496124_0018162 3300048927 Bacteria 6599
1028 Ga0496124_0052192 3300048927 Bacteria 3474
1029 Ga0496124_0120285 3300048927 Bacteria 2099
1030 Ga0496124_0161267 3300048927 Bacteria 1747
1031 Ga0496124_0184101 3300048927 Bacteria 1604
1032 Ga0496124_0268684 3300048927 Bacteria 1250
1033 Ga0496124_0275836 3300048927 Bacteria 1228
1034 Ga0496124_0286651 3300048927 Bacteria 1197
1035 Ga0496125_0019672 3300048928 Bacteria 6357
1036 Ga0496125_0038253 3300048928 Bacteria 4157
1037 Ga0496125_0046255 3300048928 Bacteria 3652
1038 Ga0496125_0112298 3300048928 Bacteria 1969
1039 Ga0496125_0127335 3300048928 Bacteria 1801
1040 Ga0496125_0193701 3300048928 Bacteria 1339
1041 Ga0496125_0334114 3300048928 Bacteria 912
1042 Ga0495678_000534 3300049459 Bacteria 36836
1043 Ga0495678_001116 3300049459 Bacteria 22352
1044 Ga0495678_001271 3300049459 Bacteria 20466
1045 Ga0495678_001492 3300049459 Bacteria 18238
1046 Ga0495678_001799 3300049459 Bacteria 15845
1047 Ga0495678_006024 3300049459 Bacteria 6535
1048 Ga0495678_008156 3300049459 Bacteria 5326
1049 Ga0495678_018763 3300049459 Bacteria 3102
1050 Ga0495678_027783 3300049459 Bacteria 2395
1051 Ga0495678_062138 3300049459 Bacteria 1399
1052 Ga0495678_067462 3300049459 Bacteria 1321
1053 Ga0495678_073234 3300049459 Bacteria 1249
1054 Ga0495678_100817 3300049459 Bacteria 1000
1055 Ga0495678_121509 3300049459 Bacteria 876
1056 Ga0495682_0001179 3300049460 Bacteria 14906
1057 Ga0495682_0005914 3300049460 Bacteria 5017
1058 Ga0495682_0006355 3300049460 Bacteria 4785
1059 Ga0495682_0017226 3300049460 Bacteria 2729
1060 Ga0495682_0044381 3300049460 Bacteria 1627
1061 Ga0495682_0061210 3300049460 Bacteria 1359
1062 Ga0495682_0065913 3300049460 Bacteria 1305
1063 Ga0501241_000245 3300049758 Bacteria 12157
1064 Ga0501269_009321 3300049766 Bacteria 1191
1065 nmdc:mga03683_202822_c1 3300050489 Bacteria 911
1066 nmdc:mga03683_3995_c1 3300050489 Bacteria 4833
1067 nmdc:mga00v17_30446_c2 3300050491 Bacteria 2631
1068 nmdc:mga00v17_432564_c1 3300050491 Bacteria 855
1069 nmdc:mga07m45_286863_c1 3300050496 Bacteria 957
1070 nmdc:mga08x19_344520_c1 3300050514 Bacteria 1040
1071 nmdc:mga08x19_461261_c1 3300050514 Bacteria 895
1072 nmdc:mga08x19_94236_c1 3300050514 Bacteria 1980
1073 Ga0500572_000413 3300053111 Bacteria 15022
1074 Ga0500634_0008464 3300053161 Bacteria 5146

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005564 Ga0070664_100000135 Ga0070664_10000013516 154
2 3300009176 Ga0105242_10000147 Ga0105242_1000014711 156
3 3300009545 Ga0105237_10000613 Ga0105237_1000061316 156
4 3300011119 Ga0105246_10068698 Ga0105246_100686982 156
5 3300013100 Ga0157373_10037185 Ga0157373_100371851 156
6 3300013105 Ga0157369_10026419 Ga0157369_100264195 156
7 3300013308 Ga0157375_10017331 Ga0157375_100173314 156
8 3300041453 Ga0451797_0393665 Ga0451797_0393665_194_712 156
9 3300046665 Ga0495661_0001713 Ga0495661_0001713_10982_11500 156
10 3300048920 Ga0496117_0128663 Ga0496117_0128663_77_595 156
11 3300048921 Ga0496118_0007506 Ga0496118_0007506_10937_11455 156
12 3300048925 Ga0496122_0017264 Ga0496122_0017264_6233_6751 156
13 3300048927 Ga0496124_0286651 Ga0496124_0286651_590_1108 156
14 3300048928 Ga0496125_0046255 Ga0496125_0046255_3021_3539 156
15 3300048928 Ga0496125_0112298 Ga0496125_0112298_35_553 156
16 3300048928 Ga0496125_0334114 Ga0496125_0334114_75_593 156
17 3300053161 Ga0500634_0008464 Ga0500634_0008464_139_657 156
18 3300011119 Ga0105246_10002727 Ga0105246_100027276 157
19 3300001915 JGI24741J21665_1014804 JGI24741J21665_10148042 158
20 3300005288 Ga0065714_10023278 Ga0065714_100232782 158
21 3300005344 Ga0070661_100540092 Ga0070661_1005400922 158
22 3300005353 Ga0070669_100000487 Ga0070669_10000048714 158
23 3300005457 Ga0070662_100000294 Ga0070662_1000002942 158
24 3300005539 Ga0068853_100001403 Ga0068853_1000014033 158
25 3300005578 Ga0068854_100016166 Ga0068854_1000161662 158
26 3300005834 Ga0068851_10000004 Ga0068851_1000000443 158
27 3300009011 Ga0105251_10000378 Ga0105251_1000037823 158
28 3300009177 Ga0105248_10053025 Ga0105248_100530254 158
29 3300009545 Ga0105237_10167975 Ga0105237_101679753 158
30 3300013105 Ga0157369_10007873 Ga0157369_100078734 158
31 3300015261 Ga0182006_1000793 Ga0182006_100079320 158
32 3300025321 Ga0207656_10000007 Ga0207656_10000007211 158
33 3300025728 Ga0207655_1165736 Ga0207655_11657361 158
34 3300025735 Ga0207713_1000323 Ga0207713_100032315 158
35 3300025933 Ga0207706_10000178 Ga0207706_1000017821 158
36 3300025941 Ga0207711_10289370 Ga0207711_102893702 158
37 3300025981 Ga0207640_10022649 Ga0207640_100226494 158
38 3300026041 Ga0207639_10012481 Ga0207639_100124814 158
39 3300042006 Ga0439432_000312 Ga0439432_000312_4646_5248 158
40 3300014497 Ga0182008_10002202 Ga0182008_100022022 159
41 3300046472 Ga0495580_0600970 Ga0495580_0600970_171_692 159
42 3300046674 Ga0495588_0062850 Ga0495588_0062850_26_547 159
43 3300047317 Ga0495604_0180777 Ga0495604_0180777_31_552 159
44 3300046506 Ga0495583_0001460 Ga0495583_0001460_42_578 162
45 3300046477 Ga0495664_0656245 Ga0495664_0656245_46_585 163
46 3300046648 Ga0495611_0109247 Ga0495611_0109247_708_1253 163
47 3300047446 Ga0495679_001945 Ga0495679_001945_10439_10984 163
48 3300046518 Ga0495631_0283176 Ga0495631_0283176_149_694 165
49 3300014497 Ga0182008_10002864 Ga0182008_100028648 166
50 3300042115 Ga0450911_005909 Ga0450911_005909_353_973 167
51 3300049766 Ga0501269_009321 Ga0501269_009321_80_643 169
52 3300041407 Ga0439447_052861 Ga0439447_052861_14_601 172
53 3300042009 Ga0439451_029237 Ga0439451_029237_520_1095 172
54 3300046460 Ga0495638_0369473 Ga0495638_0369473_16_591 173
55 3300048924 Ga0496121_0403479 Ga0496121_0403479_300_875 173
56 3300042004 Ga0439445_0160075 Ga0439445_0160075_11_595 176
57 3300041405 Ga0439438_022912 Ga0439438_022912_758_1375 177
58 3300046615 Ga0495656_0356126 Ga0495656_0356126_10_609 177
59 3300046692 Ga0495671_0007398 Ga0495671_0007398_466_1056 177
60 3300005288 Ga0065714_10007939 Ga0065714_100079393 178
61 3300005288 Ga0065714_10019801 Ga0065714_100198012 178
62 3300009036 Ga0105244_10044877 Ga0105244_100448773 178
63 3300009148 Ga0105243_10474482 Ga0105243_104744822 178
64 3300011119 Ga0105246_10062259 Ga0105246_100622593 178
65 3300013100 Ga0157373_10033746 Ga0157373_100337463 178
66 3300013104 Ga0157370_10085482 Ga0157370_100854823 178
67 3300013308 Ga0157375_10134225 Ga0157375_101342253 178
68 3300017792 Ga0163161_10067577 Ga0163161_100675772 178
69 3300017792 Ga0163161_10069642 Ga0163161_100696423 178
70 3300025728 Ga0207655_1023986 Ga0207655_10239863 178
71 3300025935 Ga0207709_10036406 Ga0207709_100364063 178
72 3300041407 Ga0439447_001171 Ga0439447_001171_7867_8481 178
73 3300041411 Ga0439466_0003071 Ga0439466_0003071_1937_2551 178
74 3300042006 Ga0439432_002405 Ga0439432_002405_816_1430 178
75 3300042013 Ga0439456_026386 Ga0439456_026386_504_1118 178
76 3300042016 Ga0439463_012811 Ga0439463_012811_242_856 178
77 3300042115 Ga0450911_020044 Ga0450911_020044_19_615 178
78 3300042138 Ga0450903_003618 Ga0450903_003618_1214_1828 178
79 3300042146 Ga0450907_000023 Ga0450907_000023_52739_53353 178
80 3300042156 Ga0439446_0003188 Ga0439446_0003188_271_885 178
81 3300042185 Ga0450909_001313 Ga0450909_001313_1489_2103 178
82 3300042435 Ga0439434_0000059 Ga0439434_0000059_20152_20766 178
83 3300042461 Ga0439460_0131771 Ga0439460_0131771_118_732 178
84 3300042532 Ga0450893_0035801 Ga0450893_0035801_14_607 178
85 3300046457 Ga0495590_0134147 Ga0495590_0134147_116_730 178
86 3300046458 Ga0495591_031637 Ga0495591_031637_507_1121 178
87 3300046471 Ga0495650_0015235 Ga0495650_0015235_2901_3515 178
88 3300046513 Ga0495616_0057706 Ga0495616_0057706_230_844 178
89 3300046519 Ga0495632_0000714 Ga0495632_0000714_22197_22811 178
90 3300046520 Ga0495637_0023558 Ga0495637_0023558_1545_2159 178
91 3300046522 Ga0495643_0009871 Ga0495643_0009871_1119_1733 178
92 3300046530 Ga0495654_0058383 Ga0495654_0058383_572_1186 178
93 3300046538 Ga0495609_0031918 Ga0495609_0031918_1297_1911 178
94 3300046615 Ga0495656_0013996 Ga0495656_0013996_1654_2268 178
95 3300046660 Ga0495625_0116052 Ga0495625_0116052_98_712 178
96 3300046665 Ga0495661_0047205 Ga0495661_0047205_1153_1767 178
97 3300046684 Ga0495669_0014373 Ga0495669_0014373_846_1460 178
98 3300046692 Ga0495671_0003462 Ga0495671_0003462_1154_1768 178
99 3300046810 Ga0495660_0015942 Ga0495660_0015942_3520_4134 178
100 3300046810 Ga0495660_0097012 Ga0495660_0097012_728_1342 178
101 3300047318 Ga0495636_0150725 Ga0495636_0150725_53_667 178
102 3300047443 Ga0495687_137773 Ga0495687_137773_167_781 178
103 3300047444 Ga0495675_0043499 Ga0495675_0043499_2144_2734 178
104 3300047445 Ga0495677_0002347 Ga0495677_0002347_6156_6770 178
105 3300047472 Ga0495686_0205058 Ga0495686_0205058_96_710 178
106 3300048091 Ga0495626_0018375 Ga0495626_0018375_1905_2519 178
107 3300049460 Ga0495682_0017226 Ga0495682_0017226_1364_1978 178
108 3300013306 Ga0163162_10322823 Ga0163162_103228232 179
109 3300042009 Ga0439451_039682 Ga0439451_039682_243_836 179
110 3300042013 Ga0439456_001645 Ga0439456_001645_1102_1719 179
111 3300046455 Ga0495603_0002644 Ga0495603_0002644_1887_2501 179
112 3300046474 Ga0495605_0117319 Ga0495605_0117319_451_1065 179
113 3300048091 Ga0495626_0289213 Ga0495626_0289213_45_638 179
114 3300013100 Ga0157373_10000305 Ga0157373_1000030525 180
115 3300015261 Ga0182006_1031338 Ga0182006_10313382 180
116 3300046453 Ga0495627_058441 Ga0495627_058441_218_838 180
117 3300005288 Ga0065714_10005368 Ga0065714_100053682 181
118 3300006058 Ga0075432_10001932 Ga0075432_100019322 181
119 3300006914 Ga0075436_100354514 Ga0075436_1003545142 181
120 3300041405 Ga0439438_000469 Ga0439438_000469_17081_17668 181
121 3300041407 Ga0439447_055348 Ga0439447_055348_267_854 181
122 3300042006 Ga0439432_101984 Ga0439432_101984_240_827 181
123 3300046453 Ga0495627_002395 Ga0495627_002395_7401_8018 181
124 3300046457 Ga0495590_0182007 Ga0495590_0182007_39_656 181
125 3300046458 Ga0495591_038774 Ga0495591_038774_219_836 181
126 3300046474 Ga0495605_0006070 Ga0495605_0006070_226_843 181
127 3300046492 Ga0495585_0085867 Ga0495585_0085867_1057_1674 181
128 3300046512 Ga0495610_0139960 Ga0495610_0139960_103_720 181
129 3300046513 Ga0495616_0049006 Ga0495616_0049006_1046_1663 181
130 3300046523 Ga0495644_0000278 Ga0495644_0000278_21882_22499 181
131 3300046524 Ga0495648_0144104 Ga0495648_0144104_369_986 181
132 3300046542 Ga0495597_0005573 Ga0495597_0005573_5580_6197 181
133 3300046615 Ga0495656_0061773 Ga0495656_0061773_138_755 181
134 3300046660 Ga0495625_0047837 Ga0495625_0047837_308_925 181
135 3300046665 Ga0495661_0204894 Ga0495661_0204894_367_984 181
136 3300046691 Ga0495670_0005203 Ga0495670_0005203_1162_1779 181
137 3300046794 Ga0495589_0012424 Ga0495589_0012424_3452_4069 181
138 3300047323 Ga0495683_0024113 Ga0495683_0024113_1001_1618 181
139 3300047470 Ga0495681_0083422 Ga0495681_0083422_439_1056 181
140 3300048091 Ga0495626_0014509 Ga0495626_0014509_21_614 181
141 3300050514 nmdc:mga08x19_344520_c1 nmdc:mga08x19_344520_c1_198_815 181
142 iso_pu_bacteria 2511231021 2511356297 181
143 3300006051 Ga0075364_10042942 Ga0075364_100429422 182
144 3300006177 Ga0075362_10287899 Ga0075362_102878992 182
145 3300006914 Ga0075436_100219908 Ga0075436_1002199082 182
146 3300017792 Ga0163161_10033596 Ga0163161_100335963 182
147 3300027907 Ga0207428_10127380 Ga0207428_101273802 182
148 3300041405 Ga0439438_009695 Ga0439438_009695_2316_2918 182
149 3300042006 Ga0439432_022736 Ga0439432_022736_1394_1996 182
150 3300042010 Ga0439452_005328 Ga0439452_005328_2360_2962 182
151 3300042013 Ga0439456_048252 Ga0439456_048252_128_730 182
152 3300046460 Ga0495638_0006340 Ga0495638_0006340_5659_6279 182
153 3300046471 Ga0495650_0032302 Ga0495650_0032302_1641_2261 182
154 3300046512 Ga0495610_0162337 Ga0495610_0162337_282_902 182
155 3300048915 Ga0496112_0900895 Ga0496112_0900895_155_715 182
156 iso_pu_bacteria 2919456309 2919460201 182
157 3300009092 Ga0105250_10228604 Ga0105250_102286041 183
158 3300013104 Ga0157370_10179659 Ga0157370_101796593 183
159 3300015265 Ga0182005_1001424 Ga0182005_10014247 183
160 3300015265 Ga0182005_1020678 Ga0182005_10206781 183
161 3300025735 Ga0207713_1002389 Ga0207713_100238914 183
162 3300041405 Ga0439438_003074 Ga0439438_003074_507_1124 183
163 3300041405 Ga0439438_028023 Ga0439438_028023_688_1305 183
164 3300041407 Ga0439447_003636 Ga0439447_003636_205_822 183
165 3300041411 Ga0439466_0002777 Ga0439466_0002777_2365_2982 183
166 3300041411 Ga0439466_0029746 Ga0439466_0029746_644_1252 183
167 3300041411 Ga0439466_0036129 Ga0439466_0036129_150_767 183
168 3300042006 Ga0439432_001657 Ga0439432_001657_3177_3785 183
169 3300042009 Ga0439451_046263 Ga0439451_046263_20_628 183
170 3300042010 Ga0439452_015149 Ga0439452_015149_1000_1608 183
171 3300042010 Ga0439452_032201 Ga0439452_032201_189_806 183
172 3300042010 Ga0439452_050780 Ga0439452_050780_189_806 183
173 3300042124 Ga0450922_000451 Ga0450922_000451_272_880 183
174 3300042137 Ga0450902_007934 Ga0450902_007934_600_1217 183
175 3300042138 Ga0450903_011872 Ga0450903_011872_317_934 183
176 3300042145 Ga0450906_018998 Ga0450906_018998_175_792 183
177 3300046452 Ga0495617_039563 Ga0495617_039563_458_1075 183
178 3300046457 Ga0495590_0004857 Ga0495590_0004857_3620_4237 183
179 3300046457 Ga0495590_0007724 Ga0495590_0007724_892_1509 183
180 3300046458 Ga0495591_000235 Ga0495591_000235_16045_16662 183
181 3300046458 Ga0495591_007291 Ga0495591_007291_754_1371 183
182 3300046458 Ga0495591_080964 Ga0495591_080964_139_756 183
183 3300046460 Ga0495638_0000542 Ga0495638_0000542_37734_38351 183
184 3300046460 Ga0495638_0079718 Ga0495638_0079718_1162_1779 183
185 3300046460 Ga0495638_0233264 Ga0495638_0233264_169_786 183
186 3300046471 Ga0495650_0005533 Ga0495650_0005533_3620_4237 183
187 3300046491 Ga0495584_0001095 Ga0495584_0001095_14381_15010 183
188 3300046491 Ga0495584_0026592 Ga0495584_0026592_1323_1940 183
189 3300046492 Ga0495585_0286103 Ga0495585_0286103_110_739 183
190 3300046500 Ga0495596_0000585 Ga0495596_0000585_5911_6528 183
191 3300046501 Ga0495607_0002853 Ga0495607_0002853_7647_8264 183
192 3300046501 Ga0495607_0036499 Ga0495607_0036499_2267_2884 183
193 3300046501 Ga0495607_0114803 Ga0495607_0114803_11_628 183
194 3300046507 Ga0495606_0042717 Ga0495606_0042717_519_1136 183
195 3300046512 Ga0495610_0012148 Ga0495610_0012148_1986_2603 183
196 3300046513 Ga0495616_0011334 Ga0495616_0011334_1028_1645 183
197 3300046515 Ga0495620_0113279 Ga0495620_0113279_206_823 183
198 3300046518 Ga0495631_0002497 Ga0495631_0002497_5428_6045 183
199 3300046519 Ga0495632_0000408 Ga0495632_0000408_33771_34400 183
200 3300046519 Ga0495632_0010125 Ga0495632_0010125_1026_1643 183
201 3300046519 Ga0495632_0014780 Ga0495632_0014780_2619_3236 183
202 3300046520 Ga0495637_0003145 Ga0495637_0003145_2412_3029 183
203 3300046520 Ga0495637_0114485 Ga0495637_0114485_245_874 183
204 3300046522 Ga0495643_0008424 Ga0495643_0008424_1296_1913 183
205 3300046522 Ga0495643_0030259 Ga0495643_0030259_2239_2856 183
206 3300046522 Ga0495643_0078461 Ga0495643_0078461_402_1019 183
207 3300046523 Ga0495644_0000335 Ga0495644_0000335_1025_1642 183
208 3300046523 Ga0495644_0002163 Ga0495644_0002163_2633_3250 183
209 3300046524 Ga0495648_0293154 Ga0495648_0293154_79_696 183
210 3300046528 Ga0495642_0000765 Ga0495642_0000765_749_1378 183
211 3300046530 Ga0495654_0017111 Ga0495654_0017111_1142_1759 183
212 3300046530 Ga0495654_0048359 Ga0495654_0048359_489_1106 183
213 3300046530 Ga0495654_0070627 Ga0495654_0070627_1005_1622 183
214 3300046538 Ga0495609_0029348 Ga0495609_0029348_1062_1691 183
215 3300046538 Ga0495609_0030642 Ga0495609_0030642_934_1563 183
216 3300046542 Ga0495597_0007229 Ga0495597_0007229_660_1277 183
217 3300046542 Ga0495597_0059753 Ga0495597_0059753_342_959 183
218 3300046616 Ga0495668_0004367 Ga0495668_0004367_5631_6248 183
219 3300046648 Ga0495611_0007230 Ga0495611_0007230_700_1317 183
220 3300046648 Ga0495611_0164379 Ga0495611_0164379_236_853 183
221 3300046660 Ga0495625_0004955 Ga0495625_0004955_6181_6798 183
222 3300046665 Ga0495661_0067662 Ga0495661_0067662_397_1014 183
223 3300046692 Ga0495671_0003499 Ga0495671_0003499_3309_3926 183
224 3300046692 Ga0495671_0010675 Ga0495671_0010675_3407_4024 183
225 3300046694 Ga0495649_0000280 Ga0495649_0000280_7311_7940 183
226 3300046694 Ga0495649_0002090 Ga0495649_0002090_12060_12677 183
227 3300046694 Ga0495649_0030998 Ga0495649_0030998_247_864 183
228 3300046794 Ga0495589_0003427 Ga0495589_0003427_2356_2973 183
229 3300046810 Ga0495660_0004183 Ga0495660_0004183_7446_8063 183
230 3300047318 Ga0495636_0054345 Ga0495636_0054345_144_773 183
231 3300047320 Ga0495672_0001739 Ga0495672_0001739_13736_14353 183
232 3300047320 Ga0495672_0002678 Ga0495672_0002678_6680_7297 183
233 3300047320 Ga0495672_0162724 Ga0495672_0162724_64_681 183
234 3300047320 Ga0495672_0311970 Ga0495672_0311970_62_679 183
235 3300047323 Ga0495683_0011900 Ga0495683_0011900_295_912 183
236 3300047323 Ga0495683_0030097 Ga0495683_0030097_1142_1759 183
237 3300047323 Ga0495683_0054649 Ga0495683_0054649_150_752 183
238 3300047443 Ga0495687_000721 Ga0495687_000721_29014_29643 183
239 3300047447 Ga0495685_054193 Ga0495685_054193_135_764 183
240 3300047469 Ga0495673_0000759 Ga0495673_0000759_6818_7435 183
241 3300047470 Ga0495681_0005638 Ga0495681_0005638_2284_2901 183
242 3300047472 Ga0495686_0035971 Ga0495686_0035971_2284_2901 183
243 3300048091 Ga0495626_0000710 Ga0495626_0000710_14465_15082 183
244 3300048091 Ga0495626_0001861 Ga0495626_0001861_14385_15014 183
245 3300048913 Ga0496110_0049402 Ga0496110_0049402_2399_3016 183
246 3300048914 Ga0496111_0328662 Ga0496111_0328662_424_1041 183
247 3300048916 Ga0496113_0577934 Ga0496113_0577934_200_817 183
248 3300048927 Ga0496124_0001277 Ga0496124_0001277_49_666 183
249 3300049459 Ga0495678_001799 Ga0495678_001799_14385_15014 183
250 3300049459 Ga0495678_008156 Ga0495678_008156_3682_4299 183
251 3300049459 Ga0495678_062138 Ga0495678_062138_377_994 183
252 3300049460 Ga0495682_0006355 Ga0495682_0006355_142_744 183
253 3300049460 Ga0495682_0044381 Ga0495682_0044381_542_1159 183
254 3300050496 nmdc:mga07m45_286863_c1 nmdc:mga07m45_286863_c1_273_875 183
255 iso_pu_bacteria 2511231012 2511299875 183
256 iso_pu_bacteria 2511231014 2511316257 183
257 iso_pu_bacteria 2511231015 2511317889 183
258 iso_pu_bacteria 2511231020 2511353133 183
259 iso_pu_bacteria 2597489888 2597861861 183
260 iso_pu_bacteria 2599185167 2599402179 183
261 iso_pu_bacteria 2599185179 2599454597 183
262 iso_pu_bacteria 2599185189 2599506622 183
263 iso_pu_bacteria 2599185190 2599516005 183
264 iso_pu_bacteria 2599185191 2599521820 183
265 iso_pu_bacteria 2599185288 2599882878 183
266 iso_pu_bacteria 2599185290 2599895383 183
267 iso_pu_bacteria 2599185303 2599950981 183
268 iso_pu_bacteria 2643221565 2643841199 183
269 iso_pu_bacteria 2643221571 2643872424 183
270 iso_pu_bacteria 2643221589 2643954692 183
271 iso_pu_bacteria 2643221602 2644024332 183
272 iso_pu_bacteria 2643221713 2644619887 183
273 iso_pu_bacteria 2738541265 2738675351 183
274 iso_pu_bacteria 2738541282 2738753754 183
275 iso_pu_bacteria 2738541294 2738807700 183
276 iso_pu_bacteria 2738541303 2738862743 183
277 iso_pu_bacteria 2738541309 2738895060 183
278 iso_pu_bacteria 2738543004 2739202182 183
279 iso_pu_bacteria 2738543015 2739259849 183
280 iso_pu_bacteria 2808606385 2808976460 183
281 iso_pu_bacteria 2808606388 2808992102 183
282 iso_pu_bacteria 2816332298 2817488611 183
283 iso_pu_bacteria 2834028612 2834032019 183
284 iso_pu_bacteria 2842826826 2842831385 183
285 iso_pu_bacteria 2842837860 2842842331 183
286 iso_pu_bacteria 2852612431 2852617276 183
287 iso_pu_bacteria 2852667396 2852671735 183
288 iso_pu_bacteria 2860867994 2860868631 183
289 iso_pu_bacteria 2904550169 2904554015 183
290 iso_pu_bacteria 2908446538 2908447231 183
291 iso_pu_bacteria 2919063839 2919065936 183
292 iso_pu_bacteria 2929189879 2929190487 183
293 iso_pu_bacteria 2931390751 2931391582 183
294 iso_pu_bacteria 2939636861 2939641322 183
295 iso_pu_bacteria 2945928738 2945929965 183
296 iso_pu_bacteria 2946006987 2946012301 183
297 iso_pu_bacteria 2946027586 2946028837 183
298 iso_pu_bacteria 2947233263 2947235372 183
299 iso_pu_bacteria 3007718800 3007722152 183
300 iso_pu_bacteria 8054285046 8054286348 183
301 iso_pu_bacteria 8054347763 8054349936 183
302 iso_pu_bacteria 8056131705 8056132529 183
303 iso_pu_bacteria 8056161164 8056161630 183
304 iso_pu_bacteria 8056172158 8056176498 183
305 iso_pu_bacteria 8056177738 8056182828 183
306 3300003323 rootH1_10140646 rootH1_101406463 184
307 3300005288 Ga0065714_10003643 Ga0065714_100036436 184
308 3300009011 Ga0105251_10170395 Ga0105251_101703951 184
309 3300009036 Ga0105244_10001726 Ga0105244_1000172615 184
310 3300009092 Ga0105250_10045551 Ga0105250_100455512 184
311 3300009148 Ga0105243_10001399 Ga0105243_1000139915 184
312 3300011119 Ga0105246_10001581 Ga0105246_1000158112 184
313 3300014497 Ga0182008_10049856 Ga0182008_100498563 184
314 3300015262 Ga0182007_10000283 Ga0182007_1000028322 184
315 3300025711 Ga0207696_1014199 Ga0207696_10141993 184
316 3300025728 Ga0207655_1000946 Ga0207655_100094615 184
317 3300025735 Ga0207713_1000494 Ga0207713_10004948 184
318 3300025935 Ga0207709_10000022 Ga0207709_1000002254 184
319 3300030744 Ga0316181_1193545 Ga0316181_11935453 184
320 3300030745 Ga0316182_1068518 Ga0316182_10685182 184
321 3300041411 Ga0439466_0048985 Ga0439466_0048985_72_689 184
322 3300042009 Ga0439451_002028 Ga0439451_002028_2768_3385 184
323 3300042013 Ga0439456_036935 Ga0439456_036935_166_783 184
324 3300042016 Ga0439463_029225 Ga0439463_029225_752_1369 184
325 3300042137 Ga0450902_021638 Ga0450902_021638_74_691 184
326 3300046458 Ga0495591_084743 Ga0495591_084743_84_704 184
327 3300046491 Ga0495584_0036659 Ga0495584_0036659_1102_1722 184
328 3300046492 Ga0495585_0000748 Ga0495585_0000748_6954_7580 184
329 3300046507 Ga0495606_0288376 Ga0495606_0288376_29_655 184
330 3300046517 Ga0495630_0352950 Ga0495630_0352950_495_1109 184
331 3300046520 Ga0495637_0025805 Ga0495637_0025805_218_838 184
332 3300046542 Ga0495597_0004856 Ga0495597_0004856_176_778 184
333 3300046542 Ga0495597_0120444 Ga0495597_0120444_155_766 184
334 3300046810 Ga0495660_0006728 Ga0495660_0006728_387_1013 184
335 3300047322 Ga0495680_0007264 Ga0495680_0007264_5185_5799 184
336 3300047446 Ga0495679_004486 Ga0495679_004486_5482_6099 184
337 3300047673 Ga0495593_0123223 Ga0495593_0123223_374_988 184
338 iso_pu_bacteria 2511231004 2511258262 184
339 iso_pu_bacteria 2511231006 2511267045 184
340 iso_pu_bacteria 2511231007 2511271347 184
341 iso_pu_bacteria 2511231008 2511279447 184
342 iso_pu_bacteria 2511231010 2511287793 184
343 iso_pu_bacteria 2511231011 2511294805 184
344 iso_pu_bacteria 2511231016 2511327295 184
345 iso_pu_bacteria 2511231017 2511330795 184
346 iso_pu_bacteria 2511231018 2511339538 184
347 iso_pu_bacteria 2511231019 2511343637 184
348 iso_pu_bacteria 2511231022 2511361583 184
349 iso_pu_bacteria 2511231023 2511367140 184
350 iso_pu_bacteria 2511231031 2511413812 184
351 iso_pu_bacteria 2511231156 2511822658 184
352 iso_pu_bacteria 2512047018 2512328105 184
353 iso_pu_bacteria 2554235341 2555667635 184
354 iso_pu_bacteria 2582580891 2583790130 184
355 iso_pu_bacteria 2597489887 2597855856 184
356 iso_pu_bacteria 2599185160 2599356854 184
357 iso_pu_bacteria 2599185164 2599381959 184
358 iso_pu_bacteria 2599185165 2599387897 184
359 iso_pu_bacteria 2599185181 2599463687 184
360 iso_pu_bacteria 2599185182 2599468965 184
361 iso_pu_bacteria 2599185185 2599487918 184
362 iso_pu_bacteria 2599185186 2599492706 184
363 iso_pu_bacteria 2599185188 2599499908 184
364 iso_pu_bacteria 2599185212 2599616426 184
365 iso_pu_bacteria 2599185248 2599769624 184
366 iso_pu_bacteria 2599185257 2599806889 184
367 iso_pu_bacteria 2599185289 2599887043 184
368 iso_pu_bacteria 2599185291 2599898372 184
369 iso_pu_bacteria 2599185300 2599931103 184
370 iso_pu_bacteria 2599185302 2599944517 184
371 iso_pu_bacteria 2599185304 2599956140 184
372 iso_pu_bacteria 2599185305 2599961134 184
373 iso_pu_bacteria 2599185306 2599964761 184
374 iso_pu_bacteria 2599185308 2599977308 184
375 iso_pu_bacteria 2599185309 2599983094 184
376 iso_pu_bacteria 2599185310 2599991027 184
377 iso_pu_bacteria 2599185311 2599996808 184
378 iso_pu_bacteria 2599185312 2600001101 184
379 iso_pu_bacteria 2599185313 2600006971 184
380 iso_pu_bacteria 2599185314 2600011476 184
381 iso_pu_bacteria 2599185315 2600019290 184
382 iso_pu_bacteria 2599185316 2600025086 184
383 iso_pu_bacteria 2599185317 2600031387 184
384 iso_pu_bacteria 2599185318 2600036916 184
385 iso_pu_bacteria 2599185319 2600043188 184
386 iso_pu_bacteria 2599185320 2600048097 184
387 iso_pu_bacteria 2599185321 2600054365 184
388 iso_pu_bacteria 2599185322 2600062565 184
389 iso_pu_bacteria 2599185323 2600066617 184
390 iso_pu_bacteria 2599185324 2600073967 184
391 iso_pu_bacteria 2599185325 2600078341 184
392 iso_pu_bacteria 2599185356 2600216316 184
393 iso_pu_bacteria 2600254930 2600361105 184
394 iso_pu_bacteria 2600254931 2600364681 184
395 iso_pu_bacteria 2600255313 2601776483 184
396 iso_pu_bacteria 2600255318 2601798046 184
397 iso_pu_bacteria 2603880185 2606076471 184
398 iso_pu_bacteria 2603880199 2606129115 184
399 iso_pu_bacteria 2623620443 2624478437 184
400 iso_pu_bacteria 2623620446 2624489980 184
401 iso_pu_bacteria 2643221633 2644190024 184
402 iso_pu_bacteria 2643221650 2644281480 184
403 iso_pu_bacteria 2667528170 2671090588 184
404 iso_pu_bacteria 2667528171 2671099757 184
405 iso_pu_bacteria 2667528176 2671129133 184
406 iso_pu_bacteria 2671180172 2671772541 184
407 iso_pu_bacteria 2675903515 2678261207 184
408 iso_pu_bacteria 2713897148 2715749417 184
409 iso_pu_bacteria 2713897149 2715759579 184
410 iso_pu_bacteria 2718217725 2718632372 184
411 iso_pu_bacteria 2738543025 2739311503 184
412 iso_pu_bacteria 2740892503 2743735277 184
413 iso_pu_bacteria 2744054620 2745006518 184
414 iso_pu_bacteria 2773857670 2774119338 184
415 iso_pu_bacteria 2773857673 2774134948 184
416 iso_pu_bacteria 2784132063 2784260830 184
417 iso_pu_bacteria 2784132072 2784317118 184
418 iso_pu_bacteria 2791355520 2794594236 184
419 iso_pu_bacteria 2808606361 2808858306 184
420 iso_pu_bacteria 2808606376 2808922530 184
421 iso_pu_bacteria 2808606377 2808933043 184
422 iso_pu_bacteria 2808606378 2808938427 184
423 iso_pu_bacteria 2808606380 2808944217 184
424 iso_pu_bacteria 2808606381 2808955218 184
425 iso_pu_bacteria 2808606382 2808956083 184
426 iso_pu_bacteria 2808606383 2808966791 184
427 iso_pu_bacteria 2808606389 2809001609 184
428 iso_pu_bacteria 2808606445 2809218186 184
429 iso_pu_bacteria 2818991456 2819657443 184
430 iso_pu_bacteria 2818991464 2819705427 184
431 iso_pu_bacteria 2825651385 2825654058 184
432 iso_pu_bacteria 2842832357 2842834371 184
433 iso_pu_bacteria 2842843487 2842846152 184
434 iso_pu_bacteria 2842854478 2842859758 184
435 iso_pu_bacteria 2844665904 2844668108 184
436 iso_pu_bacteria 2852657418 2852660235 184
437 iso_pu_bacteria 2860339153 2860343426 184
438 iso_pu_bacteria 2878029506 2878030379 184
439 iso_pu_bacteria 2880230671 2880231326 184
440 iso_pu_bacteria 2904518522 2904519782 184
441 iso_pu_bacteria 2913036834 2913037491 184
442 iso_pu_bacteria 2919385768 2919389559 184
443 iso_pu_bacteria 2919481497 2919486631 184
444 iso_pu_bacteria 2919487758 2919488491 184
445 iso_pu_bacteria 2919697872 2919698739 184
446 iso_pu_bacteria 2923153595 2923154275 184
447 iso_pu_bacteria 2923586266 2923591725 184
448 iso_pu_bacteria 2929144301 2929145028 184
449 iso_pu_bacteria 2931369376 2931371640 184
450 iso_pu_bacteria 2931396565 2931399055 184
451 iso_pu_bacteria 2935353572 2935359214 184
452 iso_pu_bacteria 2969304461 2969305173 184
453 iso_pu_bacteria 2974289157 2974293137 184
454 iso_pu_bacteria 2984286254 2984291783 184
455 iso_pu_bacteria 2988728565 2988732416 184
456 iso_pu_bacteria 2998139840 2998140675 184
457 iso_pu_bacteria 3007395558 3007399828 184
458 iso_pu_bacteria 3007511990 3007518134 184
459 iso_pu_bacteria 3007614139 3007617461 184
460 iso_pu_bacteria 3007619802 3007620038 184
461 iso_pu_bacteria 3007855910 3007859906 184
462 iso_pu_bacteria 3007861166 3007864115 184
463 iso_pu_bacteria 3007866637 3007867242 184
464 iso_pu_bacteria 637000220 637318027 184
465 iso_pu_bacteria 8019769354 8019770506 184
466 iso_pu_bacteria 8019775933 8019777557 184
467 iso_pu_bacteria 8029995093 8030000064 184
468 iso_pu_bacteria 8055770955 8055771624 184
469 iso_pu_bacteria 8056125926 8056126683 184
470 iso_pu_bacteria 8056143049 8056143956 184
471 iso_pu_bacteria 8056155041 8056158725 184
472 iso_pu_bacteria 8056166840 8056170371 184
473 iso_pu_bacteria 8056569372 8056573505 184
474 iso_pu_bacteria 8057798959 8057802913 184
475 2124908027 MRS2a_Contig_791 MRS2a_00648290 185
476 3300003781 Ga0055536_1000245 Ga0055536_100024512 185
477 3300003781 Ga0055536_1001194 Ga0055536_10011949 185
478 3300003791 Ga0055530_10000375 Ga0055530_100003758 185
479 3300003792 Ga0055540_1000992 Ga0055540_10009929 185
480 3300005288 Ga0065714_10106764 Ga0065714_101067642 185
481 3300005288 Ga0065714_10124951 Ga0065714_101249512 185
482 3300005289 Ga0065704_10137717 Ga0065704_101377172 185
483 3300005290 Ga0065712_10069777 Ga0065712_100697775 185
484 3300005293 Ga0065715_10002636 Ga0065715_100026364 185
485 3300006058 Ga0075432_10019196 Ga0075432_100191963 185
486 3300009011 Ga0105251_10002442 Ga0105251_100024428 185
487 3300009011 Ga0105251_10015169 Ga0105251_100151695 185
488 3300009036 Ga0105244_10125839 Ga0105244_101258392 185
489 3300009036 Ga0105244_10127813 Ga0105244_101278132 185
490 3300009092 Ga0105250_10028647 Ga0105250_100286472 185
491 3300009148 Ga0105243_10012262 Ga0105243_100122623 185
492 3300013100 Ga0157373_10052278 Ga0157373_100522783 185
493 3300013100 Ga0157373_10116434 Ga0157373_101164342 185
494 3300013102 Ga0157371_10919627 Ga0157371_109196271 185
495 3300013104 Ga0157370_10054670 Ga0157370_100546704 185
496 3300013105 Ga0157369_10013513 Ga0157369_100135132 185
497 3300013105 Ga0157369_10237392 Ga0157369_102373923 185
498 3300013105 Ga0157369_10356640 Ga0157369_103566402 185
499 3300013308 Ga0157375_10917686 Ga0157375_109176862 185
500 3300014497 Ga0182008_10044094 Ga0182008_100440942 185
501 3300014497 Ga0182008_10075904 Ga0182008_100759042 185
502 3300015261 Ga0182006_1002320 Ga0182006_10023206 185
503 3300015261 Ga0182006_1027091 Ga0182006_10270913 185
504 3300015261 Ga0182006_1034725 Ga0182006_10347252 185
505 3300015265 Ga0182005_1039057 Ga0182005_10390572 185
506 3300020070 Ga0206356_10475313 Ga0206356_104753131 185
507 3300025292 Ga0209676_1000096 Ga0209676_100009658 185
508 3300025292 Ga0209676_1000426 Ga0209676_100042615 185
509 3300025298 Ga0209050_1000386 Ga0209050_100038612 185
510 3300025303 Ga0209051_1000381 Ga0209051_100038111 185
511 3300025711 Ga0207696_1001699 Ga0207696_10016997 185
512 3300025728 Ga0207655_1015301 Ga0207655_10153013 185
513 3300025728 Ga0207655_1094583 Ga0207655_10945832 185
514 3300025735 Ga0207713_1003397 Ga0207713_10033978 185
515 3300025735 Ga0207713_1012218 Ga0207713_10122181 185
516 3300025735 Ga0207713_1026211 Ga0207713_10262114 185
517 3300025735 Ga0207713_1028690 Ga0207713_10286903 185
518 3300025935 Ga0207709_10030967 Ga0207709_100309673 185
519 3300027111 Ga0209281_1005994 Ga0209281_10059942 185
520 3300030521 Ga0307511_10015716 Ga0307511_100157164 185
521 3300030735 Ga0316178_1061639 Ga0316178_10616397 185
522 3300031903 Ga0307407_10206763 Ga0307407_102067632 185
523 3300031911 Ga0307412_10004782 Ga0307412_100047825 185
524 3300031911 Ga0307412_10011649 Ga0307412_100116493 185
525 3300031995 Ga0307409_100237256 Ga0307409_1002372562 185
526 3300032004 Ga0307414_10004291 Ga0307414_100042915 185
527 3300041405 Ga0439438_000803 Ga0439438_000803_6760_7377 185
528 3300041405 Ga0439438_020093 Ga0439438_020093_918_1529 185
529 3300041407 Ga0439447_009168 Ga0439447_009168_1840_2457 185
530 3300041407 Ga0439447_010654 Ga0439447_010654_1826_2449 185
531 3300041411 Ga0439466_0003089 Ga0439466_0003089_248_865 185
532 3300041997 Ga0439431_0051455 Ga0439431_0051455_246_863 185
533 3300042004 Ga0439445_0028228 Ga0439445_0028228_712_1329 185
534 3300042006 Ga0439432_005404 Ga0439432_005404_356_967 185
535 3300042006 Ga0439432_018567 Ga0439432_018567_1665_2282 185
536 3300042010 Ga0439452_000279 Ga0439452_000279_6962_7573 185
537 3300042010 Ga0439452_012515 Ga0439452_012515_1697_2314 185
538 3300042013 Ga0439456_004272 Ga0439456_004272_2089_2700 185
539 3300042013 Ga0439456_008501 Ga0439456_008501_1400_2017 185
540 3300042013 Ga0439456_048864 Ga0439456_048864_115_726 185
541 3300042016 Ga0439463_000080 Ga0439463_000080_10225_10836 185
542 3300042016 Ga0439463_019003 Ga0439463_019003_97_708 185
543 3300042016 Ga0439463_022565 Ga0439463_022565_139_750 185
544 3300042115 Ga0450911_000222 Ga0450911_000222_6925_7536 185
545 3300042136 Ga0450900_015203 Ga0450900_015203_139_750 185
546 3300042137 Ga0450902_017050 Ga0450902_017050_501_1112 185
547 3300042138 Ga0450903_021548 Ga0450903_021548_255_866 185
548 3300042145 Ga0450906_000142 Ga0450906_000142_12187_12798 185
549 3300042147 Ga0450910_021055 Ga0450910_021055_254_877 185
550 3300042156 Ga0439446_0070722 Ga0439446_0070722_364_981 185
551 3300042185 Ga0450909_015610 Ga0450909_015610_369_992 185
552 3300042993 Ga0439440_0035044 Ga0439440_0035044_232_843 185
553 3300042993 Ga0439440_0067356 Ga0439440_0067356_232_846 185
554 3300046452 Ga0495617_078127 Ga0495617_078127_422_1036 185
555 3300046458 Ga0495591_011596 Ga0495591_011596_427_1062 185
556 3300046458 Ga0495591_026098 Ga0495591_026098_390_1013 185
557 3300046458 Ga0495591_035730 Ga0495591_035730_668_1282 185
558 3300046459 Ga0495629_0002904 Ga0495629_0002904_4397_5011 185
559 3300046460 Ga0495638_0008163 Ga0495638_0008163_6628_7242 185
560 3300046460 Ga0495638_0013873 Ga0495638_0013873_1449_2072 185
561 3300046460 Ga0495638_0210834 Ga0495638_0210834_256_879 185
562 3300046473 Ga0495582_0007839 Ga0495582_0007839_4662_5276 185
563 3300046474 Ga0495605_0003210 Ga0495605_0003210_8461_9096 185
564 3300046474 Ga0495605_0044461 Ga0495605_0044461_1413_2027 185
565 3300046474 Ga0495605_0063296 Ga0495605_0063296_677_1291 185
566 3300046475 Ga0495639_0019939 Ga0495639_0019939_1637_2251 185
567 3300046491 Ga0495584_0001817 Ga0495584_0001817_5872_6495 185
568 3300046491 Ga0495584_0002793 Ga0495584_0002793_8067_8690 185
569 3300046491 Ga0495584_0027284 Ga0495584_0027284_132_755 185
570 3300046491 Ga0495584_0193673 Ga0495584_0193673_100_708 185
571 3300046499 Ga0495594_0066285 Ga0495594_0066285_1242_1856 185
572 3300046501 Ga0495607_0006092 Ga0495607_0006092_5768_6391 185
573 3300046501 Ga0495607_0102876 Ga0495607_0102876_391_1005 185
574 3300046501 Ga0495607_0121726 Ga0495607_0121726_486_1100 185
575 3300046506 Ga0495583_0026635 Ga0495583_0026635_1993_2616 185
576 3300046506 Ga0495583_0035558 Ga0495583_0035558_637_1251 185
577 3300046506 Ga0495583_0068725 Ga0495583_0068725_747_1370 185
578 3300046507 Ga0495606_0004686 Ga0495606_0004686_7057_7680 185
579 3300046512 Ga0495610_0002996 Ga0495610_0002996_5812_6435 185
580 3300046512 Ga0495610_0033032 Ga0495610_0033032_1602_2225 185
581 3300046512 Ga0495610_0175807 Ga0495610_0175807_121_729 185
582 3300046513 Ga0495616_0015912 Ga0495616_0015912_407_1042 185
583 3300046515 Ga0495620_0005462 Ga0495620_0005462_1300_1923 185
584 3300046516 Ga0495628_0097825 Ga0495628_0097825_1339_1953 185
585 3300046517 Ga0495630_0002068 Ga0495630_0002068_5805_6419 185
586 3300046518 Ga0495631_0028894 Ga0495631_0028894_1455_2078 185
587 3300046519 Ga0495632_0003573 Ga0495632_0003573_4660_5295 185
588 3300046520 Ga0495637_0004759 Ga0495637_0004759_5891_6514 185
589 3300046522 Ga0495643_0152113 Ga0495643_0152113_213_836 185
590 3300046523 Ga0495644_0016087 Ga0495644_0016087_2229_2852 185
591 3300046524 Ga0495648_0022456 Ga0495648_0022456_1803_2426 185
592 3300046524 Ga0495648_0224613 Ga0495648_0224613_133_756 185
593 3300046528 Ga0495642_0000051 Ga0495642_0000051_50737_51351 185
594 3300046530 Ga0495654_0001854 Ga0495654_0001854_5449_6072 185
595 3300046535 Ga0495586_0031461 Ga0495586_0031461_696_1310 185
596 3300046536 Ga0495587_0008447 Ga0495587_0008447_4439_5053 185
597 3300046542 Ga0495597_0092375 Ga0495597_0092375_559_1182 185
598 3300046542 Ga0495597_0133842 Ga0495597_0133842_369_983 185
599 3300046543 Ga0495645_0100041 Ga0495645_0100041_812_1426 185
600 3300046557 Ga0495622_0000609 Ga0495622_0000609_12676_13290 185
601 3300046557 Ga0495622_0090311 Ga0495622_0090311_653_1267 185
602 3300046557 Ga0495622_0092759 Ga0495622_0092759_122_736 185
603 3300046558 Ga0495633_0214865 Ga0495633_0214865_51_665 185
604 3300046642 Ga0495634_0329135 Ga0495634_0329135_186_800 185
605 3300046660 Ga0495625_0049210 Ga0495625_0049210_1651_2265 185
606 3300046663 Ga0495635_0004007 Ga0495635_0004007_8600_9214 185
607 3300046664 Ga0495659_0012469 Ga0495659_0012469_1126_1740 185
608 3300046665 Ga0495661_0020069 Ga0495661_0020069_2063_2686 185
609 3300046665 Ga0495661_0198193 Ga0495661_0198193_327_950 185
610 3300046674 Ga0495588_0003759 Ga0495588_0003759_2896_3510 185
611 3300046674 Ga0495588_0130742 Ga0495588_0130742_74_688 185
612 3300046680 Ga0495646_0061393 Ga0495646_0061393_912_1526 185
613 3300046689 Ga0495613_0009363 Ga0495613_0009363_905_1519 185
614 3300046691 Ga0495670_0002033 Ga0495670_0002033_2733_3356 185
615 3300046691 Ga0495670_0005291 Ga0495670_0005291_164_787 185
616 3300046694 Ga0495649_0005293 Ga0495649_0005293_2737_3360 185
617 3300046694 Ga0495649_0237431 Ga0495649_0237431_75_689 185
618 3300046809 Ga0495600_0020768 Ga0495600_0020768_297_911 185
619 3300046810 Ga0495660_0064925 Ga0495660_0064925_176_811 185
620 3300047315 Ga0495581_0018020 Ga0495581_0018020_626_1240 185
621 3300047317 Ga0495604_0015208 Ga0495604_0015208_2863_3477 185
622 3300047319 Ga0495674_0935736 Ga0495674_0935736_25_639 185
623 3300047320 Ga0495672_0168241 Ga0495672_0168241_381_995 185
624 3300047322 Ga0495680_0000764 Ga0495680_0000764_16773_17387 185
625 3300047444 Ga0495675_0090052 Ga0495675_0090052_297_911 185
626 3300047446 Ga0495679_002683 Ga0495679_002683_147_770 185
627 3300047469 Ga0495673_0001076 Ga0495673_0001076_22160_22783 185
628 3300047469 Ga0495673_0001742 Ga0495673_0001742_8899_9513 185
629 3300047469 Ga0495673_0004482 Ga0495673_0004482_7056_7679 185
630 3300047469 Ga0495673_0041930 Ga0495673_0041930_168_782 185
631 3300047470 Ga0495681_0001277 Ga0495681_0001277_5477_6085 185
632 3300047470 Ga0495681_0002933 Ga0495681_0002933_10384_10998 185
633 3300047470 Ga0495681_0008252 Ga0495681_0008252_3357_3980 185
634 3300047470 Ga0495681_0010534 Ga0495681_0010534_1074_1697 185
635 3300047472 Ga0495686_0292762 Ga0495686_0292762_195_818 185
636 3300047673 Ga0495593_0038234 Ga0495593_0038234_589_1203 185
637 3300047673 Ga0495593_0347346 Ga0495593_0347346_32_646 185
638 3300048090 Ga0495615_0101112 Ga0495615_0101112_70_684 185
639 3300048091 Ga0495626_0000726 Ga0495626_0000726_7134_7769 185
640 3300048913 Ga0496110_0751198 Ga0496110_0751198_81_695 185
641 3300048914 Ga0496111_0429670 Ga0496111_0429670_325_939 185
642 3300048919 Ga0496116_0004365 Ga0496116_0004365_10711_11322 185
643 3300048920 Ga0496117_0000712 Ga0496117_0000712_5654_6259 185
644 3300048920 Ga0496117_0055131 Ga0496117_0055131_907_1518 185
645 3300048921 Ga0496118_0004004 Ga0496118_0004004_10782_11393 185
646 3300048921 Ga0496118_0166112 Ga0496118_0166112_367_972 185
647 3300048923 Ga0496120_0001345 Ga0496120_0001345_23957_24562 185
648 3300048923 Ga0496120_0063614 Ga0496120_0063614_1262_1873 185
649 3300048925 Ga0496122_0055722 Ga0496122_0055722_629_1240 185
650 3300048926 Ga0496123_0006317 Ga0496123_0006317_191_802 185
651 3300048927 Ga0496124_0001071 Ga0496124_0001071_5583_6188 185
652 3300048927 Ga0496124_0003709 Ga0496124_0003709_16604_17215 185
653 3300048927 Ga0496124_0161267 Ga0496124_0161267_1101_1715 185
654 3300048928 Ga0496125_0127335 Ga0496125_0127335_341_955 185
655 3300049459 Ga0495678_006024 Ga0495678_006024_5760_6383 185
656 3300049460 Ga0495682_0065913 Ga0495682_0065913_19_633 185
657 3300049758 Ga0501241_000245 Ga0501241_000245_219_830 185
658 3300002737 JGI25162J39368_1000195 JGI25162J39368_10001958 186
659 3300002771 JGI25163J39215_1000123 JGI25163J39215_10001237 186
660 3300002772 JGI25164J39214_1000225 JGI25164J39214_100022536 186
661 3300003214 JGI25165J46597_1000291 JGI25165J46597_10002918 186
662 3300003781 Ga0055536_1000299 Ga0055536_10002999 186
663 3300003791 Ga0055530_10000340 Ga0055530_1000034030 186
664 3300003791 Ga0055530_10001838 Ga0055530_100018388 186
665 3300003791 Ga0055530_10009095 Ga0055530_100090953 186
666 3300003792 Ga0055540_1000162 Ga0055540_100016254 186
667 3300003792 Ga0055540_1001362 Ga0055540_10013628 186
668 3300003794 Ga0055531_10000734 Ga0055531_100007347 186
669 3300005288 Ga0065714_10064979 Ga0065714_100649798 186
670 3300005288 Ga0065714_10093459 Ga0065714_100934592 186
671 3300005288 Ga0065714_10108617 Ga0065714_101086172 186
672 3300005288 Ga0065714_10202672 Ga0065714_102026722 186
673 3300005289 Ga0065704_10001021 Ga0065704_100010217 186
674 3300005353 Ga0070669_100029076 Ga0070669_1000290763 186
675 3300005548 Ga0070665_100247608 Ga0070665_1002476083 186
676 3300005548 Ga0070665_100351967 Ga0070665_1003519672 186
677 3300006051 Ga0075364_10083882 Ga0075364_100838822 186
678 3300006051 Ga0075364_10146011 Ga0075364_101460113 186
679 3300006051 Ga0075364_10254572 Ga0075364_102545721 186
680 3300006058 Ga0075432_10025418 Ga0075432_100254184 186
681 3300006058 Ga0075432_10034724 Ga0075432_100347243 186
682 3300006058 Ga0075432_10089623 Ga0075432_100896232 186
683 3300006058 Ga0075432_10293630 Ga0075432_102936301 186
684 3300006177 Ga0075362_10006469 Ga0075362_100064693 186
685 3300006177 Ga0075362_10025178 Ga0075362_100251783 186
686 3300006914 Ga0075436_100126417 Ga0075436_1001264173 186
687 3300006914 Ga0075436_100199074 Ga0075436_1001990741 186
688 3300006946 Ga0079104_1000580 Ga0079104_100058029 186
689 3300006946 Ga0079104_1001511 Ga0079104_10015117 186
690 3300006946 Ga0079104_1001815 Ga0079104_10018157 186
691 3300006948 Ga0099826_10003389 Ga0099826_1000338910 186
692 3300009011 Ga0105251_10116327 Ga0105251_101163271 186
693 3300009011 Ga0105251_10126789 Ga0105251_101267892 186
694 3300009011 Ga0105251_10245100 Ga0105251_102451001 186
695 3300009011 Ga0105251_10293614 Ga0105251_102936141 186
696 3300009036 Ga0105244_10015386 Ga0105244_100153864 186
697 3300009036 Ga0105244_10085054 Ga0105244_100850542 186
698 3300009036 Ga0105244_10094371 Ga0105244_100943712 186
699 3300009036 Ga0105244_10122158 Ga0105244_101221582 186
700 3300009092 Ga0105250_10001438 Ga0105250_100014389 186
701 3300009092 Ga0105250_10003050 Ga0105250_100030503 186
702 3300009092 Ga0105250_10005748 Ga0105250_100057484 186
703 3300009148 Ga0105243_10000225 Ga0105243_1000022556 186
704 3300009553 Ga0105249_10149629 Ga0105249_101496292 186
705 3300012498 Ga0157345_1000032 Ga0157345_10000329 186
706 3300012502 Ga0157347_1001892 Ga0157347_10018922 186
707 3300013100 Ga0157373_10000478 Ga0157373_1000047825 186
708 3300013100 Ga0157373_10158868 Ga0157373_101588681 186
709 3300013102 Ga0157371_10001273 Ga0157371_1000127324 186
710 3300013102 Ga0157371_10006721 Ga0157371_100067213 186
711 3300013102 Ga0157371_10092732 Ga0157371_100927322 186
712 3300013104 Ga0157370_10006519 Ga0157370_100065198 186
713 3300013104 Ga0157370_10137029 Ga0157370_101370292 186
714 3300013104 Ga0157370_10146380 Ga0157370_101463803 186
715 3300013105 Ga0157369_10001544 Ga0157369_1000154423 186
716 3300013306 Ga0163162_10000902 Ga0163162_1000090211 186
717 3300013306 Ga0163162_10031477 Ga0163162_100314775 186
718 3300013308 Ga0157375_10229532 Ga0157375_102295322 186
719 3300014497 Ga0182008_10017285 Ga0182008_100172852 186
720 3300015261 Ga0182006_1014703 Ga0182006_10147032 186
721 3300015261 Ga0182006_1077023 Ga0182006_10770232 186
722 3300015265 Ga0182005_1005798 Ga0182005_10057982 186
723 3300015265 Ga0182005_1006559 Ga0182005_10065592 186
724 3300015265 Ga0182005_1030345 Ga0182005_10303452 186
725 3300015265 Ga0182005_1059753 Ga0182005_10597532 186
726 3300017792 Ga0163161_10001721 Ga0163161_1000172111 186
727 3300017792 Ga0163161_10007200 Ga0163161_100072007 186
728 3300017792 Ga0163161_10007727 Ga0163161_100077273 186
729 3300017792 Ga0163161_10087252 Ga0163161_100872522 186
730 3300017792 Ga0163161_10838506 Ga0163161_108385062 186
731 3300017792 Ga0163161_10846363 Ga0163161_108463631 186
732 3300025207 Ga0209760_100031 Ga0209760_10003135 186
733 3300025231 Ga0207427_100067 Ga0207427_100067106 186
734 3300025233 Ga0209437_100016 Ga0209437_10001652 186
735 3300025261 Ga0209233_1000156 Ga0209233_1000156106 186
736 3300025291 Ga0209675_1002460 Ga0209675_10024607 186
737 3300025292 Ga0209676_1000025 Ga0209676_100002554 186
738 3300025292 Ga0209676_1004102 Ga0209676_10041026 186
739 3300025298 Ga0209050_1000500 Ga0209050_10005008 186
740 3300025298 Ga0209050_1001481 Ga0209050_10014817 186
741 3300025298 Ga0209050_1001681 Ga0209050_100168116 186
742 3300025303 Ga0209051_1000089 Ga0209051_100008955 186
743 3300025303 Ga0209051_1000206 Ga0209051_100020634 186
744 3300025303 Ga0209051_1011342 Ga0209051_10113422 186
745 3300025304 Ga0209257_1000034 Ga0209257_100003454 186
746 3300025304 Ga0209257_1005409 Ga0209257_10054094 186
747 3300025711 Ga0207696_1000085 Ga0207696_100008551 186
748 3300025711 Ga0207696_1000494 Ga0207696_10004945 186
749 3300025711 Ga0207696_1028463 Ga0207696_10284633 186
750 3300025728 Ga0207655_1002034 Ga0207655_10020344 186
751 3300025728 Ga0207655_1024897 Ga0207655_10248973 186
752 3300025728 Ga0207655_1024935 Ga0207655_10249352 186
753 3300025728 Ga0207655_1040242 Ga0207655_10402423 186
754 3300025728 Ga0207655_1057299 Ga0207655_10572992 186
755 3300025728 Ga0207655_1064139 Ga0207655_10641392 186
756 3300025735 Ga0207713_1001693 Ga0207713_100169311 186
757 3300025735 Ga0207713_1006219 Ga0207713_10062198 186
758 3300025923 Ga0207681_10005475 Ga0207681_100054758 186
759 3300025935 Ga0207709_10000634 Ga0207709_1000063417 186
760 3300027111 Ga0209281_1000033 Ga0209281_100003329 186
761 3300027111 Ga0209281_1000159 Ga0209281_1000159101 186
762 3300027907 Ga0207428_10024997 Ga0207428_100249975 186
763 3300027907 Ga0207428_10137810 Ga0207428_101378102 186
764 3300027907 Ga0207428_10200258 Ga0207428_102002581 186
765 3300027907 Ga0207428_10325475 Ga0207428_103254752 186
766 3300028379 Ga0268266_10165062 Ga0268266_101650623 186
767 3300028379 Ga0268266_10225673 Ga0268266_102256732 186
768 3300030521 Ga0307511_10137412 Ga0307511_101374122 186
769 3300031548 Ga0307408_100004864 Ga0307408_1000048644 186
770 3300031548 Ga0307408_100007276 Ga0307408_1000072767 186
771 3300031730 Ga0307516_10549209 Ga0307516_105492092 186
772 3300031901 Ga0307406_10192428 Ga0307406_101924282 186
773 3300033180 Ga0307510_10001007 Ga0307510_1000100725 186
774 3300041405 Ga0439438_000761 Ga0439438_000761_5812_6420 186
775 3300041407 Ga0439447_000888 Ga0439447_000888_533_1141 186
776 3300041407 Ga0439447_001154 Ga0439447_001154_1364_1981 186
777 3300041410 Ga0439461_0017957 Ga0439461_0017957_501_1118 186
778 3300041411 Ga0439466_0007959 Ga0439466_0007959_550_1167 186
779 3300041411 Ga0439466_0024015 Ga0439466_0024015_335_943 186
780 3300041411 Ga0439466_0064897 Ga0439466_0064897_99_725 186
781 3300041413 Ga0439465_0002562 Ga0439465_0002562_3245_3862 186
782 3300042006 Ga0439432_000941 Ga0439432_000941_8577_9194 186
783 3300042006 Ga0439432_009764 Ga0439432_009764_256_882 186
784 3300042009 Ga0439451_033652 Ga0439451_033652_273_899 186
785 3300042009 Ga0439451_034132 Ga0439451_034132_76_684 186
786 3300042010 Ga0439452_002701 Ga0439452_002701_2132_2749 186
787 3300042013 Ga0439456_001262 Ga0439456_001262_3141_3758 186
788 3300042016 Ga0439463_001572 Ga0439463_001572_1807_2424 186
789 3300042016 Ga0439463_111036 Ga0439463_111036_20_628 186
790 3300042121 Ga0450919_000020 Ga0450919_000020_523_1140 186
791 3300042121 Ga0450919_002131 Ga0450919_002131_328_936 186
792 3300042124 Ga0450922_000241 Ga0450922_000241_683_1291 186
793 3300042127 Ga0450890_000104 Ga0450890_000104_7678_8295 186
794 3300042137 Ga0450902_006134 Ga0450902_006134_1103_1720 186
795 3300042138 Ga0450903_000565 Ga0450903_000565_2587_3204 186
796 3300042138 Ga0450903_005487 Ga0450903_005487_455_1063 186
797 3300042138 Ga0450903_023232 Ga0450903_023232_24_638 186
798 3300042139 Ga0450904_006737 Ga0450904_006737_170_793 186
799 3300042142 Ga0450905_022066 Ga0450905_022066_305_919 186
800 3300042145 Ga0450906_003193 Ga0450906_003193_406_1014 186
801 3300042146 Ga0450907_000578 Ga0450907_000578_3884_4492 186
802 3300042146 Ga0450907_005189 Ga0450907_005189_562_1179 186
803 3300042147 Ga0450910_005315 Ga0450910_005315_418_1035 186
804 3300042156 Ga0439446_0001501 Ga0439446_0001501_4221_4838 186
805 3300042156 Ga0439446_0100160 Ga0439446_0100160_203_811 186
806 3300042184 Ga0450908_006854 Ga0450908_006854_434_1051 186
807 3300042435 Ga0439434_0049460 Ga0439434_0049460_18_635 186
808 3300042439 Ga0439464_0039154 Ga0439464_0039154_421_1038 186
809 3300042461 Ga0439460_0000742 Ga0439460_0000742_4815_5432 186
810 3300042461 Ga0439460_0000763 Ga0439460_0000763_6030_6638 186
811 3300042531 Ga0450918_009312 Ga0450918_009312_614_1231 186
812 3300042993 Ga0439440_0010751 Ga0439440_0010751_981_1598 186
813 3300046452 Ga0495617_000430 Ga0495617_000430_14648_15265 186
814 3300046452 Ga0495617_001678 Ga0495617_001678_8138_8746 186
815 3300046452 Ga0495617_001977 Ga0495617_001977_6064_6678 186
816 3300046452 Ga0495617_007392 Ga0495617_007392_1405_2019 186
817 3300046452 Ga0495617_036928 Ga0495617_036928_960_1568 186
818 3300046452 Ga0495617_183524 Ga0495617_183524_18_632 186
819 3300046453 Ga0495627_000549 Ga0495627_000549_7691_8305 186
820 3300046453 Ga0495627_002672 Ga0495627_002672_7003_7617 186
821 3300046453 Ga0495627_002942 Ga0495627_002942_609_1223 186
822 3300046453 Ga0495627_121848 Ga0495627_121848_79_687 186
823 3300046455 Ga0495603_0013095 Ga0495603_0013095_790_1404 186
824 3300046455 Ga0495603_0018910 Ga0495603_0018910_2736_3350 186
825 3300046455 Ga0495603_0416260 Ga0495603_0416260_46_660 186
826 3300046457 Ga0495590_0000854 Ga0495590_0000854_7623_8231 186
827 3300046457 Ga0495590_0002734 Ga0495590_0002734_5852_6469 186
828 3300046457 Ga0495590_0041635 Ga0495590_0041635_964_1578 186
829 3300046458 Ga0495591_000620 Ga0495591_000620_19221_19835 186
830 3300046458 Ga0495591_000952 Ga0495591_000952_6572_7186 186
831 3300046458 Ga0495591_001093 Ga0495591_001093_7226_7840 186
832 3300046458 Ga0495591_002038 Ga0495591_002038_10793_11401 186
833 3300046458 Ga0495591_002945 Ga0495591_002945_150_764 186
834 3300046458 Ga0495591_006903 Ga0495591_006903_3260_3874 186
835 3300046458 Ga0495591_011493 Ga0495591_011493_2721_3335 186
836 3300046458 Ga0495591_057105 Ga0495591_057105_199_813 186
837 3300046460 Ga0495638_0000910 Ga0495638_0000910_238_852 186
838 3300046460 Ga0495638_0015498 Ga0495638_0015498_4186_4794 186
839 3300046460 Ga0495638_0022258 Ga0495638_0022258_714_1328 186
840 3300046460 Ga0495638_0226059 Ga0495638_0226059_335_943 186
841 3300046460 Ga0495638_0227859 Ga0495638_0227859_168_782 186
842 3300046463 Ga0495653_0144164 Ga0495653_0144164_493_1101 186
843 3300046471 Ga0495650_0003654 Ga0495650_0003654_10_624 186
844 3300046471 Ga0495650_0009188 Ga0495650_0009188_317_934 186
845 3300046471 Ga0495650_0057735 Ga0495650_0057735_573_1187 186
846 3300046471 Ga0495650_0060623 Ga0495650_0060623_589_1203 186
847 3300046471 Ga0495650_0071928 Ga0495650_0071928_725_1339 186
848 3300046471 Ga0495650_0137906 Ga0495650_0137906_257_871 186
849 3300046474 Ga0495605_0001094 Ga0495605_0001094_6835_7449 186
850 3300046474 Ga0495605_0001632 Ga0495605_0001632_2436_3053 186
851 3300046474 Ga0495605_0009353 Ga0495605_0009353_1396_2016 186
852 3300046474 Ga0495605_0019719 Ga0495605_0019719_125_739 186
853 3300046474 Ga0495605_0255151 Ga0495605_0255151_125_739 186
854 3300046475 Ga0495639_0072404 Ga0495639_0072404_346_960 186
855 3300046491 Ga0495584_0001647 Ga0495584_0001647_289_903 186
856 3300046491 Ga0495584_0005985 Ga0495584_0005985_238_846 186
857 3300046491 Ga0495584_0217001 Ga0495584_0217001_99_713 186
858 3300046492 Ga0495585_0001365 Ga0495585_0001365_18642_19256 186
859 3300046492 Ga0495585_0002379 Ga0495585_0002379_60_674 186
860 3300046492 Ga0495585_0002556 Ga0495585_0002556_12172_12786 186
861 3300046492 Ga0495585_0016382 Ga0495585_0016382_2037_2651 186
862 3300046492 Ga0495585_0069994 Ga0495585_0069994_568_1182 186
863 3300046499 Ga0495594_0080686 Ga0495594_0080686_501_1115 186
864 3300046500 Ga0495596_0023903 Ga0495596_0023903_126_740 186
865 3300046501 Ga0495607_0001968 Ga0495607_0001968_12246_12863 186
866 3300046501 Ga0495607_0004142 Ga0495607_0004142_2476_3090 186
867 3300046501 Ga0495607_0008230 Ga0495607_0008230_445_1059 186
868 3300046501 Ga0495607_0025006 Ga0495607_0025006_684_1298 186
869 3300046501 Ga0495607_0063952 Ga0495607_0063952_1263_1877 186
870 3300046501 Ga0495607_0098422 Ga0495607_0098422_734_1342 186
871 3300046501 Ga0495607_0140807 Ga0495607_0140807_69_683 186
872 3300046501 Ga0495607_0145450 Ga0495607_0145450_128_742 186
873 3300046501 Ga0495607_0178985 Ga0495607_0178985_309_917 186
874 3300046501 Ga0495607_0322347 Ga0495607_0322347_28_642 186
875 3300046506 Ga0495583_0002939 Ga0495583_0002939_7536_8144 186
876 3300046506 Ga0495583_0146834 Ga0495583_0146834_159_776 186
877 3300046507 Ga0495606_0001304 Ga0495606_0001304_6627_7241 186
878 3300046507 Ga0495606_0001668 Ga0495606_0001668_6834_7448 186
879 3300046507 Ga0495606_0005046 Ga0495606_0005046_12157_12771 186
880 3300046507 Ga0495606_0020888 Ga0495606_0020888_1152_1760 186
881 3300046507 Ga0495606_0025669 Ga0495606_0025669_2434_3048 186
882 3300046507 Ga0495606_0084429 Ga0495606_0084429_1241_1855 186
883 3300046512 Ga0495610_0001104 Ga0495610_0001104_6141_6749 186
884 3300046512 Ga0495610_0005125 Ga0495610_0005125_897_1505 186
885 3300046512 Ga0495610_0006111 Ga0495610_0006111_937_1551 186
886 3300046512 Ga0495610_0007258 Ga0495610_0007258_723_1337 186
887 3300046512 Ga0495610_0102067 Ga0495610_0102067_527_1141 186
888 3300046512 Ga0495610_0145996 Ga0495610_0145996_203_817 186
889 3300046513 Ga0495616_0000706 Ga0495616_0000706_7151_7765 186
890 3300046513 Ga0495616_0001234 Ga0495616_0001234_6792_7406 186
891 3300046513 Ga0495616_0007653 Ga0495616_0007653_4783_5400 186
892 3300046513 Ga0495616_0009837 Ga0495616_0009837_1969_2583 186
893 3300046513 Ga0495616_0263279 Ga0495616_0263279_34_642 186
894 3300046515 Ga0495620_0000355 Ga0495620_0000355_23886_24500 186
895 3300046515 Ga0495620_0003566 Ga0495620_0003566_409_1023 186
896 3300046515 Ga0495620_0033581 Ga0495620_0033581_715_1329 186
897 3300046515 Ga0495620_0066763 Ga0495620_0066763_310_918 186
898 3300046515 Ga0495620_0081305 Ga0495620_0081305_452_1060 186
899 3300046517 Ga0495630_0044082 Ga0495630_0044082_2712_3320 186
900 3300046518 Ga0495631_0000532 Ga0495631_0000532_6859_7473 186
901 3300046518 Ga0495631_0002978 Ga0495631_0002978_7707_8321 186
902 3300046518 Ga0495631_0094973 Ga0495631_0094973_280_888 186
903 3300046518 Ga0495631_0152363 Ga0495631_0152363_176_790 186
904 3300046518 Ga0495631_0211130 Ga0495631_0211130_18_632 186
905 3300046519 Ga0495632_0000497 Ga0495632_0000497_29156_29770 186
906 3300046519 Ga0495632_0005134 Ga0495632_0005134_7797_8411 186
907 3300046519 Ga0495632_0018272 Ga0495632_0018272_219_833 186
908 3300046520 Ga0495637_0001344 Ga0495637_0001344_13110_13727 186
909 3300046520 Ga0495637_0001653 Ga0495637_0001653_12079_12693 186
910 3300046520 Ga0495637_0003450 Ga0495637_0003450_7644_8258 186
911 3300046520 Ga0495637_0005825 Ga0495637_0005825_42_662 186
912 3300046520 Ga0495637_0059331 Ga0495637_0059331_270_884 186
913 3300046520 Ga0495637_0118707 Ga0495637_0118707_174_788 186
914 3300046522 Ga0495643_0004192 Ga0495643_0004192_710_1324 186
915 3300046522 Ga0495643_0005087 Ga0495643_0005087_8281_8895 186
916 3300046522 Ga0495643_0134542 Ga0495643_0134542_75_689 186
917 3300046522 Ga0495643_0164920 Ga0495643_0164920_284_907 186
918 3300046522 Ga0495643_0203683 Ga0495643_0203683_253_861 186
919 3300046522 Ga0495643_0290180 Ga0495643_0290180_117_731 186
920 3300046523 Ga0495644_0004669 Ga0495644_0004669_309_917 186
921 3300046523 Ga0495644_0009204 Ga0495644_0009204_235_849 186
922 3300046524 Ga0495648_0000735 Ga0495648_0000735_27728_28342 186
923 3300046524 Ga0495648_0002706 Ga0495648_0002706_7748_8362 186
924 3300046524 Ga0495648_0005719 Ga0495648_0005719_9328_9945 186
925 3300046524 Ga0495648_0006344 Ga0495648_0006344_109_723 186
926 3300046524 Ga0495648_0012158 Ga0495648_0012158_4967_5581 186
927 3300046524 Ga0495648_0015495 Ga0495648_0015495_4154_4762 186
928 3300046524 Ga0495648_0050052 Ga0495648_0050052_707_1321 186
929 3300046526 Ga0495666_0035480 Ga0495666_0035480_1229_1837 186
930 3300046528 Ga0495642_0000120 Ga0495642_0000120_5857_6465 186
931 3300046529 Ga0495652_0383431 Ga0495652_0383431_156_764 186
932 3300046530 Ga0495654_0000786 Ga0495654_0000786_6849_7463 186
933 3300046530 Ga0495654_0003771 Ga0495654_0003771_1012_1620 186
934 3300046530 Ga0495654_0012390 Ga0495654_0012390_3503_4111 186
935 3300046530 Ga0495654_0014270 Ga0495654_0014270_3571_4185 186
936 3300046530 Ga0495654_0036639 Ga0495654_0036639_1062_1679 186
937 3300046530 Ga0495654_0051118 Ga0495654_0051118_709_1323 186
938 3300046530 Ga0495654_0063591 Ga0495654_0063591_745_1353 186
939 3300046530 Ga0495654_0076383 Ga0495654_0076383_244_858 186
940 3300046530 Ga0495654_0113234 Ga0495654_0113234_549_1163 186
941 3300046530 Ga0495654_0114570 Ga0495654_0114570_168_782 186
942 3300046530 Ga0495654_0123951 Ga0495654_0123951_352_960 186
943 3300046536 Ga0495587_0005946 Ga0495587_0005946_896_1504 186
944 3300046538 Ga0495609_0000505 Ga0495609_0000505_23924_24538 186
945 3300046538 Ga0495609_0003591 Ga0495609_0003591_7994_8608 186
946 3300046538 Ga0495609_0003855 Ga0495609_0003855_7754_8368 186
947 3300046538 Ga0495609_0012662 Ga0495609_0012662_720_1334 186
948 3300046538 Ga0495609_0029214 Ga0495609_0029214_1719_2327 186
949 3300046538 Ga0495609_0123269 Ga0495609_0123269_483_1091 186
950 3300046538 Ga0495609_0218757 Ga0495609_0218757_45_659 186
951 3300046542 Ga0495597_0000659 Ga0495597_0000659_26715_27329 186
952 3300046542 Ga0495597_0006485 Ga0495597_0006485_791_1408 186
953 3300046542 Ga0495597_0094062 Ga0495597_0094062_43_660 186
954 3300046542 Ga0495597_0121200 Ga0495597_0121200_254_862 186
955 3300046557 Ga0495622_0002174 Ga0495622_0002174_8792_9400 186
956 3300046557 Ga0495622_0002824 Ga0495622_0002824_7021_7635 186
957 3300046557 Ga0495622_0067221 Ga0495622_0067221_847_1461 186
958 3300046557 Ga0495622_0114010 Ga0495622_0114010_579_1193 186
959 3300046557 Ga0495622_0168053 Ga0495622_0168053_85_699 186
960 3300046557 Ga0495622_0249253 Ga0495622_0249253_96_704 186
961 3300046558 Ga0495633_0001604 Ga0495633_0001604_15477_16091 186
962 3300046558 Ga0495633_0002456 Ga0495633_0002456_11955_12569 186
963 3300046558 Ga0495633_0062845 Ga0495633_0062845_416_1024 186
964 3300046615 Ga0495656_0451336 Ga0495656_0451336_43_657 186
965 3300046616 Ga0495668_0000891 Ga0495668_0000891_6655_7269 186
966 3300046616 Ga0495668_0009461 Ga0495668_0009461_4783_5391 186
967 3300046616 Ga0495668_0350296 Ga0495668_0350296_49_663 186
968 3300046642 Ga0495634_0000750 Ga0495634_0000750_6715_7323 186
969 3300046648 Ga0495611_0000849 Ga0495611_0000849_7960_8574 186
970 3300046648 Ga0495611_0004755 Ga0495611_0004755_4736_5353 186
971 3300046648 Ga0495611_0295218 Ga0495611_0295218_24_638 186
972 3300046660 Ga0495625_0002381 Ga0495625_0002381_12675_13289 186
973 3300046660 Ga0495625_0003130 Ga0495625_0003130_8247_8861 186
974 3300046660 Ga0495625_0005765 Ga0495625_0005765_5212_5826 186
975 3300046660 Ga0495625_0005941 Ga0495625_0005941_191_805 186
976 3300046660 Ga0495625_0010097 Ga0495625_0010097_43_657 186
977 3300046660 Ga0495625_0010920 Ga0495625_0010920_983_1591 186
978 3300046663 Ga0495635_0000942 Ga0495635_0000942_5517_6125 186
979 3300046664 Ga0495659_0032353 Ga0495659_0032353_335_952 186
980 3300046665 Ga0495661_0012119 Ga0495661_0012119_5163_5777 186
981 3300046665 Ga0495661_0076646 Ga0495661_0076646_486_1100 186
982 3300046665 Ga0495661_0180909 Ga0495661_0180909_384_998 186
983 3300046674 Ga0495588_0002784 Ga0495588_0002784_6805_7413 186
984 3300046674 Ga0495588_0004795 Ga0495588_0004795_842_1450 186
985 3300046679 Ga0495623_0001433 Ga0495623_0001433_6601_7209 186
986 3300046680 Ga0495646_0069599 Ga0495646_0069599_897_1505 186
987 3300046684 Ga0495669_0050707 Ga0495669_0050707_72_680 186
988 3300046689 Ga0495613_0038996 Ga0495613_0038996_116_724 186
989 3300046691 Ga0495670_0000635 Ga0495670_0000635_8027_8641 186
990 3300046691 Ga0495670_0008543 Ga0495670_0008543_4094_4702 186
991 3300046691 Ga0495670_0081537 Ga0495670_0081537_417_1031 186
992 3300046692 Ga0495671_0002528 Ga0495671_0002528_320_934 186
993 3300046692 Ga0495671_0003222 Ga0495671_0003222_8310_8924 186
994 3300046692 Ga0495671_0014619 Ga0495671_0014619_2756_3364 186
995 3300046692 Ga0495671_0029099 Ga0495671_0029099_159_767 186
996 3300046692 Ga0495671_0054579 Ga0495671_0054579_791_1405 186
997 3300046692 Ga0495671_0207548 Ga0495671_0207548_183_791 186
998 3300046694 Ga0495649_0001421 Ga0495649_0001421_16434_17048 186
999 3300046694 Ga0495649_0002306 Ga0495649_0002306_1061_1669 186
1000 3300046694 Ga0495649_0007239 Ga0495649_0007239_5608_6216 186
1001 3300046694 Ga0495649_0017472 Ga0495649_0017472_272_886 186
1002 3300046694 Ga0495649_0127189 Ga0495649_0127189_166_780 186
1003 3300046694 Ga0495649_0275888 Ga0495649_0275888_40_654 186
1004 3300046794 Ga0495589_0000425 Ga0495589_0000425_6824_7438 186
1005 3300046794 Ga0495589_0001733 Ga0495589_0001733_5153_5770 186
1006 3300046794 Ga0495589_0183881 Ga0495589_0183881_169_777 186
1007 3300046810 Ga0495660_0002191 Ga0495660_0002191_307_921 186
1008 3300046810 Ga0495660_0003326 Ga0495660_0003326_9284_9898 186
1009 3300046810 Ga0495660_0012390 Ga0495660_0012390_4299_4907 186
1010 3300046810 Ga0495660_0015278 Ga0495660_0015278_186_800 186
1011 3300046810 Ga0495660_0059820 Ga0495660_0059820_351_965 186
1012 3300046810 Ga0495660_0070228 Ga0495660_0070228_807_1430 186
1013 3300046810 Ga0495660_0094619 Ga0495660_0094619_75_689 186
1014 3300046810 Ga0495660_0150540 Ga0495660_0150540_169_792 186
1015 3300047317 Ga0495604_0090291 Ga0495604_0090291_620_1228 186
1016 3300047318 Ga0495636_0002742 Ga0495636_0002742_1705_2322 186
1017 3300047319 Ga0495674_0016688 Ga0495674_0016688_5543_6151 186
1018 3300047320 Ga0495672_0003682 Ga0495672_0003682_5723_6337 186
1019 3300047320 Ga0495672_0006719 Ga0495672_0006719_7913_8521 186
1020 3300047320 Ga0495672_0081174 Ga0495672_0081174_366_974 186
1021 3300047320 Ga0495672_0163141 Ga0495672_0163141_177_785 186
1022 3300047320 Ga0495672_0189793 Ga0495672_0189793_154_768 186
1023 3300047321 Ga0495676_0002813 Ga0495676_0002813_8254_8868 186
1024 3300047322 Ga0495680_0152514 Ga0495680_0152514_513_1121 186
1025 3300047323 Ga0495683_0000452 Ga0495683_0000452_6908_7522 186
1026 3300047323 Ga0495683_0001666 Ga0495683_0001666_1070_1678 186
1027 3300047323 Ga0495683_0046739 Ga0495683_0046739_1360_1974 186
1028 3300047323 Ga0495683_0099669 Ga0495683_0099669_402_1016 186
1029 3300047323 Ga0495683_0118182 Ga0495683_0118182_491_1105 186
1030 3300047443 Ga0495687_002191 Ga0495687_002191_5709_6317 186
1031 3300047444 Ga0495675_0303164 Ga0495675_0303164_95_703 186
1032 3300047446 Ga0495679_000791 Ga0495679_000791_12588_13202 186
1033 3300047469 Ga0495673_0000890 Ga0495673_0000890_25259_25873 186
1034 3300047469 Ga0495673_0001612 Ga0495673_0001612_9734_10348 186
1035 3300047469 Ga0495673_0002437 Ga0495673_0002437_33_647 186
1036 3300047469 Ga0495673_0004780 Ga0495673_0004780_241_849 186
1037 3300047469 Ga0495673_0009779 Ga0495673_0009779_4469_5086 186
1038 3300047469 Ga0495673_0010321 Ga0495673_0010321_313_921 186
1039 3300047469 Ga0495673_0080556 Ga0495673_0080556_593_1207 186
1040 3300047469 Ga0495673_0085165 Ga0495673_0085165_463_1080 186
1041 3300047469 Ga0495673_0126151 Ga0495673_0126151_315_923 186
1042 3300047469 Ga0495673_0224647 Ga0495673_0224647_22_630 186
1043 3300047470 Ga0495681_0000457 Ga0495681_0000457_23882_24496 186
1044 3300047470 Ga0495681_0000508 Ga0495681_0000508_8044_8658 186
1045 3300047470 Ga0495681_0036081 Ga0495681_0036081_741_1349 186
1046 3300047470 Ga0495681_0077574 Ga0495681_0077574_489_1103 186
1047 3300047470 Ga0495681_0090883 Ga0495681_0090883_350_964 186
1048 3300047470 Ga0495681_0150770 Ga0495681_0150770_206_820 186
1049 3300047472 Ga0495686_0003060 Ga0495686_0003060_8128_8742 186
1050 3300047673 Ga0495593_0223979 Ga0495593_0223979_262_870 186
1051 3300048091 Ga0495626_0000732 Ga0495626_0000732_5732_6340 186
1052 3300048091 Ga0495626_0000908 Ga0495626_0000908_5847_6455 186
1053 3300048091 Ga0495626_0001790 Ga0495626_0001790_7152_7766 186
1054 3300048091 Ga0495626_0076361 Ga0495626_0076361_688_1302 186
1055 3300048905 Ga0496102_0000419 Ga0496102_0000419_7220_7828 186
1056 3300048905 Ga0496102_0368355 Ga0496102_0368355_391_999 186
1057 3300048906 Ga0496103_0001964 Ga0496103_0001964_12284_12892 186
1058 3300048917 Ga0496114_0237846 Ga0496114_0237846_314_922 186
1059 3300048918 Ga0496115_0205678 Ga0496115_0205678_660_1268 186
1060 3300048919 Ga0496116_0000338 Ga0496116_0000338_17603_18211 186
1061 3300048919 Ga0496116_0003185 Ga0496116_0003185_8136_8750 186
1062 3300048919 Ga0496116_0024581 Ga0496116_0024581_3337_3945 186
1063 3300048919 Ga0496116_0313485 Ga0496116_0313485_29_643 186
1064 3300048920 Ga0496117_0002877 Ga0496117_0002877_6349_6957 186
1065 3300048920 Ga0496117_0008362 Ga0496117_0008362_5507_6115 186
1066 3300048920 Ga0496117_0147427 Ga0496117_0147427_704_1318 186
1067 3300048920 Ga0496117_0169789 Ga0496117_0169789_488_1096 186
1068 3300048921 Ga0496118_0004826 Ga0496118_0004826_5475_6083 186
1069 3300048921 Ga0496118_0006763 Ga0496118_0006763_10676_11284 186
1070 3300048921 Ga0496118_0020135 Ga0496118_0020135_1601_2209 186
1071 3300048924 Ga0496121_0000713 Ga0496121_0000713_56983_57591 186
1072 3300048924 Ga0496121_0005084 Ga0496121_0005084_16502_17116 186
1073 3300048924 Ga0496121_0012192 Ga0496121_0012192_5523_6137 186
1074 3300048924 Ga0496121_0200581 Ga0496121_0200581_514_1128 186
1075 3300048925 Ga0496122_0003076 Ga0496122_0003076_18390_18998 186
1076 3300048926 Ga0496123_0004296 Ga0496123_0004296_3431_4039 186
1077 3300048927 Ga0496124_0018162 Ga0496124_0018162_665_1279 186
1078 3300048927 Ga0496124_0052192 Ga0496124_0052192_2825_3439 186
1079 3300048927 Ga0496124_0120285 Ga0496124_0120285_331_939 186
1080 3300048928 Ga0496125_0019672 Ga0496125_0019672_5354_5968 186
1081 3300048928 Ga0496125_0038253 Ga0496125_0038253_764_1378 186
1082 3300049459 Ga0495678_000534 Ga0495678_000534_6598_7212 186
1083 3300049459 Ga0495678_001116 Ga0495678_001116_645_1262 186
1084 3300049459 Ga0495678_001271 Ga0495678_001271_7580_8194 186
1085 3300049459 Ga0495678_001492 Ga0495678_001492_6893_7507 186
1086 3300049459 Ga0495678_018763 Ga0495678_018763_324_932 186
1087 3300049459 Ga0495678_027783 Ga0495678_027783_132_746 186
1088 3300049459 Ga0495678_073234 Ga0495678_073234_160_768 186
1089 3300049459 Ga0495678_100817 Ga0495678_100817_124_747 186
1090 3300049459 Ga0495678_121509 Ga0495678_121509_245_859 186
1091 3300049460 Ga0495682_0001179 Ga0495682_0001179_7692_8306 186
1092 3300049460 Ga0495682_0005914 Ga0495682_0005914_4097_4705 186
1093 3300050489 nmdc:mga03683_202822_c1 nmdc:mga03683_202822_c1_197_805 186
1094 3300050489 nmdc:mga03683_3995_c1 nmdc:mga03683_3995_c1_3900_4508 186
1095 3300050491 nmdc:mga00v17_432564_c1 nmdc:mga00v17_432564_c1_75_683 186
1096 3300050514 nmdc:mga08x19_461261_c1 nmdc:mga08x19_461261_c1_208_816 186
1097 3300050514 nmdc:mga08x19_94236_c1 nmdc:mga08x19_94236_c1_216_824 186
1098 3300053111 Ga0500572_000413 Ga0500572_000413_12098_12712 186
1099 3300014497 Ga0182008_10000453 Ga0182008_100004539 187
1100 3300015265 Ga0182005_1032121 Ga0182005_10321212 187
1101 3300015265 Ga0182005_1032123 Ga0182005_10321232 187
1102 3300025230 Ga0209563_101238 Ga0209563_1012383 187
1103 3300027907 Ga0207428_10420964 Ga0207428_104209641 187
1104 3300041405 Ga0439438_000939 Ga0439438_000939_6815_7438 187
1105 3300041407 Ga0439447_000296 Ga0439447_000296_11658_12281 187
1106 3300041407 Ga0439447_001226 Ga0439447_001226_4080_4703 187
1107 3300041411 Ga0439466_0001873 Ga0439466_0001873_6569_7192 187
1108 3300041411 Ga0439466_0011332 Ga0439466_0011332_26_649 187
1109 3300042006 Ga0439432_047896 Ga0439432_047896_504_1127 187
1110 3300042010 Ga0439452_000951 Ga0439452_000951_5540_6163 187
1111 3300042185 Ga0450909_014289 Ga0450909_014289_518_1141 187
1112 3300046452 Ga0495617_170985 Ga0495617_170985_19_645 187
1113 3300046457 Ga0495590_0048472 Ga0495590_0048472_317_925 187
1114 3300046460 Ga0495638_0010326 Ga0495638_0010326_4550_5173 187
1115 3300046460 Ga0495638_0121194 Ga0495638_0121194_726_1355 187
1116 3300046460 Ga0495638_0153076 Ga0495638_0153076_192_812 187
1117 3300046463 Ga0495653_0072543 Ga0495653_0072543_1764_2381 187
1118 3300046474 Ga0495605_0010100 Ga0495605_0010100_4351_4989 187
1119 3300046501 Ga0495607_0006561 Ga0495607_0006561_2195_2821 187
1120 3300046501 Ga0495607_0282315 Ga0495607_0282315_66_689 187
1121 3300046507 Ga0495606_0110339 Ga0495606_0110339_638_1261 187
1122 3300046513 Ga0495616_0000505 Ga0495616_0000505_406_1020 187
1123 3300046517 Ga0495630_0025822 Ga0495630_0025822_3489_4106 187
1124 3300046519 Ga0495632_0018632 Ga0495632_0018632_2790_3413 187
1125 3300046519 Ga0495632_0023794 Ga0495632_0023794_1891_2517 187
1126 3300046519 Ga0495632_0117762 Ga0495632_0117762_183_806 187
1127 3300046520 Ga0495637_0001312 Ga0495637_0001312_6068_6682 187
1128 3300046520 Ga0495637_0003163 Ga0495637_0003163_7808_8431 187
1129 3300046520 Ga0495637_0110226 Ga0495637_0110226_88_711 187
1130 3300046523 Ga0495644_0022515 Ga0495644_0022515_1696_2322 187
1131 3300046524 Ga0495648_0004227 Ga0495648_0004227_8885_9493 187
1132 3300046526 Ga0495666_0001356 Ga0495666_0001356_154_771 187
1133 3300046526 Ga0495666_0004282 Ga0495666_0004282_67_684 187
1134 3300046530 Ga0495654_0002395 Ga0495654_0002395_5235_5867 187
1135 3300046530 Ga0495654_0182523 Ga0495654_0182523_166_804 187
1136 3300046557 Ga0495622_0172828 Ga0495622_0172828_122_739 187
1137 3300046558 Ga0495633_0203475 Ga0495633_0203475_183_797 187
1138 3300046660 Ga0495625_0103982 Ga0495625_0103982_660_1298 187
1139 3300046664 Ga0495659_0001610 Ga0495659_0001610_6840_7466 187
1140 3300046665 Ga0495661_0105999 Ga0495661_0105999_726_1352 187
1141 3300046679 Ga0495623_0056963 Ga0495623_0056963_1009_1626 187
1142 3300046691 Ga0495670_0000480 Ga0495670_0000480_6537_7163 187
1143 3300046691 Ga0495670_0171881 Ga0495670_0171881_221_829 187
1144 3300046694 Ga0495649_0056597 Ga0495649_0056597_1255_1878 187
1145 3300046694 Ga0495649_0183636 Ga0495649_0183636_334_957 187
1146 3300046794 Ga0495589_0003297 Ga0495589_0003297_329_952 187
1147 3300046794 Ga0495589_0087542 Ga0495589_0087542_348_956 187
1148 3300046794 Ga0495589_0104838 Ga0495589_0104838_98_712 187
1149 3300046809 Ga0495600_0267791 Ga0495600_0267791_362_979 187
1150 3300047317 Ga0495604_0008827 Ga0495604_0008827_2308_2925 187
1151 3300047320 Ga0495672_0039643 Ga0495672_0039643_389_1006 187
1152 3300047320 Ga0495672_0228887 Ga0495672_0228887_256_870 187
1153 3300047322 Ga0495680_0049517 Ga0495680_0049517_894_1511 187
1154 3300047471 Ga0495684_0009073 Ga0495684_0009073_6507_7124 187
1155 3300047472 Ga0495686_0063766 Ga0495686_0063766_1445_2059 187
1156 3300047673 Ga0495593_0024309 Ga0495593_0024309_719_1336 187
1157 3300049460 Ga0495682_0061210 Ga0495682_0061210_646_1275 187
1158 2124908027 MRS2a_Contig_1516 MRS2a_00397660 188
1159 3300002737 JGI25162J39368_1001071 JGI25162J39368_10010719 188
1160 3300002771 JGI25163J39215_1000353 JGI25163J39215_10003538 188
1161 3300002772 JGI25164J39214_1000567 JGI25164J39214_10005677 188
1162 3300003214 JGI25165J46597_1001135 JGI25165J46597_10011357 188
1163 3300005288 Ga0065714_10008542 Ga0065714_100085422 188
1164 3300005289 Ga0065704_10340018 Ga0065704_103400181 188
1165 3300005457 Ga0070662_100021890 Ga0070662_1000218901 188
1166 3300006058 Ga0075432_10001366 Ga0075432_100013668 188
1167 3300011119 Ga0105246_10100253 Ga0105246_101002532 188
1168 3300013307 Ga0157372_10001315 Ga0157372_1000131519 188
1169 3300014497 Ga0182008_10002414 Ga0182008_100024144 188
1170 3300015261 Ga0182006_1001458 Ga0182006_10014588 188
1171 3300015262 Ga0182007_10001167 Ga0182007_100011677 188
1172 3300015265 Ga0182005_1001482 Ga0182005_10014823 188
1173 3300017792 Ga0163161_10021991 Ga0163161_100219914 188
1174 3300025207 Ga0209760_100009 Ga0209760_100009121 188
1175 3300025231 Ga0207427_100016 Ga0207427_100016386 188
1176 3300025233 Ga0209437_100011 Ga0209437_100011575 188
1177 3300025261 Ga0209233_1000019 Ga0209233_1000019575 188
1178 3300025728 Ga0207655_1002956 Ga0207655_10029564 188
1179 3300025728 Ga0207655_1006576 Ga0207655_10065767 188
1180 3300025933 Ga0207706_10008048 Ga0207706_100080482 188
1181 3300027907 Ga0207428_10018645 Ga0207428_100186455 188
1182 3300030742 Ga0316183_1117811 Ga0316183_11178111 188
1183 3300031548 Ga0307408_100003590 Ga0307408_1000035906 188
1184 3300031548 Ga0307408_100020723 Ga0307408_1000207233 188
1185 3300031548 Ga0307408_100097671 Ga0307408_1000976713 188
1186 3300031731 Ga0307405_10000313 Ga0307405_100003138 188
1187 3300031731 Ga0307405_10001799 Ga0307405_100017998 188
1188 3300031731 Ga0307405_10121569 Ga0307405_101215692 188
1189 3300031824 Ga0307413_10023944 Ga0307413_100239443 188
1190 3300031901 Ga0307406_10030197 Ga0307406_100301974 188
1191 3300031901 Ga0307406_10308679 Ga0307406_103086791 188
1192 3300031911 Ga0307412_10000602 Ga0307412_100006025 188
1193 3300031911 Ga0307412_10001254 Ga0307412_100012548 188
1194 3300031911 Ga0307412_10002113 Ga0307412_100021134 188
1195 3300031911 Ga0307412_10051566 Ga0307412_100515663 188
1196 3300032002 Ga0307416_100127028 Ga0307416_1001270282 188
1197 3300032002 Ga0307416_101000594 Ga0307416_1010005941 188
1198 3300032004 Ga0307414_10565204 Ga0307414_105652042 188
1199 3300032005 Ga0307411_10018373 Ga0307411_100183731 188
1200 3300032005 Ga0307411_10134156 Ga0307411_101341563 188
1201 3300041405 Ga0439438_000848 Ga0439438_000848_6546_7154 188
1202 3300041411 Ga0439466_0000206 Ga0439466_0000206_11422_12048 188
1203 3300042010 Ga0439452_062506 Ga0439452_062506_80_679 188
1204 3300046452 Ga0495617_154004 Ga0495617_154004_18_632 188
1205 3300046454 Ga0495592_0002303 Ga0495592_0002303_12792_13400 188
1206 3300046460 Ga0495638_0143430 Ga0495638_0143430_333_962 188
1207 3300046463 Ga0495653_0001536 Ga0495653_0001536_5655_6263 188
1208 3300046472 Ga0495580_0450706 Ga0495580_0450706_49_678 188
1209 3300046474 Ga0495605_0007968 Ga0495605_0007968_1625_2254 188
1210 3300046475 Ga0495639_0000045 Ga0495639_0000045_17694_18323 188
1211 3300046491 Ga0495584_0002629 Ga0495584_0002629_8139_8765 188
1212 3300046491 Ga0495584_0301267 Ga0495584_0301267_40_654 188
1213 3300046499 Ga0495594_0119613 Ga0495594_0119613_689_1318 188
1214 3300046506 Ga0495583_0002338 Ga0495583_0002338_7943_8545 188
1215 3300046512 Ga0495610_0004751 Ga0495610_0004751_374_976 188
1216 3300046518 Ga0495631_0106110 Ga0495631_0106110_100_726 188
1217 3300046519 Ga0495632_0222826 Ga0495632_0222826_208_822 188
1218 3300046524 Ga0495648_0135186 Ga0495648_0135186_378_1004 188
1219 3300046526 Ga0495666_0011341 Ga0495666_0011341_103_711 188
1220 3300046530 Ga0495654_0000613 Ga0495654_0000613_6126_6755 188
1221 3300046536 Ga0495587_0388886 Ga0495587_0388886_24_632 188
1222 3300046543 Ga0495645_0055176 Ga0495645_0055176_59_667 188
1223 3300046557 Ga0495622_0000876 Ga0495622_0000876_6896_7525 188
1224 3300046557 Ga0495622_0025953 Ga0495622_0025953_2085_2675 188
1225 3300046660 Ga0495625_0391181 Ga0495625_0391181_192_806 188
1226 3300046664 Ga0495659_0000458 Ga0495659_0000458_7761_8390 188
1227 3300046680 Ga0495646_0022501 Ga0495646_0022501_2642_3250 188
1228 3300046689 Ga0495613_0003245 Ga0495613_0003245_11326_11934 188
1229 3300046690 Ga0495624_0000185 Ga0495624_0000185_5656_6264 188
1230 3300046692 Ga0495671_0003565 Ga0495671_0003565_725_1351 188
1231 3300046694 Ga0495649_0004805 Ga0495649_0004805_7761_8390 188
1232 3300046794 Ga0495589_0003543 Ga0495589_0003543_692_1321 188
1233 3300046810 Ga0495660_0000504 Ga0495660_0000504_25244_25858 188
1234 3300047315 Ga0495581_0072651 Ga0495581_0072651_666_1295 188
1235 3300047320 Ga0495672_0000726 Ga0495672_0000726_30037_30645 188
1236 3300047321 Ga0495676_0000884 Ga0495676_0000884_236_844 188
1237 3300047322 Ga0495680_0001910 Ga0495680_0001910_3082_3690 188
1238 3300047323 Ga0495683_0040252 Ga0495683_0040252_1358_1987 188
1239 3300047323 Ga0495683_0063104 Ga0495683_0063104_487_1113 188
1240 3300047443 Ga0495687_007933 Ga0495687_007933_31_660 188
1241 3300047470 Ga0495681_0001758 Ga0495681_0001758_253_885 188
1242 3300047471 Ga0495684_0286204 Ga0495684_0286204_240_848 188
1243 3300047673 Ga0495593_0054162 Ga0495593_0054162_781_1410 188
1244 3300048088 Ga0495602_0000848 Ga0495602_0000848_27063_27671 188
1245 3300048091 Ga0495626_0001975 Ga0495626_0001975_7729_8358 188
1246 3300048091 Ga0495626_0012148 Ga0495626_0012148_3174_3800 188
1247 3300048908 Ga0496105_0232094 Ga0496105_0232094_414_1043 188
1248 3300048909 Ga0496106_0052454 Ga0496106_0052454_2279_2887 188
1249 3300048909 Ga0496106_0260609 Ga0496106_0260609_528_1157 188
1250 3300048919 Ga0496116_0001012 Ga0496116_0001012_6817_7425 188
1251 3300048919 Ga0496116_0035753 Ga0496116_0035753_1814_2443 188
1252 3300048920 Ga0496117_0088204 Ga0496117_0088204_493_1101 188
1253 3300048921 Ga0496118_0042497 Ga0496118_0042497_907_1515 188
1254 3300048922 Ga0496119_0093383 Ga0496119_0093383_179_787 188
1255 3300048922 Ga0496119_0264039 Ga0496119_0264039_76_684 188
1256 3300048924 Ga0496121_0001802 Ga0496121_0001802_6444_7052 188
1257 3300048924 Ga0496121_0021552 Ga0496121_0021552_2569_3198 188
1258 3300048925 Ga0496122_0006201 Ga0496122_0006201_5478_6107 188
1259 3300048927 Ga0496124_0184101 Ga0496124_0184101_588_1196 188
1260 3300048927 Ga0496124_0268684 Ga0496124_0268684_168_797 188
1261 3300048927 Ga0496124_0275836 Ga0496124_0275836_512_1120 188
1262 3300048928 Ga0496125_0193701 Ga0496125_0193701_41_649 188
1263 3300049459 Ga0495678_067462 Ga0495678_067462_451_1065 188
1264 3300050491 nmdc:mga00v17_30446_c2 nmdc:mga00v17_30446_c2_153_773 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13590

DUF4136

Domain of unknown function (DUF4136)

39

204

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ga2-assembly1.cif.gz_A crystal structure of the endonuclease_v (bsu36170) from bacillus subtilis, northeast structural genomics consortium target sr624 0.8325 101 160
4ymy-assembly1.cif.gz_A-2 crystal structure of mutant nitrobindin m75a/h76l/q96c/m148l/h158a (nb11) from arabidopsis thaliana 0.6504 132 162
3wjg-assembly1.cif.gz_A-2 crystal structure of mutant nitrobindin m75l/h76l/q96c/m148w/h158l (nb10) from arabidopsis thaliana 0.643 132 162
3wjd-assembly1.cif.gz_A-2 crystal structure of mutant nitrobindin f44w/m75l/h76l/q96c/m148l/h158l (nb5) from arabidopsis thaliana 0.6225 131 162
5t10-assembly1.cif.gz_B pelc dodecamer from paraburkholderia phytofirmans, space group p6 0.6135 56 183
ID Description Score Start End Superfamily
af_Q4DD12_254_381_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.7828 138 162 2.40.370.10
af_Q653Z3_11_182_3.30.2170.10 Alpha Beta;2-Layer Sandwich;archaeoglobus fulgidus dsm 4304 fold;archaeoglobus fulgidus dsm 4304 superfamily 0.7207 94 162 3.30.2170.10
af_Q5ADV1_175_438_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6909 136 158 2.130.10.10
af_K7KMF1_95_188_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.67 112 161 3.40.630.30
1bobA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6317 136 161 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A6N3UHM9-F1-model_v4 DUF4136 domain-containing protein 0.8944 53 188
AF-A0A7X3HE24-F1-model_v4 DUF4136 domain-containing protein 0.8824 40 188
AF-A0A3B8P2P6-F1-model_v4 DUF4136 domain-containing protein 0.819 79 188
AF-A0A3C1BJH1-F1-model_v4 DUF4136 domain-containing protein 0.8049 76 186
AF-A0A367M5Q9-F1-model_v4 DUF4136 domain-containing protein 0.8021 87 188

Feature Viewer

pLDDT pTM Quality
80.17 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map