F491888
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1223 | 381 | 2446 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300048906|Ga0496103_0517701|Ga0496103_0517701_110_550 |
| Length | 146 |
| Sequence | MSDVRELIRREPSQDEHDAIRELWKRHSVAEDNRDLPGLLATLTDDCVYELVQTGHRWEGHEGAARFYGGLLGSFPLSGIVIGPQGVCEEADVTGTHEAEWLGVPPTGERLAWQVTIFFPWDRERRLFTGERVYTAGLPLPQTLAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 117 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 204 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 207 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 212 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 227 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 232 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 233 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 236 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 237 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 238 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 239 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 240 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 241 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 242 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 247 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 248 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 255 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 377 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 381 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.94 |
| Metatranscriptomes | 1.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.16 |
| Nodule | 0 |
| Rhizoplane | 9.98 |
| Rhizosphere | 89.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496103_0517701 | 3300048906 | Unclassified | 763 |
| 2 | rootH1_10246936 | 3300003323 | Bacteria | 1671 |
| 3 | JGI25407J50210_10000450 | 3300003373 | Bacteria | 8109 |
| 4 | Ga0070658_10009482 | 3300005327 | Archaea | 7822 |
| 5 | Ga0070658_10046978 | 3300005327 | Bacteria | 3493 |
| 6 | Ga0070658_10073197 | 3300005327 | Bacteria | 2809 |
| 7 | Ga0070658_10225309 | 3300005327 | Bacteria | 1586 |
| 8 | Ga0070658_10838237 | 3300005327 | Bacteria | 799 |
| 9 | Ga0070683_100028510 | 3300005329 | Bacteria | 5046 |
| 10 | Ga0070683_100087423 | 3300005329 | Bacteria | 2923 |
| 11 | Ga0070683_100254650 | 3300005329 | Bacteria | 1670 |
| 12 | Ga0070683_100805009 | 3300005329 | Unclassified | 901 |
| 13 | Ga0070690_100007766 | 3300005330 | Bacteria | 6148 |
| 14 | Ga0070690_100060869 | 3300005330 | Bacteria | 2431 |
| 15 | Ga0070666_10096419 | 3300005335 | Bacteria | 2036 |
| 16 | Ga0070680_100025767 | 3300005336 | Bacteria | 4701 |
| 17 | Ga0070680_100029925 | 3300005336 | Bacteria | 4372 |
| 18 | Ga0070680_100033727 | 3300005336 | Bacteria | 4128 |
| 19 | Ga0070680_100162730 | 3300005336 | Bacteria | 1875 |
| 20 | Ga0070680_100184861 | 3300005336 | Bacteria | 1755 |
| 21 | Ga0070680_100277812 | 3300005336 | Bacteria | 1419 |
| 22 | Ga0070682_100034271 | 3300005337 | Bacteria | 3091 |
| 23 | Ga0070682_100063207 | 3300005337 | Archaea | 2346 |
| 24 | Ga0070682_100722823 | 3300005337 | Bacteria | 801 |
| 25 | Ga0070682_100895444 | 3300005337 | Unclassified | 729 |
| 26 | Ga0070682_101090374 | 3300005337 | Bacteria | 668 |
| 27 | Ga0068868_100032026 | 3300005338 | Bacteria | 4042 |
| 28 | Ga0068868_100791820 | 3300005338 | Bacteria | 855 |
| 29 | Ga0070660_100007999 | 3300005339 | Bacteria | 7385 |
| 30 | Ga0070660_100029085 | 3300005339 | Unclassified | 4138 |
| 31 | Ga0070660_100030204 | 3300005339 | Bacteria | 4064 |
| 32 | Ga0070660_100042015 | 3300005339 | Bacteria | 3488 |
| 33 | Ga0070660_100044339 | 3300005339 | Bacteria | 3401 |
| 34 | Ga0070691_10034801 | 3300005341 | Bacteria | 2371 |
| 35 | Ga0070691_10121600 | 3300005341 | Bacteria | 1315 |
| 36 | Ga0070691_10145266 | 3300005341 | Bacteria | 1212 |
| 37 | Ga0070687_100359597 | 3300005343 | Bacteria | 942 |
| 38 | Ga0070687_100458759 | 3300005343 | Unclassified | 849 |
| 39 | Ga0070661_100028012 | 3300005344 | Bacteria | 4061 |
| 40 | Ga0070661_101447066 | 3300005344 | Bacteria | 579 |
| 41 | Ga0070692_10545659 | 3300005345 | Bacteria | 759 |
| 42 | Ga0070668_100038323 | 3300005347 | Bacteria | 3663 |
| 43 | Ga0070668_100715657 | 3300005347 | Bacteria | 884 |
| 44 | Ga0070669_100847835 | 3300005353 | Bacteria | 778 |
| 45 | Ga0070671_100095763 | 3300005355 | Bacteria | 2488 |
| 46 | Ga0070671_100200912 | 3300005355 | Unclassified | 1690 |
| 47 | Ga0070671_100548595 | 3300005355 | Unclassified | 997 |
| 48 | Ga0070671_101019235 | 3300005355 | Bacteria | 726 |
| 49 | Ga0070671_101168013 | 3300005355 | Unclassified | 677 |
| 50 | Ga0070674_100505210 | 3300005356 | Bacteria | 1007 |
| 51 | Ga0070673_100284632 | 3300005364 | Unclassified | 1451 |
| 52 | Ga0070673_101636740 | 3300005364 | Bacteria | 609 |
| 53 | Ga0070688_100169032 | 3300005365 | Bacteria | 1507 |
| 54 | Ga0070659_100185861 | 3300005366 | Bacteria | 1707 |
| 55 | Ga0070659_100217393 | 3300005366 | Bacteria | 1576 |
| 56 | Ga0070659_100233407 | 3300005366 | Bacteria | 1520 |
| 57 | Ga0070659_100729072 | 3300005366 | Bacteria | 859 |
| 58 | Ga0070703_10171684 | 3300005406 | Bacteria | 831 |
| 59 | Ga0070703_10497386 | 3300005406 | Unclassified | 548 |
| 60 | Ga0070709_10006002 | 3300005434 | Bacteria | 6602 |
| 61 | Ga0070709_10013639 | 3300005434 | Bacteria | 4574 |
| 62 | Ga0070709_10151008 | 3300005434 | Bacteria | 1606 |
| 63 | Ga0070709_10244384 | 3300005434 | Bacteria | 1290 |
| 64 | Ga0070709_10989563 | 3300005434 | Unclassified | 668 |
| 65 | Ga0070714_100003425 | 3300005435 | Bacteria | 11813 |
| 66 | Ga0070714_100009659 | 3300005435 | Bacteria | 7596 |
| 67 | Ga0070714_100017036 | 3300005435 | Bacteria | 5881 |
| 68 | Ga0070714_100032067 | 3300005435 | Bacteria | 4386 |
| 69 | Ga0070714_100144675 | 3300005435 | Unclassified | 2137 |
| 70 | Ga0070714_100220243 | 3300005435 | Unclassified | 1744 |
| 71 | Ga0070713_100047947 | 3300005436 | Bacteria | 3514 |
| 72 | Ga0070713_100080400 | 3300005436 | Bacteria | 2779 |
| 73 | Ga0070713_100211383 | 3300005436 | Bacteria | 1756 |
| 74 | Ga0070713_100298512 | 3300005436 | Unclassified | 1482 |
| 75 | Ga0070713_100539512 | 3300005436 | Bacteria | 1104 |
| 76 | Ga0070713_100732940 | 3300005436 | Unclassified | 945 |
| 77 | Ga0070710_10000870 | 3300005437 | Bacteria | 14441 |
| 78 | Ga0070710_10026521 | 3300005437 | Bacteria | 3079 |
| 79 | Ga0070710_10118983 | 3300005437 | Bacteria | 1596 |
| 80 | Ga0070710_10295280 | 3300005437 | Bacteria | 1056 |
| 81 | Ga0070710_10488251 | 3300005437 | Bacteria | 841 |
| 82 | Ga0070710_10681804 | 3300005437 | Unclassified | 723 |
| 83 | Ga0070711_100012846 | 3300005439 | Bacteria | 5244 |
| 84 | Ga0070711_100070548 | 3300005439 | Unclassified | 2460 |
| 85 | Ga0070711_100894423 | 3300005439 | Bacteria | 757 |
| 86 | Ga0070705_100015077 | 3300005440 | Bacteria | 3988 |
| 87 | Ga0070705_100017215 | 3300005440 | Bacteria | 3769 |
| 88 | Ga0070705_100382139 | 3300005440 | Bacteria | 1037 |
| 89 | Ga0070705_101374479 | 3300005440 | Bacteria | 588 |
| 90 | Ga0070700_100008900 | 3300005441 | Bacteria | 5489 |
| 91 | Ga0070700_100735079 | 3300005441 | Bacteria | 788 |
| 92 | Ga0070694_100014241 | 3300005444 | Bacteria | 4977 |
| 93 | Ga0070694_100032741 | 3300005444 | Bacteria | 3415 |
| 94 | Ga0070694_100360896 | 3300005444 | Bacteria | 1128 |
| 95 | Ga0070694_100947250 | 3300005444 | Bacteria | 713 |
| 96 | Ga0070694_101294966 | 3300005444 | Bacteria | 613 |
| 97 | Ga0070708_100149636 | 3300005445 | Bacteria | 2170 |
| 98 | Ga0070708_100400282 | 3300005445 | Bacteria | 1295 |
| 99 | Ga0070663_100067238 | 3300005455 | Bacteria | 2599 |
| 100 | Ga0070678_100297783 | 3300005456 | Bacteria | 1370 |
| 101 | Ga0070678_100306880 | 3300005456 | Bacteria | 1350 |
| 102 | Ga0070678_100389711 | 3300005456 | Bacteria | 1207 |
| 103 | Ga0070662_100086743 | 3300005457 | Bacteria | 2341 |
| 104 | Ga0070681_10049353 | 3300005458 | Bacteria | 4203 |
| 105 | Ga0070681_10061907 | 3300005458 | Bacteria | 3716 |
| 106 | Ga0070681_10145778 | 3300005458 | Bacteria | 2296 |
| 107 | Ga0070681_10238657 | 3300005458 | Bacteria | 1731 |
| 108 | Ga0070681_10267786 | 3300005458 | Unclassified | 1620 |
| 109 | Ga0070681_10540684 | 3300005458 | Bacteria | 1079 |
| 110 | Ga0068867_100000419 | 3300005459 | Bacteria | 28327 |
| 111 | Ga0068867_100052443 | 3300005459 | Bacteria | 3010 |
| 112 | Ga0068867_100217449 | 3300005459 | Bacteria | 1538 |
| 113 | Ga0070685_10004312 | 3300005466 | Bacteria | 7180 |
| 114 | Ga0070706_100096353 | 3300005467 | Bacteria | 2747 |
| 115 | Ga0070706_100349073 | 3300005467 | Bacteria | 1379 |
| 116 | Ga0070706_100838949 | 3300005467 | Bacteria | 850 |
| 117 | Ga0070707_100002503 | 3300005468 | Bacteria | 17504 |
| 118 | Ga0070707_100112015 | 3300005468 | Bacteria | 2647 |
| 119 | Ga0070707_100166816 | 3300005468 | Bacteria | 2146 |
| 120 | Ga0070707_100515497 | 3300005468 | Unclassified | 1158 |
| 121 | Ga0070707_100693653 | 3300005468 | Bacteria | 981 |
| 122 | Ga0070698_100108665 | 3300005471 | Bacteria | 2740 |
| 123 | Ga0070698_100215687 | 3300005471 | Bacteria | 1853 |
| 124 | Ga0070698_100292606 | 3300005471 | Unclassified | 1560 |
| 125 | Ga0070699_100032717 | 3300005518 | Bacteria | 4491 |
| 126 | Ga0070699_100619915 | 3300005518 | Bacteria | 987 |
| 127 | Ga0070679_100014066 | 3300005530 | Bacteria | 7675 |
| 128 | Ga0070679_100064501 | 3300005530 | Bacteria | 3651 |
| 129 | Ga0070679_100077476 | 3300005530 | Bacteria | 3313 |
| 130 | Ga0070679_100174102 | 3300005530 | Bacteria | 2125 |
| 131 | Ga0070679_100259808 | 3300005530 | Bacteria | 1692 |
| 132 | Ga0070679_100657631 | 3300005530 | Bacteria | 990 |
| 133 | Ga0070679_100701175 | 3300005530 | Bacteria | 955 |
| 134 | Ga0070684_100075578 | 3300005535 | Bacteria | 2972 |
| 135 | Ga0070684_100468029 | 3300005535 | Bacteria | 1166 |
| 136 | Ga0070684_101391850 | 3300005535 | Unclassified | 661 |
| 137 | Ga0070697_100059513 | 3300005536 | Bacteria | 3111 |
| 138 | Ga0068853_100171735 | 3300005539 | Bacteria | 1962 |
| 139 | Ga0068853_100703705 | 3300005539 | Bacteria | 964 |
| 140 | Ga0070672_100047107 | 3300005543 | Bacteria | 3344 |
| 141 | Ga0070672_100135899 | 3300005543 | Bacteria | 2025 |
| 142 | Ga0070686_100015245 | 3300005544 | Bacteria | 4446 |
| 143 | Ga0070695_100000106 | 3300005545 | Bacteria | 36745 |
| 144 | Ga0070695_100025858 | 3300005545 | Bacteria | 3627 |
| 145 | Ga0070695_100030671 | 3300005545 | Bacteria | 3349 |
| 146 | Ga0070695_100192294 | 3300005545 | Bacteria | 1453 |
| 147 | Ga0070695_100367976 | 3300005545 | Bacteria | 1081 |
| 148 | Ga0070695_100796676 | 3300005545 | Unclassified | 757 |
| 149 | Ga0070696_100018911 | 3300005546 | Bacteria | 4664 |
| 150 | Ga0070696_100020126 | 3300005546 | Bacteria | 4525 |
| 151 | Ga0070696_100034350 | 3300005546 | Bacteria | 3488 |
| 152 | Ga0070696_100138111 | 3300005546 | Bacteria | 1778 |
| 153 | Ga0070696_100707171 | 3300005546 | Unclassified | 822 |
| 154 | Ga0070693_100072111 | 3300005547 | Unclassified | 2037 |
| 155 | Ga0070693_100154525 | 3300005547 | Bacteria | 1456 |
| 156 | Ga0070693_100406346 | 3300005547 | Bacteria | 945 |
| 157 | Ga0070693_100544324 | 3300005547 | Unclassified | 830 |
| 158 | Ga0070665_100095756 | 3300005548 | Bacteria | 2973 |
| 159 | Ga0070704_100074250 | 3300005549 | Bacteria | 2480 |
| 160 | Ga0070704_100172120 | 3300005549 | Unclassified | 1723 |
| 161 | Ga0070704_100248717 | 3300005549 | Bacteria | 1459 |
| 162 | Ga0068855_100063144 | 3300005563 | Bacteria | 4323 |
| 163 | Ga0068855_100112282 | 3300005563 | Bacteria | 3127 |
| 164 | Ga0068855_100226606 | 3300005563 | Bacteria | 2094 |
| 165 | Ga0068855_100286379 | 3300005563 | Bacteria | 1828 |
| 166 | Ga0068855_100287692 | 3300005563 | Bacteria | 1823 |
| 167 | Ga0068855_100404887 | 3300005563 | Bacteria | 1495 |
| 168 | Ga0068855_100697374 | 3300005563 | Bacteria | 1087 |
| 169 | Ga0068855_101211774 | 3300005563 | Unclassified | 784 |
| 170 | Ga0070664_100419805 | 3300005564 | Bacteria | 1225 |
| 171 | Ga0068854_100003253 | 3300005578 | Bacteria | 10118 |
| 172 | Ga0068856_100012137 | 3300005614 | Bacteria | 8344 |
| 173 | Ga0068856_100040457 | 3300005614 | Bacteria | 4579 |
| 174 | Ga0068856_100282786 | 3300005614 | Bacteria | 1675 |
| 175 | Ga0068856_100582698 | 3300005614 | Bacteria | 1140 |
| 176 | Ga0068856_100725971 | 3300005614 | Bacteria | 1014 |
| 177 | Ga0070702_100005126 | 3300005615 | Bacteria | 6063 |
| 178 | Ga0070702_100023594 | 3300005615 | Bacteria | 3271 |
| 179 | Ga0070702_100025724 | 3300005615 | Bacteria | 3156 |
| 180 | Ga0070702_100637980 | 3300005615 | Unclassified | 804 |
| 181 | Ga0070702_100694454 | 3300005615 | Bacteria | 775 |
| 182 | Ga0068852_100117475 | 3300005616 | Bacteria | 2429 |
| 183 | Ga0068852_100328691 | 3300005616 | Bacteria | 1487 |
| 184 | Ga0068852_101251207 | 3300005616 | Unclassified | 764 |
| 185 | Ga0068852_101356203 | 3300005616 | Archaea | 733 |
| 186 | Ga0068864_100205746 | 3300005618 | Bacteria | 1810 |
| 187 | Ga0068866_10088459 | 3300005718 | Bacteria | 1681 |
| 188 | Ga0068861_100018620 | 3300005719 | Bacteria | 4948 |
| 189 | Ga0068861_100195048 | 3300005719 | Bacteria | 1696 |
| 190 | Ga0068861_100274732 | 3300005719 | Bacteria | 1448 |
| 191 | Ga0068860_100922051 | 3300005843 | Bacteria | 890 |
| 192 | Ga0068860_101010881 | 3300005843 | Bacteria | 849 |
| 193 | Ga0081455_10003816 | 3300005937 | Bacteria | 17194 |
| 194 | Ga0081455_10005873 | 3300005937 | Bacteria | 13339 |
| 195 | Ga0081538_10000435 | 3300005981 | Bacteria | 47048 |
| 196 | Ga0081538_10003328 | 3300005981 | Bacteria | 15223 |
| 197 | Ga0081538_10028156 | 3300005981 | Bacteria | 3873 |
| 198 | Ga0081540_1007276 | 3300005983 | Bacteria | 7926 |
| 199 | Ga0081539_10001011 | 3300005985 | Bacteria | 51860 |
| 200 | Ga0070717_10003099 | 3300006028 | Bacteria | 11855 |
| 201 | Ga0070717_10024528 | 3300006028 | Bacteria | 4790 |
| 202 | Ga0070717_10032359 | 3300006028 | Bacteria | 4213 |
| 203 | Ga0070717_10089097 | 3300006028 | Bacteria | 2602 |
| 204 | Ga0070717_10166381 | 3300006028 | Bacteria | 1915 |
| 205 | Ga0070717_10347458 | 3300006028 | Unclassified | 1325 |
| 206 | Ga0070717_10349413 | 3300006028 | Bacteria | 1322 |
| 207 | Ga0070715_10005681 | 3300006163 | Bacteria | 4182 |
| 208 | Ga0070716_100029384 | 3300006173 | Bacteria | 2971 |
| 209 | Ga0070716_100133139 | 3300006173 | Bacteria | 1574 |
| 210 | Ga0070716_100146287 | 3300006173 | Bacteria | 1514 |
| 211 | Ga0070716_100271460 | 3300006173 | Bacteria | 1166 |
| 212 | Ga0070716_100638413 | 3300006173 | Bacteria | 806 |
| 213 | Ga0070712_100169359 | 3300006175 | Bacteria | 1693 |
| 214 | Ga0070712_100900959 | 3300006175 | Unclassified | 762 |
| 215 | Ga0070712_101008213 | 3300006175 | Unclassified | 721 |
| 216 | Ga0075367_10280865 | 3300006178 | Unclassified | 1047 |
| 217 | Ga0097621_100021600 | 3300006237 | Bacteria | 4983 |
| 218 | Ga0097621_100516143 | 3300006237 | Bacteria | 1084 |
| 219 | Ga0097621_101104542 | 3300006237 | Bacteria | 744 |
| 220 | Ga0068871_100027740 | 3300006358 | Bacteria | 4431 |
| 221 | Ga0068871_100052886 | 3300006358 | Bacteria | 3290 |
| 222 | Ga0068871_100218867 | 3300006358 | Unclassified | 1649 |
| 223 | Ga0075428_100151134 | 3300006844 | Bacteria | 2522 |
| 224 | Ga0075431_100096728 | 3300006847 | Unclassified | 3048 |
| 225 | Ga0075431_101948996 | 3300006847 | Unclassified | 543 |
| 226 | Ga0075434_100012215 | 3300006871 | Bacteria | 8137 |
| 227 | Ga0075434_100138379 | 3300006871 | Bacteria | 2454 |
| 228 | Ga0075434_100508946 | 3300006871 | Unclassified | 1225 |
| 229 | Ga0075434_101179843 | 3300006871 | Bacteria | 778 |
| 230 | Ga0068865_100000269 | 3300006881 | Bacteria | 28461 |
| 231 | Ga0068865_100026125 | 3300006881 | Bacteria | 3847 |
| 232 | Ga0075436_100006756 | 3300006914 | Bacteria | 7851 |
| 233 | Ga0075436_100118450 | 3300006914 | Bacteria | 1851 |
| 234 | Ga0075435_100002731 | 3300007076 | Bacteria | 11784 |
| 235 | Ga0075435_100361361 | 3300007076 | Bacteria | 1245 |
| 236 | Ga0105240_10014499 | 3300009093 | Bacteria | 10761 |
| 237 | Ga0105240_10187008 | 3300009093 | Bacteria | 2439 |
| 238 | Ga0105240_11071385 | 3300009093 | Unclassified | 859 |
| 239 | Ga0105240_11206088 | 3300009093 | Unclassified | 801 |
| 240 | Ga0105240_11492467 | 3300009093 | Bacteria | 709 |
| 241 | Ga0105240_11670351 | 3300009093 | Unclassified | 665 |
| 242 | Ga0105240_11887323 | 3300009093 | Bacteria | 622 |
| 243 | Ga0111539_10033139 | 3300009094 | Bacteria | 6272 |
| 244 | Ga0111539_10460153 | 3300009094 | Unclassified | 1481 |
| 245 | Ga0105245_10016809 | 3300009098 | Bacteria | 6388 |
| 246 | Ga0105245_10129749 | 3300009098 | Bacteria | 2364 |
| 247 | Ga0105245_10154293 | 3300009098 | Bacteria | 2174 |
| 248 | Ga0105245_10163519 | 3300009098 | Bacteria | 2114 |
| 249 | Ga0105245_10229543 | 3300009098 | Bacteria | 1795 |
| 250 | Ga0105245_10708423 | 3300009098 | Unclassified | 1040 |
| 251 | Ga0105247_10657317 | 3300009101 | Unclassified | 784 |
| 252 | Ga0114129_10041196 | 3300009147 | Bacteria | 6509 |
| 253 | Ga0114129_10536596 | 3300009147 | Bacteria | 1523 |
| 254 | Ga0105243_10054426 | 3300009148 | Bacteria | 3177 |
| 255 | Ga0105243_10075428 | 3300009148 | Archaea | 2737 |
| 256 | Ga0105241_10036307 | 3300009174 | Bacteria | 3708 |
| 257 | Ga0105241_10166633 | 3300009174 | Bacteria | 1816 |
| 258 | Ga0105241_11696115 | 3300009174 | Unclassified | 614 |
| 259 | Ga0105241_12623849 | 3300009174 | Unclassified | 506 |
| 260 | Ga0105242_10056023 | 3300009176 | Bacteria | 3225 |
| 261 | Ga0105242_10080040 | 3300009176 | Bacteria | 2730 |
| 262 | Ga0105242_10989247 | 3300009176 | Unclassified | 848 |
| 263 | Ga0105248_10012557 | 3300009177 | Bacteria | 9343 |
| 264 | Ga0105248_10192131 | 3300009177 | Bacteria | 2300 |
| 265 | Ga0105248_10224775 | 3300009177 | Bacteria | 2113 |
| 266 | Ga0105248_10329962 | 3300009177 | Bacteria | 1718 |
| 267 | Ga0105237_10068438 | 3300009545 | Bacteria | 3544 |
| 268 | Ga0105237_11127563 | 3300009545 | Unclassified | 791 |
| 269 | Ga0105238_10093399 | 3300009551 | Bacteria | 2996 |
| 270 | Ga0105249_10003662 | 3300009553 | Bacteria | 13260 |
| 271 | Ga0105249_10009480 | 3300009553 | Bacteria | 8527 |
| 272 | Ga0105249_10039919 | 3300009553 | Bacteria | 4262 |
| 273 | Ga0105249_10673792 | 3300009553 | Bacteria | 1093 |
| 274 | Ga0105239_10035049 | 3300010375 | Bacteria | 5511 |
| 275 | Ga0105239_10171509 | 3300010375 | Unclassified | 2426 |
| 276 | Ga0105239_10524635 | 3300010375 | Bacteria | 1347 |
| 277 | Ga0105239_10547996 | 3300010375 | Unclassified | 1317 |
| 278 | Ga0105239_10753207 | 3300010375 | Bacteria | 1115 |
| 279 | Ga0105239_11471691 | 3300010375 | Bacteria | 787 |
| 280 | Ga0105246_10412334 | 3300011119 | Bacteria | 1125 |
| 281 | Ga0105246_10599069 | 3300011119 | Bacteria | 952 |
| 282 | Ga0157320_1032014 | 3300012481 | Bacteria | 535 |
| 283 | Ga0157373_10325543 | 3300013100 | Bacteria | 1094 |
| 284 | Ga0157373_10584281 | 3300013100 | Bacteria | 812 |
| 285 | Ga0157373_11170257 | 3300013100 | Unclassified | 579 |
| 286 | Ga0157371_10557486 | 3300013102 | Bacteria | 850 |
| 287 | Ga0157371_11032058 | 3300013102 | Bacteria | 628 |
| 288 | Ga0157371_11168824 | 3300013102 | Unclassified | 592 |
| 289 | Ga0157370_10055431 | 3300013104 | Bacteria | 3776 |
| 290 | Ga0157370_10073197 | 3300013104 | Bacteria | 3233 |
| 291 | Ga0157370_10310199 | 3300013104 | Bacteria | 1456 |
| 292 | Ga0157370_10435425 | 3300013104 | Bacteria | 1206 |
| 293 | Ga0157369_10016604 | 3300013105 | Bacteria | 8277 |
| 294 | Ga0157369_10067620 | 3300013105 | Bacteria | 3840 |
| 295 | Ga0157369_10146300 | 3300013105 | Bacteria | 2499 |
| 296 | Ga0157369_10153852 | 3300013105 | Bacteria | 2430 |
| 297 | Ga0157369_10254717 | 3300013105 | Bacteria | 1831 |
| 298 | Ga0157374_10005704 | 3300013296 | Bacteria | 10502 |
| 299 | Ga0157374_10156083 | 3300013296 | Bacteria | 2221 |
| 300 | Ga0157374_12736583 | 3300013296 | Unclassified | 521 |
| 301 | Ga0157378_10039466 | 3300013297 | Bacteria | 4187 |
| 302 | Ga0157378_10070463 | 3300013297 | Bacteria | 3139 |
| 303 | Ga0157378_10276192 | 3300013297 | Bacteria | 1618 |
| 304 | Ga0157378_10859023 | 3300013297 | Bacteria | 936 |
| 305 | Ga0157378_11436529 | 3300013297 | Bacteria | 733 |
| 306 | Ga0157378_11452375 | 3300013297 | Unclassified | 730 |
| 307 | Ga0163162_10010825 | 3300013306 | Bacteria | 8875 |
| 308 | Ga0163162_10039717 | 3300013306 | Bacteria | 4704 |
| 309 | Ga0163162_10232459 | 3300013306 | Bacteria | 1974 |
| 310 | Ga0157372_10020621 | 3300013307 | Bacteria | 7113 |
| 311 | Ga0157372_10650332 | 3300013307 | Bacteria | 1228 |
| 312 | Ga0157372_10886745 | 3300013307 | Bacteria | 1035 |
| 313 | Ga0157372_11223933 | 3300013307 | Unclassified | 867 |
| 314 | Ga0157372_12309997 | 3300013307 | Unclassified | 618 |
| 315 | Ga0157372_12823749 | 3300013307 | Unclassified | 557 |
| 316 | Ga0157372_13112230 | 3300013307 | Unclassified | 530 |
| 317 | Ga0157375_10014254 | 3300013308 | Bacteria | 7085 |
| 318 | Ga0157375_10065178 | 3300013308 | Bacteria | 3631 |
| 319 | Ga0157375_10112408 | 3300013308 | Bacteria | 2824 |
| 320 | Ga0157375_10118020 | 3300013308 | Bacteria | 2759 |
| 321 | Ga0157375_10248826 | 3300013308 | Bacteria | 1938 |
| 322 | Ga0157375_11098246 | 3300013308 | Unclassified | 931 |
| 323 | Ga0163163_10041709 | 3300014325 | Bacteria | 4490 |
| 324 | Ga0163163_10805092 | 3300014325 | Unclassified | 1003 |
| 325 | Ga0157380_10063275 | 3300014326 | Bacteria | 2966 |
| 326 | Ga0182008_10001839 | 3300014497 | Bacteria | 13815 |
| 327 | Ga0182008_10098827 | 3300014497 | Bacteria | 1441 |
| 328 | Ga0157377_10001454 | 3300014745 | Bacteria | 10244 |
| 329 | Ga0157376_10065286 | 3300014969 | Bacteria | 3072 |
| 330 | Ga0157376_10108444 | 3300014969 | Bacteria | 2439 |
| 331 | Ga0157376_10667750 | 3300014969 | Bacteria | 1041 |
| 332 | Ga0157376_12487565 | 3300014969 | Bacteria | 557 |
| 333 | Ga0182007_10015583 | 3300015262 | Bacteria | 2829 |
| 334 | Ga0163161_10009018 | 3300017792 | Bacteria | 6898 |
| 335 | Ga0163161_10088175 | 3300017792 | Bacteria | 2293 |
| 336 | Ga0197907_10709808 | 3300020069 | Bacteria | 1293 |
| 337 | Ga0197907_11100010 | 3300020069 | Unclassified | 678 |
| 338 | Ga0206356_10304527 | 3300020070 | Unclassified | 585 |
| 339 | Ga0206356_10942522 | 3300020070 | Bacteria | 699 |
| 340 | Ga0206356_11155746 | 3300020070 | Bacteria | 1324 |
| 341 | Ga0206356_11607730 | 3300020070 | Bacteria | 1567 |
| 342 | Ga0206356_11619724 | 3300020070 | Bacteria | 1308 |
| 343 | Ga0206354_10660436 | 3300020081 | Unclassified | 811 |
| 344 | Ga0206353_11569701 | 3300020082 | Bacteria | 984 |
| 345 | Ga0206353_12032259 | 3300020082 | Unclassified | 778 |
| 346 | Ga0213871_10005010 | 3300021441 | Bacteria | 2701 |
| 347 | Ga0224712_10115863 | 3300022467 | Bacteria | 1155 |
| 348 | Ga0224712_10583324 | 3300022467 | Unclassified | 545 |
| 349 | Ga0207653_10015032 | 3300025885 | Archaea | 2429 |
| 350 | Ga0207692_10010365 | 3300025898 | Bacteria | 3926 |
| 351 | Ga0207692_10012991 | 3300025898 | Bacteria | 3598 |
| 352 | Ga0207692_10022223 | 3300025898 | Bacteria | 2916 |
| 353 | Ga0207692_10235605 | 3300025898 | Unclassified | 1091 |
| 354 | Ga0207642_10039473 | 3300025899 | Bacteria | 2052 |
| 355 | Ga0207710_10101614 | 3300025900 | Unclassified | 1356 |
| 356 | Ga0207688_10158092 | 3300025901 | Unclassified | 1342 |
| 357 | Ga0207647_10073751 | 3300025904 | Bacteria | 2056 |
| 358 | Ga0207685_10232439 | 3300025905 | Bacteria | 883 |
| 359 | Ga0207699_10054111 | 3300025906 | Bacteria | 2383 |
| 360 | Ga0207699_10091693 | 3300025906 | Bacteria | 1908 |
| 361 | Ga0207699_10168150 | 3300025906 | Bacteria | 1465 |
| 362 | Ga0207645_10254771 | 3300025907 | Bacteria | 1162 |
| 363 | Ga0207705_10074903 | 3300025909 | Bacteria | 2458 |
| 364 | Ga0207705_10152230 | 3300025909 | Bacteria | 1734 |
| 365 | Ga0207684_10168628 | 3300025910 | Bacteria | 1887 |
| 366 | Ga0207684_10233873 | 3300025910 | Bacteria | 1585 |
| 367 | Ga0207684_10458500 | 3300025910 | Bacteria | 1094 |
| 368 | Ga0207684_10490080 | 3300025910 | Bacteria | 1054 |
| 369 | Ga0207654_10175874 | 3300025911 | Bacteria | 1393 |
| 370 | Ga0207654_10732306 | 3300025911 | Bacteria | 712 |
| 371 | Ga0207707_10059555 | 3300025912 | Bacteria | 3323 |
| 372 | Ga0207707_10064555 | 3300025912 | Bacteria | 3187 |
| 373 | Ga0207707_10193396 | 3300025912 | Bacteria | 1774 |
| 374 | Ga0207707_10608679 | 3300025912 | Bacteria | 924 |
| 375 | Ga0207695_10092451 | 3300025913 | Bacteria | 3036 |
| 376 | Ga0207693_10000699 | 3300025915 | Bacteria | 30109 |
| 377 | Ga0207693_10001049 | 3300025915 | Bacteria | 24711 |
| 378 | Ga0207693_10026878 | 3300025915 | Bacteria | 4552 |
| 379 | Ga0207693_10027988 | 3300025915 | Bacteria | 4455 |
| 380 | Ga0207693_10038114 | 3300025915 | Unclassified | 3786 |
| 381 | Ga0207693_11163822 | 3300025915 | Unclassified | 583 |
| 382 | Ga0207693_11255666 | 3300025915 | Bacteria | 556 |
| 383 | Ga0207663_10011201 | 3300025916 | Bacteria | 4807 |
| 384 | Ga0207663_10014821 | 3300025916 | Bacteria | 4283 |
| 385 | Ga0207663_10065108 | 3300025916 | Bacteria | 2328 |
| 386 | Ga0207663_10356680 | 3300025916 | Bacteria | 1108 |
| 387 | Ga0207663_10635702 | 3300025916 | Unclassified | 841 |
| 388 | Ga0207660_10015302 | 3300025917 | Bacteria | 5060 |
| 389 | Ga0207660_10046060 | 3300025917 | Bacteria | 3076 |
| 390 | Ga0207660_10289038 | 3300025917 | Bacteria | 1303 |
| 391 | Ga0207660_10546929 | 3300025917 | Bacteria | 941 |
| 392 | Ga0207660_10801212 | 3300025917 | Unclassified | 769 |
| 393 | Ga0207660_11111121 | 3300025917 | Bacteria | 644 |
| 394 | Ga0207662_10539072 | 3300025918 | Bacteria | 807 |
| 395 | Ga0207662_10867222 | 3300025918 | Unclassified | 638 |
| 396 | Ga0207657_10007767 | 3300025919 | Bacteria | 10952 |
| 397 | Ga0207657_10015251 | 3300025919 | Bacteria | 7452 |
| 398 | Ga0207657_10021691 | 3300025919 | Bacteria | 6037 |
| 399 | Ga0207657_10024610 | 3300025919 | Bacteria | 5570 |
| 400 | Ga0207657_10041550 | 3300025919 | Bacteria | 4066 |
| 401 | Ga0207657_10110219 | 3300025919 | Bacteria | 2274 |
| 402 | Ga0207649_10058557 | 3300025920 | Bacteria | 2413 |
| 403 | Ga0207649_11132906 | 3300025920 | Bacteria | 618 |
| 404 | Ga0207652_10032198 | 3300025921 | Bacteria | 4405 |
| 405 | Ga0207652_10033399 | 3300025921 | Bacteria | 4332 |
| 406 | Ga0207652_10067623 | 3300025921 | Bacteria | 3098 |
| 407 | Ga0207652_10171983 | 3300025921 | Bacteria | 1944 |
| 408 | Ga0207652_10261456 | 3300025921 | Unclassified | 1561 |
| 409 | Ga0207652_10290124 | 3300025921 | Bacteria | 1476 |
| 410 | Ga0207652_10419303 | 3300025921 | Bacteria | 1207 |
| 411 | Ga0207652_10706657 | 3300025921 | Unclassified | 899 |
| 412 | Ga0207646_10000502 | 3300025922 | Bacteria | 52324 |
| 413 | Ga0207646_10073373 | 3300025922 | Bacteria | 3057 |
| 414 | Ga0207646_10439548 | 3300025922 | Bacteria | 1177 |
| 415 | Ga0207646_10792966 | 3300025922 | Bacteria | 844 |
| 416 | Ga0207646_11071483 | 3300025922 | Bacteria | 710 |
| 417 | Ga0207681_10041996 | 3300025923 | Bacteria | 3052 |
| 418 | Ga0207694_10056009 | 3300025924 | Bacteria | 3062 |
| 419 | Ga0207694_10255122 | 3300025924 | Bacteria | 1436 |
| 420 | Ga0207687_10015761 | 3300025927 | Bacteria | 4960 |
| 421 | Ga0207687_10245862 | 3300025927 | Bacteria | 1420 |
| 422 | Ga0207700_10058384 | 3300025928 | Bacteria | 2914 |
| 423 | Ga0207700_10131897 | 3300025928 | Bacteria | 2041 |
| 424 | Ga0207700_10144233 | 3300025928 | Bacteria | 1960 |
| 425 | Ga0207700_10192486 | 3300025928 | Bacteria | 1714 |
| 426 | Ga0207700_10976191 | 3300025928 | Bacteria | 758 |
| 427 | Ga0207664_10000789 | 3300025929 | Bacteria | 21390 |
| 428 | Ga0207664_10028157 | 3300025929 | Unclassified | 4267 |
| 429 | Ga0207664_10033946 | 3300025929 | Bacteria | 3926 |
| 430 | Ga0207664_10040027 | 3300025929 | Bacteria | 3641 |
| 431 | Ga0207664_10084701 | 3300025929 | Bacteria | 2586 |
| 432 | Ga0207664_10313691 | 3300025929 | Bacteria | 1382 |
| 433 | Ga0207664_10332147 | 3300025929 | Bacteria | 1343 |
| 434 | Ga0207664_10343395 | 3300025929 | Bacteria | 1320 |
| 435 | Ga0207664_10396498 | 3300025929 | Bacteria | 1227 |
| 436 | Ga0207664_10549489 | 3300025929 | Bacteria | 1036 |
| 437 | Ga0207644_10028140 | 3300025931 | Bacteria | 3888 |
| 438 | Ga0207690_10138992 | 3300025932 | Bacteria | 1787 |
| 439 | Ga0207690_10145626 | 3300025932 | Bacteria | 1751 |
| 440 | Ga0207690_10151005 | 3300025932 | Bacteria | 1722 |
| 441 | Ga0207690_10327095 | 3300025932 | Bacteria | 1206 |
| 442 | Ga0207690_10440841 | 3300025932 | Bacteria | 1045 |
| 443 | Ga0207690_10479403 | 3300025932 | Bacteria | 1004 |
| 444 | Ga0207706_10021585 | 3300025933 | Bacteria | 5780 |
| 445 | Ga0207686_10050201 | 3300025934 | Bacteria | 2593 |
| 446 | Ga0207709_10002432 | 3300025935 | Bacteria | 11705 |
| 447 | Ga0207709_10051636 | 3300025935 | Bacteria | 2521 |
| 448 | Ga0207670_10191897 | 3300025936 | Unclassified | 1546 |
| 449 | Ga0207669_10128579 | 3300025937 | Bacteria | 1736 |
| 450 | Ga0207704_10009494 | 3300025938 | Bacteria | 4697 |
| 451 | Ga0207704_10041516 | 3300025938 | Bacteria | 2699 |
| 452 | Ga0207665_10004539 | 3300025939 | Bacteria | 9212 |
| 453 | Ga0207665_10005937 | 3300025939 | Bacteria | 8125 |
| 454 | Ga0207665_10026358 | 3300025939 | Bacteria | 3837 |
| 455 | Ga0207665_10210308 | 3300025939 | Bacteria | 1421 |
| 456 | Ga0207665_10591413 | 3300025939 | Bacteria | 866 |
| 457 | Ga0207691_10018525 | 3300025940 | Bacteria | 6597 |
| 458 | Ga0207691_10259386 | 3300025940 | Bacteria | 1498 |
| 459 | Ga0207711_10346423 | 3300025941 | Bacteria | 1375 |
| 460 | Ga0207711_10426129 | 3300025941 | Bacteria | 1234 |
| 461 | Ga0207711_10496749 | 3300025941 | Bacteria | 1137 |
| 462 | Ga0207689_10921381 | 3300025942 | Bacteria | 737 |
| 463 | Ga0207661_10154301 | 3300025944 | Bacteria | 1987 |
| 464 | Ga0207661_10471511 | 3300025944 | Bacteria | 1145 |
| 465 | Ga0207661_10480548 | 3300025944 | Bacteria | 1134 |
| 466 | Ga0207661_10928286 | 3300025944 | Bacteria | 802 |
| 467 | Ga0207679_10208866 | 3300025945 | Bacteria | 1636 |
| 468 | Ga0207667_10096976 | 3300025949 | Bacteria | 3043 |
| 469 | Ga0207667_10258030 | 3300025949 | Bacteria | 1782 |
| 470 | Ga0207667_10333440 | 3300025949 | Bacteria | 1548 |
| 471 | Ga0207667_10409514 | 3300025949 | Bacteria | 1380 |
| 472 | Ga0207667_10485173 | 3300025949 | Bacteria | 1254 |
| 473 | Ga0207667_11588106 | 3300025949 | Unclassified | 623 |
| 474 | Ga0207651_11544450 | 3300025960 | Bacteria | 598 |
| 475 | Ga0207712_10020566 | 3300025961 | Bacteria | 4324 |
| 476 | Ga0207712_11018156 | 3300025961 | Unclassified | 735 |
| 477 | Ga0207668_10249289 | 3300025972 | Bacteria | 1441 |
| 478 | Ga0207668_10251601 | 3300025972 | Bacteria | 1435 |
| 479 | Ga0207640_10223653 | 3300025981 | Bacteria | 1443 |
| 480 | Ga0207640_11473164 | 3300025981 | Bacteria | 611 |
| 481 | Ga0207640_11517365 | 3300025981 | Unclassified | 602 |
| 482 | Ga0207677_10088825 | 3300026023 | Bacteria | 2242 |
| 483 | Ga0207677_10112984 | 3300026023 | Bacteria | 2027 |
| 484 | Ga0207677_10117123 | 3300026023 | Bacteria | 1996 |
| 485 | Ga0207639_10043044 | 3300026041 | Bacteria | 3387 |
| 486 | Ga0207639_10054656 | 3300026041 | Bacteria | 3053 |
| 487 | Ga0207678_10027318 | 3300026067 | Bacteria | 4977 |
| 488 | Ga0207678_10042931 | 3300026067 | Bacteria | 3914 |
| 489 | Ga0207678_10894260 | 3300026067 | Bacteria | 785 |
| 490 | Ga0207708_10007994 | 3300026075 | Bacteria | 7836 |
| 491 | Ga0207708_10010110 | 3300026075 | Bacteria | 7007 |
| 492 | Ga0207708_10756472 | 3300026075 | Bacteria | 834 |
| 493 | Ga0207702_10027407 | 3300026078 | Bacteria | 4731 |
| 494 | Ga0207702_10051427 | 3300026078 | Bacteria | 3482 |
| 495 | Ga0207702_10430533 | 3300026078 | Unclassified | 1277 |
| 496 | Ga0207702_10562346 | 3300026078 | Bacteria | 1116 |
| 497 | Ga0207702_10577781 | 3300026078 | Bacteria | 1101 |
| 498 | Ga0207702_10718403 | 3300026078 | Bacteria | 985 |
| 499 | Ga0207702_10750799 | 3300026078 | Bacteria | 963 |
| 500 | Ga0207702_10812900 | 3300026078 | Bacteria | 924 |
| 501 | Ga0207648_10000729 | 3300026089 | Bacteria | 36820 |
| 502 | Ga0207648_10010693 | 3300026089 | Bacteria | 8673 |
| 503 | Ga0207676_10178680 | 3300026095 | Bacteria | 1856 |
| 504 | Ga0207675_100004302 | 3300026118 | Bacteria | 13757 |
| 505 | Ga0207675_100016438 | 3300026118 | Bacteria | 6910 |
| 506 | Ga0207675_100106174 | 3300026118 | Bacteria | 2648 |
| 507 | Ga0207675_100186641 | 3300026118 | Bacteria | 1988 |
| 508 | Ga0207683_10005318 | 3300026121 | Bacteria | 11040 |
| 509 | Ga0207683_10009738 | 3300026121 | Bacteria | 8193 |
| 510 | Ga0207683_10323557 | 3300026121 | Bacteria | 1413 |
| 511 | Ga0207683_10404413 | 3300026121 | Bacteria | 1256 |
| 512 | Ga0207698_10066000 | 3300026142 | Bacteria | 2846 |
| 513 | Ga0207698_10089108 | 3300026142 | Bacteria | 2518 |
| 514 | Ga0207698_10877295 | 3300026142 | Bacteria | 903 |
| 515 | Ga0209966_1003416 | 3300027695 | Bacteria | 2671 |
| 516 | Ga0207428_10011614 | 3300027907 | Bacteria | 7774 |
| 517 | Ga0207428_10352970 | 3300027907 | Unclassified | 1082 |
| 518 | Ga0265319_1004321 | 3300028563 | Bacteria | 7062 |
| 519 | Ga0265334_10009422 | 3300028573 | Bacteria | 4129 |
| 520 | Ga0265334_10040347 | 3300028573 | Bacteria | 1829 |
| 521 | Ga0265334_10132196 | 3300028573 | Bacteria | 887 |
| 522 | Ga0265318_10000065 | 3300028577 | Bacteria | 102014 |
| 523 | Ga0265318_10005617 | 3300028577 | Bacteria | 5875 |
| 524 | Ga0265318_10087185 | 3300028577 | Unclassified | 1150 |
| 525 | Ga0265322_10009372 | 3300028654 | Bacteria | 2842 |
| 526 | Ga0265338_10002456 | 3300028800 | Bacteria | 27727 |
| 527 | Ga0265338_10005902 | 3300028800 | Bacteria | 15784 |
| 528 | Ga0265338_10019684 | 3300028800 | Bacteria | 7143 |
| 529 | Ga0265338_10078845 | 3300028800 | Bacteria | 2775 |
| 530 | Ga0265338_10147697 | 3300028800 | Bacteria | 1831 |
| 531 | Ga0265330_10028891 | 3300031235 | Bacteria | 2495 |
| 532 | Ga0265332_10009518 | 3300031238 | Bacteria | 4336 |
| 533 | Ga0265320_10082307 | 3300031240 | Bacteria | 1501 |
| 534 | Ga0265320_10090639 | 3300031240 | Bacteria | 1416 |
| 535 | Ga0265325_10111830 | 3300031241 | Bacteria | 1326 |
| 536 | Ga0265325_10374259 | 3300031241 | Unclassified | 626 |
| 537 | Ga0265329_10005149 | 3300031242 | Bacteria | 5319 |
| 538 | Ga0265329_10026605 | 3300031242 | Bacteria | 1905 |
| 539 | Ga0265329_10086034 | 3300031242 | Bacteria | 996 |
| 540 | Ga0265340_10183375 | 3300031247 | Unclassified | 945 |
| 541 | Ga0265339_10006175 | 3300031249 | Bacteria | 7893 |
| 542 | Ga0265339_10220957 | 3300031249 | Unclassified | 926 |
| 543 | Ga0265331_10112240 | 3300031250 | Bacteria | 1250 |
| 544 | Ga0265327_10026720 | 3300031251 | Bacteria | 3337 |
| 545 | Ga0265327_10036954 | 3300031251 | Bacteria | 2679 |
| 546 | Ga0265327_10313381 | 3300031251 | Unclassified | 689 |
| 547 | Ga0265316_10013688 | 3300031344 | Bacteria | 7195 |
| 548 | Ga0265316_10328355 | 3300031344 | Bacteria | 1110 |
| 549 | Ga0265316_10615264 | 3300031344 | Bacteria | 769 |
| 550 | Ga0307408_101844651 | 3300031548 | Bacteria | 579 |
| 551 | Ga0265313_10060039 | 3300031595 | Bacteria | 1785 |
| 552 | Ga0265313_10073422 | 3300031595 | Bacteria | 1570 |
| 553 | Ga0265314_10012609 | 3300031711 | Bacteria | 6881 |
| 554 | Ga0265314_10101572 | 3300031711 | Bacteria | 1847 |
| 555 | Ga0265314_10296245 | 3300031711 | Bacteria | 909 |
| 556 | Ga0265342_10047131 | 3300031712 | Bacteria | 2588 |
| 557 | Ga0265342_10068015 | 3300031712 | Bacteria | 2083 |
| 558 | Ga0265342_10202343 | 3300031712 | Unclassified | 1078 |
| 559 | Ga0265342_10235599 | 3300031712 | Bacteria | 981 |
| 560 | Ga0265342_10528904 | 3300031712 | Unclassified | 599 |
| 561 | Ga0307409_100148520 | 3300031995 | Bacteria | 2031 |
| 562 | Ga0307416_100371810 | 3300032002 | Unclassified | 1456 |
| 563 | Ga0307411_10369542 | 3300032005 | Bacteria | 1176 |
| 564 | Ga0307415_100544082 | 3300032126 | Bacteria | 1023 |
| 565 | Ga0307415_102352882 | 3300032126 | Bacteria | 523 |
| 566 | Ga0373930_0013891 | 3300034816 | Bacteria | 1492 |
| 567 | Ga0373926_0065166 | 3300035083 | Bacteria | 1332 |
| 568 | Ga0373949_0028987 | 3300035090 | Bacteria | 1309 |
| 569 | Ga0373949_0045929 | 3300035090 | Bacteria | 1087 |
| 570 | Ga0373951_0146209 | 3300035091 | Bacteria | 660 |
| 571 | Ga0373952_0018155 | 3300035092 | Bacteria | 1453 |
| 572 | Ga0373932_0114348 | 3300035112 | Bacteria | 893 |
| 573 | Ga0373932_0141006 | 3300035112 | Bacteria | 820 |
| 574 | Ga0373936_0585438 | 3300035113 | Unclassified | 523 |
| 575 | Ga0373939_0307337 | 3300035114 | Bacteria | 634 |
| 576 | Ga0373941_0036429 | 3300035115 | Bacteria | 1496 |
| 577 | Ga0373941_0115890 | 3300035115 | Bacteria | 950 |
| 578 | Ga0373945_0006611 | 3300035116 | Bacteria | 3747 |
| 579 | Ga0373945_0109493 | 3300035116 | Bacteria | 1089 |
| 580 | Ga0373953_0291420 | 3300035117 | Bacteria | 712 |
| 581 | Ga0373956_0031081 | 3300035119 | Bacteria | 2338 |
| 582 | Ga0373957_0129169 | 3300035120 | Bacteria | 1028 |
| 583 | Ga0373960_0003654 | 3300035121 | Bacteria | 3491 |
| 584 | Ga0373943_0013168 | 3300035170 | Bacteria | 3732 |
| 585 | Ga0373946_0117810 | 3300035171 | Bacteria | 1209 |
| 586 | Ga0373931_0058833 | 3300035691 | Bacteria | 2065 |
| 587 | Ga0373931_0582700 | 3300035691 | Unclassified | 730 |
| 588 | Ga0373931_0856851 | 3300035691 | Bacteria | 609 |
| 589 | Ga0373931_1071628 | 3300035691 | Bacteria | 548 |
| 590 | Ga0373935_0108295 | 3300035692 | Bacteria | 1841 |
| 591 | Ga0373935_0155673 | 3300035692 | Bacteria | 1554 |
| 592 | Ga0373935_0356425 | 3300035692 | Unclassified | 1044 |
| 593 | Ga0373935_0517514 | 3300035692 | Bacteria | 868 |
| 594 | Ga0373933_0617998 | 3300035724 | Bacteria | 712 |
| 595 | Ga0373947_0002361 | 3300035725 | Bacteria | 11399 |
| 596 | Ga0373947_1112785 | 3300035725 | Bacteria | 538 |
| 597 | Ga0373937_1077367 | 3300036401 | Bacteria | 752 |
| 598 | Ga0373925_0013132 | 3300037068 | Bacteria | 5994 |
| 599 | Ga0373925_0896491 | 3300037068 | Unclassified | 731 |
| 600 | Ga0373925_1429370 | 3300037068 | Bacteria | 566 |
| 601 | Ga0395899_0000855 | 3300037312 | Bacteria | 29149 |
| 602 | Ga0395899_0003647 | 3300037312 | Bacteria | 12195 |
| 603 | Ga0395899_0003808 | 3300037312 | Bacteria | 11913 |
| 604 | Ga0395899_0011930 | 3300037312 | Bacteria | 6657 |
| 605 | Ga0395899_0057859 | 3300037312 | Bacteria | 2860 |
| 606 | Ga0395899_0066433 | 3300037312 | Bacteria | 2648 |
| 607 | Ga0395899_0283048 | 3300037312 | Archaea | 1127 |
| 608 | Ga0395899_0398574 | 3300037312 | Bacteria | 911 |
| 609 | Ga0395899_0602386 | 3300037312 | Bacteria | 700 |
| 610 | Ga0395900_0000988 | 3300037418 | Bacteria | 36988 |
| 611 | Ga0395900_0001815 | 3300037418 | Bacteria | 24440 |
| 612 | Ga0395900_0002063 | 3300037418 | Bacteria | 22548 |
| 613 | Ga0395900_0006089 | 3300037418 | Bacteria | 12579 |
| 614 | Ga0395900_0006883 | 3300037418 | Bacteria | 11797 |
| 615 | Ga0395900_0015254 | 3300037418 | Bacteria | 7835 |
| 616 | Ga0395900_0023619 | 3300037418 | Bacteria | 6290 |
| 617 | Ga0395900_0029608 | 3300037418 | Bacteria | 5617 |
| 618 | Ga0395900_0037663 | 3300037418 | Bacteria | 4986 |
| 619 | Ga0395900_0059472 | 3300037418 | Bacteria | 3934 |
| 620 | Ga0395900_0125938 | 3300037418 | Bacteria | 2627 |
| 621 | Ga0395900_0170566 | 3300037418 | Bacteria | 2216 |
| 622 | Ga0395900_0578180 | 3300037418 | Unclassified | 1065 |
| 623 | Ga0395900_0670615 | 3300037418 | Bacteria | 972 |
| 624 | Ga0395900_0926614 | 3300037418 | Unclassified | 794 |
| 625 | Ga0395898_0001851 | 3300037466 | Bacteria | 27144 |
| 626 | Ga0395898_0005501 | 3300037466 | Bacteria | 13678 |
| 627 | Ga0395898_0009660 | 3300037466 | Bacteria | 10127 |
| 628 | Ga0395898_0010358 | 3300037466 | Bacteria | 9751 |
| 629 | Ga0395898_0010653 | 3300037466 | Bacteria | 9604 |
| 630 | Ga0395898_0021055 | 3300037466 | Bacteria | 6616 |
| 631 | Ga0395898_0060661 | 3300037466 | Bacteria | 3675 |
| 632 | Ga0395898_0081955 | 3300037466 | Bacteria | 3110 |
| 633 | Ga0395898_0101093 | 3300037466 | Bacteria | 2769 |
| 634 | Ga0395898_0317136 | 3300037466 | Bacteria | 1487 |
| 635 | Ga0395898_0524100 | 3300037466 | Bacteria | 1126 |
| 636 | Ga0395898_1239195 | 3300037466 | Unclassified | 676 |
| 637 | Ga0395898_1772913 | 3300037466 | Unclassified | 539 |
| 638 | Ga0395905_0002715 | 3300037471 | Bacteria | 19391 |
| 639 | Ga0395905_0003527 | 3300037471 | Bacteria | 16686 |
| 640 | Ga0395905_0004780 | 3300037471 | Bacteria | 13992 |
| 641 | Ga0395905_0005093 | 3300037471 | Bacteria | 13515 |
| 642 | Ga0395905_0007145 | 3300037471 | Bacteria | 11164 |
| 643 | Ga0395905_0014219 | 3300037471 | Bacteria | 7603 |
| 644 | Ga0395905_0016488 | 3300037471 | Bacteria | 7023 |
| 645 | Ga0395905_0031792 | 3300037471 | Bacteria | 4966 |
| 646 | Ga0395905_0065321 | 3300037471 | Bacteria | 3406 |
| 647 | Ga0395905_0192669 | 3300037471 | Bacteria | 1912 |
| 648 | Ga0395905_0197616 | 3300037471 | Bacteria | 1886 |
| 649 | Ga0395905_0300467 | 3300037471 | Unclassified | 1492 |
| 650 | Ga0395905_0724884 | 3300037471 | Bacteria | 897 |
| 651 | Ga0395905_0754904 | 3300037471 | Bacteria | 875 |
| 652 | Ga0395905_1369700 | 3300037471 | Bacteria | 611 |
| 653 | Ga0395901_0001046 | 3300038443 | Bacteria | 29844 |
| 654 | Ga0395901_0001699 | 3300038443 | Bacteria | 22721 |
| 655 | Ga0395901_0017122 | 3300038443 | Bacteria | 7389 |
| 656 | Ga0395901_0020132 | 3300038443 | Bacteria | 6827 |
| 657 | Ga0395901_0020914 | 3300038443 | Bacteria | 6703 |
| 658 | Ga0395901_0023314 | 3300038443 | Bacteria | 6343 |
| 659 | Ga0395901_0023336 | 3300038443 | Bacteria | 6340 |
| 660 | Ga0395901_0026916 | 3300038443 | Bacteria | 5904 |
| 661 | Ga0395901_0029314 | 3300038443 | Bacteria | 5665 |
| 662 | Ga0395901_0034882 | 3300038443 | Bacteria | 5196 |
| 663 | Ga0395901_0052204 | 3300038443 | Bacteria | 4249 |
| 664 | Ga0395901_0124759 | 3300038443 | Bacteria | 2705 |
| 665 | Ga0395901_0155154 | 3300038443 | Bacteria | 2405 |
| 666 | Ga0395901_0252693 | 3300038443 | Unclassified | 1836 |
| 667 | Ga0395901_0309946 | 3300038443 | Bacteria | 1635 |
| 668 | Ga0395901_0311363 | 3300038443 | Archaea | 1630 |
| 669 | Ga0395901_0393519 | 3300038443 | Bacteria | 1424 |
| 670 | Ga0395901_0410610 | 3300038443 | Bacteria | 1390 |
| 671 | Ga0395901_0739048 | 3300038443 | Unclassified | 978 |
| 672 | Ga0436360_1202685 | 3300039438 | Bacteria | 4165 |
| 673 | Ga0451789_0679119 | 3300041443 | Bacteria | 659 |
| 674 | Ga0451800_1000072 | 3300041459 | Bacteria | 967 |
| 675 | Ga0451804_0350657 | 3300041463 | Unclassified | 758 |
| 676 | Ga0451807_0386844 | 3300041486 | Bacteria | 944 |
| 677 | Ga0451835_0352271 | 3300041492 | Bacteria | 704 |
| 678 | Ga0451851_0134753 | 3300041507 | Unclassified | 663 |
| 679 | Ga0451851_1194924 | 3300041507 | Unclassified | 528 |
| 680 | Ga0451855_1544268 | 3300041511 | Unclassified | 502 |
| 681 | Ga0451853_0421655 | 3300041512 | Bacteria | 647 |
| 682 | Ga0451853_1430403 | 3300041512 | Bacteria | 2367 |
| 683 | Ga0451853_2263295 | 3300041512 | Bacteria | 1185 |
| 684 | Ga0439448_0010108 | 3300042005 | Bacteria | 2790 |
| 685 | Ga0439448_0169426 | 3300042005 | Unclassified | 762 |
| 686 | Ga0439454_033538 | 3300042011 | Bacteria | 815 |
| 687 | Ga0439463_094006 | 3300042016 | Bacteria | 772 |
| 688 | Ga0450923_086057 | 3300042125 | Bacteria | 712 |
| 689 | Ga0450908_016961 | 3300042184 | Bacteria | 1296 |
| 690 | Ga0439460_0278507 | 3300042461 | Unclassified | 582 |
| 691 | Ga0439440_0172541 | 3300042993 | Unclassified | 630 |
| 692 | Ga0466972_0280379 | 3300044658 | Unclassified | 779 |
| 693 | Ga0466965_0728045 | 3300044683 | Bacteria | 571 |
| 694 | Ga0466966_0170455 | 3300044684 | Bacteria | 1323 |
| 695 | Ga0466966_0227404 | 3300044684 | Bacteria | 1126 |
| 696 | Ga0466961_0083010 | 3300044693 | Bacteria | 2026 |
| 697 | Ga0466961_0437122 | 3300044693 | Bacteria | 792 |
| 698 | Ga0466963_0002006 | 3300044694 | Bacteria | 11187 |
| 699 | Ga0466963_0002668 | 3300044694 | Bacteria | 10046 |
| 700 | Ga0466963_0002932 | 3300044694 | Bacteria | 9647 |
| 701 | Ga0466963_0006305 | 3300044694 | Bacteria | 7013 |
| 702 | Ga0466963_0007463 | 3300044694 | Bacteria | 6522 |
| 703 | Ga0466963_0008542 | 3300044694 | Bacteria | 6148 |
| 704 | Ga0466963_0008804 | 3300044694 | Bacteria | 6063 |
| 705 | Ga0466963_0015548 | 3300044694 | Bacteria | 4715 |
| 706 | Ga0466963_0030071 | 3300044694 | Bacteria | 3501 |
| 707 | Ga0466963_0036743 | 3300044694 | Bacteria | 3195 |
| 708 | Ga0466963_0043566 | 3300044694 | Bacteria | 2951 |
| 709 | Ga0466963_0064925 | 3300044694 | Bacteria | 2446 |
| 710 | Ga0466963_0184519 | 3300044694 | Bacteria | 1457 |
| 711 | Ga0466963_0225109 | 3300044694 | Bacteria | 1314 |
| 712 | Ga0466963_0225822 | 3300044694 | Bacteria | 1312 |
| 713 | Ga0466963_0234454 | 3300044694 | Unclassified | 1286 |
| 714 | Ga0466963_0243816 | 3300044694 | Bacteria | 1261 |
| 715 | Ga0466964_0002663 | 3300044706 | Bacteria | 6393 |
| 716 | Ga0466964_0003457 | 3300044706 | Bacteria | 5764 |
| 717 | Ga0466964_0004480 | 3300044706 | Bacteria | 5160 |
| 718 | Ga0466964_0006257 | 3300044706 | Bacteria | 4437 |
| 719 | Ga0466964_0024038 | 3300044706 | Bacteria | 2372 |
| 720 | Ga0466964_0096262 | 3300044706 | Bacteria | 1297 |
| 721 | Ga0466964_0200596 | 3300044706 | Unclassified | 957 |
| 722 | Ga0466964_0404640 | 3300044706 | Bacteria | 714 |
| 723 | Ga0466971_0002599 | 3300044719 | Bacteria | 7639 |
| 724 | Ga0466971_0024052 | 3300044719 | Bacteria | 2716 |
| 725 | Ga0466971_0291099 | 3300044719 | Unclassified | 783 |
| 726 | Ga0466968_0006248 | 3300044735 | Bacteria | 4483 |
| 727 | Ga0466968_0089598 | 3300044735 | Unclassified | 1361 |
| 728 | Ga0466968_0219915 | 3300044735 | Bacteria | 894 |
| 729 | Ga0466970_0588577 | 3300044765 | Unclassified | 645 |
| 730 | Ga0466957_0024215 | 3300044842 | Bacteria | 3591 |
| 731 | Ga0466957_0073905 | 3300044842 | Bacteria | 2114 |
| 732 | Ga0466957_0082801 | 3300044842 | Bacteria | 2000 |
| 733 | Ga0466957_0100193 | 3300044842 | Bacteria | 1825 |
| 734 | Ga0466957_0130237 | 3300044842 | Bacteria | 1611 |
| 735 | Ga0466957_0181285 | 3300044842 | Bacteria | 1375 |
| 736 | Ga0466957_0217806 | 3300044842 | Bacteria | 1259 |
| 737 | Ga0466957_0352786 | 3300044842 | Bacteria | 998 |
| 738 | Ga0466957_1102298 | 3300044842 | Bacteria | 572 |
| 739 | Ga0466960_0074010 | 3300044901 | Bacteria | 1701 |
| 740 | Ga0466959_0006028 | 3300045049 | Bacteria | 8368 |
| 741 | Ga0466959_0017610 | 3300045049 | Bacteria | 5238 |
| 742 | Ga0466959_0087487 | 3300045049 | Bacteria | 2241 |
| 743 | Ga0466959_0362906 | 3300045049 | Bacteria | 987 |
| 744 | Ga0466959_0416606 | 3300045049 | Unclassified | 912 |
| 745 | Ga0466959_0993707 | 3300045049 | Unclassified | 559 |
| 746 | Ga0451576_0880536 | 3300045051 | Bacteria | 940 |
| 747 | Ga0466958_0002675 | 3300045836 | Bacteria | 9020 |
| 748 | Ga0466958_0008643 | 3300045836 | Bacteria | 5654 |
| 749 | Ga0466958_0020069 | 3300045836 | Bacteria | 3895 |
| 750 | Ga0466958_0085058 | 3300045836 | Bacteria | 1951 |
| 751 | Ga0466958_0092512 | 3300045836 | Bacteria | 1872 |
| 752 | Ga0466958_0161536 | 3300045836 | Bacteria | 1415 |
| 753 | Ga0466958_0191493 | 3300045836 | Bacteria | 1300 |
| 754 | Ga0466967_0006182 | 3300045976 | Bacteria | 8436 |
| 755 | Ga0466967_0008612 | 3300045976 | Bacteria | 7497 |
| 756 | Ga0466967_0014509 | 3300045976 | Bacteria | 6140 |
| 757 | Ga0466967_0016742 | 3300045976 | Bacteria | 5793 |
| 758 | Ga0466967_0028335 | 3300045976 | Bacteria | 4674 |
| 759 | Ga0466967_0034359 | 3300045976 | Bacteria | 4303 |
| 760 | Ga0466967_0035140 | 3300045976 | Bacteria | 4262 |
| 761 | Ga0466967_0045571 | 3300045976 | Bacteria | 3811 |
| 762 | Ga0466967_0057084 | 3300045976 | Bacteria | 3445 |
| 763 | Ga0466967_0061309 | 3300045976 | Bacteria | 3336 |
| 764 | Ga0466967_0062554 | 3300045976 | Bacteria | 3304 |
| 765 | Ga0466967_0063431 | 3300045976 | Bacteria | 3283 |
| 766 | Ga0466967_0083214 | 3300045976 | Bacteria | 2893 |
| 767 | Ga0466967_0116397 | 3300045976 | Bacteria | 2462 |
| 768 | Ga0466967_0122681 | 3300045976 | Bacteria | 2403 |
| 769 | Ga0466967_0133638 | 3300045976 | Bacteria | 2305 |
| 770 | Ga0466967_0151088 | 3300045976 | Bacteria | 2170 |
| 771 | Ga0466967_0172763 | 3300045976 | Bacteria | 2034 |
| 772 | Ga0466967_0176333 | 3300045976 | Bacteria | 2013 |
| 773 | Ga0466967_0317810 | 3300045976 | Bacteria | 1501 |
| 774 | Ga0466967_0324464 | 3300045976 | Bacteria | 1485 |
| 775 | Ga0466967_0326028 | 3300045976 | Unclassified | 1482 |
| 776 | Ga0466967_0438439 | 3300045976 | Bacteria | 1275 |
| 777 | Ga0466967_0513968 | 3300045976 | Bacteria | 1176 |
| 778 | Ga0466967_0557468 | 3300045976 | Bacteria | 1128 |
| 779 | Ga0495592_0001047 | 3300046454 | Bacteria | 19192 |
| 780 | Ga0495592_0129070 | 3300046454 | Bacteria | 1770 |
| 781 | Ga0495592_0287037 | 3300046454 | Bacteria | 1074 |
| 782 | Ga0495603_0002533 | 3300046455 | Bacteria | 10757 |
| 783 | Ga0495603_0071520 | 3300046455 | Unclassified | 2039 |
| 784 | Ga0495603_0233866 | 3300046455 | Bacteria | 1059 |
| 785 | Ga0495629_0074536 | 3300046459 | Unclassified | 2369 |
| 786 | Ga0495629_0117139 | 3300046459 | Bacteria | 1856 |
| 787 | Ga0495629_0240813 | 3300046459 | Bacteria | 1246 |
| 788 | Ga0495641_0015369 | 3300046461 | Bacteria | 4091 |
| 789 | Ga0495641_0027317 | 3300046461 | Bacteria | 2776 |
| 790 | Ga0495641_0108039 | 3300046461 | Unclassified | 1241 |
| 791 | Ga0495641_0233079 | 3300046461 | Bacteria | 826 |
| 792 | Ga0495651_0072906 | 3300046462 | Bacteria | 2607 |
| 793 | Ga0495651_0101131 | 3300046462 | Unclassified | 2146 |
| 794 | Ga0495653_0041210 | 3300046463 | Unclassified | 3605 |
| 795 | Ga0495653_0044446 | 3300046463 | Bacteria | 3447 |
| 796 | Ga0495653_0251323 | 3300046463 | Bacteria | 1173 |
| 797 | Ga0495653_0282672 | 3300046463 | Bacteria | 1088 |
| 798 | Ga0495580_0364736 | 3300046472 | Unclassified | 977 |
| 799 | Ga0495580_0816732 | 3300046472 | Unclassified | 604 |
| 800 | Ga0495582_0006869 | 3300046473 | Bacteria | 6327 |
| 801 | Ga0495582_0063961 | 3300046473 | Bacteria | 2031 |
| 802 | Ga0495582_0096284 | 3300046473 | Bacteria | 1654 |
| 803 | Ga0495582_0124150 | 3300046473 | Bacteria | 1456 |
| 804 | Ga0495582_0241402 | 3300046473 | Bacteria | 1035 |
| 805 | Ga0495582_0561372 | 3300046473 | Unclassified | 660 |
| 806 | Ga0495605_0081882 | 3300046474 | Bacteria | 1509 |
| 807 | Ga0495605_0088762 | 3300046474 | Unclassified | 1436 |
| 808 | Ga0495639_0000877 | 3300046475 | Bacteria | 13617 |
| 809 | Ga0495639_0006207 | 3300046475 | Bacteria | 5132 |
| 810 | Ga0495639_0466887 | 3300046475 | Bacteria | 642 |
| 811 | Ga0495662_0009854 | 3300046476 | Unclassified | 4693 |
| 812 | Ga0495662_0030505 | 3300046476 | Unclassified | 2603 |
| 813 | Ga0495664_0030024 | 3300046477 | Bacteria | 3183 |
| 814 | Ga0495664_0093337 | 3300046477 | Bacteria | 1810 |
| 815 | Ga0495584_0014522 | 3300046491 | Bacteria | 4012 |
| 816 | Ga0495584_0022200 | 3300046491 | Bacteria | 3222 |
| 817 | Ga0495585_0103556 | 3300046492 | Unclassified | 1520 |
| 818 | Ga0495594_0002098 | 3300046499 | Bacteria | 10375 |
| 819 | Ga0495594_0423919 | 3300046499 | Unclassified | 757 |
| 820 | Ga0495596_0072140 | 3300046500 | Bacteria | 1341 |
| 821 | Ga0495596_0309522 | 3300046500 | Bacteria | 614 |
| 822 | Ga0495607_0044751 | 3300046501 | Bacteria | 2608 |
| 823 | Ga0495608_0366157 | 3300046511 | Bacteria | 885 |
| 824 | Ga0495608_0422469 | 3300046511 | Bacteria | 813 |
| 825 | Ga0495608_0945563 | 3300046511 | Unclassified | 503 |
| 826 | Ga0495618_0113340 | 3300046514 | Bacteria | 1736 |
| 827 | Ga0495618_0135170 | 3300046514 | Unclassified | 1577 |
| 828 | Ga0495628_0004790 | 3300046516 | Bacteria | 11916 |
| 829 | Ga0495628_0186999 | 3300046516 | Bacteria | 1565 |
| 830 | Ga0495628_0246291 | 3300046516 | Unclassified | 1335 |
| 831 | Ga0495628_0368726 | 3300046516 | Bacteria | 1053 |
| 832 | Ga0495630_0003203 | 3300046517 | Bacteria | 11383 |
| 833 | Ga0495630_0051348 | 3300046517 | Bacteria | 3087 |
| 834 | Ga0495630_0074378 | 3300046517 | Unclassified | 2558 |
| 835 | Ga0495630_0123725 | 3300046517 | Bacteria | 1962 |
| 836 | Ga0495631_0152154 | 3300046518 | Bacteria | 993 |
| 837 | Ga0495637_0105742 | 3300046520 | Bacteria | 1096 |
| 838 | Ga0495644_0009530 | 3300046523 | Bacteria | 3743 |
| 839 | Ga0495644_0082940 | 3300046523 | Bacteria | 1209 |
| 840 | Ga0495644_0349382 | 3300046523 | Bacteria | 582 |
| 841 | Ga0495644_0369561 | 3300046523 | Bacteria | 566 |
| 842 | Ga0495666_0000867 | 3300046526 | Bacteria | 14112 |
| 843 | Ga0495666_0179235 | 3300046526 | Bacteria | 979 |
| 844 | Ga0495666_0364333 | 3300046526 | Unclassified | 651 |
| 845 | Ga0495642_0312683 | 3300046528 | Unclassified | 689 |
| 846 | Ga0495652_0029275 | 3300046529 | Bacteria | 4839 |
| 847 | Ga0495652_0065759 | 3300046529 | Archaea | 3045 |
| 848 | Ga0495652_0084337 | 3300046529 | Bacteria | 2613 |
| 849 | Ga0495652_0353232 | 3300046529 | Bacteria | 1052 |
| 850 | Ga0495665_0019091 | 3300046531 | Unclassified | 3684 |
| 851 | Ga0495665_0033238 | 3300046531 | Unclassified | 2759 |
| 852 | Ga0495665_0424895 | 3300046531 | Bacteria | 673 |
| 853 | Ga0495640_0004109 | 3300046533 | Bacteria | 11645 |
| 854 | Ga0495640_0082573 | 3300046533 | Archaea | 2133 |
| 855 | Ga0495640_0115901 | 3300046533 | Unclassified | 1745 |
| 856 | Ga0495640_0396743 | 3300046533 | Unclassified | 847 |
| 857 | Ga0495640_0731717 | 3300046533 | Unclassified | 592 |
| 858 | Ga0495586_0010965 | 3300046535 | Unclassified | 4815 |
| 859 | Ga0495586_0055339 | 3300046535 | Bacteria | 2150 |
| 860 | Ga0495586_0447187 | 3300046535 | Bacteria | 745 |
| 861 | Ga0495587_0069988 | 3300046536 | Bacteria | 2042 |
| 862 | Ga0495587_0678216 | 3300046536 | Bacteria | 565 |
| 863 | Ga0495609_0031795 | 3300046538 | Unclassified | 2398 |
| 864 | Ga0495609_0106559 | 3300046538 | Bacteria | 1212 |
| 865 | Ga0495621_0171644 | 3300046539 | Bacteria | 862 |
| 866 | Ga0495645_0078317 | 3300046543 | Bacteria | 2375 |
| 867 | Ga0495645_0141264 | 3300046543 | Bacteria | 1679 |
| 868 | Ga0495622_0089452 | 3300046557 | Bacteria | 1415 |
| 869 | Ga0495667_0002076 | 3300046559 | Bacteria | 13310 |
| 870 | Ga0495667_0043857 | 3300046559 | Unclassified | 2963 |
| 871 | Ga0495667_0062620 | 3300046559 | Bacteria | 2437 |
| 872 | Ga0495667_0146747 | 3300046559 | Bacteria | 1519 |
| 873 | Ga0495667_0335516 | 3300046559 | Unclassified | 956 |
| 874 | Ga0495667_0385354 | 3300046559 | Bacteria | 884 |
| 875 | Ga0495656_0043675 | 3300046615 | Unclassified | 1883 |
| 876 | Ga0495656_0194110 | 3300046615 | Unclassified | 1004 |
| 877 | Ga0495656_0424036 | 3300046615 | Unclassified | 698 |
| 878 | Ga0495656_0472058 | 3300046615 | Bacteria | 663 |
| 879 | Ga0495634_0035965 | 3300046642 | Unclassified | 3388 |
| 880 | Ga0495634_0190810 | 3300046642 | Bacteria | 1278 |
| 881 | Ga0495634_0239921 | 3300046642 | Bacteria | 1112 |
| 882 | Ga0495635_0025222 | 3300046663 | Unclassified | 4140 |
| 883 | Ga0495635_0036622 | 3300046663 | Bacteria | 3400 |
| 884 | Ga0495635_0083039 | 3300046663 | Archaea | 2192 |
| 885 | Ga0495635_0112181 | 3300046663 | Bacteria | 1862 |
| 886 | Ga0495635_0132377 | 3300046663 | Bacteria | 1700 |
| 887 | Ga0495659_0100369 | 3300046664 | Bacteria | 1120 |
| 888 | Ga0495661_0247731 | 3300046665 | Bacteria | 911 |
| 889 | Ga0495661_0277446 | 3300046665 | Unclassified | 846 |
| 890 | Ga0495588_0037931 | 3300046674 | Bacteria | 2450 |
| 891 | Ga0495657_0088334 | 3300046675 | Bacteria | 1993 |
| 892 | Ga0495657_0207979 | 3300046675 | Bacteria | 1190 |
| 893 | Ga0495657_0261536 | 3300046675 | Bacteria | 1039 |
| 894 | Ga0495599_0074553 | 3300046678 | Unclassified | 2118 |
| 895 | Ga0495599_0162116 | 3300046678 | Archaea | 1382 |
| 896 | Ga0495623_0045462 | 3300046679 | Bacteria | 2789 |
| 897 | Ga0495623_0378008 | 3300046679 | Unclassified | 766 |
| 898 | Ga0495646_0050909 | 3300046680 | Bacteria | 2508 |
| 899 | Ga0495646_0059593 | 3300046680 | Bacteria | 2279 |
| 900 | Ga0495646_0078057 | 3300046680 | Bacteria | 1936 |
| 901 | Ga0495647_0005813 | 3300046681 | Unclassified | 4058 |
| 902 | Ga0495647_0104038 | 3300046681 | Bacteria | 1178 |
| 903 | Ga0495647_0249509 | 3300046681 | Bacteria | 790 |
| 904 | Ga0495658_0009961 | 3300046683 | Unclassified | 4741 |
| 905 | Ga0495658_0029687 | 3300046683 | Bacteria | 2963 |
| 906 | Ga0495658_0061758 | 3300046683 | Bacteria | 2152 |
| 907 | Ga0495658_0079339 | 3300046683 | Bacteria | 1923 |
| 908 | Ga0495658_0163125 | 3300046683 | Bacteria | 1376 |
| 909 | Ga0495658_0360976 | 3300046683 | Unclassified | 924 |
| 910 | Ga0495613_0002918 | 3300046689 | Bacteria | 12813 |
| 911 | Ga0495613_0084540 | 3300046689 | Bacteria | 2304 |
| 912 | Ga0495613_0088452 | 3300046689 | Bacteria | 2245 |
| 913 | Ga0495613_0115405 | 3300046689 | Unclassified | 1932 |
| 914 | Ga0495613_0217534 | 3300046689 | Bacteria | 1342 |
| 915 | Ga0495613_0248891 | 3300046689 | Bacteria | 1241 |
| 916 | Ga0495624_0002334 | 3300046690 | Bacteria | 14427 |
| 917 | Ga0495624_0016274 | 3300046690 | Bacteria | 5008 |
| 918 | Ga0495624_0192245 | 3300046690 | Bacteria | 1241 |
| 919 | Ga0495624_0522156 | 3300046690 | Bacteria | 710 |
| 920 | Ga0495589_0114626 | 3300046794 | Bacteria | 1300 |
| 921 | Ga0495600_0071080 | 3300046809 | Bacteria | 2274 |
| 922 | Ga0495600_0088670 | 3300046809 | Unclassified | 2018 |
| 923 | Ga0495600_0363640 | 3300046809 | Unclassified | 905 |
| 924 | Ga0495581_0010204 | 3300047315 | Bacteria | 5433 |
| 925 | Ga0495581_0059738 | 3300047315 | Unclassified | 2203 |
| 926 | Ga0495581_0069837 | 3300047315 | Bacteria | 2031 |
| 927 | Ga0495581_0104785 | 3300047315 | Unclassified | 1643 |
| 928 | Ga0495581_0436445 | 3300047315 | Bacteria | 763 |
| 929 | Ga0495604_0069150 | 3300047317 | Bacteria | 2677 |
| 930 | Ga0495636_0033221 | 3300047318 | Bacteria | 2119 |
| 931 | Ga0495636_0139826 | 3300047318 | Bacteria | 1081 |
| 932 | Ga0495636_0199105 | 3300047318 | Bacteria | 914 |
| 933 | Ga0495674_0057496 | 3300047319 | Unclassified | 3403 |
| 934 | Ga0495674_0198639 | 3300047319 | Bacteria | 1664 |
| 935 | Ga0495674_0321001 | 3300047319 | Bacteria | 1262 |
| 936 | Ga0495674_0364173 | 3300047319 | Unclassified | 1172 |
| 937 | Ga0495674_0546456 | 3300047319 | Unclassified | 922 |
| 938 | Ga0495676_0023828 | 3300047321 | Bacteria | 5304 |
| 939 | Ga0495676_0028473 | 3300047321 | Bacteria | 4769 |
| 940 | Ga0495676_0106124 | 3300047321 | Bacteria | 2070 |
| 941 | Ga0495676_0159285 | 3300047321 | Bacteria | 1598 |
| 942 | Ga0495676_0693272 | 3300047321 | Bacteria | 659 |
| 943 | Ga0495680_0062558 | 3300047322 | Bacteria | 2861 |
| 944 | Ga0495675_0211176 | 3300047444 | Unclassified | 1178 |
| 945 | Ga0495677_0048266 | 3300047445 | Bacteria | 1564 |
| 946 | Ga0495677_0120451 | 3300047445 | Bacteria | 1001 |
| 947 | Ga0495685_172602 | 3300047447 | Unclassified | 698 |
| 948 | Ga0495684_0029560 | 3300047471 | Archaea | 4206 |
| 949 | Ga0495684_0041333 | 3300047471 | Unclassified | 3533 |
| 950 | Ga0495684_0410742 | 3300047471 | Bacteria | 948 |
| 951 | Ga0495593_0046814 | 3300047673 | Unclassified | 2303 |
| 952 | Ga0495602_0032377 | 3300048088 | Bacteria | 4922 |
| 953 | Ga0495602_0050380 | 3300048088 | Bacteria | 3721 |
| 954 | Ga0495602_0393103 | 3300048088 | Bacteria | 990 |
| 955 | Ga0495614_0010382 | 3300048089 | Unclassified | 4106 |
| 956 | Ga0495614_0131177 | 3300048089 | Bacteria | 1109 |
| 957 | Ga0495614_0181237 | 3300048089 | Unclassified | 948 |
| 958 | Ga0495614_0246782 | 3300048089 | Unclassified | 816 |
| 959 | Ga0495626_0429544 | 3300048091 | Bacteria | 509 |
| 960 | Ga0496100_0017841 | 3300048903 | Bacteria | 4197 |
| 961 | Ga0496100_0050640 | 3300048903 | Bacteria | 2692 |
| 962 | Ga0496100_0266646 | 3300048903 | Bacteria | 1272 |
| 963 | Ga0496100_0313550 | 3300048903 | Bacteria | 1177 |
| 964 | Ga0496100_0490154 | 3300048903 | Bacteria | 946 |
| 965 | Ga0496100_0640480 | 3300048903 | Bacteria | 827 |
| 966 | Ga0496100_0793961 | 3300048903 | Bacteria | 741 |
| 967 | Ga0496101_0127120 | 3300048904 | Unclassified | 1932 |
| 968 | Ga0496101_0151615 | 3300048904 | Unclassified | 1773 |
| 969 | Ga0496101_0153102 | 3300048904 | Bacteria | 1765 |
| 970 | Ga0496101_0232186 | 3300048904 | Bacteria | 1434 |
| 971 | Ga0496102_0003780 | 3300048905 | Bacteria | 12801 |
| 972 | Ga0496102_0045690 | 3300048905 | Bacteria | 3976 |
| 973 | Ga0496102_0075999 | 3300048905 | Bacteria | 3088 |
| 974 | Ga0496102_0145423 | 3300048905 | Bacteria | 2225 |
| 975 | Ga0496102_0180186 | 3300048905 | Bacteria | 1990 |
| 976 | Ga0496102_0365130 | 3300048905 | Bacteria | 1359 |
| 977 | Ga0496103_0005252 | 3300048906 | Bacteria | 7776 |
| 978 | Ga0496103_0005964 | 3300048906 | Bacteria | 7287 |
| 979 | Ga0496103_0006783 | 3300048906 | Bacteria | 6832 |
| 980 | Ga0496103_0011753 | 3300048906 | Bacteria | 5194 |
| 981 | Ga0496103_0025899 | 3300048906 | Bacteria | 3548 |
| 982 | Ga0496103_0096859 | 3300048906 | Bacteria | 1865 |
| 983 | Ga0496103_0180692 | 3300048906 | Bacteria | 1356 |
| 984 | Ga0496104_0008696 | 3300048907 | Bacteria | 9030 |
| 985 | Ga0496104_0017204 | 3300048907 | Bacteria | 6577 |
| 986 | Ga0496104_0056716 | 3300048907 | Bacteria | 3705 |
| 987 | Ga0496104_0250604 | 3300048907 | Bacteria | 1683 |
| 988 | Ga0496104_0329163 | 3300048907 | Unclassified | 1441 |
| 989 | Ga0496104_0498756 | 3300048907 | Bacteria | 1128 |
| 990 | Ga0496104_0993542 | 3300048907 | Unclassified | 743 |
| 991 | Ga0496104_1169422 | 3300048907 | Bacteria | 673 |
| 992 | Ga0496105_0000774 | 3300048908 | Bacteria | 21680 |
| 993 | Ga0496105_0044361 | 3300048908 | Bacteria | 3667 |
| 994 | Ga0496105_0060312 | 3300048908 | Bacteria | 3130 |
| 995 | Ga0496105_0069810 | 3300048908 | Bacteria | 2903 |
| 996 | Ga0496105_0145712 | 3300048908 | Bacteria | 1947 |
| 997 | Ga0496105_0151850 | 3300048908 | Bacteria | 1903 |
| 998 | Ga0496105_0161934 | 3300048908 | Bacteria | 1837 |
| 999 | Ga0496105_0888539 | 3300048908 | Unclassified | 672 |
| 1000 | Ga0496106_0013297 | 3300048909 | Bacteria | 6076 |
| 1001 | Ga0496106_0022161 | 3300048909 | Bacteria | 4717 |
| 1002 | Ga0496106_0087181 | 3300048909 | Bacteria | 2405 |
| 1003 | Ga0496106_0296226 | 3300048909 | Unclassified | 1297 |
| 1004 | Ga0496106_0456448 | 3300048909 | Bacteria | 1026 |
| 1005 | Ga0496106_0495979 | 3300048909 | Bacteria | 981 |
| 1006 | Ga0496106_1202343 | 3300048909 | Bacteria | 591 |
| 1007 | Ga0496107_0047235 | 3300048910 | Bacteria | 3100 |
| 1008 | Ga0496107_0055251 | 3300048910 | Bacteria | 2868 |
| 1009 | Ga0496107_0059682 | 3300048910 | Bacteria | 2760 |
| 1010 | Ga0496107_0191159 | 3300048910 | Bacteria | 1521 |
| 1011 | Ga0496107_0695377 | 3300048910 | Unclassified | 748 |
| 1012 | Ga0496108_0006605 | 3300048911 | Bacteria | 9405 |
| 1013 | Ga0496108_0012735 | 3300048911 | Bacteria | 6849 |
| 1014 | Ga0496108_0020741 | 3300048911 | Bacteria | 5402 |
| 1015 | Ga0496108_0233016 | 3300048911 | Bacteria | 1601 |
| 1016 | Ga0496108_0313846 | 3300048911 | Bacteria | 1366 |
| 1017 | Ga0496108_0316935 | 3300048911 | Bacteria | 1359 |
| 1018 | Ga0496108_1219788 | 3300048911 | Bacteria | 635 |
| 1019 | Ga0496109_0001185 | 3300048912 | Bacteria | 21642 |
| 1020 | Ga0496109_0010434 | 3300048912 | Bacteria | 7935 |
| 1021 | Ga0496109_0037853 | 3300048912 | Bacteria | 4359 |
| 1022 | Ga0496109_0059987 | 3300048912 | Unclassified | 3476 |
| 1023 | Ga0496109_0064459 | 3300048912 | Bacteria | 3353 |
| 1024 | Ga0496109_0129561 | 3300048912 | Bacteria | 2354 |
| 1025 | Ga0496109_0165862 | 3300048912 | Bacteria | 2070 |
| 1026 | Ga0496109_0271725 | 3300048912 | Bacteria | 1597 |
| 1027 | Ga0496109_0327860 | 3300048912 | Archaea | 1445 |
| 1028 | Ga0496109_0336585 | 3300048912 | Bacteria | 1425 |
| 1029 | Ga0496109_0690118 | 3300048912 | Unclassified | 958 |
| 1030 | Ga0496109_0775652 | 3300048912 | Unclassified | 897 |
| 1031 | Ga0496109_1242363 | 3300048912 | Bacteria | 681 |
| 1032 | Ga0496110_0001930 | 3300048913 | Bacteria | 15355 |
| 1033 | Ga0496110_0061900 | 3300048913 | Bacteria | 3304 |
| 1034 | Ga0496110_0079920 | 3300048913 | Bacteria | 2912 |
| 1035 | Ga0496110_0084393 | 3300048913 | Bacteria | 2835 |
| 1036 | Ga0496110_0122957 | 3300048913 | Archaea | 2340 |
| 1037 | Ga0496110_0865903 | 3300048913 | Bacteria | 809 |
| 1038 | Ga0496111_0013131 | 3300048914 | Bacteria | 5628 |
| 1039 | Ga0496111_0016941 | 3300048914 | Bacteria | 5029 |
| 1040 | Ga0496111_0025491 | 3300048914 | Bacteria | 4172 |
| 1041 | Ga0496111_0029739 | 3300048914 | Bacteria | 3881 |
| 1042 | Ga0496111_0379440 | 3300048914 | Bacteria | 1045 |
| 1043 | Ga0496111_0385835 | 3300048914 | Bacteria | 1036 |
| 1044 | Ga0496111_0532181 | 3300048914 | Bacteria | 864 |
| 1045 | Ga0496111_0597097 | 3300048914 | Unclassified | 808 |
| 1046 | Ga0496112_0001626 | 3300048915 | Bacteria | 17400 |
| 1047 | Ga0496112_0010813 | 3300048915 | Bacteria | 8303 |
| 1048 | Ga0496112_0022196 | 3300048915 | Bacteria | 6049 |
| 1049 | Ga0496112_0026094 | 3300048915 | Bacteria | 5618 |
| 1050 | Ga0496112_0063900 | 3300048915 | Bacteria | 3631 |
| 1051 | Ga0496112_0232221 | 3300048915 | Bacteria | 1799 |
| 1052 | Ga0496112_0295395 | 3300048915 | Bacteria | 1566 |
| 1053 | Ga0496112_0590599 | 3300048915 | Bacteria | 1043 |
| 1054 | Ga0496112_1271487 | 3300048915 | Unclassified | 652 |
| 1055 | Ga0496113_0000174 | 3300048916 | Bacteria | 28582 |
| 1056 | Ga0496113_0029988 | 3300048916 | Bacteria | 3933 |
| 1057 | Ga0496113_0161588 | 3300048916 | Bacteria | 1771 |
| 1058 | Ga0496113_0234408 | 3300048916 | Bacteria | 1464 |
| 1059 | Ga0496113_0356266 | 3300048916 | Bacteria | 1174 |
| 1060 | Ga0496113_0621746 | 3300048916 | Unclassified | 864 |
| 1061 | Ga0496113_0732505 | 3300048916 | Bacteria | 788 |
| 1062 | Ga0496113_0807908 | 3300048916 | Unclassified | 745 |
| 1063 | Ga0496113_1089824 | 3300048916 | Unclassified | 627 |
| 1064 | Ga0496114_0018406 | 3300048917 | Bacteria | 5646 |
| 1065 | Ga0496114_0019355 | 3300048917 | Bacteria | 5516 |
| 1066 | Ga0496114_0051967 | 3300048917 | Bacteria | 3413 |
| 1067 | Ga0496114_0103198 | 3300048917 | Unclassified | 2437 |
| 1068 | Ga0496114_0288937 | 3300048917 | Unclassified | 1446 |
| 1069 | Ga0496114_0373262 | 3300048917 | Bacteria | 1262 |
| 1070 | Ga0496114_0762099 | 3300048917 | Bacteria | 845 |
| 1071 | Ga0496115_0020362 | 3300048918 | Bacteria | 5117 |
| 1072 | Ga0496115_0036936 | 3300048918 | Bacteria | 3869 |
| 1073 | Ga0496115_0037849 | 3300048918 | Bacteria | 3824 |
| 1074 | Ga0496115_0097812 | 3300048918 | Bacteria | 2403 |
| 1075 | Ga0496115_0196047 | 3300048918 | Bacteria | 1669 |
| 1076 | Ga0496115_0646164 | 3300048918 | Unclassified | 837 |
| 1077 | Ga0501031_0049719 | 3300049568 | Bacteria | 2732 |
| 1078 | Ga0501033_0035501 | 3300049570 | Bacteria | 3738 |
| 1079 | Ga0501036_0014593 | 3300049572 | Bacteria | 6543 |
| 1080 | Ga0501036_0046327 | 3300049572 | Bacteria | 3682 |
| 1081 | Ga0501038_0016243 | 3300049574 | Bacteria | 6750 |
| 1082 | Ga0501039_0017007 | 3300049575 | Bacteria | 5574 |
| 1083 | Ga0501039_0018576 | 3300049575 | Bacteria | 5337 |
| 1084 | Ga0501039_1066350 | 3300049575 | Unclassified | 627 |
| 1085 | Ga0501040_0016148 | 3300049576 | Bacteria | 4938 |
| 1086 | Ga0501040_0020766 | 3300049576 | Bacteria | 4379 |
| 1087 | Ga0501040_0022945 | 3300049576 | Bacteria | 4181 |
| 1088 | Ga0501040_0042835 | 3300049576 | Bacteria | 3084 |
| 1089 | Ga0501041_0001170 | 3300049577 | Bacteria | 14358 |
| 1090 | Ga0501041_0071486 | 3300049577 | Bacteria | 2130 |
| 1091 | Ga0501042_0008113 | 3300049578 | Bacteria | 6914 |
| 1092 | Ga0501042_0102983 | 3300049578 | Bacteria | 2054 |
| 1093 | Ga0501042_0105050 | 3300049578 | Bacteria | 2032 |
| 1094 | Ga0501042_0115359 | 3300049578 | Bacteria | 1934 |
| 1095 | Ga0501043_0056308 | 3300049579 | Bacteria | 3088 |
| 1096 | Ga0501046_0289757 | 3300049580 | Unclassified | 1198 |
| 1097 | Ga0501048_0043273 | 3300049582 | Bacteria | 3224 |
| 1098 | Ga0501048_0060236 | 3300049582 | Bacteria | 2690 |
| 1099 | Ga0501048_0214595 | 3300049582 | Bacteria | 1364 |
| 1100 | Ga0501067_0002546 | 3300049583 | Bacteria | 10059 |
| 1101 | Ga0501067_0027507 | 3300049583 | Bacteria | 3151 |
| 1102 | Ga0501068_0057575 | 3300049584 | Bacteria | 2357 |
| 1103 | Ga0501068_0110349 | 3300049584 | Bacteria | 1710 |
| 1104 | Ga0501068_0299208 | 3300049584 | Bacteria | 1030 |
| 1105 | Ga0501069_0012316 | 3300049585 | Bacteria | 4545 |
| 1106 | Ga0501069_0021334 | 3300049585 | Bacteria | 3513 |
| 1107 | Ga0501069_0054283 | 3300049585 | Bacteria | 2232 |
| 1108 | Ga0501069_0460293 | 3300049585 | Unclassified | 756 |
| 1109 | Ga0501069_0904664 | 3300049585 | Unclassified | 537 |
| 1110 | Ga0501070_0142436 | 3300049586 | Bacteria | 1979 |
| 1111 | Ga0501070_0398511 | 3300049586 | Bacteria | 1113 |
| 1112 | Ga0501071_0001490 | 3300049587 | Bacteria | 13610 |
| 1113 | Ga0501071_0013539 | 3300049587 | Bacteria | 5561 |
| 1114 | Ga0501071_0097781 | 3300049587 | Unclassified | 2161 |
| 1115 | Ga0501071_0137802 | 3300049587 | Bacteria | 1816 |
| 1116 | Ga0501071_0228847 | 3300049587 | Unclassified | 1400 |
| 1117 | Ga0501071_0328973 | 3300049587 | Bacteria | 1161 |
| 1118 | Ga0501071_0432172 | 3300049587 | Unclassified | 1007 |
| 1119 | Ga0501072_0001558 | 3300049588 | Bacteria | 17113 |
| 1120 | Ga0501072_0019748 | 3300049588 | Bacteria | 5213 |
| 1121 | Ga0501072_0069243 | 3300049588 | Bacteria | 2786 |
| 1122 | Ga0501072_0087270 | 3300049588 | Unclassified | 2476 |
| 1123 | Ga0501072_0126752 | 3300049588 | Bacteria | 2034 |
| 1124 | Ga0501072_0128644 | 3300049588 | Bacteria | 2018 |
| 1125 | Ga0501072_0196721 | 3300049588 | Bacteria | 1607 |
| 1126 | Ga0501074_0009147 | 3300049590 | Bacteria | 7192 |
| 1127 | Ga0501074_0099874 | 3300049590 | Bacteria | 2077 |
| 1128 | Ga0501074_0175667 | 3300049590 | Bacteria | 1528 |
| 1129 | Ga0501074_0231555 | 3300049590 | Bacteria | 1315 |
| 1130 | Ga0501075_0023278 | 3300049591 | Bacteria | 4534 |
| 1131 | Ga0501075_0033702 | 3300049591 | Bacteria | 3810 |
| 1132 | Ga0501075_0035257 | 3300049591 | Bacteria | 3730 |
| 1133 | Ga0501075_0042288 | 3300049591 | Bacteria | 3416 |
| 1134 | Ga0501075_0056499 | 3300049591 | Bacteria | 2954 |
| 1135 | Ga0501075_0063325 | 3300049591 | Bacteria | 2788 |
| 1136 | Ga0501075_0476657 | 3300049591 | Unclassified | 952 |
| 1137 | Ga0501076_0019912 | 3300049592 | Bacteria | 5132 |
| 1138 | Ga0501076_0035198 | 3300049592 | Bacteria | 3918 |
| 1139 | Ga0501076_0073434 | 3300049592 | Unclassified | 2739 |
| 1140 | Ga0501076_0108740 | 3300049592 | Bacteria | 2240 |
| 1141 | Ga0501077_0050824 | 3300049593 | Bacteria | 2635 |
| 1142 | Ga0501077_0073290 | 3300049593 | Bacteria | 2169 |
| 1143 | Ga0501079_0014176 | 3300049741 | Bacteria | 6077 |
| 1144 | Ga0501079_0023324 | 3300049741 | Bacteria | 4749 |
| 1145 | Ga0501079_0029148 | 3300049741 | Bacteria | 4236 |
| 1146 | Ga0501079_0034365 | 3300049741 | Bacteria | 3901 |
| 1147 | Ga0501080_0023671 | 3300049742 | Bacteria | 5690 |
| 1148 | Ga0501080_0173336 | 3300049742 | Bacteria | 1988 |
| 1149 | Ga0501080_0270094 | 3300049742 | Bacteria | 1548 |
| 1150 | Ga0501081_0062685 | 3300049743 | Unclassified | 2579 |
| 1151 | Ga0501081_0107172 | 3300049743 | Bacteria | 1981 |
| 1152 | Ga0501081_0142595 | 3300049743 | Unclassified | 1717 |
| 1153 | Ga0501081_0190495 | 3300049743 | Bacteria | 1485 |
| 1154 | Ga0501081_0307186 | 3300049743 | Bacteria | 1164 |
| 1155 | Ga0501081_0327002 | 3300049743 | Bacteria | 1127 |
| 1156 | Ga0501081_0513407 | 3300049743 | Bacteria | 894 |
| 1157 | Ga0501083_0002636 | 3300049744 | Bacteria | 12354 |
| 1158 | Ga0501045_0003524 | 3300049824 | Bacteria | 10724 |
| 1159 | Ga0501045_0017164 | 3300049824 | Bacteria | 5140 |
| 1160 | Ga0501045_0190361 | 3300049824 | Bacteria | 1529 |
| 1161 | nmdc:mga05p37_103965_c1 | 3300050507 | Bacteria | 3495 |
| 1162 | nmdc:mga05p37_125342_c1 | 3300050507 | Bacteria | 3154 |
| 1163 | nmdc:mga05p37_20308_c1 | 3300050507 | Bacteria | 8037 |
| 1164 | nmdc:mga05p37_316820_c1 | 3300050507 | Bacteria | 1847 |
| 1165 | nmdc:mga06r32_350821_c1 | 3300050510 | Bacteria | 1460 |
| 1166 | nmdc:mga06r32_509054_c1 | 3300050510 | Bacteria | 1180 |
| 1167 | nmdc:mga06r32_71444_c1 | 3300050510 | Unclassified | 3358 |
| 1168 | nmdc:mga08y16_233788_c1 | 3300050511 | Bacteria | 1901 |
| 1169 | nmdc:mga08y16_302132_c1 | 3300050511 | Bacteria | 1650 |
| 1170 | nmdc:mga0n895_10843_c1 | 3300050512 | Bacteria | 8088 |
| 1171 | nmdc:mga0n895_1091422_c1 | 3300050512 | Bacteria | 776 |
| 1172 | nmdc:mga0n895_113497_c1 | 3300050512 | Unclassified | 2343 |
| 1173 | nmdc:mga0n895_212455_c1 | 3300050512 | Unclassified | 1965 |
| 1174 | nmdc:mga0n895_644451_c1 | 3300050512 | Bacteria | 1059 |
| 1175 | nmdc:mga0n895_783874_c1 | 3300050512 | Unclassified | 945 |
| 1176 | nmdc:mga0rr50_106172_c1 | 3300050513 | Bacteria | 2215 |
| 1177 | nmdc:mga0rr50_151098_c1 | 3300050513 | Bacteria | 1877 |
| 1178 | nmdc:mga0rr50_170371_c1 | 3300050513 | Bacteria | 1774 |
| 1179 | nmdc:mga0rr50_200196_c1 | 3300050513 | Bacteria | 1641 |
| 1180 | nmdc:mga0rr50_665421_c1 | 3300050513 | Bacteria | 888 |
| 1181 | nmdc:mga08x19_163556_c1 | 3300050514 | Bacteria | 1512 |
| 1182 | nmdc:mga08x19_232640_c1 | 3300050514 | Unclassified | 1269 |
| 1183 | nmdc:mga0a205_23321_c1 | 3300050515 | Bacteria | 5870 |
| 1184 | nmdc:mga0a205_46526_c1 | 3300050515 | Bacteria | 4185 |
| 1185 | Ga0495601_0015514 | 3300053077 | Bacteria | 4604 |
| 1186 | Ga0495601_0025347 | 3300053077 | Unclassified | 3657 |
| 1187 | Ga0495601_0056965 | 3300053077 | Archaea | 2475 |
| 1188 | Ga0495601_0142240 | 3300053077 | Bacteria | 1565 |
| 1189 | Ga0495601_0196217 | 3300053077 | Bacteria | 1319 |
| 1190 | Ga0495601_0227023 | 3300053077 | Bacteria | 1220 |
| 1191 | Ga0495601_0679254 | 3300053077 | Unclassified | 658 |
| 1192 | Ga0495612_0024789 | 3300053078 | Unclassified | 2408 |
| 1193 | Ga0495655_0077943 | 3300053083 | Bacteria | 941 |
| 1194 | Ga0495655_0143051 | 3300053083 | Unclassified | 746 |
| 1195 | Ga0495595_0019057 | 3300053084 | Bacteria | 2973 |
| 1196 | Ga0495595_0225004 | 3300053084 | Bacteria | 936 |
| 1197 | Ga0495595_0290693 | 3300053084 | Bacteria | 821 |
| 1198 | Ga0495595_0291375 | 3300053084 | Unclassified | 820 |
| 1199 | Ga0495619_0007030 | 3300053085 | Bacteria | 7121 |
| 1200 | Ga0495619_0021703 | 3300053085 | Bacteria | 4102 |
| 1201 | Ga0495619_0025564 | 3300053085 | Bacteria | 3793 |
| 1202 | Ga0495619_0119289 | 3300053085 | Unclassified | 1808 |
| 1203 | Ga0495619_0329682 | 3300053085 | Bacteria | 1056 |
| 1204 | Ga0500566_0111911 | 3300053094 | Unclassified | 1483 |
| 1205 | Ga0501084_0009197 | 3300054114 | Bacteria | 8170 |
| 1206 | Ga0501084_0014265 | 3300054114 | Bacteria | 6582 |
| 1207 | Ga0501084_0023755 | 3300054114 | Bacteria | 5113 |
| 1208 | Ga0501084_0283473 | 3300054114 | Unclassified | 1399 |
| 1209 | Ga0501084_0377726 | 3300054114 | Bacteria | 1198 |
| 1210 | Ga0587083_0140200 | 3300059505 | Unclassified | 643 |
| 1211 | Ga0501082_0009108 | 3300060353 | Bacteria | 8561 |
| 1212 | Ga0501082_0015420 | 3300060353 | Bacteria | 6576 |
| 1213 | Ga0501082_0976506 | 3300060353 | Unclassified | 741 |
| 1214 | Ga0466962_0002011 | 3300061719 | Bacteria | 9595 |
| 1215 | Ga0466962_0003932 | 3300061719 | Bacteria | 7110 |
| 1216 | Ga0466962_0106029 | 3300061719 | Bacteria | 1351 |
| 1217 | Ga0466962_0346922 | 3300061719 | Unclassified | 739 |
| 1218 | Ga0530510_0001882 | 3300061734 | Bacteria | 14320 |
| 1219 | Ga0530510_0012536 | 3300061734 | Bacteria | 5957 |
| 1220 | Ga0530510_0018981 | 3300061734 | Bacteria | 4877 |
| 1221 | Ga0530510_0020943 | 3300061734 | Bacteria | 4651 |
| 1222 | Ga0530510_0037429 | 3300061734 | Bacteria | 3499 |
| 1223 | Ga0530510_0514562 | 3300061734 | Bacteria | 908 |
| 1224 | Ga0496103_0517701 | |||
| 1225 | rootH1_10246936 | |||
| 1226 | JGI25407J50210_10000450 | |||
| 1227 | Ga0070658_10009482 | |||
| 1228 | Ga0070658_10046978 | |||
| 1229 | Ga0070658_10073197 | |||
| 1230 | Ga0070658_10225309 | |||
| 1231 | Ga0070658_10838237 | |||
| 1232 | Ga0070683_100028510 | |||
| 1233 | Ga0070683_100087423 | |||
| 1234 | Ga0070683_100254650 | |||
| 1235 | Ga0070683_100805009 | |||
| 1236 | Ga0070690_100007766 | |||
| 1237 | Ga0070690_100060869 | |||
| 1238 | Ga0070666_10096419 | |||
| 1239 | Ga0070680_100025767 | |||
| 1240 | Ga0070680_100029925 | |||
| 1241 | Ga0070680_100033727 | |||
| 1242 | Ga0070680_100162730 | |||
| 1243 | Ga0070680_100184861 | |||
| 1244 | Ga0070680_100277812 | |||
| 1245 | Ga0070682_100034271 | |||
| 1246 | Ga0070682_100063207 | |||
| 1247 | Ga0070682_100722823 | |||
| 1248 | Ga0070682_100895444 | |||
| 1249 | Ga0070682_101090374 | |||
| 1250 | Ga0068868_100032026 | |||
| 1251 | Ga0068868_100791820 | |||
| 1252 | Ga0070660_100007999 | |||
| 1253 | Ga0070660_100029085 | |||
| 1254 | Ga0070660_100030204 | |||
| 1255 | Ga0070660_100042015 | |||
| 1256 | Ga0070660_100044339 | |||
| 1257 | Ga0070691_10034801 | |||
| 1258 | Ga0070691_10121600 | |||
| 1259 | Ga0070691_10145266 | |||
| 1260 | Ga0070687_100359597 | |||
| 1261 | Ga0070687_100458759 | |||
| 1262 | Ga0070661_100028012 | |||
| 1263 | Ga0070661_101447066 | |||
| 1264 | Ga0070692_10545659 | |||
| 1265 | Ga0070668_100038323 | |||
| 1266 | Ga0070668_100715657 | |||
| 1267 | Ga0070669_100847835 | |||
| 1268 | Ga0070671_100095763 | |||
| 1269 | Ga0070671_100200912 | |||
| 1270 | Ga0070671_100548595 | |||
| 1271 | Ga0070671_101019235 | |||
| 1272 | Ga0070671_101168013 | |||
| 1273 | Ga0070674_100505210 | |||
| 1274 | Ga0070673_100284632 | |||
| 1275 | Ga0070673_101636740 | |||
| 1276 | Ga0070688_100169032 | |||
| 1277 | Ga0070659_100185861 | |||
| 1278 | Ga0070659_100217393 | |||
| 1279 | Ga0070659_100233407 | |||
| 1280 | Ga0070659_100729072 | |||
| 1281 | Ga0070703_10171684 | |||
| 1282 | Ga0070703_10497386 | |||
| 1283 | Ga0070709_10006002 | |||
| 1284 | Ga0070709_10013639 | |||
| 1285 | Ga0070709_10151008 | |||
| 1286 | Ga0070709_10244384 | |||
| 1287 | Ga0070709_10989563 | |||
| 1288 | Ga0070714_100003425 | |||
| 1289 | Ga0070714_100009659 | |||
| 1290 | Ga0070714_100017036 | |||
| 1291 | Ga0070714_100032067 | |||
| 1292 | Ga0070714_100144675 | |||
| 1293 | Ga0070714_100220243 | |||
| 1294 | Ga0070713_100047947 | |||
| 1295 | Ga0070713_100080400 | |||
| 1296 | Ga0070713_100211383 | |||
| 1297 | Ga0070713_100298512 | |||
| 1298 | Ga0070713_100539512 | |||
| 1299 | Ga0070713_100732940 | |||
| 1300 | Ga0070710_10000870 | |||
| 1301 | Ga0070710_10026521 | |||
| 1302 | Ga0070710_10118983 | |||
| 1303 | Ga0070710_10295280 | |||
| 1304 | Ga0070710_10488251 | |||
| 1305 | Ga0070710_10681804 | |||
| 1306 | Ga0070711_100012846 | |||
| 1307 | Ga0070711_100070548 | |||
| 1308 | Ga0070711_100894423 | |||
| 1309 | Ga0070705_100015077 | |||
| 1310 | Ga0070705_100017215 | |||
| 1311 | Ga0070705_100382139 | |||
| 1312 | Ga0070705_101374479 | |||
| 1313 | Ga0070700_100008900 | |||
| 1314 | Ga0070700_100735079 | |||
| 1315 | Ga0070694_100014241 | |||
| 1316 | Ga0070694_100032741 | |||
| 1317 | Ga0070694_100360896 | |||
| 1318 | Ga0070694_100947250 | |||
| 1319 | Ga0070694_101294966 | |||
| 1320 | Ga0070708_100149636 | |||
| 1321 | Ga0070708_100400282 | |||
| 1322 | Ga0070663_100067238 | |||
| 1323 | Ga0070678_100297783 | |||
| 1324 | Ga0070678_100306880 | |||
| 1325 | Ga0070678_100389711 | |||
| 1326 | Ga0070662_100086743 | |||
| 1327 | Ga0070681_10049353 | |||
| 1328 | Ga0070681_10061907 | |||
| 1329 | Ga0070681_10145778 | |||
| 1330 | Ga0070681_10238657 | |||
| 1331 | Ga0070681_10267786 | |||
| 1332 | Ga0070681_10540684 | |||
| 1333 | Ga0068867_100000419 | |||
| 1334 | Ga0068867_100052443 | |||
| 1335 | Ga0068867_100217449 | |||
| 1336 | Ga0070685_10004312 | |||
| 1337 | Ga0070706_100096353 | |||
| 1338 | Ga0070706_100349073 | |||
| 1339 | Ga0070706_100838949 | |||
| 1340 | Ga0070707_100002503 | |||
| 1341 | Ga0070707_100112015 | |||
| 1342 | Ga0070707_100166816 | |||
| 1343 | Ga0070707_100515497 | |||
| 1344 | Ga0070707_100693653 | |||
| 1345 | Ga0070698_100108665 | |||
| 1346 | Ga0070698_100215687 | |||
| 1347 | Ga0070698_100292606 | |||
| 1348 | Ga0070699_100032717 | |||
| 1349 | Ga0070699_100619915 | |||
| 1350 | Ga0070679_100014066 | |||
| 1351 | Ga0070679_100064501 | |||
| 1352 | Ga0070679_100077476 | |||
| 1353 | Ga0070679_100174102 | |||
| 1354 | Ga0070679_100259808 | |||
| 1355 | Ga0070679_100657631 | |||
| 1356 | Ga0070679_100701175 | |||
| 1357 | Ga0070684_100075578 | |||
| 1358 | Ga0070684_100468029 | |||
| 1359 | Ga0070684_101391850 | |||
| 1360 | Ga0070697_100059513 | |||
| 1361 | Ga0068853_100171735 | |||
| 1362 | Ga0068853_100703705 | |||
| 1363 | Ga0070672_100047107 | |||
| 1364 | Ga0070672_100135899 | |||
| 1365 | Ga0070686_100015245 | |||
| 1366 | Ga0070695_100000106 | |||
| 1367 | Ga0070695_100025858 | |||
| 1368 | Ga0070695_100030671 | |||
| 1369 | Ga0070695_100192294 | |||
| 1370 | Ga0070695_100367976 | |||
| 1371 | Ga0070695_100796676 | |||
| 1372 | Ga0070696_100018911 | |||
| 1373 | Ga0070696_100020126 | |||
| 1374 | Ga0070696_100034350 | |||
| 1375 | Ga0070696_100138111 | |||
| 1376 | Ga0070696_100707171 | |||
| 1377 | Ga0070693_100072111 | |||
| 1378 | Ga0070693_100154525 | |||
| 1379 | Ga0070693_100406346 | |||
| 1380 | Ga0070693_100544324 | |||
| 1381 | Ga0070665_100095756 | |||
| 1382 | Ga0070704_100074250 | |||
| 1383 | Ga0070704_100172120 | |||
| 1384 | Ga0070704_100248717 | |||
| 1385 | Ga0068855_100063144 | |||
| 1386 | Ga0068855_100112282 | |||
| 1387 | Ga0068855_100226606 | |||
| 1388 | Ga0068855_100286379 | |||
| 1389 | Ga0068855_100287692 | |||
| 1390 | Ga0068855_100404887 | |||
| 1391 | Ga0068855_100697374 | |||
| 1392 | Ga0068855_101211774 | |||
| 1393 | Ga0070664_100419805 | |||
| 1394 | Ga0068854_100003253 | |||
| 1395 | Ga0068856_100012137 | |||
| 1396 | Ga0068856_100040457 | |||
| 1397 | Ga0068856_100282786 | |||
| 1398 | Ga0068856_100582698 | |||
| 1399 | Ga0068856_100725971 | |||
| 1400 | Ga0070702_100005126 | |||
| 1401 | Ga0070702_100023594 | |||
| 1402 | Ga0070702_100025724 | |||
| 1403 | Ga0070702_100637980 | |||
| 1404 | Ga0070702_100694454 | |||
| 1405 | Ga0068852_100117475 | |||
| 1406 | Ga0068852_100328691 | |||
| 1407 | Ga0068852_101251207 | |||
| 1408 | Ga0068852_101356203 | |||
| 1409 | Ga0068864_100205746 | |||
| 1410 | Ga0068866_10088459 | |||
| 1411 | Ga0068861_100018620 | |||
| 1412 | Ga0068861_100195048 | |||
| 1413 | Ga0068861_100274732 | |||
| 1414 | Ga0068860_100922051 | |||
| 1415 | Ga0068860_101010881 | |||
| 1416 | Ga0081455_10003816 | |||
| 1417 | Ga0081455_10005873 | |||
| 1418 | Ga0081538_10000435 | |||
| 1419 | Ga0081538_10003328 | |||
| 1420 | Ga0081538_10028156 | |||
| 1421 | Ga0081540_1007276 | |||
| 1422 | Ga0081539_10001011 | |||
| 1423 | Ga0070717_10003099 | |||
| 1424 | Ga0070717_10024528 | |||
| 1425 | Ga0070717_10032359 | |||
| 1426 | Ga0070717_10089097 | |||
| 1427 | Ga0070717_10166381 | |||
| 1428 | Ga0070717_10347458 | |||
| 1429 | Ga0070717_10349413 | |||
| 1430 | Ga0070715_10005681 | |||
| 1431 | Ga0070716_100029384 | |||
| 1432 | Ga0070716_100133139 | |||
| 1433 | Ga0070716_100146287 | |||
| 1434 | Ga0070716_100271460 | |||
| 1435 | Ga0070716_100638413 | |||
| 1436 | Ga0070712_100169359 | |||
| 1437 | Ga0070712_100900959 | |||
| 1438 | Ga0070712_101008213 | |||
| 1439 | Ga0075367_10280865 | |||
| 1440 | Ga0097621_100021600 | |||
| 1441 | Ga0097621_100516143 | |||
| 1442 | Ga0097621_101104542 | |||
| 1443 | Ga0068871_100027740 | |||
| 1444 | Ga0068871_100052886 | |||
| 1445 | Ga0068871_100218867 | |||
| 1446 | Ga0075428_100151134 | |||
| 1447 | Ga0075431_100096728 | |||
| 1448 | Ga0075431_101948996 | |||
| 1449 | Ga0075434_100012215 | |||
| 1450 | Ga0075434_100138379 | |||
| 1451 | Ga0075434_100508946 | |||
| 1452 | Ga0075434_101179843 | |||
| 1453 | Ga0068865_100000269 | |||
| 1454 | Ga0068865_100026125 | |||
| 1455 | Ga0075436_100006756 | |||
| 1456 | Ga0075436_100118450 | |||
| 1457 | Ga0075435_100002731 | |||
| 1458 | Ga0075435_100361361 | |||
| 1459 | Ga0105240_10014499 | |||
| 1460 | Ga0105240_10187008 | |||
| 1461 | Ga0105240_11071385 | |||
| 1462 | Ga0105240_11206088 | |||
| 1463 | Ga0105240_11492467 | |||
| 1464 | Ga0105240_11670351 | |||
| 1465 | Ga0105240_11887323 | |||
| 1466 | Ga0111539_10033139 | |||
| 1467 | Ga0111539_10460153 | |||
| 1468 | Ga0105245_10016809 | |||
| 1469 | Ga0105245_10129749 | |||
| 1470 | Ga0105245_10154293 | |||
| 1471 | Ga0105245_10163519 | |||
| 1472 | Ga0105245_10229543 | |||
| 1473 | Ga0105245_10708423 | |||
| 1474 | Ga0105247_10657317 | |||
| 1475 | Ga0114129_10041196 | |||
| 1476 | Ga0114129_10536596 | |||
| 1477 | Ga0105243_10054426 | |||
| 1478 | Ga0105243_10075428 | |||
| 1479 | Ga0105241_10036307 | |||
| 1480 | Ga0105241_10166633 | |||
| 1481 | Ga0105241_11696115 | |||
| 1482 | Ga0105241_12623849 | |||
| 1483 | Ga0105242_10056023 | |||
| 1484 | Ga0105242_10080040 | |||
| 1485 | Ga0105242_10989247 | |||
| 1486 | Ga0105248_10012557 | |||
| 1487 | Ga0105248_10192131 | |||
| 1488 | Ga0105248_10224775 | |||
| 1489 | Ga0105248_10329962 | |||
| 1490 | Ga0105237_10068438 | |||
| 1491 | Ga0105237_11127563 | |||
| 1492 | Ga0105238_10093399 | |||
| 1493 | Ga0105249_10003662 | |||
| 1494 | Ga0105249_10009480 | |||
| 1495 | Ga0105249_10039919 | |||
| 1496 | Ga0105249_10673792 | |||
| 1497 | Ga0105239_10035049 | |||
| 1498 | Ga0105239_10171509 | |||
| 1499 | Ga0105239_10524635 | |||
| 1500 | Ga0105239_10547996 | |||
| 1501 | Ga0105239_10753207 | |||
| 1502 | Ga0105239_11471691 | |||
| 1503 | Ga0105246_10412334 | |||
| 1504 | Ga0105246_10599069 | |||
| 1505 | Ga0157320_1032014 | |||
| 1506 | Ga0157373_10325543 | |||
| 1507 | Ga0157373_10584281 | |||
| 1508 | Ga0157373_11170257 | |||
| 1509 | Ga0157371_10557486 | |||
| 1510 | Ga0157371_11032058 | |||
| 1511 | Ga0157371_11168824 | |||
| 1512 | Ga0157370_10055431 | |||
| 1513 | Ga0157370_10073197 | |||
| 1514 | Ga0157370_10310199 | |||
| 1515 | Ga0157370_10435425 | |||
| 1516 | Ga0157369_10016604 | |||
| 1517 | Ga0157369_10067620 | |||
| 1518 | Ga0157369_10146300 | |||
| 1519 | Ga0157369_10153852 | |||
| 1520 | Ga0157369_10254717 | |||
| 1521 | Ga0157374_10005704 | |||
| 1522 | Ga0157374_10156083 | |||
| 1523 | Ga0157374_12736583 | |||
| 1524 | Ga0157378_10039466 | |||
| 1525 | Ga0157378_10070463 | |||
| 1526 | Ga0157378_10276192 | |||
| 1527 | Ga0157378_10859023 | |||
| 1528 | Ga0157378_11436529 | |||
| 1529 | Ga0157378_11452375 | |||
| 1530 | Ga0163162_10010825 | |||
| 1531 | Ga0163162_10039717 | |||
| 1532 | Ga0163162_10232459 | |||
| 1533 | Ga0157372_10020621 | |||
| 1534 | Ga0157372_10650332 | |||
| 1535 | Ga0157372_10886745 | |||
| 1536 | Ga0157372_11223933 | |||
| 1537 | Ga0157372_12309997 | |||
| 1538 | Ga0157372_12823749 | |||
| 1539 | Ga0157372_13112230 | |||
| 1540 | Ga0157375_10014254 | |||
| 1541 | Ga0157375_10065178 | |||
| 1542 | Ga0157375_10112408 | |||
| 1543 | Ga0157375_10118020 | |||
| 1544 | Ga0157375_10248826 | |||
| 1545 | Ga0157375_11098246 | |||
| 1546 | Ga0163163_10041709 | |||
| 1547 | Ga0163163_10805092 | |||
| 1548 | Ga0157380_10063275 | |||
| 1549 | Ga0182008_10001839 | |||
| 1550 | Ga0182008_10098827 | |||
| 1551 | Ga0157377_10001454 | |||
| 1552 | Ga0157376_10065286 | |||
| 1553 | Ga0157376_10108444 | |||
| 1554 | Ga0157376_10667750 | |||
| 1555 | Ga0157376_12487565 | |||
| 1556 | Ga0182007_10015583 | |||
| 1557 | Ga0163161_10009018 | |||
| 1558 | Ga0163161_10088175 | |||
| 1559 | Ga0197907_10709808 | |||
| 1560 | Ga0197907_11100010 | |||
| 1561 | Ga0206356_10304527 | |||
| 1562 | Ga0206356_10942522 | |||
| 1563 | Ga0206356_11155746 | |||
| 1564 | Ga0206356_11607730 | |||
| 1565 | Ga0206356_11619724 | |||
| 1566 | Ga0206354_10660436 | |||
| 1567 | Ga0206353_11569701 | |||
| 1568 | Ga0206353_12032259 | |||
| 1569 | Ga0213871_10005010 | |||
| 1570 | Ga0224712_10115863 | |||
| 1571 | Ga0224712_10583324 | |||
| 1572 | Ga0207653_10015032 | |||
| 1573 | Ga0207692_10010365 | |||
| 1574 | Ga0207692_10012991 | |||
| 1575 | Ga0207692_10022223 | |||
| 1576 | Ga0207692_10235605 | |||
| 1577 | Ga0207642_10039473 | |||
| 1578 | Ga0207710_10101614 | |||
| 1579 | Ga0207688_10158092 | |||
| 1580 | Ga0207647_10073751 | |||
| 1581 | Ga0207685_10232439 | |||
| 1582 | Ga0207699_10054111 | |||
| 1583 | Ga0207699_10091693 | |||
| 1584 | Ga0207699_10168150 | |||
| 1585 | Ga0207645_10254771 | |||
| 1586 | Ga0207705_10074903 | |||
| 1587 | Ga0207705_10152230 | |||
| 1588 | Ga0207684_10168628 | |||
| 1589 | Ga0207684_10233873 | |||
| 1590 | Ga0207684_10458500 | |||
| 1591 | Ga0207684_10490080 | |||
| 1592 | Ga0207654_10175874 | |||
| 1593 | Ga0207654_10732306 | |||
| 1594 | Ga0207707_10059555 | |||
| 1595 | Ga0207707_10064555 | |||
| 1596 | Ga0207707_10193396 | |||
| 1597 | Ga0207707_10608679 | |||
| 1598 | Ga0207695_10092451 | |||
| 1599 | Ga0207693_10000699 | |||
| 1600 | Ga0207693_10001049 | |||
| 1601 | Ga0207693_10026878 | |||
| 1602 | Ga0207693_10027988 | |||
| 1603 | Ga0207693_10038114 | |||
| 1604 | Ga0207693_11163822 | |||
| 1605 | Ga0207693_11255666 | |||
| 1606 | Ga0207663_10011201 | |||
| 1607 | Ga0207663_10014821 | |||
| 1608 | Ga0207663_10065108 | |||
| 1609 | Ga0207663_10356680 | |||
| 1610 | Ga0207663_10635702 | |||
| 1611 | Ga0207660_10015302 | |||
| 1612 | Ga0207660_10046060 | |||
| 1613 | Ga0207660_10289038 | |||
| 1614 | Ga0207660_10546929 | |||
| 1615 | Ga0207660_10801212 | |||
| 1616 | Ga0207660_11111121 | |||
| 1617 | Ga0207662_10539072 | |||
| 1618 | Ga0207662_10867222 | |||
| 1619 | Ga0207657_10007767 | |||
| 1620 | Ga0207657_10015251 | |||
| 1621 | Ga0207657_10021691 | |||
| 1622 | Ga0207657_10024610 | |||
| 1623 | Ga0207657_10041550 | |||
| 1624 | Ga0207657_10110219 | |||
| 1625 | Ga0207649_10058557 | |||
| 1626 | Ga0207649_11132906 | |||
| 1627 | Ga0207652_10032198 | |||
| 1628 | Ga0207652_10033399 | |||
| 1629 | Ga0207652_10067623 | |||
| 1630 | Ga0207652_10171983 | |||
| 1631 | Ga0207652_10261456 | |||
| 1632 | Ga0207652_10290124 | |||
| 1633 | Ga0207652_10419303 | |||
| 1634 | Ga0207652_10706657 | |||
| 1635 | Ga0207646_10000502 | |||
| 1636 | Ga0207646_10073373 | |||
| 1637 | Ga0207646_10439548 | |||
| 1638 | Ga0207646_10792966 | |||
| 1639 | Ga0207646_11071483 | |||
| 1640 | Ga0207681_10041996 | |||
| 1641 | Ga0207694_10056009 | |||
| 1642 | Ga0207694_10255122 | |||
| 1643 | Ga0207687_10015761 | |||
| 1644 | Ga0207687_10245862 | |||
| 1645 | Ga0207700_10058384 | |||
| 1646 | Ga0207700_10131897 | |||
| 1647 | Ga0207700_10144233 | |||
| 1648 | Ga0207700_10192486 | |||
| 1649 | Ga0207700_10976191 | |||
| 1650 | Ga0207664_10000789 | |||
| 1651 | Ga0207664_10028157 | |||
| 1652 | Ga0207664_10033946 | |||
| 1653 | Ga0207664_10040027 | |||
| 1654 | Ga0207664_10084701 | |||
| 1655 | Ga0207664_10313691 | |||
| 1656 | Ga0207664_10332147 | |||
| 1657 | Ga0207664_10343395 | |||
| 1658 | Ga0207664_10396498 | |||
| 1659 | Ga0207664_10549489 | |||
| 1660 | Ga0207644_10028140 | |||
| 1661 | Ga0207690_10138992 | |||
| 1662 | Ga0207690_10145626 | |||
| 1663 | Ga0207690_10151005 | |||
| 1664 | Ga0207690_10327095 | |||
| 1665 | Ga0207690_10440841 | |||
| 1666 | Ga0207690_10479403 | |||
| 1667 | Ga0207706_10021585 | |||
| 1668 | Ga0207686_10050201 | |||
| 1669 | Ga0207709_10002432 | |||
| 1670 | Ga0207709_10051636 | |||
| 1671 | Ga0207670_10191897 | |||
| 1672 | Ga0207669_10128579 | |||
| 1673 | Ga0207704_10009494 | |||
| 1674 | Ga0207704_10041516 | |||
| 1675 | Ga0207665_10004539 | |||
| 1676 | Ga0207665_10005937 | |||
| 1677 | Ga0207665_10026358 | |||
| 1678 | Ga0207665_10210308 | |||
| 1679 | Ga0207665_10591413 | |||
| 1680 | Ga0207691_10018525 | |||
| 1681 | Ga0207691_10259386 | |||
| 1682 | Ga0207711_10346423 | |||
| 1683 | Ga0207711_10426129 | |||
| 1684 | Ga0207711_10496749 | |||
| 1685 | Ga0207689_10921381 | |||
| 1686 | Ga0207661_10154301 | |||
| 1687 | Ga0207661_10471511 | |||
| 1688 | Ga0207661_10480548 | |||
| 1689 | Ga0207661_10928286 | |||
| 1690 | Ga0207679_10208866 | |||
| 1691 | Ga0207667_10096976 | |||
| 1692 | Ga0207667_10258030 | |||
| 1693 | Ga0207667_10333440 | |||
| 1694 | Ga0207667_10409514 | |||
| 1695 | Ga0207667_10485173 | |||
| 1696 | Ga0207667_11588106 | |||
| 1697 | Ga0207651_11544450 | |||
| 1698 | Ga0207712_10020566 | |||
| 1699 | Ga0207712_11018156 | |||
| 1700 | Ga0207668_10249289 | |||
| 1701 | Ga0207668_10251601 | |||
| 1702 | Ga0207640_10223653 | |||
| 1703 | Ga0207640_11473164 | |||
| 1704 | Ga0207640_11517365 | |||
| 1705 | Ga0207677_10088825 | |||
| 1706 | Ga0207677_10112984 | |||
| 1707 | Ga0207677_10117123 | |||
| 1708 | Ga0207639_10043044 | |||
| 1709 | Ga0207639_10054656 | |||
| 1710 | Ga0207678_10027318 | |||
| 1711 | Ga0207678_10042931 | |||
| 1712 | Ga0207678_10894260 | |||
| 1713 | Ga0207708_10007994 | |||
| 1714 | Ga0207708_10010110 | |||
| 1715 | Ga0207708_10756472 | |||
| 1716 | Ga0207702_10027407 | |||
| 1717 | Ga0207702_10051427 | |||
| 1718 | Ga0207702_10430533 | |||
| 1719 | Ga0207702_10562346 | |||
| 1720 | Ga0207702_10577781 | |||
| 1721 | Ga0207702_10718403 | |||
| 1722 | Ga0207702_10750799 | |||
| 1723 | Ga0207702_10812900 | |||
| 1724 | Ga0207648_10000729 | |||
| 1725 | Ga0207648_10010693 | |||
| 1726 | Ga0207676_10178680 | |||
| 1727 | Ga0207675_100004302 | |||
| 1728 | Ga0207675_100016438 | |||
| 1729 | Ga0207675_100106174 | |||
| 1730 | Ga0207675_100186641 | |||
| 1731 | Ga0207683_10005318 | |||
| 1732 | Ga0207683_10009738 | |||
| 1733 | Ga0207683_10323557 | |||
| 1734 | Ga0207683_10404413 | |||
| 1735 | Ga0207698_10066000 | |||
| 1736 | Ga0207698_10089108 | |||
| 1737 | Ga0207698_10877295 | |||
| 1738 | Ga0209966_1003416 | |||
| 1739 | Ga0207428_10011614 | |||
| 1740 | Ga0207428_10352970 | |||
| 1741 | Ga0265319_1004321 | |||
| 1742 | Ga0265334_10009422 | |||
| 1743 | Ga0265334_10040347 | |||
| 1744 | Ga0265334_10132196 | |||
| 1745 | Ga0265318_10000065 | |||
| 1746 | Ga0265318_10005617 | |||
| 1747 | Ga0265318_10087185 | |||
| 1748 | Ga0265322_10009372 | |||
| 1749 | Ga0265338_10002456 | |||
| 1750 | Ga0265338_10005902 | |||
| 1751 | Ga0265338_10019684 | |||
| 1752 | Ga0265338_10078845 | |||
| 1753 | Ga0265338_10147697 | |||
| 1754 | Ga0265330_10028891 | |||
| 1755 | Ga0265332_10009518 | |||
| 1756 | Ga0265320_10082307 | |||
| 1757 | Ga0265320_10090639 | |||
| 1758 | Ga0265325_10111830 | |||
| 1759 | Ga0265325_10374259 | |||
| 1760 | Ga0265329_10005149 | |||
| 1761 | Ga0265329_10026605 | |||
| 1762 | Ga0265329_10086034 | |||
| 1763 | Ga0265340_10183375 | |||
| 1764 | Ga0265339_10006175 | |||
| 1765 | Ga0265339_10220957 | |||
| 1766 | Ga0265331_10112240 | |||
| 1767 | Ga0265327_10026720 | |||
| 1768 | Ga0265327_10036954 | |||
| 1769 | Ga0265327_10313381 | |||
| 1770 | Ga0265316_10013688 | |||
| 1771 | Ga0265316_10328355 | |||
| 1772 | Ga0265316_10615264 | |||
| 1773 | Ga0307408_101844651 | |||
| 1774 | Ga0265313_10060039 | |||
| 1775 | Ga0265313_10073422 | |||
| 1776 | Ga0265314_10012609 | |||
| 1777 | Ga0265314_10101572 | |||
| 1778 | Ga0265314_10296245 | |||
| 1779 | Ga0265342_10047131 | |||
| 1780 | Ga0265342_10068015 | |||
| 1781 | Ga0265342_10202343 | |||
| 1782 | Ga0265342_10235599 | |||
| 1783 | Ga0265342_10528904 | |||
| 1784 | Ga0307409_100148520 | |||
| 1785 | Ga0307416_100371810 | |||
| 1786 | Ga0307411_10369542 | |||
| 1787 | Ga0307415_100544082 | |||
| 1788 | Ga0307415_102352882 | |||
| 1789 | Ga0373930_0013891 | |||
| 1790 | Ga0373926_0065166 | |||
| 1791 | Ga0373949_0028987 | |||
| 1792 | Ga0373949_0045929 | |||
| 1793 | Ga0373951_0146209 | |||
| 1794 | Ga0373952_0018155 | |||
| 1795 | Ga0373932_0114348 | |||
| 1796 | Ga0373932_0141006 | |||
| 1797 | Ga0373936_0585438 | |||
| 1798 | Ga0373939_0307337 | |||
| 1799 | Ga0373941_0036429 | |||
| 1800 | Ga0373941_0115890 | |||
| 1801 | Ga0373945_0006611 | |||
| 1802 | Ga0373945_0109493 | |||
| 1803 | Ga0373953_0291420 | |||
| 1804 | Ga0373956_0031081 | |||
| 1805 | Ga0373957_0129169 | |||
| 1806 | Ga0373960_0003654 | |||
| 1807 | Ga0373943_0013168 | |||
| 1808 | Ga0373946_0117810 | |||
| 1809 | Ga0373931_0058833 | |||
| 1810 | Ga0373931_0582700 | |||
| 1811 | Ga0373931_0856851 | |||
| 1812 | Ga0373931_1071628 | |||
| 1813 | Ga0373935_0108295 | |||
| 1814 | Ga0373935_0155673 | |||
| 1815 | Ga0373935_0356425 | |||
| 1816 | Ga0373935_0517514 | |||
| 1817 | Ga0373933_0617998 | |||
| 1818 | Ga0373947_0002361 | |||
| 1819 | Ga0373947_1112785 | |||
| 1820 | Ga0373937_1077367 | |||
| 1821 | Ga0373925_0013132 | |||
| 1822 | Ga0373925_0896491 | |||
| 1823 | Ga0373925_1429370 | |||
| 1824 | Ga0395899_0000855 | |||
| 1825 | Ga0395899_0003647 | |||
| 1826 | Ga0395899_0003808 | |||
| 1827 | Ga0395899_0011930 | |||
| 1828 | Ga0395899_0057859 | |||
| 1829 | Ga0395899_0066433 | |||
| 1830 | Ga0395899_0283048 | |||
| 1831 | Ga0395899_0398574 | |||
| 1832 | Ga0395899_0602386 | |||
| 1833 | Ga0395900_0000988 | |||
| 1834 | Ga0395900_0001815 | |||
| 1835 | Ga0395900_0002063 | |||
| 1836 | Ga0395900_0006089 | |||
| 1837 | Ga0395900_0006883 | |||
| 1838 | Ga0395900_0015254 | |||
| 1839 | Ga0395900_0023619 | |||
| 1840 | Ga0395900_0029608 | |||
| 1841 | Ga0395900_0037663 | |||
| 1842 | Ga0395900_0059472 | |||
| 1843 | Ga0395900_0125938 | |||
| 1844 | Ga0395900_0170566 | |||
| 1845 | Ga0395900_0578180 | |||
| 1846 | Ga0395900_0670615 | |||
| 1847 | Ga0395900_0926614 | |||
| 1848 | Ga0395898_0001851 | |||
| 1849 | Ga0395898_0005501 | |||
| 1850 | Ga0395898_0009660 | |||
| 1851 | Ga0395898_0010358 | |||
| 1852 | Ga0395898_0010653 | |||
| 1853 | Ga0395898_0021055 | |||
| 1854 | Ga0395898_0060661 | |||
| 1855 | Ga0395898_0081955 | |||
| 1856 | Ga0395898_0101093 | |||
| 1857 | Ga0395898_0317136 | |||
| 1858 | Ga0395898_0524100 | |||
| 1859 | Ga0395898_1239195 | |||
| 1860 | Ga0395898_1772913 | |||
| 1861 | Ga0395905_0002715 | |||
| 1862 | Ga0395905_0003527 | |||
| 1863 | Ga0395905_0004780 | |||
| 1864 | Ga0395905_0005093 | |||
| 1865 | Ga0395905_0007145 | |||
| 1866 | Ga0395905_0014219 | |||
| 1867 | Ga0395905_0016488 | |||
| 1868 | Ga0395905_0031792 | |||
| 1869 | Ga0395905_0065321 | |||
| 1870 | Ga0395905_0192669 | |||
| 1871 | Ga0395905_0197616 | |||
| 1872 | Ga0395905_0300467 | |||
| 1873 | Ga0395905_0724884 | |||
| 1874 | Ga0395905_0754904 | |||
| 1875 | Ga0395905_1369700 | |||
| 1876 | Ga0395901_0001046 | |||
| 1877 | Ga0395901_0001699 | |||
| 1878 | Ga0395901_0017122 | |||
| 1879 | Ga0395901_0020132 | |||
| 1880 | Ga0395901_0020914 | |||
| 1881 | Ga0395901_0023314 | |||
| 1882 | Ga0395901_0023336 | |||
| 1883 | Ga0395901_0026916 | |||
| 1884 | Ga0395901_0029314 | |||
| 1885 | Ga0395901_0034882 | |||
| 1886 | Ga0395901_0052204 | |||
| 1887 | Ga0395901_0124759 | |||
| 1888 | Ga0395901_0155154 | |||
| 1889 | Ga0395901_0252693 | |||
| 1890 | Ga0395901_0309946 | |||
| 1891 | Ga0395901_0311363 | |||
| 1892 | Ga0395901_0393519 | |||
| 1893 | Ga0395901_0410610 | |||
| 1894 | Ga0395901_0739048 | |||
| 1895 | Ga0436360_1202685 | |||
| 1896 | Ga0451789_0679119 | |||
| 1897 | Ga0451800_1000072 | |||
| 1898 | Ga0451804_0350657 | |||
| 1899 | Ga0451807_0386844 | |||
| 1900 | Ga0451835_0352271 | |||
| 1901 | Ga0451851_0134753 | |||
| 1902 | Ga0451851_1194924 | |||
| 1903 | Ga0451855_1544268 | |||
| 1904 | Ga0451853_0421655 | |||
| 1905 | Ga0451853_1430403 | |||
| 1906 | Ga0451853_2263295 | |||
| 1907 | Ga0439448_0010108 | |||
| 1908 | Ga0439448_0169426 | |||
| 1909 | Ga0439454_033538 | |||
| 1910 | Ga0439463_094006 | |||
| 1911 | Ga0450923_086057 | |||
| 1912 | Ga0450908_016961 | |||
| 1913 | Ga0439460_0278507 | |||
| 1914 | Ga0439440_0172541 | |||
| 1915 | Ga0466972_0280379 | |||
| 1916 | Ga0466965_0728045 | |||
| 1917 | Ga0466966_0170455 | |||
| 1918 | Ga0466966_0227404 | |||
| 1919 | Ga0466961_0083010 | |||
| 1920 | Ga0466961_0437122 | |||
| 1921 | Ga0466963_0002006 | |||
| 1922 | Ga0466963_0002668 | |||
| 1923 | Ga0466963_0002932 | |||
| 1924 | Ga0466963_0006305 | |||
| 1925 | Ga0466963_0007463 | |||
| 1926 | Ga0466963_0008542 | |||
| 1927 | Ga0466963_0008804 | |||
| 1928 | Ga0466963_0015548 | |||
| 1929 | Ga0466963_0030071 | |||
| 1930 | Ga0466963_0036743 | |||
| 1931 | Ga0466963_0043566 | |||
| 1932 | Ga0466963_0064925 | |||
| 1933 | Ga0466963_0184519 | |||
| 1934 | Ga0466963_0225109 | |||
| 1935 | Ga0466963_0225822 | |||
| 1936 | Ga0466963_0234454 | |||
| 1937 | Ga0466963_0243816 | |||
| 1938 | Ga0466964_0002663 | |||
| 1939 | Ga0466964_0003457 | |||
| 1940 | Ga0466964_0004480 | |||
| 1941 | Ga0466964_0006257 | |||
| 1942 | Ga0466964_0024038 | |||
| 1943 | Ga0466964_0096262 | |||
| 1944 | Ga0466964_0200596 | |||
| 1945 | Ga0466964_0404640 | |||
| 1946 | Ga0466971_0002599 | |||
| 1947 | Ga0466971_0024052 | |||
| 1948 | Ga0466971_0291099 | |||
| 1949 | Ga0466968_0006248 | |||
| 1950 | Ga0466968_0089598 | |||
| 1951 | Ga0466968_0219915 | |||
| 1952 | Ga0466970_0588577 | |||
| 1953 | Ga0466957_0024215 | |||
| 1954 | Ga0466957_0073905 | |||
| 1955 | Ga0466957_0082801 | |||
| 1956 | Ga0466957_0100193 | |||
| 1957 | Ga0466957_0130237 | |||
| 1958 | Ga0466957_0181285 | |||
| 1959 | Ga0466957_0217806 | |||
| 1960 | Ga0466957_0352786 | |||
| 1961 | Ga0466957_1102298 | |||
| 1962 | Ga0466960_0074010 | |||
| 1963 | Ga0466959_0006028 | |||
| 1964 | Ga0466959_0017610 | |||
| 1965 | Ga0466959_0087487 | |||
| 1966 | Ga0466959_0362906 | |||
| 1967 | Ga0466959_0416606 | |||
| 1968 | Ga0466959_0993707 | |||
| 1969 | Ga0451576_0880536 | |||
| 1970 | Ga0466958_0002675 | |||
| 1971 | Ga0466958_0008643 | |||
| 1972 | Ga0466958_0020069 | |||
| 1973 | Ga0466958_0085058 | |||
| 1974 | Ga0466958_0092512 | |||
| 1975 | Ga0466958_0161536 | |||
| 1976 | Ga0466958_0191493 | |||
| 1977 | Ga0466967_0006182 | |||
| 1978 | Ga0466967_0008612 | |||
| 1979 | Ga0466967_0014509 | |||
| 1980 | Ga0466967_0016742 | |||
| 1981 | Ga0466967_0028335 | |||
| 1982 | Ga0466967_0034359 | |||
| 1983 | Ga0466967_0035140 | |||
| 1984 | Ga0466967_0045571 | |||
| 1985 | Ga0466967_0057084 | |||
| 1986 | Ga0466967_0061309 | |||
| 1987 | Ga0466967_0062554 | |||
| 1988 | Ga0466967_0063431 | |||
| 1989 | Ga0466967_0083214 | |||
| 1990 | Ga0466967_0116397 | |||
| 1991 | Ga0466967_0122681 | |||
| 1992 | Ga0466967_0133638 | |||
| 1993 | Ga0466967_0151088 | |||
| 1994 | Ga0466967_0172763 | |||
| 1995 | Ga0466967_0176333 | |||
| 1996 | Ga0466967_0317810 | |||
| 1997 | Ga0466967_0324464 | |||
| 1998 | Ga0466967_0326028 | |||
| 1999 | Ga0466967_0438439 | |||
| 2000 | Ga0466967_0513968 | |||
| 2001 | Ga0466967_0557468 | |||
| 2002 | Ga0495592_0001047 | |||
| 2003 | Ga0495592_0129070 | |||
| 2004 | Ga0495592_0287037 | |||
| 2005 | Ga0495603_0002533 | |||
| 2006 | Ga0495603_0071520 | |||
| 2007 | Ga0495603_0233866 | |||
| 2008 | Ga0495629_0074536 | |||
| 2009 | Ga0495629_0117139 | |||
| 2010 | Ga0495629_0240813 | |||
| 2011 | Ga0495641_0015369 | |||
| 2012 | Ga0495641_0027317 | |||
| 2013 | Ga0495641_0108039 | |||
| 2014 | Ga0495641_0233079 | |||
| 2015 | Ga0495651_0072906 | |||
| 2016 | Ga0495651_0101131 | |||
| 2017 | Ga0495653_0041210 | |||
| 2018 | Ga0495653_0044446 | |||
| 2019 | Ga0495653_0251323 | |||
| 2020 | Ga0495653_0282672 | |||
| 2021 | Ga0495580_0364736 | |||
| 2022 | Ga0495580_0816732 | |||
| 2023 | Ga0495582_0006869 | |||
| 2024 | Ga0495582_0063961 | |||
| 2025 | Ga0495582_0096284 | |||
| 2026 | Ga0495582_0124150 | |||
| 2027 | Ga0495582_0241402 | |||
| 2028 | Ga0495582_0561372 | |||
| 2029 | Ga0495605_0081882 | |||
| 2030 | Ga0495605_0088762 | |||
| 2031 | Ga0495639_0000877 | |||
| 2032 | Ga0495639_0006207 | |||
| 2033 | Ga0495639_0466887 | |||
| 2034 | Ga0495662_0009854 | |||
| 2035 | Ga0495662_0030505 | |||
| 2036 | Ga0495664_0030024 | |||
| 2037 | Ga0495664_0093337 | |||
| 2038 | Ga0495584_0014522 | |||
| 2039 | Ga0495584_0022200 | |||
| 2040 | Ga0495585_0103556 | |||
| 2041 | Ga0495594_0002098 | |||
| 2042 | Ga0495594_0423919 | |||
| 2043 | Ga0495596_0072140 | |||
| 2044 | Ga0495596_0309522 | |||
| 2045 | Ga0495607_0044751 | |||
| 2046 | Ga0495608_0366157 | |||
| 2047 | Ga0495608_0422469 | |||
| 2048 | Ga0495608_0945563 | |||
| 2049 | Ga0495618_0113340 | |||
| 2050 | Ga0495618_0135170 | |||
| 2051 | Ga0495628_0004790 | |||
| 2052 | Ga0495628_0186999 | |||
| 2053 | Ga0495628_0246291 | |||
| 2054 | Ga0495628_0368726 | |||
| 2055 | Ga0495630_0003203 | |||
| 2056 | Ga0495630_0051348 | |||
| 2057 | Ga0495630_0074378 | |||
| 2058 | Ga0495630_0123725 | |||
| 2059 | Ga0495631_0152154 | |||
| 2060 | Ga0495637_0105742 | |||
| 2061 | Ga0495644_0009530 | |||
| 2062 | Ga0495644_0082940 | |||
| 2063 | Ga0495644_0349382 | |||
| 2064 | Ga0495644_0369561 | |||
| 2065 | Ga0495666_0000867 | |||
| 2066 | Ga0495666_0179235 | |||
| 2067 | Ga0495666_0364333 | |||
| 2068 | Ga0495642_0312683 | |||
| 2069 | Ga0495652_0029275 | |||
| 2070 | Ga0495652_0065759 | |||
| 2071 | Ga0495652_0084337 | |||
| 2072 | Ga0495652_0353232 | |||
| 2073 | Ga0495665_0019091 | |||
| 2074 | Ga0495665_0033238 | |||
| 2075 | Ga0495665_0424895 | |||
| 2076 | Ga0495640_0004109 | |||
| 2077 | Ga0495640_0082573 | |||
| 2078 | Ga0495640_0115901 | |||
| 2079 | Ga0495640_0396743 | |||
| 2080 | Ga0495640_0731717 | |||
| 2081 | Ga0495586_0010965 | |||
| 2082 | Ga0495586_0055339 | |||
| 2083 | Ga0495586_0447187 | |||
| 2084 | Ga0495587_0069988 | |||
| 2085 | Ga0495587_0678216 | |||
| 2086 | Ga0495609_0031795 | |||
| 2087 | Ga0495609_0106559 | |||
| 2088 | Ga0495621_0171644 | |||
| 2089 | Ga0495645_0078317 | |||
| 2090 | Ga0495645_0141264 | |||
| 2091 | Ga0495622_0089452 | |||
| 2092 | Ga0495667_0002076 | |||
| 2093 | Ga0495667_0043857 | |||
| 2094 | Ga0495667_0062620 | |||
| 2095 | Ga0495667_0146747 | |||
| 2096 | Ga0495667_0335516 | |||
| 2097 | Ga0495667_0385354 | |||
| 2098 | Ga0495656_0043675 | |||
| 2099 | Ga0495656_0194110 | |||
| 2100 | Ga0495656_0424036 | |||
| 2101 | Ga0495656_0472058 | |||
| 2102 | Ga0495634_0035965 | |||
| 2103 | Ga0495634_0190810 | |||
| 2104 | Ga0495634_0239921 | |||
| 2105 | Ga0495635_0025222 | |||
| 2106 | Ga0495635_0036622 | |||
| 2107 | Ga0495635_0083039 | |||
| 2108 | Ga0495635_0112181 | |||
| 2109 | Ga0495635_0132377 | |||
| 2110 | Ga0495659_0100369 | |||
| 2111 | Ga0495661_0247731 | |||
| 2112 | Ga0495661_0277446 | |||
| 2113 | Ga0495588_0037931 | |||
| 2114 | Ga0495657_0088334 | |||
| 2115 | Ga0495657_0207979 | |||
| 2116 | Ga0495657_0261536 | |||
| 2117 | Ga0495599_0074553 | |||
| 2118 | Ga0495599_0162116 | |||
| 2119 | Ga0495623_0045462 | |||
| 2120 | Ga0495623_0378008 | |||
| 2121 | Ga0495646_0050909 | |||
| 2122 | Ga0495646_0059593 | |||
| 2123 | Ga0495646_0078057 | |||
| 2124 | Ga0495647_0005813 | |||
| 2125 | Ga0495647_0104038 | |||
| 2126 | Ga0495647_0249509 | |||
| 2127 | Ga0495658_0009961 | |||
| 2128 | Ga0495658_0029687 | |||
| 2129 | Ga0495658_0061758 | |||
| 2130 | Ga0495658_0079339 | |||
| 2131 | Ga0495658_0163125 | |||
| 2132 | Ga0495658_0360976 | |||
| 2133 | Ga0495613_0002918 | |||
| 2134 | Ga0495613_0084540 | |||
| 2135 | Ga0495613_0088452 | |||
| 2136 | Ga0495613_0115405 | |||
| 2137 | Ga0495613_0217534 | |||
| 2138 | Ga0495613_0248891 | |||
| 2139 | Ga0495624_0002334 | |||
| 2140 | Ga0495624_0016274 | |||
| 2141 | Ga0495624_0192245 | |||
| 2142 | Ga0495624_0522156 | |||
| 2143 | Ga0495589_0114626 | |||
| 2144 | Ga0495600_0071080 | |||
| 2145 | Ga0495600_0088670 | |||
| 2146 | Ga0495600_0363640 | |||
| 2147 | Ga0495581_0010204 | |||
| 2148 | Ga0495581_0059738 | |||
| 2149 | Ga0495581_0069837 | |||
| 2150 | Ga0495581_0104785 | |||
| 2151 | Ga0495581_0436445 | |||
| 2152 | Ga0495604_0069150 | |||
| 2153 | Ga0495636_0033221 | |||
| 2154 | Ga0495636_0139826 | |||
| 2155 | Ga0495636_0199105 | |||
| 2156 | Ga0495674_0057496 | |||
| 2157 | Ga0495674_0198639 | |||
| 2158 | Ga0495674_0321001 | |||
| 2159 | Ga0495674_0364173 | |||
| 2160 | Ga0495674_0546456 | |||
| 2161 | Ga0495676_0023828 | |||
| 2162 | Ga0495676_0028473 | |||
| 2163 | Ga0495676_0106124 | |||
| 2164 | Ga0495676_0159285 | |||
| 2165 | Ga0495676_0693272 | |||
| 2166 | Ga0495680_0062558 | |||
| 2167 | Ga0495675_0211176 | |||
| 2168 | Ga0495677_0048266 | |||
| 2169 | Ga0495677_0120451 | |||
| 2170 | Ga0495685_172602 | |||
| 2171 | Ga0495684_0029560 | |||
| 2172 | Ga0495684_0041333 | |||
| 2173 | Ga0495684_0410742 | |||
| 2174 | Ga0495593_0046814 | |||
| 2175 | Ga0495602_0032377 | |||
| 2176 | Ga0495602_0050380 | |||
| 2177 | Ga0495602_0393103 | |||
| 2178 | Ga0495614_0010382 | |||
| 2179 | Ga0495614_0131177 | |||
| 2180 | Ga0495614_0181237 | |||
| 2181 | Ga0495614_0246782 | |||
| 2182 | Ga0495626_0429544 | |||
| 2183 | Ga0496100_0017841 | |||
| 2184 | Ga0496100_0050640 | |||
| 2185 | Ga0496100_0266646 | |||
| 2186 | Ga0496100_0313550 | |||
| 2187 | Ga0496100_0490154 | |||
| 2188 | Ga0496100_0640480 | |||
| 2189 | Ga0496100_0793961 | |||
| 2190 | Ga0496101_0127120 | |||
| 2191 | Ga0496101_0151615 | |||
| 2192 | Ga0496101_0153102 | |||
| 2193 | Ga0496101_0232186 | |||
| 2194 | Ga0496102_0003780 | |||
| 2195 | Ga0496102_0045690 | |||
| 2196 | Ga0496102_0075999 | |||
| 2197 | Ga0496102_0145423 | |||
| 2198 | Ga0496102_0180186 | |||
| 2199 | Ga0496102_0365130 | |||
| 2200 | Ga0496103_0005252 | |||
| 2201 | Ga0496103_0005964 | |||
| 2202 | Ga0496103_0006783 | |||
| 2203 | Ga0496103_0011753 | |||
| 2204 | Ga0496103_0025899 | |||
| 2205 | Ga0496103_0096859 | |||
| 2206 | Ga0496103_0180692 | |||
| 2207 | Ga0496104_0008696 | |||
| 2208 | Ga0496104_0017204 | |||
| 2209 | Ga0496104_0056716 | |||
| 2210 | Ga0496104_0250604 | |||
| 2211 | Ga0496104_0329163 | |||
| 2212 | Ga0496104_0498756 | |||
| 2213 | Ga0496104_0993542 | |||
| 2214 | Ga0496104_1169422 | |||
| 2215 | Ga0496105_0000774 | |||
| 2216 | Ga0496105_0044361 | |||
| 2217 | Ga0496105_0060312 | |||
| 2218 | Ga0496105_0069810 | |||
| 2219 | Ga0496105_0145712 | |||
| 2220 | Ga0496105_0151850 | |||
| 2221 | Ga0496105_0161934 | |||
| 2222 | Ga0496105_0888539 | |||
| 2223 | Ga0496106_0013297 | |||
| 2224 | Ga0496106_0022161 | |||
| 2225 | Ga0496106_0087181 | |||
| 2226 | Ga0496106_0296226 | |||
| 2227 | Ga0496106_0456448 | |||
| 2228 | Ga0496106_0495979 | |||
| 2229 | Ga0496106_1202343 | |||
| 2230 | Ga0496107_0047235 | |||
| 2231 | Ga0496107_0055251 | |||
| 2232 | Ga0496107_0059682 | |||
| 2233 | Ga0496107_0191159 | |||
| 2234 | Ga0496107_0695377 | |||
| 2235 | Ga0496108_0006605 | |||
| 2236 | Ga0496108_0012735 | |||
| 2237 | Ga0496108_0020741 | |||
| 2238 | Ga0496108_0233016 | |||
| 2239 | Ga0496108_0313846 | |||
| 2240 | Ga0496108_0316935 | |||
| 2241 | Ga0496108_1219788 | |||
| 2242 | Ga0496109_0001185 | |||
| 2243 | Ga0496109_0010434 | |||
| 2244 | Ga0496109_0037853 | |||
| 2245 | Ga0496109_0059987 | |||
| 2246 | Ga0496109_0064459 | |||
| 2247 | Ga0496109_0129561 | |||
| 2248 | Ga0496109_0165862 | |||
| 2249 | Ga0496109_0271725 | |||
| 2250 | Ga0496109_0327860 | |||
| 2251 | Ga0496109_0336585 | |||
| 2252 | Ga0496109_0690118 | |||
| 2253 | Ga0496109_0775652 | |||
| 2254 | Ga0496109_1242363 | |||
| 2255 | Ga0496110_0001930 | |||
| 2256 | Ga0496110_0061900 | |||
| 2257 | Ga0496110_0079920 | |||
| 2258 | Ga0496110_0084393 | |||
| 2259 | Ga0496110_0122957 | |||
| 2260 | Ga0496110_0865903 | |||
| 2261 | Ga0496111_0013131 | |||
| 2262 | Ga0496111_0016941 | |||
| 2263 | Ga0496111_0025491 | |||
| 2264 | Ga0496111_0029739 | |||
| 2265 | Ga0496111_0379440 | |||
| 2266 | Ga0496111_0385835 | |||
| 2267 | Ga0496111_0532181 | |||
| 2268 | Ga0496111_0597097 | |||
| 2269 | Ga0496112_0001626 | |||
| 2270 | Ga0496112_0010813 | |||
| 2271 | Ga0496112_0022196 | |||
| 2272 | Ga0496112_0026094 | |||
| 2273 | Ga0496112_0063900 | |||
| 2274 | Ga0496112_0232221 | |||
| 2275 | Ga0496112_0295395 | |||
| 2276 | Ga0496112_0590599 | |||
| 2277 | Ga0496112_1271487 | |||
| 2278 | Ga0496113_0000174 | |||
| 2279 | Ga0496113_0029988 | |||
| 2280 | Ga0496113_0161588 | |||
| 2281 | Ga0496113_0234408 | |||
| 2282 | Ga0496113_0356266 | |||
| 2283 | Ga0496113_0621746 | |||
| 2284 | Ga0496113_0732505 | |||
| 2285 | Ga0496113_0807908 | |||
| 2286 | Ga0496113_1089824 | |||
| 2287 | Ga0496114_0018406 | |||
| 2288 | Ga0496114_0019355 | |||
| 2289 | Ga0496114_0051967 | |||
| 2290 | Ga0496114_0103198 | |||
| 2291 | Ga0496114_0288937 | |||
| 2292 | Ga0496114_0373262 | |||
| 2293 | Ga0496114_0762099 | |||
| 2294 | Ga0496115_0020362 | |||
| 2295 | Ga0496115_0036936 | |||
| 2296 | Ga0496115_0037849 | |||
| 2297 | Ga0496115_0097812 | |||
| 2298 | Ga0496115_0196047 | |||
| 2299 | Ga0496115_0646164 | |||
| 2300 | Ga0501031_0049719 | |||
| 2301 | Ga0501033_0035501 | |||
| 2302 | Ga0501036_0014593 | |||
| 2303 | Ga0501036_0046327 | |||
| 2304 | Ga0501038_0016243 | |||
| 2305 | Ga0501039_0017007 | |||
| 2306 | Ga0501039_0018576 | |||
| 2307 | Ga0501039_1066350 | |||
| 2308 | Ga0501040_0016148 | |||
| 2309 | Ga0501040_0020766 | |||
| 2310 | Ga0501040_0022945 | |||
| 2311 | Ga0501040_0042835 | |||
| 2312 | Ga0501041_0001170 | |||
| 2313 | Ga0501041_0071486 | |||
| 2314 | Ga0501042_0008113 | |||
| 2315 | Ga0501042_0102983 | |||
| 2316 | Ga0501042_0105050 | |||
| 2317 | Ga0501042_0115359 | |||
| 2318 | Ga0501043_0056308 | |||
| 2319 | Ga0501046_0289757 | |||
| 2320 | Ga0501048_0043273 | |||
| 2321 | Ga0501048_0060236 | |||
| 2322 | Ga0501048_0214595 | |||
| 2323 | Ga0501067_0002546 | |||
| 2324 | Ga0501067_0027507 | |||
| 2325 | Ga0501068_0057575 | |||
| 2326 | Ga0501068_0110349 | |||
| 2327 | Ga0501068_0299208 | |||
| 2328 | Ga0501069_0012316 | |||
| 2329 | Ga0501069_0021334 | |||
| 2330 | Ga0501069_0054283 | |||
| 2331 | Ga0501069_0460293 | |||
| 2332 | Ga0501069_0904664 | |||
| 2333 | Ga0501070_0142436 | |||
| 2334 | Ga0501070_0398511 | |||
| 2335 | Ga0501071_0001490 | |||
| 2336 | Ga0501071_0013539 | |||
| 2337 | Ga0501071_0097781 | |||
| 2338 | Ga0501071_0137802 | |||
| 2339 | Ga0501071_0228847 | |||
| 2340 | Ga0501071_0328973 | |||
| 2341 | Ga0501071_0432172 | |||
| 2342 | Ga0501072_0001558 | |||
| 2343 | Ga0501072_0019748 | |||
| 2344 | Ga0501072_0069243 | |||
| 2345 | Ga0501072_0087270 | |||
| 2346 | Ga0501072_0126752 | |||
| 2347 | Ga0501072_0128644 | |||
| 2348 | Ga0501072_0196721 | |||
| 2349 | Ga0501074_0009147 | |||
| 2350 | Ga0501074_0099874 | |||
| 2351 | Ga0501074_0175667 | |||
| 2352 | Ga0501074_0231555 | |||
| 2353 | Ga0501075_0023278 | |||
| 2354 | Ga0501075_0033702 | |||
| 2355 | Ga0501075_0035257 | |||
| 2356 | Ga0501075_0042288 | |||
| 2357 | Ga0501075_0056499 | |||
| 2358 | Ga0501075_0063325 | |||
| 2359 | Ga0501075_0476657 | |||
| 2360 | Ga0501076_0019912 | |||
| 2361 | Ga0501076_0035198 | |||
| 2362 | Ga0501076_0073434 | |||
| 2363 | Ga0501076_0108740 | |||
| 2364 | Ga0501077_0050824 | |||
| 2365 | Ga0501077_0073290 | |||
| 2366 | Ga0501079_0014176 | |||
| 2367 | Ga0501079_0023324 | |||
| 2368 | Ga0501079_0029148 | |||
| 2369 | Ga0501079_0034365 | |||
| 2370 | Ga0501080_0023671 | |||
| 2371 | Ga0501080_0173336 | |||
| 2372 | Ga0501080_0270094 | |||
| 2373 | Ga0501081_0062685 | |||
| 2374 | Ga0501081_0107172 | |||
| 2375 | Ga0501081_0142595 | |||
| 2376 | Ga0501081_0190495 | |||
| 2377 | Ga0501081_0307186 | |||
| 2378 | Ga0501081_0327002 | |||
| 2379 | Ga0501081_0513407 | |||
| 2380 | Ga0501083_0002636 | |||
| 2381 | Ga0501045_0003524 | |||
| 2382 | Ga0501045_0017164 | |||
| 2383 | Ga0501045_0190361 | |||
| 2384 | nmdc:mga05p37_103965_c1 | |||
| 2385 | nmdc:mga05p37_125342_c1 | |||
| 2386 | nmdc:mga05p37_20308_c1 | |||
| 2387 | nmdc:mga05p37_316820_c1 | |||
| 2388 | nmdc:mga06r32_350821_c1 | |||
| 2389 | nmdc:mga06r32_509054_c1 | |||
| 2390 | nmdc:mga06r32_71444_c1 | |||
| 2391 | nmdc:mga08y16_233788_c1 | |||
| 2392 | nmdc:mga08y16_302132_c1 | |||
| 2393 | nmdc:mga0n895_10843_c1 | |||
| 2394 | nmdc:mga0n895_1091422_c1 | |||
| 2395 | nmdc:mga0n895_113497_c1 | |||
| 2396 | nmdc:mga0n895_212455_c1 | |||
| 2397 | nmdc:mga0n895_644451_c1 | |||
| 2398 | nmdc:mga0n895_783874_c1 | |||
| 2399 | nmdc:mga0rr50_106172_c1 | |||
| 2400 | nmdc:mga0rr50_151098_c1 | |||
| 2401 | nmdc:mga0rr50_170371_c1 | |||
| 2402 | nmdc:mga0rr50_200196_c1 | |||
| 2403 | nmdc:mga0rr50_665421_c1 | |||
| 2404 | nmdc:mga08x19_163556_c1 | |||
| 2405 | nmdc:mga08x19_232640_c1 | |||
| 2406 | nmdc:mga0a205_23321_c1 | |||
| 2407 | nmdc:mga0a205_46526_c1 | |||
| 2408 | Ga0495601_0015514 | |||
| 2409 | Ga0495601_0025347 | |||
| 2410 | Ga0495601_0056965 | |||
| 2411 | Ga0495601_0142240 | |||
| 2412 | Ga0495601_0196217 | |||
| 2413 | Ga0495601_0227023 | |||
| 2414 | Ga0495601_0679254 | |||
| 2415 | Ga0495612_0024789 | |||
| 2416 | Ga0495655_0077943 | |||
| 2417 | Ga0495655_0143051 | |||
| 2418 | Ga0495595_0019057 | |||
| 2419 | Ga0495595_0225004 | |||
| 2420 | Ga0495595_0290693 | |||
| 2421 | Ga0495595_0291375 | |||
| 2422 | Ga0495619_0007030 | |||
| 2423 | Ga0495619_0021703 | |||
| 2424 | Ga0495619_0025564 | |||
| 2425 | Ga0495619_0119289 | |||
| 2426 | Ga0495619_0329682 | |||
| 2427 | Ga0500566_0111911 | |||
| 2428 | Ga0501084_0009197 | |||
| 2429 | Ga0501084_0014265 | |||
| 2430 | Ga0501084_0023755 | |||
| 2431 | Ga0501084_0283473 | |||
| 2432 | Ga0501084_0377726 | |||
| 2433 | Ga0587083_0140200 | |||
| 2434 | Ga0501082_0009108 | |||
| 2435 | Ga0501082_0015420 | |||
| 2436 | Ga0501082_0976506 | |||
| 2437 | Ga0466962_0002011 | |||
| 2438 | Ga0466962_0003932 | |||
| 2439 | Ga0466962_0106029 | |||
| 2440 | Ga0466962_0346922 | |||
| 2441 | Ga0530510_0001882 | |||
| 2442 | Ga0530510_0012536 | |||
| 2443 | Ga0530510_0018981 | |||
| 2444 | Ga0530510_0020943 | |||
| 2445 | Ga0530510_0037429 | |||
| 2446 | Ga0530510_0514562 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tpm-assembly2.cif.gz_D | 2.8 angstrom crystal structure of the c-terminal dimerization domain of transcriptional regulator pdhr from escherichia coli. | 0.8547 | 14 | 43 |
| 3kkg-assembly1.cif.gz_A-2 | crystal structure of putative snoal-like polyketide cyclase (yp_509242.1) from jannaschia sp. ccs1 at 1.40 a resolution | 0.8494 | 12 | 143 |
| 3ehc-assembly1.cif.gz_A | crystal structure of a snoal-like polyketide cyclase (atu3018) from agrobacterium tumefaciens str. c58 at 2.12 a resolution | 0.8486 | 22 | 143 |
| 5tpm-assembly2.cif.gz_C | 2.8 angstrom crystal structure of the c-terminal dimerization domain of transcriptional regulator pdhr from escherichia coli. | 0.8461 | 14 | 43 |
| 3fgy-assembly1.cif.gz_B | crystal structure of a ntf2-like protein (bxe_b1094) from burkholderia xenovorans lb400 at 1.59 a resolution | 0.8454 | 20 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ACM2_81_217_1.20.120.530 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);GntR ligand-binding domain-like | 0.8864 | 14 | 43 | 1.20.120.530 |
| af_Q6TMK2_24_122_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8738 | 45 | 143 | 3.10.450.50 |
| af_Q6ID84_103_213_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8592 | 43 | 137 | 3.10.450.50 |
| 5tpmB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);GntR ligand-binding domain-like | 0.8527 | 14 | 43 | 1.20.120.530 |
| 3ehcA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8497 | 22 | 143 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538LJZ4-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9999 | 1 | 151 |
GO:0030638
|
| AF-A0A7Z9M6L7-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9982 | 5 | 143 |
GO:0030638
|
| AF-A0A7Z9N6J8-F1-model_v4 | Nuclear transport factor 2 family protein | 0.998 | 5 | 143 |
GO:0030638
|
| AF-A0A382IAU1-F1-model_v4 | SnoaL-like domain-containing protein | 0.9964 | 5 | 139 |
GO:0030638
|
| AF-A0A381VF20-F1-model_v4 | SnoaL-like domain-containing protein | 0.9953 | 1 | 143 |
GO:0030638
|