F491888

General Info

Members Datasets Scaffolds Average Seq Length
1223 381 2446 152

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0517701|Ga0496103_0517701_110_550
Length 146
Sequence MSDVRELIRREPSQDEHDAIRELWKRHSVAEDNRDLPGLLATLTDDCVYELVQTGHRWEGHEGAARFYGGLLGSFPLSGIVIGPQGVCEEADVTGTHEAEWLGVPPTGERLAWQVTIFFPWDRERRLFTGERVYTAGLPLPQTLAG

Samples

Sample ID Description Type Environment
1 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
177 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
188 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
202 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
203 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
228 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
229 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
230 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
231 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
232 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
233 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
237 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
238 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
239 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
240 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
241 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
270 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
271 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
272 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
279 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
280 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
281 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
282 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
289 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
294 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
317 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
318 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
319 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
320 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
321 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
322 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
350 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
351 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
354 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
355 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
356 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
357 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
358 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
362 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
368 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
369 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
373 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
374 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
380 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
381 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 9.98
Rhizosphere 89.21
Stem 0
Stem Tuber 0
Unclassified 17.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496103_0517701 3300048906 Unclassified 763
2 rootH1_10246936 3300003323 Bacteria 1671
3 JGI25407J50210_10000450 3300003373 Bacteria 8109
4 Ga0070658_10009482 3300005327 Archaea 7822
5 Ga0070658_10046978 3300005327 Bacteria 3493
6 Ga0070658_10073197 3300005327 Bacteria 2809
7 Ga0070658_10225309 3300005327 Bacteria 1586
8 Ga0070658_10838237 3300005327 Bacteria 799
9 Ga0070683_100028510 3300005329 Bacteria 5046
10 Ga0070683_100087423 3300005329 Bacteria 2923
11 Ga0070683_100254650 3300005329 Bacteria 1670
12 Ga0070683_100805009 3300005329 Unclassified 901
13 Ga0070690_100007766 3300005330 Bacteria 6148
14 Ga0070690_100060869 3300005330 Bacteria 2431
15 Ga0070666_10096419 3300005335 Bacteria 2036
16 Ga0070680_100025767 3300005336 Bacteria 4701
17 Ga0070680_100029925 3300005336 Bacteria 4372
18 Ga0070680_100033727 3300005336 Bacteria 4128
19 Ga0070680_100162730 3300005336 Bacteria 1875
20 Ga0070680_100184861 3300005336 Bacteria 1755
21 Ga0070680_100277812 3300005336 Bacteria 1419
22 Ga0070682_100034271 3300005337 Bacteria 3091
23 Ga0070682_100063207 3300005337 Archaea 2346
24 Ga0070682_100722823 3300005337 Bacteria 801
25 Ga0070682_100895444 3300005337 Unclassified 729
26 Ga0070682_101090374 3300005337 Bacteria 668
27 Ga0068868_100032026 3300005338 Bacteria 4042
28 Ga0068868_100791820 3300005338 Bacteria 855
29 Ga0070660_100007999 3300005339 Bacteria 7385
30 Ga0070660_100029085 3300005339 Unclassified 4138
31 Ga0070660_100030204 3300005339 Bacteria 4064
32 Ga0070660_100042015 3300005339 Bacteria 3488
33 Ga0070660_100044339 3300005339 Bacteria 3401
34 Ga0070691_10034801 3300005341 Bacteria 2371
35 Ga0070691_10121600 3300005341 Bacteria 1315
36 Ga0070691_10145266 3300005341 Bacteria 1212
37 Ga0070687_100359597 3300005343 Bacteria 942
38 Ga0070687_100458759 3300005343 Unclassified 849
39 Ga0070661_100028012 3300005344 Bacteria 4061
40 Ga0070661_101447066 3300005344 Bacteria 579
41 Ga0070692_10545659 3300005345 Bacteria 759
42 Ga0070668_100038323 3300005347 Bacteria 3663
43 Ga0070668_100715657 3300005347 Bacteria 884
44 Ga0070669_100847835 3300005353 Bacteria 778
45 Ga0070671_100095763 3300005355 Bacteria 2488
46 Ga0070671_100200912 3300005355 Unclassified 1690
47 Ga0070671_100548595 3300005355 Unclassified 997
48 Ga0070671_101019235 3300005355 Bacteria 726
49 Ga0070671_101168013 3300005355 Unclassified 677
50 Ga0070674_100505210 3300005356 Bacteria 1007
51 Ga0070673_100284632 3300005364 Unclassified 1451
52 Ga0070673_101636740 3300005364 Bacteria 609
53 Ga0070688_100169032 3300005365 Bacteria 1507
54 Ga0070659_100185861 3300005366 Bacteria 1707
55 Ga0070659_100217393 3300005366 Bacteria 1576
56 Ga0070659_100233407 3300005366 Bacteria 1520
57 Ga0070659_100729072 3300005366 Bacteria 859
58 Ga0070703_10171684 3300005406 Bacteria 831
59 Ga0070703_10497386 3300005406 Unclassified 548
60 Ga0070709_10006002 3300005434 Bacteria 6602
61 Ga0070709_10013639 3300005434 Bacteria 4574
62 Ga0070709_10151008 3300005434 Bacteria 1606
63 Ga0070709_10244384 3300005434 Bacteria 1290
64 Ga0070709_10989563 3300005434 Unclassified 668
65 Ga0070714_100003425 3300005435 Bacteria 11813
66 Ga0070714_100009659 3300005435 Bacteria 7596
67 Ga0070714_100017036 3300005435 Bacteria 5881
68 Ga0070714_100032067 3300005435 Bacteria 4386
69 Ga0070714_100144675 3300005435 Unclassified 2137
70 Ga0070714_100220243 3300005435 Unclassified 1744
71 Ga0070713_100047947 3300005436 Bacteria 3514
72 Ga0070713_100080400 3300005436 Bacteria 2779
73 Ga0070713_100211383 3300005436 Bacteria 1756
74 Ga0070713_100298512 3300005436 Unclassified 1482
75 Ga0070713_100539512 3300005436 Bacteria 1104
76 Ga0070713_100732940 3300005436 Unclassified 945
77 Ga0070710_10000870 3300005437 Bacteria 14441
78 Ga0070710_10026521 3300005437 Bacteria 3079
79 Ga0070710_10118983 3300005437 Bacteria 1596
80 Ga0070710_10295280 3300005437 Bacteria 1056
81 Ga0070710_10488251 3300005437 Bacteria 841
82 Ga0070710_10681804 3300005437 Unclassified 723
83 Ga0070711_100012846 3300005439 Bacteria 5244
84 Ga0070711_100070548 3300005439 Unclassified 2460
85 Ga0070711_100894423 3300005439 Bacteria 757
86 Ga0070705_100015077 3300005440 Bacteria 3988
87 Ga0070705_100017215 3300005440 Bacteria 3769
88 Ga0070705_100382139 3300005440 Bacteria 1037
89 Ga0070705_101374479 3300005440 Bacteria 588
90 Ga0070700_100008900 3300005441 Bacteria 5489
91 Ga0070700_100735079 3300005441 Bacteria 788
92 Ga0070694_100014241 3300005444 Bacteria 4977
93 Ga0070694_100032741 3300005444 Bacteria 3415
94 Ga0070694_100360896 3300005444 Bacteria 1128
95 Ga0070694_100947250 3300005444 Bacteria 713
96 Ga0070694_101294966 3300005444 Bacteria 613
97 Ga0070708_100149636 3300005445 Bacteria 2170
98 Ga0070708_100400282 3300005445 Bacteria 1295
99 Ga0070663_100067238 3300005455 Bacteria 2599
100 Ga0070678_100297783 3300005456 Bacteria 1370
101 Ga0070678_100306880 3300005456 Bacteria 1350
102 Ga0070678_100389711 3300005456 Bacteria 1207
103 Ga0070662_100086743 3300005457 Bacteria 2341
104 Ga0070681_10049353 3300005458 Bacteria 4203
105 Ga0070681_10061907 3300005458 Bacteria 3716
106 Ga0070681_10145778 3300005458 Bacteria 2296
107 Ga0070681_10238657 3300005458 Bacteria 1731
108 Ga0070681_10267786 3300005458 Unclassified 1620
109 Ga0070681_10540684 3300005458 Bacteria 1079
110 Ga0068867_100000419 3300005459 Bacteria 28327
111 Ga0068867_100052443 3300005459 Bacteria 3010
112 Ga0068867_100217449 3300005459 Bacteria 1538
113 Ga0070685_10004312 3300005466 Bacteria 7180
114 Ga0070706_100096353 3300005467 Bacteria 2747
115 Ga0070706_100349073 3300005467 Bacteria 1379
116 Ga0070706_100838949 3300005467 Bacteria 850
117 Ga0070707_100002503 3300005468 Bacteria 17504
118 Ga0070707_100112015 3300005468 Bacteria 2647
119 Ga0070707_100166816 3300005468 Bacteria 2146
120 Ga0070707_100515497 3300005468 Unclassified 1158
121 Ga0070707_100693653 3300005468 Bacteria 981
122 Ga0070698_100108665 3300005471 Bacteria 2740
123 Ga0070698_100215687 3300005471 Bacteria 1853
124 Ga0070698_100292606 3300005471 Unclassified 1560
125 Ga0070699_100032717 3300005518 Bacteria 4491
126 Ga0070699_100619915 3300005518 Bacteria 987
127 Ga0070679_100014066 3300005530 Bacteria 7675
128 Ga0070679_100064501 3300005530 Bacteria 3651
129 Ga0070679_100077476 3300005530 Bacteria 3313
130 Ga0070679_100174102 3300005530 Bacteria 2125
131 Ga0070679_100259808 3300005530 Bacteria 1692
132 Ga0070679_100657631 3300005530 Bacteria 990
133 Ga0070679_100701175 3300005530 Bacteria 955
134 Ga0070684_100075578 3300005535 Bacteria 2972
135 Ga0070684_100468029 3300005535 Bacteria 1166
136 Ga0070684_101391850 3300005535 Unclassified 661
137 Ga0070697_100059513 3300005536 Bacteria 3111
138 Ga0068853_100171735 3300005539 Bacteria 1962
139 Ga0068853_100703705 3300005539 Bacteria 964
140 Ga0070672_100047107 3300005543 Bacteria 3344
141 Ga0070672_100135899 3300005543 Bacteria 2025
142 Ga0070686_100015245 3300005544 Bacteria 4446
143 Ga0070695_100000106 3300005545 Bacteria 36745
144 Ga0070695_100025858 3300005545 Bacteria 3627
145 Ga0070695_100030671 3300005545 Bacteria 3349
146 Ga0070695_100192294 3300005545 Bacteria 1453
147 Ga0070695_100367976 3300005545 Bacteria 1081
148 Ga0070695_100796676 3300005545 Unclassified 757
149 Ga0070696_100018911 3300005546 Bacteria 4664
150 Ga0070696_100020126 3300005546 Bacteria 4525
151 Ga0070696_100034350 3300005546 Bacteria 3488
152 Ga0070696_100138111 3300005546 Bacteria 1778
153 Ga0070696_100707171 3300005546 Unclassified 822
154 Ga0070693_100072111 3300005547 Unclassified 2037
155 Ga0070693_100154525 3300005547 Bacteria 1456
156 Ga0070693_100406346 3300005547 Bacteria 945
157 Ga0070693_100544324 3300005547 Unclassified 830
158 Ga0070665_100095756 3300005548 Bacteria 2973
159 Ga0070704_100074250 3300005549 Bacteria 2480
160 Ga0070704_100172120 3300005549 Unclassified 1723
161 Ga0070704_100248717 3300005549 Bacteria 1459
162 Ga0068855_100063144 3300005563 Bacteria 4323
163 Ga0068855_100112282 3300005563 Bacteria 3127
164 Ga0068855_100226606 3300005563 Bacteria 2094
165 Ga0068855_100286379 3300005563 Bacteria 1828
166 Ga0068855_100287692 3300005563 Bacteria 1823
167 Ga0068855_100404887 3300005563 Bacteria 1495
168 Ga0068855_100697374 3300005563 Bacteria 1087
169 Ga0068855_101211774 3300005563 Unclassified 784
170 Ga0070664_100419805 3300005564 Bacteria 1225
171 Ga0068854_100003253 3300005578 Bacteria 10118
172 Ga0068856_100012137 3300005614 Bacteria 8344
173 Ga0068856_100040457 3300005614 Bacteria 4579
174 Ga0068856_100282786 3300005614 Bacteria 1675
175 Ga0068856_100582698 3300005614 Bacteria 1140
176 Ga0068856_100725971 3300005614 Bacteria 1014
177 Ga0070702_100005126 3300005615 Bacteria 6063
178 Ga0070702_100023594 3300005615 Bacteria 3271
179 Ga0070702_100025724 3300005615 Bacteria 3156
180 Ga0070702_100637980 3300005615 Unclassified 804
181 Ga0070702_100694454 3300005615 Bacteria 775
182 Ga0068852_100117475 3300005616 Bacteria 2429
183 Ga0068852_100328691 3300005616 Bacteria 1487
184 Ga0068852_101251207 3300005616 Unclassified 764
185 Ga0068852_101356203 3300005616 Archaea 733
186 Ga0068864_100205746 3300005618 Bacteria 1810
187 Ga0068866_10088459 3300005718 Bacteria 1681
188 Ga0068861_100018620 3300005719 Bacteria 4948
189 Ga0068861_100195048 3300005719 Bacteria 1696
190 Ga0068861_100274732 3300005719 Bacteria 1448
191 Ga0068860_100922051 3300005843 Bacteria 890
192 Ga0068860_101010881 3300005843 Bacteria 849
193 Ga0081455_10003816 3300005937 Bacteria 17194
194 Ga0081455_10005873 3300005937 Bacteria 13339
195 Ga0081538_10000435 3300005981 Bacteria 47048
196 Ga0081538_10003328 3300005981 Bacteria 15223
197 Ga0081538_10028156 3300005981 Bacteria 3873
198 Ga0081540_1007276 3300005983 Bacteria 7926
199 Ga0081539_10001011 3300005985 Bacteria 51860
200 Ga0070717_10003099 3300006028 Bacteria 11855
201 Ga0070717_10024528 3300006028 Bacteria 4790
202 Ga0070717_10032359 3300006028 Bacteria 4213
203 Ga0070717_10089097 3300006028 Bacteria 2602
204 Ga0070717_10166381 3300006028 Bacteria 1915
205 Ga0070717_10347458 3300006028 Unclassified 1325
206 Ga0070717_10349413 3300006028 Bacteria 1322
207 Ga0070715_10005681 3300006163 Bacteria 4182
208 Ga0070716_100029384 3300006173 Bacteria 2971
209 Ga0070716_100133139 3300006173 Bacteria 1574
210 Ga0070716_100146287 3300006173 Bacteria 1514
211 Ga0070716_100271460 3300006173 Bacteria 1166
212 Ga0070716_100638413 3300006173 Bacteria 806
213 Ga0070712_100169359 3300006175 Bacteria 1693
214 Ga0070712_100900959 3300006175 Unclassified 762
215 Ga0070712_101008213 3300006175 Unclassified 721
216 Ga0075367_10280865 3300006178 Unclassified 1047
217 Ga0097621_100021600 3300006237 Bacteria 4983
218 Ga0097621_100516143 3300006237 Bacteria 1084
219 Ga0097621_101104542 3300006237 Bacteria 744
220 Ga0068871_100027740 3300006358 Bacteria 4431
221 Ga0068871_100052886 3300006358 Bacteria 3290
222 Ga0068871_100218867 3300006358 Unclassified 1649
223 Ga0075428_100151134 3300006844 Bacteria 2522
224 Ga0075431_100096728 3300006847 Unclassified 3048
225 Ga0075431_101948996 3300006847 Unclassified 543
226 Ga0075434_100012215 3300006871 Bacteria 8137
227 Ga0075434_100138379 3300006871 Bacteria 2454
228 Ga0075434_100508946 3300006871 Unclassified 1225
229 Ga0075434_101179843 3300006871 Bacteria 778
230 Ga0068865_100000269 3300006881 Bacteria 28461
231 Ga0068865_100026125 3300006881 Bacteria 3847
232 Ga0075436_100006756 3300006914 Bacteria 7851
233 Ga0075436_100118450 3300006914 Bacteria 1851
234 Ga0075435_100002731 3300007076 Bacteria 11784
235 Ga0075435_100361361 3300007076 Bacteria 1245
236 Ga0105240_10014499 3300009093 Bacteria 10761
237 Ga0105240_10187008 3300009093 Bacteria 2439
238 Ga0105240_11071385 3300009093 Unclassified 859
239 Ga0105240_11206088 3300009093 Unclassified 801
240 Ga0105240_11492467 3300009093 Bacteria 709
241 Ga0105240_11670351 3300009093 Unclassified 665
242 Ga0105240_11887323 3300009093 Bacteria 622
243 Ga0111539_10033139 3300009094 Bacteria 6272
244 Ga0111539_10460153 3300009094 Unclassified 1481
245 Ga0105245_10016809 3300009098 Bacteria 6388
246 Ga0105245_10129749 3300009098 Bacteria 2364
247 Ga0105245_10154293 3300009098 Bacteria 2174
248 Ga0105245_10163519 3300009098 Bacteria 2114
249 Ga0105245_10229543 3300009098 Bacteria 1795
250 Ga0105245_10708423 3300009098 Unclassified 1040
251 Ga0105247_10657317 3300009101 Unclassified 784
252 Ga0114129_10041196 3300009147 Bacteria 6509
253 Ga0114129_10536596 3300009147 Bacteria 1523
254 Ga0105243_10054426 3300009148 Bacteria 3177
255 Ga0105243_10075428 3300009148 Archaea 2737
256 Ga0105241_10036307 3300009174 Bacteria 3708
257 Ga0105241_10166633 3300009174 Bacteria 1816
258 Ga0105241_11696115 3300009174 Unclassified 614
259 Ga0105241_12623849 3300009174 Unclassified 506
260 Ga0105242_10056023 3300009176 Bacteria 3225
261 Ga0105242_10080040 3300009176 Bacteria 2730
262 Ga0105242_10989247 3300009176 Unclassified 848
263 Ga0105248_10012557 3300009177 Bacteria 9343
264 Ga0105248_10192131 3300009177 Bacteria 2300
265 Ga0105248_10224775 3300009177 Bacteria 2113
266 Ga0105248_10329962 3300009177 Bacteria 1718
267 Ga0105237_10068438 3300009545 Bacteria 3544
268 Ga0105237_11127563 3300009545 Unclassified 791
269 Ga0105238_10093399 3300009551 Bacteria 2996
270 Ga0105249_10003662 3300009553 Bacteria 13260
271 Ga0105249_10009480 3300009553 Bacteria 8527
272 Ga0105249_10039919 3300009553 Bacteria 4262
273 Ga0105249_10673792 3300009553 Bacteria 1093
274 Ga0105239_10035049 3300010375 Bacteria 5511
275 Ga0105239_10171509 3300010375 Unclassified 2426
276 Ga0105239_10524635 3300010375 Bacteria 1347
277 Ga0105239_10547996 3300010375 Unclassified 1317
278 Ga0105239_10753207 3300010375 Bacteria 1115
279 Ga0105239_11471691 3300010375 Bacteria 787
280 Ga0105246_10412334 3300011119 Bacteria 1125
281 Ga0105246_10599069 3300011119 Bacteria 952
282 Ga0157320_1032014 3300012481 Bacteria 535
283 Ga0157373_10325543 3300013100 Bacteria 1094
284 Ga0157373_10584281 3300013100 Bacteria 812
285 Ga0157373_11170257 3300013100 Unclassified 579
286 Ga0157371_10557486 3300013102 Bacteria 850
287 Ga0157371_11032058 3300013102 Bacteria 628
288 Ga0157371_11168824 3300013102 Unclassified 592
289 Ga0157370_10055431 3300013104 Bacteria 3776
290 Ga0157370_10073197 3300013104 Bacteria 3233
291 Ga0157370_10310199 3300013104 Bacteria 1456
292 Ga0157370_10435425 3300013104 Bacteria 1206
293 Ga0157369_10016604 3300013105 Bacteria 8277
294 Ga0157369_10067620 3300013105 Bacteria 3840
295 Ga0157369_10146300 3300013105 Bacteria 2499
296 Ga0157369_10153852 3300013105 Bacteria 2430
297 Ga0157369_10254717 3300013105 Bacteria 1831
298 Ga0157374_10005704 3300013296 Bacteria 10502
299 Ga0157374_10156083 3300013296 Bacteria 2221
300 Ga0157374_12736583 3300013296 Unclassified 521
301 Ga0157378_10039466 3300013297 Bacteria 4187
302 Ga0157378_10070463 3300013297 Bacteria 3139
303 Ga0157378_10276192 3300013297 Bacteria 1618
304 Ga0157378_10859023 3300013297 Bacteria 936
305 Ga0157378_11436529 3300013297 Bacteria 733
306 Ga0157378_11452375 3300013297 Unclassified 730
307 Ga0163162_10010825 3300013306 Bacteria 8875
308 Ga0163162_10039717 3300013306 Bacteria 4704
309 Ga0163162_10232459 3300013306 Bacteria 1974
310 Ga0157372_10020621 3300013307 Bacteria 7113
311 Ga0157372_10650332 3300013307 Bacteria 1228
312 Ga0157372_10886745 3300013307 Bacteria 1035
313 Ga0157372_11223933 3300013307 Unclassified 867
314 Ga0157372_12309997 3300013307 Unclassified 618
315 Ga0157372_12823749 3300013307 Unclassified 557
316 Ga0157372_13112230 3300013307 Unclassified 530
317 Ga0157375_10014254 3300013308 Bacteria 7085
318 Ga0157375_10065178 3300013308 Bacteria 3631
319 Ga0157375_10112408 3300013308 Bacteria 2824
320 Ga0157375_10118020 3300013308 Bacteria 2759
321 Ga0157375_10248826 3300013308 Bacteria 1938
322 Ga0157375_11098246 3300013308 Unclassified 931
323 Ga0163163_10041709 3300014325 Bacteria 4490
324 Ga0163163_10805092 3300014325 Unclassified 1003
325 Ga0157380_10063275 3300014326 Bacteria 2966
326 Ga0182008_10001839 3300014497 Bacteria 13815
327 Ga0182008_10098827 3300014497 Bacteria 1441
328 Ga0157377_10001454 3300014745 Bacteria 10244
329 Ga0157376_10065286 3300014969 Bacteria 3072
330 Ga0157376_10108444 3300014969 Bacteria 2439
331 Ga0157376_10667750 3300014969 Bacteria 1041
332 Ga0157376_12487565 3300014969 Bacteria 557
333 Ga0182007_10015583 3300015262 Bacteria 2829
334 Ga0163161_10009018 3300017792 Bacteria 6898
335 Ga0163161_10088175 3300017792 Bacteria 2293
336 Ga0197907_10709808 3300020069 Bacteria 1293
337 Ga0197907_11100010 3300020069 Unclassified 678
338 Ga0206356_10304527 3300020070 Unclassified 585
339 Ga0206356_10942522 3300020070 Bacteria 699
340 Ga0206356_11155746 3300020070 Bacteria 1324
341 Ga0206356_11607730 3300020070 Bacteria 1567
342 Ga0206356_11619724 3300020070 Bacteria 1308
343 Ga0206354_10660436 3300020081 Unclassified 811
344 Ga0206353_11569701 3300020082 Bacteria 984
345 Ga0206353_12032259 3300020082 Unclassified 778
346 Ga0213871_10005010 3300021441 Bacteria 2701
347 Ga0224712_10115863 3300022467 Bacteria 1155
348 Ga0224712_10583324 3300022467 Unclassified 545
349 Ga0207653_10015032 3300025885 Archaea 2429
350 Ga0207692_10010365 3300025898 Bacteria 3926
351 Ga0207692_10012991 3300025898 Bacteria 3598
352 Ga0207692_10022223 3300025898 Bacteria 2916
353 Ga0207692_10235605 3300025898 Unclassified 1091
354 Ga0207642_10039473 3300025899 Bacteria 2052
355 Ga0207710_10101614 3300025900 Unclassified 1356
356 Ga0207688_10158092 3300025901 Unclassified 1342
357 Ga0207647_10073751 3300025904 Bacteria 2056
358 Ga0207685_10232439 3300025905 Bacteria 883
359 Ga0207699_10054111 3300025906 Bacteria 2383
360 Ga0207699_10091693 3300025906 Bacteria 1908
361 Ga0207699_10168150 3300025906 Bacteria 1465
362 Ga0207645_10254771 3300025907 Bacteria 1162
363 Ga0207705_10074903 3300025909 Bacteria 2458
364 Ga0207705_10152230 3300025909 Bacteria 1734
365 Ga0207684_10168628 3300025910 Bacteria 1887
366 Ga0207684_10233873 3300025910 Bacteria 1585
367 Ga0207684_10458500 3300025910 Bacteria 1094
368 Ga0207684_10490080 3300025910 Bacteria 1054
369 Ga0207654_10175874 3300025911 Bacteria 1393
370 Ga0207654_10732306 3300025911 Bacteria 712
371 Ga0207707_10059555 3300025912 Bacteria 3323
372 Ga0207707_10064555 3300025912 Bacteria 3187
373 Ga0207707_10193396 3300025912 Bacteria 1774
374 Ga0207707_10608679 3300025912 Bacteria 924
375 Ga0207695_10092451 3300025913 Bacteria 3036
376 Ga0207693_10000699 3300025915 Bacteria 30109
377 Ga0207693_10001049 3300025915 Bacteria 24711
378 Ga0207693_10026878 3300025915 Bacteria 4552
379 Ga0207693_10027988 3300025915 Bacteria 4455
380 Ga0207693_10038114 3300025915 Unclassified 3786
381 Ga0207693_11163822 3300025915 Unclassified 583
382 Ga0207693_11255666 3300025915 Bacteria 556
383 Ga0207663_10011201 3300025916 Bacteria 4807
384 Ga0207663_10014821 3300025916 Bacteria 4283
385 Ga0207663_10065108 3300025916 Bacteria 2328
386 Ga0207663_10356680 3300025916 Bacteria 1108
387 Ga0207663_10635702 3300025916 Unclassified 841
388 Ga0207660_10015302 3300025917 Bacteria 5060
389 Ga0207660_10046060 3300025917 Bacteria 3076
390 Ga0207660_10289038 3300025917 Bacteria 1303
391 Ga0207660_10546929 3300025917 Bacteria 941
392 Ga0207660_10801212 3300025917 Unclassified 769
393 Ga0207660_11111121 3300025917 Bacteria 644
394 Ga0207662_10539072 3300025918 Bacteria 807
395 Ga0207662_10867222 3300025918 Unclassified 638
396 Ga0207657_10007767 3300025919 Bacteria 10952
397 Ga0207657_10015251 3300025919 Bacteria 7452
398 Ga0207657_10021691 3300025919 Bacteria 6037
399 Ga0207657_10024610 3300025919 Bacteria 5570
400 Ga0207657_10041550 3300025919 Bacteria 4066
401 Ga0207657_10110219 3300025919 Bacteria 2274
402 Ga0207649_10058557 3300025920 Bacteria 2413
403 Ga0207649_11132906 3300025920 Bacteria 618
404 Ga0207652_10032198 3300025921 Bacteria 4405
405 Ga0207652_10033399 3300025921 Bacteria 4332
406 Ga0207652_10067623 3300025921 Bacteria 3098
407 Ga0207652_10171983 3300025921 Bacteria 1944
408 Ga0207652_10261456 3300025921 Unclassified 1561
409 Ga0207652_10290124 3300025921 Bacteria 1476
410 Ga0207652_10419303 3300025921 Bacteria 1207
411 Ga0207652_10706657 3300025921 Unclassified 899
412 Ga0207646_10000502 3300025922 Bacteria 52324
413 Ga0207646_10073373 3300025922 Bacteria 3057
414 Ga0207646_10439548 3300025922 Bacteria 1177
415 Ga0207646_10792966 3300025922 Bacteria 844
416 Ga0207646_11071483 3300025922 Bacteria 710
417 Ga0207681_10041996 3300025923 Bacteria 3052
418 Ga0207694_10056009 3300025924 Bacteria 3062
419 Ga0207694_10255122 3300025924 Bacteria 1436
420 Ga0207687_10015761 3300025927 Bacteria 4960
421 Ga0207687_10245862 3300025927 Bacteria 1420
422 Ga0207700_10058384 3300025928 Bacteria 2914
423 Ga0207700_10131897 3300025928 Bacteria 2041
424 Ga0207700_10144233 3300025928 Bacteria 1960
425 Ga0207700_10192486 3300025928 Bacteria 1714
426 Ga0207700_10976191 3300025928 Bacteria 758
427 Ga0207664_10000789 3300025929 Bacteria 21390
428 Ga0207664_10028157 3300025929 Unclassified 4267
429 Ga0207664_10033946 3300025929 Bacteria 3926
430 Ga0207664_10040027 3300025929 Bacteria 3641
431 Ga0207664_10084701 3300025929 Bacteria 2586
432 Ga0207664_10313691 3300025929 Bacteria 1382
433 Ga0207664_10332147 3300025929 Bacteria 1343
434 Ga0207664_10343395 3300025929 Bacteria 1320
435 Ga0207664_10396498 3300025929 Bacteria 1227
436 Ga0207664_10549489 3300025929 Bacteria 1036
437 Ga0207644_10028140 3300025931 Bacteria 3888
438 Ga0207690_10138992 3300025932 Bacteria 1787
439 Ga0207690_10145626 3300025932 Bacteria 1751
440 Ga0207690_10151005 3300025932 Bacteria 1722
441 Ga0207690_10327095 3300025932 Bacteria 1206
442 Ga0207690_10440841 3300025932 Bacteria 1045
443 Ga0207690_10479403 3300025932 Bacteria 1004
444 Ga0207706_10021585 3300025933 Bacteria 5780
445 Ga0207686_10050201 3300025934 Bacteria 2593
446 Ga0207709_10002432 3300025935 Bacteria 11705
447 Ga0207709_10051636 3300025935 Bacteria 2521
448 Ga0207670_10191897 3300025936 Unclassified 1546
449 Ga0207669_10128579 3300025937 Bacteria 1736
450 Ga0207704_10009494 3300025938 Bacteria 4697
451 Ga0207704_10041516 3300025938 Bacteria 2699
452 Ga0207665_10004539 3300025939 Bacteria 9212
453 Ga0207665_10005937 3300025939 Bacteria 8125
454 Ga0207665_10026358 3300025939 Bacteria 3837
455 Ga0207665_10210308 3300025939 Bacteria 1421
456 Ga0207665_10591413 3300025939 Bacteria 866
457 Ga0207691_10018525 3300025940 Bacteria 6597
458 Ga0207691_10259386 3300025940 Bacteria 1498
459 Ga0207711_10346423 3300025941 Bacteria 1375
460 Ga0207711_10426129 3300025941 Bacteria 1234
461 Ga0207711_10496749 3300025941 Bacteria 1137
462 Ga0207689_10921381 3300025942 Bacteria 737
463 Ga0207661_10154301 3300025944 Bacteria 1987
464 Ga0207661_10471511 3300025944 Bacteria 1145
465 Ga0207661_10480548 3300025944 Bacteria 1134
466 Ga0207661_10928286 3300025944 Bacteria 802
467 Ga0207679_10208866 3300025945 Bacteria 1636
468 Ga0207667_10096976 3300025949 Bacteria 3043
469 Ga0207667_10258030 3300025949 Bacteria 1782
470 Ga0207667_10333440 3300025949 Bacteria 1548
471 Ga0207667_10409514 3300025949 Bacteria 1380
472 Ga0207667_10485173 3300025949 Bacteria 1254
473 Ga0207667_11588106 3300025949 Unclassified 623
474 Ga0207651_11544450 3300025960 Bacteria 598
475 Ga0207712_10020566 3300025961 Bacteria 4324
476 Ga0207712_11018156 3300025961 Unclassified 735
477 Ga0207668_10249289 3300025972 Bacteria 1441
478 Ga0207668_10251601 3300025972 Bacteria 1435
479 Ga0207640_10223653 3300025981 Bacteria 1443
480 Ga0207640_11473164 3300025981 Bacteria 611
481 Ga0207640_11517365 3300025981 Unclassified 602
482 Ga0207677_10088825 3300026023 Bacteria 2242
483 Ga0207677_10112984 3300026023 Bacteria 2027
484 Ga0207677_10117123 3300026023 Bacteria 1996
485 Ga0207639_10043044 3300026041 Bacteria 3387
486 Ga0207639_10054656 3300026041 Bacteria 3053
487 Ga0207678_10027318 3300026067 Bacteria 4977
488 Ga0207678_10042931 3300026067 Bacteria 3914
489 Ga0207678_10894260 3300026067 Bacteria 785
490 Ga0207708_10007994 3300026075 Bacteria 7836
491 Ga0207708_10010110 3300026075 Bacteria 7007
492 Ga0207708_10756472 3300026075 Bacteria 834
493 Ga0207702_10027407 3300026078 Bacteria 4731
494 Ga0207702_10051427 3300026078 Bacteria 3482
495 Ga0207702_10430533 3300026078 Unclassified 1277
496 Ga0207702_10562346 3300026078 Bacteria 1116
497 Ga0207702_10577781 3300026078 Bacteria 1101
498 Ga0207702_10718403 3300026078 Bacteria 985
499 Ga0207702_10750799 3300026078 Bacteria 963
500 Ga0207702_10812900 3300026078 Bacteria 924
501 Ga0207648_10000729 3300026089 Bacteria 36820
502 Ga0207648_10010693 3300026089 Bacteria 8673
503 Ga0207676_10178680 3300026095 Bacteria 1856
504 Ga0207675_100004302 3300026118 Bacteria 13757
505 Ga0207675_100016438 3300026118 Bacteria 6910
506 Ga0207675_100106174 3300026118 Bacteria 2648
507 Ga0207675_100186641 3300026118 Bacteria 1988
508 Ga0207683_10005318 3300026121 Bacteria 11040
509 Ga0207683_10009738 3300026121 Bacteria 8193
510 Ga0207683_10323557 3300026121 Bacteria 1413
511 Ga0207683_10404413 3300026121 Bacteria 1256
512 Ga0207698_10066000 3300026142 Bacteria 2846
513 Ga0207698_10089108 3300026142 Bacteria 2518
514 Ga0207698_10877295 3300026142 Bacteria 903
515 Ga0209966_1003416 3300027695 Bacteria 2671
516 Ga0207428_10011614 3300027907 Bacteria 7774
517 Ga0207428_10352970 3300027907 Unclassified 1082
518 Ga0265319_1004321 3300028563 Bacteria 7062
519 Ga0265334_10009422 3300028573 Bacteria 4129
520 Ga0265334_10040347 3300028573 Bacteria 1829
521 Ga0265334_10132196 3300028573 Bacteria 887
522 Ga0265318_10000065 3300028577 Bacteria 102014
523 Ga0265318_10005617 3300028577 Bacteria 5875
524 Ga0265318_10087185 3300028577 Unclassified 1150
525 Ga0265322_10009372 3300028654 Bacteria 2842
526 Ga0265338_10002456 3300028800 Bacteria 27727
527 Ga0265338_10005902 3300028800 Bacteria 15784
528 Ga0265338_10019684 3300028800 Bacteria 7143
529 Ga0265338_10078845 3300028800 Bacteria 2775
530 Ga0265338_10147697 3300028800 Bacteria 1831
531 Ga0265330_10028891 3300031235 Bacteria 2495
532 Ga0265332_10009518 3300031238 Bacteria 4336
533 Ga0265320_10082307 3300031240 Bacteria 1501
534 Ga0265320_10090639 3300031240 Bacteria 1416
535 Ga0265325_10111830 3300031241 Bacteria 1326
536 Ga0265325_10374259 3300031241 Unclassified 626
537 Ga0265329_10005149 3300031242 Bacteria 5319
538 Ga0265329_10026605 3300031242 Bacteria 1905
539 Ga0265329_10086034 3300031242 Bacteria 996
540 Ga0265340_10183375 3300031247 Unclassified 945
541 Ga0265339_10006175 3300031249 Bacteria 7893
542 Ga0265339_10220957 3300031249 Unclassified 926
543 Ga0265331_10112240 3300031250 Bacteria 1250
544 Ga0265327_10026720 3300031251 Bacteria 3337
545 Ga0265327_10036954 3300031251 Bacteria 2679
546 Ga0265327_10313381 3300031251 Unclassified 689
547 Ga0265316_10013688 3300031344 Bacteria 7195
548 Ga0265316_10328355 3300031344 Bacteria 1110
549 Ga0265316_10615264 3300031344 Bacteria 769
550 Ga0307408_101844651 3300031548 Bacteria 579
551 Ga0265313_10060039 3300031595 Bacteria 1785
552 Ga0265313_10073422 3300031595 Bacteria 1570
553 Ga0265314_10012609 3300031711 Bacteria 6881
554 Ga0265314_10101572 3300031711 Bacteria 1847
555 Ga0265314_10296245 3300031711 Bacteria 909
556 Ga0265342_10047131 3300031712 Bacteria 2588
557 Ga0265342_10068015 3300031712 Bacteria 2083
558 Ga0265342_10202343 3300031712 Unclassified 1078
559 Ga0265342_10235599 3300031712 Bacteria 981
560 Ga0265342_10528904 3300031712 Unclassified 599
561 Ga0307409_100148520 3300031995 Bacteria 2031
562 Ga0307416_100371810 3300032002 Unclassified 1456
563 Ga0307411_10369542 3300032005 Bacteria 1176
564 Ga0307415_100544082 3300032126 Bacteria 1023
565 Ga0307415_102352882 3300032126 Bacteria 523
566 Ga0373930_0013891 3300034816 Bacteria 1492
567 Ga0373926_0065166 3300035083 Bacteria 1332
568 Ga0373949_0028987 3300035090 Bacteria 1309
569 Ga0373949_0045929 3300035090 Bacteria 1087
570 Ga0373951_0146209 3300035091 Bacteria 660
571 Ga0373952_0018155 3300035092 Bacteria 1453
572 Ga0373932_0114348 3300035112 Bacteria 893
573 Ga0373932_0141006 3300035112 Bacteria 820
574 Ga0373936_0585438 3300035113 Unclassified 523
575 Ga0373939_0307337 3300035114 Bacteria 634
576 Ga0373941_0036429 3300035115 Bacteria 1496
577 Ga0373941_0115890 3300035115 Bacteria 950
578 Ga0373945_0006611 3300035116 Bacteria 3747
579 Ga0373945_0109493 3300035116 Bacteria 1089
580 Ga0373953_0291420 3300035117 Bacteria 712
581 Ga0373956_0031081 3300035119 Bacteria 2338
582 Ga0373957_0129169 3300035120 Bacteria 1028
583 Ga0373960_0003654 3300035121 Bacteria 3491
584 Ga0373943_0013168 3300035170 Bacteria 3732
585 Ga0373946_0117810 3300035171 Bacteria 1209
586 Ga0373931_0058833 3300035691 Bacteria 2065
587 Ga0373931_0582700 3300035691 Unclassified 730
588 Ga0373931_0856851 3300035691 Bacteria 609
589 Ga0373931_1071628 3300035691 Bacteria 548
590 Ga0373935_0108295 3300035692 Bacteria 1841
591 Ga0373935_0155673 3300035692 Bacteria 1554
592 Ga0373935_0356425 3300035692 Unclassified 1044
593 Ga0373935_0517514 3300035692 Bacteria 868
594 Ga0373933_0617998 3300035724 Bacteria 712
595 Ga0373947_0002361 3300035725 Bacteria 11399
596 Ga0373947_1112785 3300035725 Bacteria 538
597 Ga0373937_1077367 3300036401 Bacteria 752
598 Ga0373925_0013132 3300037068 Bacteria 5994
599 Ga0373925_0896491 3300037068 Unclassified 731
600 Ga0373925_1429370 3300037068 Bacteria 566
601 Ga0395899_0000855 3300037312 Bacteria 29149
602 Ga0395899_0003647 3300037312 Bacteria 12195
603 Ga0395899_0003808 3300037312 Bacteria 11913
604 Ga0395899_0011930 3300037312 Bacteria 6657
605 Ga0395899_0057859 3300037312 Bacteria 2860
606 Ga0395899_0066433 3300037312 Bacteria 2648
607 Ga0395899_0283048 3300037312 Archaea 1127
608 Ga0395899_0398574 3300037312 Bacteria 911
609 Ga0395899_0602386 3300037312 Bacteria 700
610 Ga0395900_0000988 3300037418 Bacteria 36988
611 Ga0395900_0001815 3300037418 Bacteria 24440
612 Ga0395900_0002063 3300037418 Bacteria 22548
613 Ga0395900_0006089 3300037418 Bacteria 12579
614 Ga0395900_0006883 3300037418 Bacteria 11797
615 Ga0395900_0015254 3300037418 Bacteria 7835
616 Ga0395900_0023619 3300037418 Bacteria 6290
617 Ga0395900_0029608 3300037418 Bacteria 5617
618 Ga0395900_0037663 3300037418 Bacteria 4986
619 Ga0395900_0059472 3300037418 Bacteria 3934
620 Ga0395900_0125938 3300037418 Bacteria 2627
621 Ga0395900_0170566 3300037418 Bacteria 2216
622 Ga0395900_0578180 3300037418 Unclassified 1065
623 Ga0395900_0670615 3300037418 Bacteria 972
624 Ga0395900_0926614 3300037418 Unclassified 794
625 Ga0395898_0001851 3300037466 Bacteria 27144
626 Ga0395898_0005501 3300037466 Bacteria 13678
627 Ga0395898_0009660 3300037466 Bacteria 10127
628 Ga0395898_0010358 3300037466 Bacteria 9751
629 Ga0395898_0010653 3300037466 Bacteria 9604
630 Ga0395898_0021055 3300037466 Bacteria 6616
631 Ga0395898_0060661 3300037466 Bacteria 3675
632 Ga0395898_0081955 3300037466 Bacteria 3110
633 Ga0395898_0101093 3300037466 Bacteria 2769
634 Ga0395898_0317136 3300037466 Bacteria 1487
635 Ga0395898_0524100 3300037466 Bacteria 1126
636 Ga0395898_1239195 3300037466 Unclassified 676
637 Ga0395898_1772913 3300037466 Unclassified 539
638 Ga0395905_0002715 3300037471 Bacteria 19391
639 Ga0395905_0003527 3300037471 Bacteria 16686
640 Ga0395905_0004780 3300037471 Bacteria 13992
641 Ga0395905_0005093 3300037471 Bacteria 13515
642 Ga0395905_0007145 3300037471 Bacteria 11164
643 Ga0395905_0014219 3300037471 Bacteria 7603
644 Ga0395905_0016488 3300037471 Bacteria 7023
645 Ga0395905_0031792 3300037471 Bacteria 4966
646 Ga0395905_0065321 3300037471 Bacteria 3406
647 Ga0395905_0192669 3300037471 Bacteria 1912
648 Ga0395905_0197616 3300037471 Bacteria 1886
649 Ga0395905_0300467 3300037471 Unclassified 1492
650 Ga0395905_0724884 3300037471 Bacteria 897
651 Ga0395905_0754904 3300037471 Bacteria 875
652 Ga0395905_1369700 3300037471 Bacteria 611
653 Ga0395901_0001046 3300038443 Bacteria 29844
654 Ga0395901_0001699 3300038443 Bacteria 22721
655 Ga0395901_0017122 3300038443 Bacteria 7389
656 Ga0395901_0020132 3300038443 Bacteria 6827
657 Ga0395901_0020914 3300038443 Bacteria 6703
658 Ga0395901_0023314 3300038443 Bacteria 6343
659 Ga0395901_0023336 3300038443 Bacteria 6340
660 Ga0395901_0026916 3300038443 Bacteria 5904
661 Ga0395901_0029314 3300038443 Bacteria 5665
662 Ga0395901_0034882 3300038443 Bacteria 5196
663 Ga0395901_0052204 3300038443 Bacteria 4249
664 Ga0395901_0124759 3300038443 Bacteria 2705
665 Ga0395901_0155154 3300038443 Bacteria 2405
666 Ga0395901_0252693 3300038443 Unclassified 1836
667 Ga0395901_0309946 3300038443 Bacteria 1635
668 Ga0395901_0311363 3300038443 Archaea 1630
669 Ga0395901_0393519 3300038443 Bacteria 1424
670 Ga0395901_0410610 3300038443 Bacteria 1390
671 Ga0395901_0739048 3300038443 Unclassified 978
672 Ga0436360_1202685 3300039438 Bacteria 4165
673 Ga0451789_0679119 3300041443 Bacteria 659
674 Ga0451800_1000072 3300041459 Bacteria 967
675 Ga0451804_0350657 3300041463 Unclassified 758
676 Ga0451807_0386844 3300041486 Bacteria 944
677 Ga0451835_0352271 3300041492 Bacteria 704
678 Ga0451851_0134753 3300041507 Unclassified 663
679 Ga0451851_1194924 3300041507 Unclassified 528
680 Ga0451855_1544268 3300041511 Unclassified 502
681 Ga0451853_0421655 3300041512 Bacteria 647
682 Ga0451853_1430403 3300041512 Bacteria 2367
683 Ga0451853_2263295 3300041512 Bacteria 1185
684 Ga0439448_0010108 3300042005 Bacteria 2790
685 Ga0439448_0169426 3300042005 Unclassified 762
686 Ga0439454_033538 3300042011 Bacteria 815
687 Ga0439463_094006 3300042016 Bacteria 772
688 Ga0450923_086057 3300042125 Bacteria 712
689 Ga0450908_016961 3300042184 Bacteria 1296
690 Ga0439460_0278507 3300042461 Unclassified 582
691 Ga0439440_0172541 3300042993 Unclassified 630
692 Ga0466972_0280379 3300044658 Unclassified 779
693 Ga0466965_0728045 3300044683 Bacteria 571
694 Ga0466966_0170455 3300044684 Bacteria 1323
695 Ga0466966_0227404 3300044684 Bacteria 1126
696 Ga0466961_0083010 3300044693 Bacteria 2026
697 Ga0466961_0437122 3300044693 Bacteria 792
698 Ga0466963_0002006 3300044694 Bacteria 11187
699 Ga0466963_0002668 3300044694 Bacteria 10046
700 Ga0466963_0002932 3300044694 Bacteria 9647
701 Ga0466963_0006305 3300044694 Bacteria 7013
702 Ga0466963_0007463 3300044694 Bacteria 6522
703 Ga0466963_0008542 3300044694 Bacteria 6148
704 Ga0466963_0008804 3300044694 Bacteria 6063
705 Ga0466963_0015548 3300044694 Bacteria 4715
706 Ga0466963_0030071 3300044694 Bacteria 3501
707 Ga0466963_0036743 3300044694 Bacteria 3195
708 Ga0466963_0043566 3300044694 Bacteria 2951
709 Ga0466963_0064925 3300044694 Bacteria 2446
710 Ga0466963_0184519 3300044694 Bacteria 1457
711 Ga0466963_0225109 3300044694 Bacteria 1314
712 Ga0466963_0225822 3300044694 Bacteria 1312
713 Ga0466963_0234454 3300044694 Unclassified 1286
714 Ga0466963_0243816 3300044694 Bacteria 1261
715 Ga0466964_0002663 3300044706 Bacteria 6393
716 Ga0466964_0003457 3300044706 Bacteria 5764
717 Ga0466964_0004480 3300044706 Bacteria 5160
718 Ga0466964_0006257 3300044706 Bacteria 4437
719 Ga0466964_0024038 3300044706 Bacteria 2372
720 Ga0466964_0096262 3300044706 Bacteria 1297
721 Ga0466964_0200596 3300044706 Unclassified 957
722 Ga0466964_0404640 3300044706 Bacteria 714
723 Ga0466971_0002599 3300044719 Bacteria 7639
724 Ga0466971_0024052 3300044719 Bacteria 2716
725 Ga0466971_0291099 3300044719 Unclassified 783
726 Ga0466968_0006248 3300044735 Bacteria 4483
727 Ga0466968_0089598 3300044735 Unclassified 1361
728 Ga0466968_0219915 3300044735 Bacteria 894
729 Ga0466970_0588577 3300044765 Unclassified 645
730 Ga0466957_0024215 3300044842 Bacteria 3591
731 Ga0466957_0073905 3300044842 Bacteria 2114
732 Ga0466957_0082801 3300044842 Bacteria 2000
733 Ga0466957_0100193 3300044842 Bacteria 1825
734 Ga0466957_0130237 3300044842 Bacteria 1611
735 Ga0466957_0181285 3300044842 Bacteria 1375
736 Ga0466957_0217806 3300044842 Bacteria 1259
737 Ga0466957_0352786 3300044842 Bacteria 998
738 Ga0466957_1102298 3300044842 Bacteria 572
739 Ga0466960_0074010 3300044901 Bacteria 1701
740 Ga0466959_0006028 3300045049 Bacteria 8368
741 Ga0466959_0017610 3300045049 Bacteria 5238
742 Ga0466959_0087487 3300045049 Bacteria 2241
743 Ga0466959_0362906 3300045049 Bacteria 987
744 Ga0466959_0416606 3300045049 Unclassified 912
745 Ga0466959_0993707 3300045049 Unclassified 559
746 Ga0451576_0880536 3300045051 Bacteria 940
747 Ga0466958_0002675 3300045836 Bacteria 9020
748 Ga0466958_0008643 3300045836 Bacteria 5654
749 Ga0466958_0020069 3300045836 Bacteria 3895
750 Ga0466958_0085058 3300045836 Bacteria 1951
751 Ga0466958_0092512 3300045836 Bacteria 1872
752 Ga0466958_0161536 3300045836 Bacteria 1415
753 Ga0466958_0191493 3300045836 Bacteria 1300
754 Ga0466967_0006182 3300045976 Bacteria 8436
755 Ga0466967_0008612 3300045976 Bacteria 7497
756 Ga0466967_0014509 3300045976 Bacteria 6140
757 Ga0466967_0016742 3300045976 Bacteria 5793
758 Ga0466967_0028335 3300045976 Bacteria 4674
759 Ga0466967_0034359 3300045976 Bacteria 4303
760 Ga0466967_0035140 3300045976 Bacteria 4262
761 Ga0466967_0045571 3300045976 Bacteria 3811
762 Ga0466967_0057084 3300045976 Bacteria 3445
763 Ga0466967_0061309 3300045976 Bacteria 3336
764 Ga0466967_0062554 3300045976 Bacteria 3304
765 Ga0466967_0063431 3300045976 Bacteria 3283
766 Ga0466967_0083214 3300045976 Bacteria 2893
767 Ga0466967_0116397 3300045976 Bacteria 2462
768 Ga0466967_0122681 3300045976 Bacteria 2403
769 Ga0466967_0133638 3300045976 Bacteria 2305
770 Ga0466967_0151088 3300045976 Bacteria 2170
771 Ga0466967_0172763 3300045976 Bacteria 2034
772 Ga0466967_0176333 3300045976 Bacteria 2013
773 Ga0466967_0317810 3300045976 Bacteria 1501
774 Ga0466967_0324464 3300045976 Bacteria 1485
775 Ga0466967_0326028 3300045976 Unclassified 1482
776 Ga0466967_0438439 3300045976 Bacteria 1275
777 Ga0466967_0513968 3300045976 Bacteria 1176
778 Ga0466967_0557468 3300045976 Bacteria 1128
779 Ga0495592_0001047 3300046454 Bacteria 19192
780 Ga0495592_0129070 3300046454 Bacteria 1770
781 Ga0495592_0287037 3300046454 Bacteria 1074
782 Ga0495603_0002533 3300046455 Bacteria 10757
783 Ga0495603_0071520 3300046455 Unclassified 2039
784 Ga0495603_0233866 3300046455 Bacteria 1059
785 Ga0495629_0074536 3300046459 Unclassified 2369
786 Ga0495629_0117139 3300046459 Bacteria 1856
787 Ga0495629_0240813 3300046459 Bacteria 1246
788 Ga0495641_0015369 3300046461 Bacteria 4091
789 Ga0495641_0027317 3300046461 Bacteria 2776
790 Ga0495641_0108039 3300046461 Unclassified 1241
791 Ga0495641_0233079 3300046461 Bacteria 826
792 Ga0495651_0072906 3300046462 Bacteria 2607
793 Ga0495651_0101131 3300046462 Unclassified 2146
794 Ga0495653_0041210 3300046463 Unclassified 3605
795 Ga0495653_0044446 3300046463 Bacteria 3447
796 Ga0495653_0251323 3300046463 Bacteria 1173
797 Ga0495653_0282672 3300046463 Bacteria 1088
798 Ga0495580_0364736 3300046472 Unclassified 977
799 Ga0495580_0816732 3300046472 Unclassified 604
800 Ga0495582_0006869 3300046473 Bacteria 6327
801 Ga0495582_0063961 3300046473 Bacteria 2031
802 Ga0495582_0096284 3300046473 Bacteria 1654
803 Ga0495582_0124150 3300046473 Bacteria 1456
804 Ga0495582_0241402 3300046473 Bacteria 1035
805 Ga0495582_0561372 3300046473 Unclassified 660
806 Ga0495605_0081882 3300046474 Bacteria 1509
807 Ga0495605_0088762 3300046474 Unclassified 1436
808 Ga0495639_0000877 3300046475 Bacteria 13617
809 Ga0495639_0006207 3300046475 Bacteria 5132
810 Ga0495639_0466887 3300046475 Bacteria 642
811 Ga0495662_0009854 3300046476 Unclassified 4693
812 Ga0495662_0030505 3300046476 Unclassified 2603
813 Ga0495664_0030024 3300046477 Bacteria 3183
814 Ga0495664_0093337 3300046477 Bacteria 1810
815 Ga0495584_0014522 3300046491 Bacteria 4012
816 Ga0495584_0022200 3300046491 Bacteria 3222
817 Ga0495585_0103556 3300046492 Unclassified 1520
818 Ga0495594_0002098 3300046499 Bacteria 10375
819 Ga0495594_0423919 3300046499 Unclassified 757
820 Ga0495596_0072140 3300046500 Bacteria 1341
821 Ga0495596_0309522 3300046500 Bacteria 614
822 Ga0495607_0044751 3300046501 Bacteria 2608
823 Ga0495608_0366157 3300046511 Bacteria 885
824 Ga0495608_0422469 3300046511 Bacteria 813
825 Ga0495608_0945563 3300046511 Unclassified 503
826 Ga0495618_0113340 3300046514 Bacteria 1736
827 Ga0495618_0135170 3300046514 Unclassified 1577
828 Ga0495628_0004790 3300046516 Bacteria 11916
829 Ga0495628_0186999 3300046516 Bacteria 1565
830 Ga0495628_0246291 3300046516 Unclassified 1335
831 Ga0495628_0368726 3300046516 Bacteria 1053
832 Ga0495630_0003203 3300046517 Bacteria 11383
833 Ga0495630_0051348 3300046517 Bacteria 3087
834 Ga0495630_0074378 3300046517 Unclassified 2558
835 Ga0495630_0123725 3300046517 Bacteria 1962
836 Ga0495631_0152154 3300046518 Bacteria 993
837 Ga0495637_0105742 3300046520 Bacteria 1096
838 Ga0495644_0009530 3300046523 Bacteria 3743
839 Ga0495644_0082940 3300046523 Bacteria 1209
840 Ga0495644_0349382 3300046523 Bacteria 582
841 Ga0495644_0369561 3300046523 Bacteria 566
842 Ga0495666_0000867 3300046526 Bacteria 14112
843 Ga0495666_0179235 3300046526 Bacteria 979
844 Ga0495666_0364333 3300046526 Unclassified 651
845 Ga0495642_0312683 3300046528 Unclassified 689
846 Ga0495652_0029275 3300046529 Bacteria 4839
847 Ga0495652_0065759 3300046529 Archaea 3045
848 Ga0495652_0084337 3300046529 Bacteria 2613
849 Ga0495652_0353232 3300046529 Bacteria 1052
850 Ga0495665_0019091 3300046531 Unclassified 3684
851 Ga0495665_0033238 3300046531 Unclassified 2759
852 Ga0495665_0424895 3300046531 Bacteria 673
853 Ga0495640_0004109 3300046533 Bacteria 11645
854 Ga0495640_0082573 3300046533 Archaea 2133
855 Ga0495640_0115901 3300046533 Unclassified 1745
856 Ga0495640_0396743 3300046533 Unclassified 847
857 Ga0495640_0731717 3300046533 Unclassified 592
858 Ga0495586_0010965 3300046535 Unclassified 4815
859 Ga0495586_0055339 3300046535 Bacteria 2150
860 Ga0495586_0447187 3300046535 Bacteria 745
861 Ga0495587_0069988 3300046536 Bacteria 2042
862 Ga0495587_0678216 3300046536 Bacteria 565
863 Ga0495609_0031795 3300046538 Unclassified 2398
864 Ga0495609_0106559 3300046538 Bacteria 1212
865 Ga0495621_0171644 3300046539 Bacteria 862
866 Ga0495645_0078317 3300046543 Bacteria 2375
867 Ga0495645_0141264 3300046543 Bacteria 1679
868 Ga0495622_0089452 3300046557 Bacteria 1415
869 Ga0495667_0002076 3300046559 Bacteria 13310
870 Ga0495667_0043857 3300046559 Unclassified 2963
871 Ga0495667_0062620 3300046559 Bacteria 2437
872 Ga0495667_0146747 3300046559 Bacteria 1519
873 Ga0495667_0335516 3300046559 Unclassified 956
874 Ga0495667_0385354 3300046559 Bacteria 884
875 Ga0495656_0043675 3300046615 Unclassified 1883
876 Ga0495656_0194110 3300046615 Unclassified 1004
877 Ga0495656_0424036 3300046615 Unclassified 698
878 Ga0495656_0472058 3300046615 Bacteria 663
879 Ga0495634_0035965 3300046642 Unclassified 3388
880 Ga0495634_0190810 3300046642 Bacteria 1278
881 Ga0495634_0239921 3300046642 Bacteria 1112
882 Ga0495635_0025222 3300046663 Unclassified 4140
883 Ga0495635_0036622 3300046663 Bacteria 3400
884 Ga0495635_0083039 3300046663 Archaea 2192
885 Ga0495635_0112181 3300046663 Bacteria 1862
886 Ga0495635_0132377 3300046663 Bacteria 1700
887 Ga0495659_0100369 3300046664 Bacteria 1120
888 Ga0495661_0247731 3300046665 Bacteria 911
889 Ga0495661_0277446 3300046665 Unclassified 846
890 Ga0495588_0037931 3300046674 Bacteria 2450
891 Ga0495657_0088334 3300046675 Bacteria 1993
892 Ga0495657_0207979 3300046675 Bacteria 1190
893 Ga0495657_0261536 3300046675 Bacteria 1039
894 Ga0495599_0074553 3300046678 Unclassified 2118
895 Ga0495599_0162116 3300046678 Archaea 1382
896 Ga0495623_0045462 3300046679 Bacteria 2789
897 Ga0495623_0378008 3300046679 Unclassified 766
898 Ga0495646_0050909 3300046680 Bacteria 2508
899 Ga0495646_0059593 3300046680 Bacteria 2279
900 Ga0495646_0078057 3300046680 Bacteria 1936
901 Ga0495647_0005813 3300046681 Unclassified 4058
902 Ga0495647_0104038 3300046681 Bacteria 1178
903 Ga0495647_0249509 3300046681 Bacteria 790
904 Ga0495658_0009961 3300046683 Unclassified 4741
905 Ga0495658_0029687 3300046683 Bacteria 2963
906 Ga0495658_0061758 3300046683 Bacteria 2152
907 Ga0495658_0079339 3300046683 Bacteria 1923
908 Ga0495658_0163125 3300046683 Bacteria 1376
909 Ga0495658_0360976 3300046683 Unclassified 924
910 Ga0495613_0002918 3300046689 Bacteria 12813
911 Ga0495613_0084540 3300046689 Bacteria 2304
912 Ga0495613_0088452 3300046689 Bacteria 2245
913 Ga0495613_0115405 3300046689 Unclassified 1932
914 Ga0495613_0217534 3300046689 Bacteria 1342
915 Ga0495613_0248891 3300046689 Bacteria 1241
916 Ga0495624_0002334 3300046690 Bacteria 14427
917 Ga0495624_0016274 3300046690 Bacteria 5008
918 Ga0495624_0192245 3300046690 Bacteria 1241
919 Ga0495624_0522156 3300046690 Bacteria 710
920 Ga0495589_0114626 3300046794 Bacteria 1300
921 Ga0495600_0071080 3300046809 Bacteria 2274
922 Ga0495600_0088670 3300046809 Unclassified 2018
923 Ga0495600_0363640 3300046809 Unclassified 905
924 Ga0495581_0010204 3300047315 Bacteria 5433
925 Ga0495581_0059738 3300047315 Unclassified 2203
926 Ga0495581_0069837 3300047315 Bacteria 2031
927 Ga0495581_0104785 3300047315 Unclassified 1643
928 Ga0495581_0436445 3300047315 Bacteria 763
929 Ga0495604_0069150 3300047317 Bacteria 2677
930 Ga0495636_0033221 3300047318 Bacteria 2119
931 Ga0495636_0139826 3300047318 Bacteria 1081
932 Ga0495636_0199105 3300047318 Bacteria 914
933 Ga0495674_0057496 3300047319 Unclassified 3403
934 Ga0495674_0198639 3300047319 Bacteria 1664
935 Ga0495674_0321001 3300047319 Bacteria 1262
936 Ga0495674_0364173 3300047319 Unclassified 1172
937 Ga0495674_0546456 3300047319 Unclassified 922
938 Ga0495676_0023828 3300047321 Bacteria 5304
939 Ga0495676_0028473 3300047321 Bacteria 4769
940 Ga0495676_0106124 3300047321 Bacteria 2070
941 Ga0495676_0159285 3300047321 Bacteria 1598
942 Ga0495676_0693272 3300047321 Bacteria 659
943 Ga0495680_0062558 3300047322 Bacteria 2861
944 Ga0495675_0211176 3300047444 Unclassified 1178
945 Ga0495677_0048266 3300047445 Bacteria 1564
946 Ga0495677_0120451 3300047445 Bacteria 1001
947 Ga0495685_172602 3300047447 Unclassified 698
948 Ga0495684_0029560 3300047471 Archaea 4206
949 Ga0495684_0041333 3300047471 Unclassified 3533
950 Ga0495684_0410742 3300047471 Bacteria 948
951 Ga0495593_0046814 3300047673 Unclassified 2303
952 Ga0495602_0032377 3300048088 Bacteria 4922
953 Ga0495602_0050380 3300048088 Bacteria 3721
954 Ga0495602_0393103 3300048088 Bacteria 990
955 Ga0495614_0010382 3300048089 Unclassified 4106
956 Ga0495614_0131177 3300048089 Bacteria 1109
957 Ga0495614_0181237 3300048089 Unclassified 948
958 Ga0495614_0246782 3300048089 Unclassified 816
959 Ga0495626_0429544 3300048091 Bacteria 509
960 Ga0496100_0017841 3300048903 Bacteria 4197
961 Ga0496100_0050640 3300048903 Bacteria 2692
962 Ga0496100_0266646 3300048903 Bacteria 1272
963 Ga0496100_0313550 3300048903 Bacteria 1177
964 Ga0496100_0490154 3300048903 Bacteria 946
965 Ga0496100_0640480 3300048903 Bacteria 827
966 Ga0496100_0793961 3300048903 Bacteria 741
967 Ga0496101_0127120 3300048904 Unclassified 1932
968 Ga0496101_0151615 3300048904 Unclassified 1773
969 Ga0496101_0153102 3300048904 Bacteria 1765
970 Ga0496101_0232186 3300048904 Bacteria 1434
971 Ga0496102_0003780 3300048905 Bacteria 12801
972 Ga0496102_0045690 3300048905 Bacteria 3976
973 Ga0496102_0075999 3300048905 Bacteria 3088
974 Ga0496102_0145423 3300048905 Bacteria 2225
975 Ga0496102_0180186 3300048905 Bacteria 1990
976 Ga0496102_0365130 3300048905 Bacteria 1359
977 Ga0496103_0005252 3300048906 Bacteria 7776
978 Ga0496103_0005964 3300048906 Bacteria 7287
979 Ga0496103_0006783 3300048906 Bacteria 6832
980 Ga0496103_0011753 3300048906 Bacteria 5194
981 Ga0496103_0025899 3300048906 Bacteria 3548
982 Ga0496103_0096859 3300048906 Bacteria 1865
983 Ga0496103_0180692 3300048906 Bacteria 1356
984 Ga0496104_0008696 3300048907 Bacteria 9030
985 Ga0496104_0017204 3300048907 Bacteria 6577
986 Ga0496104_0056716 3300048907 Bacteria 3705
987 Ga0496104_0250604 3300048907 Bacteria 1683
988 Ga0496104_0329163 3300048907 Unclassified 1441
989 Ga0496104_0498756 3300048907 Bacteria 1128
990 Ga0496104_0993542 3300048907 Unclassified 743
991 Ga0496104_1169422 3300048907 Bacteria 673
992 Ga0496105_0000774 3300048908 Bacteria 21680
993 Ga0496105_0044361 3300048908 Bacteria 3667
994 Ga0496105_0060312 3300048908 Bacteria 3130
995 Ga0496105_0069810 3300048908 Bacteria 2903
996 Ga0496105_0145712 3300048908 Bacteria 1947
997 Ga0496105_0151850 3300048908 Bacteria 1903
998 Ga0496105_0161934 3300048908 Bacteria 1837
999 Ga0496105_0888539 3300048908 Unclassified 672
1000 Ga0496106_0013297 3300048909 Bacteria 6076
1001 Ga0496106_0022161 3300048909 Bacteria 4717
1002 Ga0496106_0087181 3300048909 Bacteria 2405
1003 Ga0496106_0296226 3300048909 Unclassified 1297
1004 Ga0496106_0456448 3300048909 Bacteria 1026
1005 Ga0496106_0495979 3300048909 Bacteria 981
1006 Ga0496106_1202343 3300048909 Bacteria 591
1007 Ga0496107_0047235 3300048910 Bacteria 3100
1008 Ga0496107_0055251 3300048910 Bacteria 2868
1009 Ga0496107_0059682 3300048910 Bacteria 2760
1010 Ga0496107_0191159 3300048910 Bacteria 1521
1011 Ga0496107_0695377 3300048910 Unclassified 748
1012 Ga0496108_0006605 3300048911 Bacteria 9405
1013 Ga0496108_0012735 3300048911 Bacteria 6849
1014 Ga0496108_0020741 3300048911 Bacteria 5402
1015 Ga0496108_0233016 3300048911 Bacteria 1601
1016 Ga0496108_0313846 3300048911 Bacteria 1366
1017 Ga0496108_0316935 3300048911 Bacteria 1359
1018 Ga0496108_1219788 3300048911 Bacteria 635
1019 Ga0496109_0001185 3300048912 Bacteria 21642
1020 Ga0496109_0010434 3300048912 Bacteria 7935
1021 Ga0496109_0037853 3300048912 Bacteria 4359
1022 Ga0496109_0059987 3300048912 Unclassified 3476
1023 Ga0496109_0064459 3300048912 Bacteria 3353
1024 Ga0496109_0129561 3300048912 Bacteria 2354
1025 Ga0496109_0165862 3300048912 Bacteria 2070
1026 Ga0496109_0271725 3300048912 Bacteria 1597
1027 Ga0496109_0327860 3300048912 Archaea 1445
1028 Ga0496109_0336585 3300048912 Bacteria 1425
1029 Ga0496109_0690118 3300048912 Unclassified 958
1030 Ga0496109_0775652 3300048912 Unclassified 897
1031 Ga0496109_1242363 3300048912 Bacteria 681
1032 Ga0496110_0001930 3300048913 Bacteria 15355
1033 Ga0496110_0061900 3300048913 Bacteria 3304
1034 Ga0496110_0079920 3300048913 Bacteria 2912
1035 Ga0496110_0084393 3300048913 Bacteria 2835
1036 Ga0496110_0122957 3300048913 Archaea 2340
1037 Ga0496110_0865903 3300048913 Bacteria 809
1038 Ga0496111_0013131 3300048914 Bacteria 5628
1039 Ga0496111_0016941 3300048914 Bacteria 5029
1040 Ga0496111_0025491 3300048914 Bacteria 4172
1041 Ga0496111_0029739 3300048914 Bacteria 3881
1042 Ga0496111_0379440 3300048914 Bacteria 1045
1043 Ga0496111_0385835 3300048914 Bacteria 1036
1044 Ga0496111_0532181 3300048914 Bacteria 864
1045 Ga0496111_0597097 3300048914 Unclassified 808
1046 Ga0496112_0001626 3300048915 Bacteria 17400
1047 Ga0496112_0010813 3300048915 Bacteria 8303
1048 Ga0496112_0022196 3300048915 Bacteria 6049
1049 Ga0496112_0026094 3300048915 Bacteria 5618
1050 Ga0496112_0063900 3300048915 Bacteria 3631
1051 Ga0496112_0232221 3300048915 Bacteria 1799
1052 Ga0496112_0295395 3300048915 Bacteria 1566
1053 Ga0496112_0590599 3300048915 Bacteria 1043
1054 Ga0496112_1271487 3300048915 Unclassified 652
1055 Ga0496113_0000174 3300048916 Bacteria 28582
1056 Ga0496113_0029988 3300048916 Bacteria 3933
1057 Ga0496113_0161588 3300048916 Bacteria 1771
1058 Ga0496113_0234408 3300048916 Bacteria 1464
1059 Ga0496113_0356266 3300048916 Bacteria 1174
1060 Ga0496113_0621746 3300048916 Unclassified 864
1061 Ga0496113_0732505 3300048916 Bacteria 788
1062 Ga0496113_0807908 3300048916 Unclassified 745
1063 Ga0496113_1089824 3300048916 Unclassified 627
1064 Ga0496114_0018406 3300048917 Bacteria 5646
1065 Ga0496114_0019355 3300048917 Bacteria 5516
1066 Ga0496114_0051967 3300048917 Bacteria 3413
1067 Ga0496114_0103198 3300048917 Unclassified 2437
1068 Ga0496114_0288937 3300048917 Unclassified 1446
1069 Ga0496114_0373262 3300048917 Bacteria 1262
1070 Ga0496114_0762099 3300048917 Bacteria 845
1071 Ga0496115_0020362 3300048918 Bacteria 5117
1072 Ga0496115_0036936 3300048918 Bacteria 3869
1073 Ga0496115_0037849 3300048918 Bacteria 3824
1074 Ga0496115_0097812 3300048918 Bacteria 2403
1075 Ga0496115_0196047 3300048918 Bacteria 1669
1076 Ga0496115_0646164 3300048918 Unclassified 837
1077 Ga0501031_0049719 3300049568 Bacteria 2732
1078 Ga0501033_0035501 3300049570 Bacteria 3738
1079 Ga0501036_0014593 3300049572 Bacteria 6543
1080 Ga0501036_0046327 3300049572 Bacteria 3682
1081 Ga0501038_0016243 3300049574 Bacteria 6750
1082 Ga0501039_0017007 3300049575 Bacteria 5574
1083 Ga0501039_0018576 3300049575 Bacteria 5337
1084 Ga0501039_1066350 3300049575 Unclassified 627
1085 Ga0501040_0016148 3300049576 Bacteria 4938
1086 Ga0501040_0020766 3300049576 Bacteria 4379
1087 Ga0501040_0022945 3300049576 Bacteria 4181
1088 Ga0501040_0042835 3300049576 Bacteria 3084
1089 Ga0501041_0001170 3300049577 Bacteria 14358
1090 Ga0501041_0071486 3300049577 Bacteria 2130
1091 Ga0501042_0008113 3300049578 Bacteria 6914
1092 Ga0501042_0102983 3300049578 Bacteria 2054
1093 Ga0501042_0105050 3300049578 Bacteria 2032
1094 Ga0501042_0115359 3300049578 Bacteria 1934
1095 Ga0501043_0056308 3300049579 Bacteria 3088
1096 Ga0501046_0289757 3300049580 Unclassified 1198
1097 Ga0501048_0043273 3300049582 Bacteria 3224
1098 Ga0501048_0060236 3300049582 Bacteria 2690
1099 Ga0501048_0214595 3300049582 Bacteria 1364
1100 Ga0501067_0002546 3300049583 Bacteria 10059
1101 Ga0501067_0027507 3300049583 Bacteria 3151
1102 Ga0501068_0057575 3300049584 Bacteria 2357
1103 Ga0501068_0110349 3300049584 Bacteria 1710
1104 Ga0501068_0299208 3300049584 Bacteria 1030
1105 Ga0501069_0012316 3300049585 Bacteria 4545
1106 Ga0501069_0021334 3300049585 Bacteria 3513
1107 Ga0501069_0054283 3300049585 Bacteria 2232
1108 Ga0501069_0460293 3300049585 Unclassified 756
1109 Ga0501069_0904664 3300049585 Unclassified 537
1110 Ga0501070_0142436 3300049586 Bacteria 1979
1111 Ga0501070_0398511 3300049586 Bacteria 1113
1112 Ga0501071_0001490 3300049587 Bacteria 13610
1113 Ga0501071_0013539 3300049587 Bacteria 5561
1114 Ga0501071_0097781 3300049587 Unclassified 2161
1115 Ga0501071_0137802 3300049587 Bacteria 1816
1116 Ga0501071_0228847 3300049587 Unclassified 1400
1117 Ga0501071_0328973 3300049587 Bacteria 1161
1118 Ga0501071_0432172 3300049587 Unclassified 1007
1119 Ga0501072_0001558 3300049588 Bacteria 17113
1120 Ga0501072_0019748 3300049588 Bacteria 5213
1121 Ga0501072_0069243 3300049588 Bacteria 2786
1122 Ga0501072_0087270 3300049588 Unclassified 2476
1123 Ga0501072_0126752 3300049588 Bacteria 2034
1124 Ga0501072_0128644 3300049588 Bacteria 2018
1125 Ga0501072_0196721 3300049588 Bacteria 1607
1126 Ga0501074_0009147 3300049590 Bacteria 7192
1127 Ga0501074_0099874 3300049590 Bacteria 2077
1128 Ga0501074_0175667 3300049590 Bacteria 1528
1129 Ga0501074_0231555 3300049590 Bacteria 1315
1130 Ga0501075_0023278 3300049591 Bacteria 4534
1131 Ga0501075_0033702 3300049591 Bacteria 3810
1132 Ga0501075_0035257 3300049591 Bacteria 3730
1133 Ga0501075_0042288 3300049591 Bacteria 3416
1134 Ga0501075_0056499 3300049591 Bacteria 2954
1135 Ga0501075_0063325 3300049591 Bacteria 2788
1136 Ga0501075_0476657 3300049591 Unclassified 952
1137 Ga0501076_0019912 3300049592 Bacteria 5132
1138 Ga0501076_0035198 3300049592 Bacteria 3918
1139 Ga0501076_0073434 3300049592 Unclassified 2739
1140 Ga0501076_0108740 3300049592 Bacteria 2240
1141 Ga0501077_0050824 3300049593 Bacteria 2635
1142 Ga0501077_0073290 3300049593 Bacteria 2169
1143 Ga0501079_0014176 3300049741 Bacteria 6077
1144 Ga0501079_0023324 3300049741 Bacteria 4749
1145 Ga0501079_0029148 3300049741 Bacteria 4236
1146 Ga0501079_0034365 3300049741 Bacteria 3901
1147 Ga0501080_0023671 3300049742 Bacteria 5690
1148 Ga0501080_0173336 3300049742 Bacteria 1988
1149 Ga0501080_0270094 3300049742 Bacteria 1548
1150 Ga0501081_0062685 3300049743 Unclassified 2579
1151 Ga0501081_0107172 3300049743 Bacteria 1981
1152 Ga0501081_0142595 3300049743 Unclassified 1717
1153 Ga0501081_0190495 3300049743 Bacteria 1485
1154 Ga0501081_0307186 3300049743 Bacteria 1164
1155 Ga0501081_0327002 3300049743 Bacteria 1127
1156 Ga0501081_0513407 3300049743 Bacteria 894
1157 Ga0501083_0002636 3300049744 Bacteria 12354
1158 Ga0501045_0003524 3300049824 Bacteria 10724
1159 Ga0501045_0017164 3300049824 Bacteria 5140
1160 Ga0501045_0190361 3300049824 Bacteria 1529
1161 nmdc:mga05p37_103965_c1 3300050507 Bacteria 3495
1162 nmdc:mga05p37_125342_c1 3300050507 Bacteria 3154
1163 nmdc:mga05p37_20308_c1 3300050507 Bacteria 8037
1164 nmdc:mga05p37_316820_c1 3300050507 Bacteria 1847
1165 nmdc:mga06r32_350821_c1 3300050510 Bacteria 1460
1166 nmdc:mga06r32_509054_c1 3300050510 Bacteria 1180
1167 nmdc:mga06r32_71444_c1 3300050510 Unclassified 3358
1168 nmdc:mga08y16_233788_c1 3300050511 Bacteria 1901
1169 nmdc:mga08y16_302132_c1 3300050511 Bacteria 1650
1170 nmdc:mga0n895_10843_c1 3300050512 Bacteria 8088
1171 nmdc:mga0n895_1091422_c1 3300050512 Bacteria 776
1172 nmdc:mga0n895_113497_c1 3300050512 Unclassified 2343
1173 nmdc:mga0n895_212455_c1 3300050512 Unclassified 1965
1174 nmdc:mga0n895_644451_c1 3300050512 Bacteria 1059
1175 nmdc:mga0n895_783874_c1 3300050512 Unclassified 945
1176 nmdc:mga0rr50_106172_c1 3300050513 Bacteria 2215
1177 nmdc:mga0rr50_151098_c1 3300050513 Bacteria 1877
1178 nmdc:mga0rr50_170371_c1 3300050513 Bacteria 1774
1179 nmdc:mga0rr50_200196_c1 3300050513 Bacteria 1641
1180 nmdc:mga0rr50_665421_c1 3300050513 Bacteria 888
1181 nmdc:mga08x19_163556_c1 3300050514 Bacteria 1512
1182 nmdc:mga08x19_232640_c1 3300050514 Unclassified 1269
1183 nmdc:mga0a205_23321_c1 3300050515 Bacteria 5870
1184 nmdc:mga0a205_46526_c1 3300050515 Bacteria 4185
1185 Ga0495601_0015514 3300053077 Bacteria 4604
1186 Ga0495601_0025347 3300053077 Unclassified 3657
1187 Ga0495601_0056965 3300053077 Archaea 2475
1188 Ga0495601_0142240 3300053077 Bacteria 1565
1189 Ga0495601_0196217 3300053077 Bacteria 1319
1190 Ga0495601_0227023 3300053077 Bacteria 1220
1191 Ga0495601_0679254 3300053077 Unclassified 658
1192 Ga0495612_0024789 3300053078 Unclassified 2408
1193 Ga0495655_0077943 3300053083 Bacteria 941
1194 Ga0495655_0143051 3300053083 Unclassified 746
1195 Ga0495595_0019057 3300053084 Bacteria 2973
1196 Ga0495595_0225004 3300053084 Bacteria 936
1197 Ga0495595_0290693 3300053084 Bacteria 821
1198 Ga0495595_0291375 3300053084 Unclassified 820
1199 Ga0495619_0007030 3300053085 Bacteria 7121
1200 Ga0495619_0021703 3300053085 Bacteria 4102
1201 Ga0495619_0025564 3300053085 Bacteria 3793
1202 Ga0495619_0119289 3300053085 Unclassified 1808
1203 Ga0495619_0329682 3300053085 Bacteria 1056
1204 Ga0500566_0111911 3300053094 Unclassified 1483
1205 Ga0501084_0009197 3300054114 Bacteria 8170
1206 Ga0501084_0014265 3300054114 Bacteria 6582
1207 Ga0501084_0023755 3300054114 Bacteria 5113
1208 Ga0501084_0283473 3300054114 Unclassified 1399
1209 Ga0501084_0377726 3300054114 Bacteria 1198
1210 Ga0587083_0140200 3300059505 Unclassified 643
1211 Ga0501082_0009108 3300060353 Bacteria 8561
1212 Ga0501082_0015420 3300060353 Bacteria 6576
1213 Ga0501082_0976506 3300060353 Unclassified 741
1214 Ga0466962_0002011 3300061719 Bacteria 9595
1215 Ga0466962_0003932 3300061719 Bacteria 7110
1216 Ga0466962_0106029 3300061719 Bacteria 1351
1217 Ga0466962_0346922 3300061719 Unclassified 739
1218 Ga0530510_0001882 3300061734 Bacteria 14320
1219 Ga0530510_0012536 3300061734 Bacteria 5957
1220 Ga0530510_0018981 3300061734 Bacteria 4877
1221 Ga0530510_0020943 3300061734 Bacteria 4651
1222 Ga0530510_0037429 3300061734 Bacteria 3499
1223 Ga0530510_0514562 3300061734 Bacteria 908
1224 Ga0496103_0517701
1225 rootH1_10246936
1226 JGI25407J50210_10000450
1227 Ga0070658_10009482
1228 Ga0070658_10046978
1229 Ga0070658_10073197
1230 Ga0070658_10225309
1231 Ga0070658_10838237
1232 Ga0070683_100028510
1233 Ga0070683_100087423
1234 Ga0070683_100254650
1235 Ga0070683_100805009
1236 Ga0070690_100007766
1237 Ga0070690_100060869
1238 Ga0070666_10096419
1239 Ga0070680_100025767
1240 Ga0070680_100029925
1241 Ga0070680_100033727
1242 Ga0070680_100162730
1243 Ga0070680_100184861
1244 Ga0070680_100277812
1245 Ga0070682_100034271
1246 Ga0070682_100063207
1247 Ga0070682_100722823
1248 Ga0070682_100895444
1249 Ga0070682_101090374
1250 Ga0068868_100032026
1251 Ga0068868_100791820
1252 Ga0070660_100007999
1253 Ga0070660_100029085
1254 Ga0070660_100030204
1255 Ga0070660_100042015
1256 Ga0070660_100044339
1257 Ga0070691_10034801
1258 Ga0070691_10121600
1259 Ga0070691_10145266
1260 Ga0070687_100359597
1261 Ga0070687_100458759
1262 Ga0070661_100028012
1263 Ga0070661_101447066
1264 Ga0070692_10545659
1265 Ga0070668_100038323
1266 Ga0070668_100715657
1267 Ga0070669_100847835
1268 Ga0070671_100095763
1269 Ga0070671_100200912
1270 Ga0070671_100548595
1271 Ga0070671_101019235
1272 Ga0070671_101168013
1273 Ga0070674_100505210
1274 Ga0070673_100284632
1275 Ga0070673_101636740
1276 Ga0070688_100169032
1277 Ga0070659_100185861
1278 Ga0070659_100217393
1279 Ga0070659_100233407
1280 Ga0070659_100729072
1281 Ga0070703_10171684
1282 Ga0070703_10497386
1283 Ga0070709_10006002
1284 Ga0070709_10013639
1285 Ga0070709_10151008
1286 Ga0070709_10244384
1287 Ga0070709_10989563
1288 Ga0070714_100003425
1289 Ga0070714_100009659
1290 Ga0070714_100017036
1291 Ga0070714_100032067
1292 Ga0070714_100144675
1293 Ga0070714_100220243
1294 Ga0070713_100047947
1295 Ga0070713_100080400
1296 Ga0070713_100211383
1297 Ga0070713_100298512
1298 Ga0070713_100539512
1299 Ga0070713_100732940
1300 Ga0070710_10000870
1301 Ga0070710_10026521
1302 Ga0070710_10118983
1303 Ga0070710_10295280
1304 Ga0070710_10488251
1305 Ga0070710_10681804
1306 Ga0070711_100012846
1307 Ga0070711_100070548
1308 Ga0070711_100894423
1309 Ga0070705_100015077
1310 Ga0070705_100017215
1311 Ga0070705_100382139
1312 Ga0070705_101374479
1313 Ga0070700_100008900
1314 Ga0070700_100735079
1315 Ga0070694_100014241
1316 Ga0070694_100032741
1317 Ga0070694_100360896
1318 Ga0070694_100947250
1319 Ga0070694_101294966
1320 Ga0070708_100149636
1321 Ga0070708_100400282
1322 Ga0070663_100067238
1323 Ga0070678_100297783
1324 Ga0070678_100306880
1325 Ga0070678_100389711
1326 Ga0070662_100086743
1327 Ga0070681_10049353
1328 Ga0070681_10061907
1329 Ga0070681_10145778
1330 Ga0070681_10238657
1331 Ga0070681_10267786
1332 Ga0070681_10540684
1333 Ga0068867_100000419
1334 Ga0068867_100052443
1335 Ga0068867_100217449
1336 Ga0070685_10004312
1337 Ga0070706_100096353
1338 Ga0070706_100349073
1339 Ga0070706_100838949
1340 Ga0070707_100002503
1341 Ga0070707_100112015
1342 Ga0070707_100166816
1343 Ga0070707_100515497
1344 Ga0070707_100693653
1345 Ga0070698_100108665
1346 Ga0070698_100215687
1347 Ga0070698_100292606
1348 Ga0070699_100032717
1349 Ga0070699_100619915
1350 Ga0070679_100014066
1351 Ga0070679_100064501
1352 Ga0070679_100077476
1353 Ga0070679_100174102
1354 Ga0070679_100259808
1355 Ga0070679_100657631
1356 Ga0070679_100701175
1357 Ga0070684_100075578
1358 Ga0070684_100468029
1359 Ga0070684_101391850
1360 Ga0070697_100059513
1361 Ga0068853_100171735
1362 Ga0068853_100703705
1363 Ga0070672_100047107
1364 Ga0070672_100135899
1365 Ga0070686_100015245
1366 Ga0070695_100000106
1367 Ga0070695_100025858
1368 Ga0070695_100030671
1369 Ga0070695_100192294
1370 Ga0070695_100367976
1371 Ga0070695_100796676
1372 Ga0070696_100018911
1373 Ga0070696_100020126
1374 Ga0070696_100034350
1375 Ga0070696_100138111
1376 Ga0070696_100707171
1377 Ga0070693_100072111
1378 Ga0070693_100154525
1379 Ga0070693_100406346
1380 Ga0070693_100544324
1381 Ga0070665_100095756
1382 Ga0070704_100074250
1383 Ga0070704_100172120
1384 Ga0070704_100248717
1385 Ga0068855_100063144
1386 Ga0068855_100112282
1387 Ga0068855_100226606
1388 Ga0068855_100286379
1389 Ga0068855_100287692
1390 Ga0068855_100404887
1391 Ga0068855_100697374
1392 Ga0068855_101211774
1393 Ga0070664_100419805
1394 Ga0068854_100003253
1395 Ga0068856_100012137
1396 Ga0068856_100040457
1397 Ga0068856_100282786
1398 Ga0068856_100582698
1399 Ga0068856_100725971
1400 Ga0070702_100005126
1401 Ga0070702_100023594
1402 Ga0070702_100025724
1403 Ga0070702_100637980
1404 Ga0070702_100694454
1405 Ga0068852_100117475
1406 Ga0068852_100328691
1407 Ga0068852_101251207
1408 Ga0068852_101356203
1409 Ga0068864_100205746
1410 Ga0068866_10088459
1411 Ga0068861_100018620
1412 Ga0068861_100195048
1413 Ga0068861_100274732
1414 Ga0068860_100922051
1415 Ga0068860_101010881
1416 Ga0081455_10003816
1417 Ga0081455_10005873
1418 Ga0081538_10000435
1419 Ga0081538_10003328
1420 Ga0081538_10028156
1421 Ga0081540_1007276
1422 Ga0081539_10001011
1423 Ga0070717_10003099
1424 Ga0070717_10024528
1425 Ga0070717_10032359
1426 Ga0070717_10089097
1427 Ga0070717_10166381
1428 Ga0070717_10347458
1429 Ga0070717_10349413
1430 Ga0070715_10005681
1431 Ga0070716_100029384
1432 Ga0070716_100133139
1433 Ga0070716_100146287
1434 Ga0070716_100271460
1435 Ga0070716_100638413
1436 Ga0070712_100169359
1437 Ga0070712_100900959
1438 Ga0070712_101008213
1439 Ga0075367_10280865
1440 Ga0097621_100021600
1441 Ga0097621_100516143
1442 Ga0097621_101104542
1443 Ga0068871_100027740
1444 Ga0068871_100052886
1445 Ga0068871_100218867
1446 Ga0075428_100151134
1447 Ga0075431_100096728
1448 Ga0075431_101948996
1449 Ga0075434_100012215
1450 Ga0075434_100138379
1451 Ga0075434_100508946
1452 Ga0075434_101179843
1453 Ga0068865_100000269
1454 Ga0068865_100026125
1455 Ga0075436_100006756
1456 Ga0075436_100118450
1457 Ga0075435_100002731
1458 Ga0075435_100361361
1459 Ga0105240_10014499
1460 Ga0105240_10187008
1461 Ga0105240_11071385
1462 Ga0105240_11206088
1463 Ga0105240_11492467
1464 Ga0105240_11670351
1465 Ga0105240_11887323
1466 Ga0111539_10033139
1467 Ga0111539_10460153
1468 Ga0105245_10016809
1469 Ga0105245_10129749
1470 Ga0105245_10154293
1471 Ga0105245_10163519
1472 Ga0105245_10229543
1473 Ga0105245_10708423
1474 Ga0105247_10657317
1475 Ga0114129_10041196
1476 Ga0114129_10536596
1477 Ga0105243_10054426
1478 Ga0105243_10075428
1479 Ga0105241_10036307
1480 Ga0105241_10166633
1481 Ga0105241_11696115
1482 Ga0105241_12623849
1483 Ga0105242_10056023
1484 Ga0105242_10080040
1485 Ga0105242_10989247
1486 Ga0105248_10012557
1487 Ga0105248_10192131
1488 Ga0105248_10224775
1489 Ga0105248_10329962
1490 Ga0105237_10068438
1491 Ga0105237_11127563
1492 Ga0105238_10093399
1493 Ga0105249_10003662
1494 Ga0105249_10009480
1495 Ga0105249_10039919
1496 Ga0105249_10673792
1497 Ga0105239_10035049
1498 Ga0105239_10171509
1499 Ga0105239_10524635
1500 Ga0105239_10547996
1501 Ga0105239_10753207
1502 Ga0105239_11471691
1503 Ga0105246_10412334
1504 Ga0105246_10599069
1505 Ga0157320_1032014
1506 Ga0157373_10325543
1507 Ga0157373_10584281
1508 Ga0157373_11170257
1509 Ga0157371_10557486
1510 Ga0157371_11032058
1511 Ga0157371_11168824
1512 Ga0157370_10055431
1513 Ga0157370_10073197
1514 Ga0157370_10310199
1515 Ga0157370_10435425
1516 Ga0157369_10016604
1517 Ga0157369_10067620
1518 Ga0157369_10146300
1519 Ga0157369_10153852
1520 Ga0157369_10254717
1521 Ga0157374_10005704
1522 Ga0157374_10156083
1523 Ga0157374_12736583
1524 Ga0157378_10039466
1525 Ga0157378_10070463
1526 Ga0157378_10276192
1527 Ga0157378_10859023
1528 Ga0157378_11436529
1529 Ga0157378_11452375
1530 Ga0163162_10010825
1531 Ga0163162_10039717
1532 Ga0163162_10232459
1533 Ga0157372_10020621
1534 Ga0157372_10650332
1535 Ga0157372_10886745
1536 Ga0157372_11223933
1537 Ga0157372_12309997
1538 Ga0157372_12823749
1539 Ga0157372_13112230
1540 Ga0157375_10014254
1541 Ga0157375_10065178
1542 Ga0157375_10112408
1543 Ga0157375_10118020
1544 Ga0157375_10248826
1545 Ga0157375_11098246
1546 Ga0163163_10041709
1547 Ga0163163_10805092
1548 Ga0157380_10063275
1549 Ga0182008_10001839
1550 Ga0182008_10098827
1551 Ga0157377_10001454
1552 Ga0157376_10065286
1553 Ga0157376_10108444
1554 Ga0157376_10667750
1555 Ga0157376_12487565
1556 Ga0182007_10015583
1557 Ga0163161_10009018
1558 Ga0163161_10088175
1559 Ga0197907_10709808
1560 Ga0197907_11100010
1561 Ga0206356_10304527
1562 Ga0206356_10942522
1563 Ga0206356_11155746
1564 Ga0206356_11607730
1565 Ga0206356_11619724
1566 Ga0206354_10660436
1567 Ga0206353_11569701
1568 Ga0206353_12032259
1569 Ga0213871_10005010
1570 Ga0224712_10115863
1571 Ga0224712_10583324
1572 Ga0207653_10015032
1573 Ga0207692_10010365
1574 Ga0207692_10012991
1575 Ga0207692_10022223
1576 Ga0207692_10235605
1577 Ga0207642_10039473
1578 Ga0207710_10101614
1579 Ga0207688_10158092
1580 Ga0207647_10073751
1581 Ga0207685_10232439
1582 Ga0207699_10054111
1583 Ga0207699_10091693
1584 Ga0207699_10168150
1585 Ga0207645_10254771
1586 Ga0207705_10074903
1587 Ga0207705_10152230
1588 Ga0207684_10168628
1589 Ga0207684_10233873
1590 Ga0207684_10458500
1591 Ga0207684_10490080
1592 Ga0207654_10175874
1593 Ga0207654_10732306
1594 Ga0207707_10059555
1595 Ga0207707_10064555
1596 Ga0207707_10193396
1597 Ga0207707_10608679
1598 Ga0207695_10092451
1599 Ga0207693_10000699
1600 Ga0207693_10001049
1601 Ga0207693_10026878
1602 Ga0207693_10027988
1603 Ga0207693_10038114
1604 Ga0207693_11163822
1605 Ga0207693_11255666
1606 Ga0207663_10011201
1607 Ga0207663_10014821
1608 Ga0207663_10065108
1609 Ga0207663_10356680
1610 Ga0207663_10635702
1611 Ga0207660_10015302
1612 Ga0207660_10046060
1613 Ga0207660_10289038
1614 Ga0207660_10546929
1615 Ga0207660_10801212
1616 Ga0207660_11111121
1617 Ga0207662_10539072
1618 Ga0207662_10867222
1619 Ga0207657_10007767
1620 Ga0207657_10015251
1621 Ga0207657_10021691
1622 Ga0207657_10024610
1623 Ga0207657_10041550
1624 Ga0207657_10110219
1625 Ga0207649_10058557
1626 Ga0207649_11132906
1627 Ga0207652_10032198
1628 Ga0207652_10033399
1629 Ga0207652_10067623
1630 Ga0207652_10171983
1631 Ga0207652_10261456
1632 Ga0207652_10290124
1633 Ga0207652_10419303
1634 Ga0207652_10706657
1635 Ga0207646_10000502
1636 Ga0207646_10073373
1637 Ga0207646_10439548
1638 Ga0207646_10792966
1639 Ga0207646_11071483
1640 Ga0207681_10041996
1641 Ga0207694_10056009
1642 Ga0207694_10255122
1643 Ga0207687_10015761
1644 Ga0207687_10245862
1645 Ga0207700_10058384
1646 Ga0207700_10131897
1647 Ga0207700_10144233
1648 Ga0207700_10192486
1649 Ga0207700_10976191
1650 Ga0207664_10000789
1651 Ga0207664_10028157
1652 Ga0207664_10033946
1653 Ga0207664_10040027
1654 Ga0207664_10084701
1655 Ga0207664_10313691
1656 Ga0207664_10332147
1657 Ga0207664_10343395
1658 Ga0207664_10396498
1659 Ga0207664_10549489
1660 Ga0207644_10028140
1661 Ga0207690_10138992
1662 Ga0207690_10145626
1663 Ga0207690_10151005
1664 Ga0207690_10327095
1665 Ga0207690_10440841
1666 Ga0207690_10479403
1667 Ga0207706_10021585
1668 Ga0207686_10050201
1669 Ga0207709_10002432
1670 Ga0207709_10051636
1671 Ga0207670_10191897
1672 Ga0207669_10128579
1673 Ga0207704_10009494
1674 Ga0207704_10041516
1675 Ga0207665_10004539
1676 Ga0207665_10005937
1677 Ga0207665_10026358
1678 Ga0207665_10210308
1679 Ga0207665_10591413
1680 Ga0207691_10018525
1681 Ga0207691_10259386
1682 Ga0207711_10346423
1683 Ga0207711_10426129
1684 Ga0207711_10496749
1685 Ga0207689_10921381
1686 Ga0207661_10154301
1687 Ga0207661_10471511
1688 Ga0207661_10480548
1689 Ga0207661_10928286
1690 Ga0207679_10208866
1691 Ga0207667_10096976
1692 Ga0207667_10258030
1693 Ga0207667_10333440
1694 Ga0207667_10409514
1695 Ga0207667_10485173
1696 Ga0207667_11588106
1697 Ga0207651_11544450
1698 Ga0207712_10020566
1699 Ga0207712_11018156
1700 Ga0207668_10249289
1701 Ga0207668_10251601
1702 Ga0207640_10223653
1703 Ga0207640_11473164
1704 Ga0207640_11517365
1705 Ga0207677_10088825
1706 Ga0207677_10112984
1707 Ga0207677_10117123
1708 Ga0207639_10043044
1709 Ga0207639_10054656
1710 Ga0207678_10027318
1711 Ga0207678_10042931
1712 Ga0207678_10894260
1713 Ga0207708_10007994
1714 Ga0207708_10010110
1715 Ga0207708_10756472
1716 Ga0207702_10027407
1717 Ga0207702_10051427
1718 Ga0207702_10430533
1719 Ga0207702_10562346
1720 Ga0207702_10577781
1721 Ga0207702_10718403
1722 Ga0207702_10750799
1723 Ga0207702_10812900
1724 Ga0207648_10000729
1725 Ga0207648_10010693
1726 Ga0207676_10178680
1727 Ga0207675_100004302
1728 Ga0207675_100016438
1729 Ga0207675_100106174
1730 Ga0207675_100186641
1731 Ga0207683_10005318
1732 Ga0207683_10009738
1733 Ga0207683_10323557
1734 Ga0207683_10404413
1735 Ga0207698_10066000
1736 Ga0207698_10089108
1737 Ga0207698_10877295
1738 Ga0209966_1003416
1739 Ga0207428_10011614
1740 Ga0207428_10352970
1741 Ga0265319_1004321
1742 Ga0265334_10009422
1743 Ga0265334_10040347
1744 Ga0265334_10132196
1745 Ga0265318_10000065
1746 Ga0265318_10005617
1747 Ga0265318_10087185
1748 Ga0265322_10009372
1749 Ga0265338_10002456
1750 Ga0265338_10005902
1751 Ga0265338_10019684
1752 Ga0265338_10078845
1753 Ga0265338_10147697
1754 Ga0265330_10028891
1755 Ga0265332_10009518
1756 Ga0265320_10082307
1757 Ga0265320_10090639
1758 Ga0265325_10111830
1759 Ga0265325_10374259
1760 Ga0265329_10005149
1761 Ga0265329_10026605
1762 Ga0265329_10086034
1763 Ga0265340_10183375
1764 Ga0265339_10006175
1765 Ga0265339_10220957
1766 Ga0265331_10112240
1767 Ga0265327_10026720
1768 Ga0265327_10036954
1769 Ga0265327_10313381
1770 Ga0265316_10013688
1771 Ga0265316_10328355
1772 Ga0265316_10615264
1773 Ga0307408_101844651
1774 Ga0265313_10060039
1775 Ga0265313_10073422
1776 Ga0265314_10012609
1777 Ga0265314_10101572
1778 Ga0265314_10296245
1779 Ga0265342_10047131
1780 Ga0265342_10068015
1781 Ga0265342_10202343
1782 Ga0265342_10235599
1783 Ga0265342_10528904
1784 Ga0307409_100148520
1785 Ga0307416_100371810
1786 Ga0307411_10369542
1787 Ga0307415_100544082
1788 Ga0307415_102352882
1789 Ga0373930_0013891
1790 Ga0373926_0065166
1791 Ga0373949_0028987
1792 Ga0373949_0045929
1793 Ga0373951_0146209
1794 Ga0373952_0018155
1795 Ga0373932_0114348
1796 Ga0373932_0141006
1797 Ga0373936_0585438
1798 Ga0373939_0307337
1799 Ga0373941_0036429
1800 Ga0373941_0115890
1801 Ga0373945_0006611
1802 Ga0373945_0109493
1803 Ga0373953_0291420
1804 Ga0373956_0031081
1805 Ga0373957_0129169
1806 Ga0373960_0003654
1807 Ga0373943_0013168
1808 Ga0373946_0117810
1809 Ga0373931_0058833
1810 Ga0373931_0582700
1811 Ga0373931_0856851
1812 Ga0373931_1071628
1813 Ga0373935_0108295
1814 Ga0373935_0155673
1815 Ga0373935_0356425
1816 Ga0373935_0517514
1817 Ga0373933_0617998
1818 Ga0373947_0002361
1819 Ga0373947_1112785
1820 Ga0373937_1077367
1821 Ga0373925_0013132
1822 Ga0373925_0896491
1823 Ga0373925_1429370
1824 Ga0395899_0000855
1825 Ga0395899_0003647
1826 Ga0395899_0003808
1827 Ga0395899_0011930
1828 Ga0395899_0057859
1829 Ga0395899_0066433
1830 Ga0395899_0283048
1831 Ga0395899_0398574
1832 Ga0395899_0602386
1833 Ga0395900_0000988
1834 Ga0395900_0001815
1835 Ga0395900_0002063
1836 Ga0395900_0006089
1837 Ga0395900_0006883
1838 Ga0395900_0015254
1839 Ga0395900_0023619
1840 Ga0395900_0029608
1841 Ga0395900_0037663
1842 Ga0395900_0059472
1843 Ga0395900_0125938
1844 Ga0395900_0170566
1845 Ga0395900_0578180
1846 Ga0395900_0670615
1847 Ga0395900_0926614
1848 Ga0395898_0001851
1849 Ga0395898_0005501
1850 Ga0395898_0009660
1851 Ga0395898_0010358
1852 Ga0395898_0010653
1853 Ga0395898_0021055
1854 Ga0395898_0060661
1855 Ga0395898_0081955
1856 Ga0395898_0101093
1857 Ga0395898_0317136
1858 Ga0395898_0524100
1859 Ga0395898_1239195
1860 Ga0395898_1772913
1861 Ga0395905_0002715
1862 Ga0395905_0003527
1863 Ga0395905_0004780
1864 Ga0395905_0005093
1865 Ga0395905_0007145
1866 Ga0395905_0014219
1867 Ga0395905_0016488
1868 Ga0395905_0031792
1869 Ga0395905_0065321
1870 Ga0395905_0192669
1871 Ga0395905_0197616
1872 Ga0395905_0300467
1873 Ga0395905_0724884
1874 Ga0395905_0754904
1875 Ga0395905_1369700
1876 Ga0395901_0001046
1877 Ga0395901_0001699
1878 Ga0395901_0017122
1879 Ga0395901_0020132
1880 Ga0395901_0020914
1881 Ga0395901_0023314
1882 Ga0395901_0023336
1883 Ga0395901_0026916
1884 Ga0395901_0029314
1885 Ga0395901_0034882
1886 Ga0395901_0052204
1887 Ga0395901_0124759
1888 Ga0395901_0155154
1889 Ga0395901_0252693
1890 Ga0395901_0309946
1891 Ga0395901_0311363
1892 Ga0395901_0393519
1893 Ga0395901_0410610
1894 Ga0395901_0739048
1895 Ga0436360_1202685
1896 Ga0451789_0679119
1897 Ga0451800_1000072
1898 Ga0451804_0350657
1899 Ga0451807_0386844
1900 Ga0451835_0352271
1901 Ga0451851_0134753
1902 Ga0451851_1194924
1903 Ga0451855_1544268
1904 Ga0451853_0421655
1905 Ga0451853_1430403
1906 Ga0451853_2263295
1907 Ga0439448_0010108
1908 Ga0439448_0169426
1909 Ga0439454_033538
1910 Ga0439463_094006
1911 Ga0450923_086057
1912 Ga0450908_016961
1913 Ga0439460_0278507
1914 Ga0439440_0172541
1915 Ga0466972_0280379
1916 Ga0466965_0728045
1917 Ga0466966_0170455
1918 Ga0466966_0227404
1919 Ga0466961_0083010
1920 Ga0466961_0437122
1921 Ga0466963_0002006
1922 Ga0466963_0002668
1923 Ga0466963_0002932
1924 Ga0466963_0006305
1925 Ga0466963_0007463
1926 Ga0466963_0008542
1927 Ga0466963_0008804
1928 Ga0466963_0015548
1929 Ga0466963_0030071
1930 Ga0466963_0036743
1931 Ga0466963_0043566
1932 Ga0466963_0064925
1933 Ga0466963_0184519
1934 Ga0466963_0225109
1935 Ga0466963_0225822
1936 Ga0466963_0234454
1937 Ga0466963_0243816
1938 Ga0466964_0002663
1939 Ga0466964_0003457
1940 Ga0466964_0004480
1941 Ga0466964_0006257
1942 Ga0466964_0024038
1943 Ga0466964_0096262
1944 Ga0466964_0200596
1945 Ga0466964_0404640
1946 Ga0466971_0002599
1947 Ga0466971_0024052
1948 Ga0466971_0291099
1949 Ga0466968_0006248
1950 Ga0466968_0089598
1951 Ga0466968_0219915
1952 Ga0466970_0588577
1953 Ga0466957_0024215
1954 Ga0466957_0073905
1955 Ga0466957_0082801
1956 Ga0466957_0100193
1957 Ga0466957_0130237
1958 Ga0466957_0181285
1959 Ga0466957_0217806
1960 Ga0466957_0352786
1961 Ga0466957_1102298
1962 Ga0466960_0074010
1963 Ga0466959_0006028
1964 Ga0466959_0017610
1965 Ga0466959_0087487
1966 Ga0466959_0362906
1967 Ga0466959_0416606
1968 Ga0466959_0993707
1969 Ga0451576_0880536
1970 Ga0466958_0002675
1971 Ga0466958_0008643
1972 Ga0466958_0020069
1973 Ga0466958_0085058
1974 Ga0466958_0092512
1975 Ga0466958_0161536
1976 Ga0466958_0191493
1977 Ga0466967_0006182
1978 Ga0466967_0008612
1979 Ga0466967_0014509
1980 Ga0466967_0016742
1981 Ga0466967_0028335
1982 Ga0466967_0034359
1983 Ga0466967_0035140
1984 Ga0466967_0045571
1985 Ga0466967_0057084
1986 Ga0466967_0061309
1987 Ga0466967_0062554
1988 Ga0466967_0063431
1989 Ga0466967_0083214
1990 Ga0466967_0116397
1991 Ga0466967_0122681
1992 Ga0466967_0133638
1993 Ga0466967_0151088
1994 Ga0466967_0172763
1995 Ga0466967_0176333
1996 Ga0466967_0317810
1997 Ga0466967_0324464
1998 Ga0466967_0326028
1999 Ga0466967_0438439
2000 Ga0466967_0513968
2001 Ga0466967_0557468
2002 Ga0495592_0001047
2003 Ga0495592_0129070
2004 Ga0495592_0287037
2005 Ga0495603_0002533
2006 Ga0495603_0071520
2007 Ga0495603_0233866
2008 Ga0495629_0074536
2009 Ga0495629_0117139
2010 Ga0495629_0240813
2011 Ga0495641_0015369
2012 Ga0495641_0027317
2013 Ga0495641_0108039
2014 Ga0495641_0233079
2015 Ga0495651_0072906
2016 Ga0495651_0101131
2017 Ga0495653_0041210
2018 Ga0495653_0044446
2019 Ga0495653_0251323
2020 Ga0495653_0282672
2021 Ga0495580_0364736
2022 Ga0495580_0816732
2023 Ga0495582_0006869
2024 Ga0495582_0063961
2025 Ga0495582_0096284
2026 Ga0495582_0124150
2027 Ga0495582_0241402
2028 Ga0495582_0561372
2029 Ga0495605_0081882
2030 Ga0495605_0088762
2031 Ga0495639_0000877
2032 Ga0495639_0006207
2033 Ga0495639_0466887
2034 Ga0495662_0009854
2035 Ga0495662_0030505
2036 Ga0495664_0030024
2037 Ga0495664_0093337
2038 Ga0495584_0014522
2039 Ga0495584_0022200
2040 Ga0495585_0103556
2041 Ga0495594_0002098
2042 Ga0495594_0423919
2043 Ga0495596_0072140
2044 Ga0495596_0309522
2045 Ga0495607_0044751
2046 Ga0495608_0366157
2047 Ga0495608_0422469
2048 Ga0495608_0945563
2049 Ga0495618_0113340
2050 Ga0495618_0135170
2051 Ga0495628_0004790
2052 Ga0495628_0186999
2053 Ga0495628_0246291
2054 Ga0495628_0368726
2055 Ga0495630_0003203
2056 Ga0495630_0051348
2057 Ga0495630_0074378
2058 Ga0495630_0123725
2059 Ga0495631_0152154
2060 Ga0495637_0105742
2061 Ga0495644_0009530
2062 Ga0495644_0082940
2063 Ga0495644_0349382
2064 Ga0495644_0369561
2065 Ga0495666_0000867
2066 Ga0495666_0179235
2067 Ga0495666_0364333
2068 Ga0495642_0312683
2069 Ga0495652_0029275
2070 Ga0495652_0065759
2071 Ga0495652_0084337
2072 Ga0495652_0353232
2073 Ga0495665_0019091
2074 Ga0495665_0033238
2075 Ga0495665_0424895
2076 Ga0495640_0004109
2077 Ga0495640_0082573
2078 Ga0495640_0115901
2079 Ga0495640_0396743
2080 Ga0495640_0731717
2081 Ga0495586_0010965
2082 Ga0495586_0055339
2083 Ga0495586_0447187
2084 Ga0495587_0069988
2085 Ga0495587_0678216
2086 Ga0495609_0031795
2087 Ga0495609_0106559
2088 Ga0495621_0171644
2089 Ga0495645_0078317
2090 Ga0495645_0141264
2091 Ga0495622_0089452
2092 Ga0495667_0002076
2093 Ga0495667_0043857
2094 Ga0495667_0062620
2095 Ga0495667_0146747
2096 Ga0495667_0335516
2097 Ga0495667_0385354
2098 Ga0495656_0043675
2099 Ga0495656_0194110
2100 Ga0495656_0424036
2101 Ga0495656_0472058
2102 Ga0495634_0035965
2103 Ga0495634_0190810
2104 Ga0495634_0239921
2105 Ga0495635_0025222
2106 Ga0495635_0036622
2107 Ga0495635_0083039
2108 Ga0495635_0112181
2109 Ga0495635_0132377
2110 Ga0495659_0100369
2111 Ga0495661_0247731
2112 Ga0495661_0277446
2113 Ga0495588_0037931
2114 Ga0495657_0088334
2115 Ga0495657_0207979
2116 Ga0495657_0261536
2117 Ga0495599_0074553
2118 Ga0495599_0162116
2119 Ga0495623_0045462
2120 Ga0495623_0378008
2121 Ga0495646_0050909
2122 Ga0495646_0059593
2123 Ga0495646_0078057
2124 Ga0495647_0005813
2125 Ga0495647_0104038
2126 Ga0495647_0249509
2127 Ga0495658_0009961
2128 Ga0495658_0029687
2129 Ga0495658_0061758
2130 Ga0495658_0079339
2131 Ga0495658_0163125
2132 Ga0495658_0360976
2133 Ga0495613_0002918
2134 Ga0495613_0084540
2135 Ga0495613_0088452
2136 Ga0495613_0115405
2137 Ga0495613_0217534
2138 Ga0495613_0248891
2139 Ga0495624_0002334
2140 Ga0495624_0016274
2141 Ga0495624_0192245
2142 Ga0495624_0522156
2143 Ga0495589_0114626
2144 Ga0495600_0071080
2145 Ga0495600_0088670
2146 Ga0495600_0363640
2147 Ga0495581_0010204
2148 Ga0495581_0059738
2149 Ga0495581_0069837
2150 Ga0495581_0104785
2151 Ga0495581_0436445
2152 Ga0495604_0069150
2153 Ga0495636_0033221
2154 Ga0495636_0139826
2155 Ga0495636_0199105
2156 Ga0495674_0057496
2157 Ga0495674_0198639
2158 Ga0495674_0321001
2159 Ga0495674_0364173
2160 Ga0495674_0546456
2161 Ga0495676_0023828
2162 Ga0495676_0028473
2163 Ga0495676_0106124
2164 Ga0495676_0159285
2165 Ga0495676_0693272
2166 Ga0495680_0062558
2167 Ga0495675_0211176
2168 Ga0495677_0048266
2169 Ga0495677_0120451
2170 Ga0495685_172602
2171 Ga0495684_0029560
2172 Ga0495684_0041333
2173 Ga0495684_0410742
2174 Ga0495593_0046814
2175 Ga0495602_0032377
2176 Ga0495602_0050380
2177 Ga0495602_0393103
2178 Ga0495614_0010382
2179 Ga0495614_0131177
2180 Ga0495614_0181237
2181 Ga0495614_0246782
2182 Ga0495626_0429544
2183 Ga0496100_0017841
2184 Ga0496100_0050640
2185 Ga0496100_0266646
2186 Ga0496100_0313550
2187 Ga0496100_0490154
2188 Ga0496100_0640480
2189 Ga0496100_0793961
2190 Ga0496101_0127120
2191 Ga0496101_0151615
2192 Ga0496101_0153102
2193 Ga0496101_0232186
2194 Ga0496102_0003780
2195 Ga0496102_0045690
2196 Ga0496102_0075999
2197 Ga0496102_0145423
2198 Ga0496102_0180186
2199 Ga0496102_0365130
2200 Ga0496103_0005252
2201 Ga0496103_0005964
2202 Ga0496103_0006783
2203 Ga0496103_0011753
2204 Ga0496103_0025899
2205 Ga0496103_0096859
2206 Ga0496103_0180692
2207 Ga0496104_0008696
2208 Ga0496104_0017204
2209 Ga0496104_0056716
2210 Ga0496104_0250604
2211 Ga0496104_0329163
2212 Ga0496104_0498756
2213 Ga0496104_0993542
2214 Ga0496104_1169422
2215 Ga0496105_0000774
2216 Ga0496105_0044361
2217 Ga0496105_0060312
2218 Ga0496105_0069810
2219 Ga0496105_0145712
2220 Ga0496105_0151850
2221 Ga0496105_0161934
2222 Ga0496105_0888539
2223 Ga0496106_0013297
2224 Ga0496106_0022161
2225 Ga0496106_0087181
2226 Ga0496106_0296226
2227 Ga0496106_0456448
2228 Ga0496106_0495979
2229 Ga0496106_1202343
2230 Ga0496107_0047235
2231 Ga0496107_0055251
2232 Ga0496107_0059682
2233 Ga0496107_0191159
2234 Ga0496107_0695377
2235 Ga0496108_0006605
2236 Ga0496108_0012735
2237 Ga0496108_0020741
2238 Ga0496108_0233016
2239 Ga0496108_0313846
2240 Ga0496108_0316935
2241 Ga0496108_1219788
2242 Ga0496109_0001185
2243 Ga0496109_0010434
2244 Ga0496109_0037853
2245 Ga0496109_0059987
2246 Ga0496109_0064459
2247 Ga0496109_0129561
2248 Ga0496109_0165862
2249 Ga0496109_0271725
2250 Ga0496109_0327860
2251 Ga0496109_0336585
2252 Ga0496109_0690118
2253 Ga0496109_0775652
2254 Ga0496109_1242363
2255 Ga0496110_0001930
2256 Ga0496110_0061900
2257 Ga0496110_0079920
2258 Ga0496110_0084393
2259 Ga0496110_0122957
2260 Ga0496110_0865903
2261 Ga0496111_0013131
2262 Ga0496111_0016941
2263 Ga0496111_0025491
2264 Ga0496111_0029739
2265 Ga0496111_0379440
2266 Ga0496111_0385835
2267 Ga0496111_0532181
2268 Ga0496111_0597097
2269 Ga0496112_0001626
2270 Ga0496112_0010813
2271 Ga0496112_0022196
2272 Ga0496112_0026094
2273 Ga0496112_0063900
2274 Ga0496112_0232221
2275 Ga0496112_0295395
2276 Ga0496112_0590599
2277 Ga0496112_1271487
2278 Ga0496113_0000174
2279 Ga0496113_0029988
2280 Ga0496113_0161588
2281 Ga0496113_0234408
2282 Ga0496113_0356266
2283 Ga0496113_0621746
2284 Ga0496113_0732505
2285 Ga0496113_0807908
2286 Ga0496113_1089824
2287 Ga0496114_0018406
2288 Ga0496114_0019355
2289 Ga0496114_0051967
2290 Ga0496114_0103198
2291 Ga0496114_0288937
2292 Ga0496114_0373262
2293 Ga0496114_0762099
2294 Ga0496115_0020362
2295 Ga0496115_0036936
2296 Ga0496115_0037849
2297 Ga0496115_0097812
2298 Ga0496115_0196047
2299 Ga0496115_0646164
2300 Ga0501031_0049719
2301 Ga0501033_0035501
2302 Ga0501036_0014593
2303 Ga0501036_0046327
2304 Ga0501038_0016243
2305 Ga0501039_0017007
2306 Ga0501039_0018576
2307 Ga0501039_1066350
2308 Ga0501040_0016148
2309 Ga0501040_0020766
2310 Ga0501040_0022945
2311 Ga0501040_0042835
2312 Ga0501041_0001170
2313 Ga0501041_0071486
2314 Ga0501042_0008113
2315 Ga0501042_0102983
2316 Ga0501042_0105050
2317 Ga0501042_0115359
2318 Ga0501043_0056308
2319 Ga0501046_0289757
2320 Ga0501048_0043273
2321 Ga0501048_0060236
2322 Ga0501048_0214595
2323 Ga0501067_0002546
2324 Ga0501067_0027507
2325 Ga0501068_0057575
2326 Ga0501068_0110349
2327 Ga0501068_0299208
2328 Ga0501069_0012316
2329 Ga0501069_0021334
2330 Ga0501069_0054283
2331 Ga0501069_0460293
2332 Ga0501069_0904664
2333 Ga0501070_0142436
2334 Ga0501070_0398511
2335 Ga0501071_0001490
2336 Ga0501071_0013539
2337 Ga0501071_0097781
2338 Ga0501071_0137802
2339 Ga0501071_0228847
2340 Ga0501071_0328973
2341 Ga0501071_0432172
2342 Ga0501072_0001558
2343 Ga0501072_0019748
2344 Ga0501072_0069243
2345 Ga0501072_0087270
2346 Ga0501072_0126752
2347 Ga0501072_0128644
2348 Ga0501072_0196721
2349 Ga0501074_0009147
2350 Ga0501074_0099874
2351 Ga0501074_0175667
2352 Ga0501074_0231555
2353 Ga0501075_0023278
2354 Ga0501075_0033702
2355 Ga0501075_0035257
2356 Ga0501075_0042288
2357 Ga0501075_0056499
2358 Ga0501075_0063325
2359 Ga0501075_0476657
2360 Ga0501076_0019912
2361 Ga0501076_0035198
2362 Ga0501076_0073434
2363 Ga0501076_0108740
2364 Ga0501077_0050824
2365 Ga0501077_0073290
2366 Ga0501079_0014176
2367 Ga0501079_0023324
2368 Ga0501079_0029148
2369 Ga0501079_0034365
2370 Ga0501080_0023671
2371 Ga0501080_0173336
2372 Ga0501080_0270094
2373 Ga0501081_0062685
2374 Ga0501081_0107172
2375 Ga0501081_0142595
2376 Ga0501081_0190495
2377 Ga0501081_0307186
2378 Ga0501081_0327002
2379 Ga0501081_0513407
2380 Ga0501083_0002636
2381 Ga0501045_0003524
2382 Ga0501045_0017164
2383 Ga0501045_0190361
2384 nmdc:mga05p37_103965_c1
2385 nmdc:mga05p37_125342_c1
2386 nmdc:mga05p37_20308_c1
2387 nmdc:mga05p37_316820_c1
2388 nmdc:mga06r32_350821_c1
2389 nmdc:mga06r32_509054_c1
2390 nmdc:mga06r32_71444_c1
2391 nmdc:mga08y16_233788_c1
2392 nmdc:mga08y16_302132_c1
2393 nmdc:mga0n895_10843_c1
2394 nmdc:mga0n895_1091422_c1
2395 nmdc:mga0n895_113497_c1
2396 nmdc:mga0n895_212455_c1
2397 nmdc:mga0n895_644451_c1
2398 nmdc:mga0n895_783874_c1
2399 nmdc:mga0rr50_106172_c1
2400 nmdc:mga0rr50_151098_c1
2401 nmdc:mga0rr50_170371_c1
2402 nmdc:mga0rr50_200196_c1
2403 nmdc:mga0rr50_665421_c1
2404 nmdc:mga08x19_163556_c1
2405 nmdc:mga08x19_232640_c1
2406 nmdc:mga0a205_23321_c1
2407 nmdc:mga0a205_46526_c1
2408 Ga0495601_0015514
2409 Ga0495601_0025347
2410 Ga0495601_0056965
2411 Ga0495601_0142240
2412 Ga0495601_0196217
2413 Ga0495601_0227023
2414 Ga0495601_0679254
2415 Ga0495612_0024789
2416 Ga0495655_0077943
2417 Ga0495655_0143051
2418 Ga0495595_0019057
2419 Ga0495595_0225004
2420 Ga0495595_0290693
2421 Ga0495595_0291375
2422 Ga0495619_0007030
2423 Ga0495619_0021703
2424 Ga0495619_0025564
2425 Ga0495619_0119289
2426 Ga0495619_0329682
2427 Ga0500566_0111911
2428 Ga0501084_0009197
2429 Ga0501084_0014265
2430 Ga0501084_0023755
2431 Ga0501084_0283473
2432 Ga0501084_0377726
2433 Ga0587083_0140200
2434 Ga0501082_0009108
2435 Ga0501082_0015420
2436 Ga0501082_0976506
2437 Ga0466962_0002011
2438 Ga0466962_0003932
2439 Ga0466962_0106029
2440 Ga0466962_0346922
2441 Ga0530510_0001882
2442 Ga0530510_0012536
2443 Ga0530510_0018981
2444 Ga0530510_0020943
2445 Ga0530510_0037429
2446 Ga0530510_0514562

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

24

127

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tpm-assembly2.cif.gz_D 2.8 angstrom crystal structure of the c-terminal dimerization domain of transcriptional regulator pdhr from escherichia coli. 0.8547 14 43
3kkg-assembly1.cif.gz_A-2 crystal structure of putative snoal-like polyketide cyclase (yp_509242.1) from jannaschia sp. ccs1 at 1.40 a resolution 0.8494 12 143
3ehc-assembly1.cif.gz_A crystal structure of a snoal-like polyketide cyclase (atu3018) from agrobacterium tumefaciens str. c58 at 2.12 a resolution 0.8486 22 143
5tpm-assembly2.cif.gz_C 2.8 angstrom crystal structure of the c-terminal dimerization domain of transcriptional regulator pdhr from escherichia coli. 0.8461 14 43
3fgy-assembly1.cif.gz_B crystal structure of a ntf2-like protein (bxe_b1094) from burkholderia xenovorans lb400 at 1.59 a resolution 0.8454 20 143
ID Description Score Start End Superfamily
af_P0ACM2_81_217_1.20.120.530 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);GntR ligand-binding domain-like 0.8864 14 43 1.20.120.530
af_Q6TMK2_24_122_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8738 45 143 3.10.450.50
af_Q6ID84_103_213_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8592 43 137 3.10.450.50
5tpmB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);GntR ligand-binding domain-like 0.8527 14 43 1.20.120.530
3ehcA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8497 22 143 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A538LJZ4-F1-model_v4 Nuclear transport factor 2 family protein 0.9999 1 151 GO:0030638
AF-A0A7Z9M6L7-F1-model_v4 Nuclear transport factor 2 family protein 0.9982 5 143 GO:0030638
AF-A0A7Z9N6J8-F1-model_v4 Nuclear transport factor 2 family protein 0.998 5 143 GO:0030638
AF-A0A382IAU1-F1-model_v4 SnoaL-like domain-containing protein 0.9964 5 139 GO:0030638
AF-A0A381VF20-F1-model_v4 SnoaL-like domain-containing protein 0.9953 1 143 GO:0030638

Map