F491714
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1209 | 468 | 991 | 359 |
Family's Representative Sequence
| Representative Sequence | 3300046517|Ga0495630_0073954|Ga0495630_0073954_1264_2535 |
| Length | 423 |
| Sequence | MRLICTSGVLPMEWALSAKIRLMAGSLYSVELTAKGMLLACSRPVQANVQAPQQSMALQRQRFAIMNRRYSWPLWTLAGVVVLLIALHIALPYMVRNYLNDKLADMGAYRGQINDVDLALWRGAYKINGLKIVKIDGKIPVPFVNAPLIDLSVSWHSLWYNHAVVAEVQFFHPEVNFVDGGANKQNSQTGQGTDWRAQLGKLLPITLNEVRIFDGKISFRNFNSKPPVNMNATQVNASIFNLTNVVDTKGKRDARFEGKALLLGQAPLETTATFDPLSNFEDFEFRLRVKDIELKRMNDFASAYGKFDFNAGHGDVVIEAQAKKAQLNGYIKPLLKDVDVFNWQQDVENKDKGIFRSIWEAIVGGSETVLKNQAKNQFATRVELSGSVHRQDVSAFQAFLQILRNGFIQAFNARYERPKPDAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 6 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 7 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 8 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 9 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 10 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 11 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 12 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 13 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 14 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 15 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 16 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 17 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 18 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 19 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 20 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 21 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 22 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 23 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 24 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 25 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 26 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 27 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 28 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 29 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 30 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 31 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 32 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 33 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 34 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 35 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 36 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 37 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 38 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 39 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 40 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 41 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 42 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 43 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 44 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 45 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 46 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 47 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 48 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 49 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 50 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 51 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 52 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 53 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 54 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 55 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 56 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 57 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 58 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 59 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 60 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 61 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 62 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 63 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 64 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 65 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 66 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 67 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 68 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 69 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 70 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 71 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 72 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 73 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 74 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 75 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 76 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 77 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 78 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 79 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 80 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 81 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 82 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 83 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 84 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 85 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 86 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 87 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 88 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 89 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 90 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 91 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 92 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 93 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 94 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 95 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 96 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 97 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 98 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 99 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 100 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 101 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 102 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 103 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 104 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 105 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 106 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 107 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 108 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 109 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 110 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 111 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 112 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 113 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 114 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 115 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 116 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 117 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 118 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 119 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 120 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 121 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 122 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 123 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 124 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 125 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 126 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 127 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 128 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 129 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 130 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 131 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 132 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 133 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 134 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 135 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 136 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 137 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 138 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 139 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 140 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 141 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 142 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 143 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 144 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 145 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 146 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 147 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 148 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 149 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 150 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 151 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 152 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 153 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 154 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 155 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 156 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 157 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 158 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 159 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 160 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 161 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 162 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 163 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 164 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 165 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 166 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 167 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 168 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 169 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 170 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 171 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 172 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 173 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 174 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 175 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 176 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 177 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 178 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 179 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 180 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 181 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 182 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 183 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 184 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 185 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 186 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 187 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 188 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 189 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 190 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 191 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 192 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 193 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 194 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 195 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 196 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 197 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 198 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 199 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 200 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 201 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 202 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 203 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 204 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 205 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 206 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 207 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 208 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 209 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 210 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 211 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 212 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 217 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 220 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 221 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 222 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 223 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 224 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 225 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 226 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 227 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 228 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 237 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 238 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 246 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 247 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 248 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 249 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 251 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 261 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 264 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 283 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 284 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 286 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 288 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 289 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 290 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 291 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 292 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 293 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 294 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 295 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 296 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 297 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 298 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 299 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 300 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 301 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 302 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 303 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 304 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 305 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 306 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 307 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 308 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 309 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 310 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 311 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 312 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 313 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 314 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 315 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 316 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 317 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 318 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 319 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 320 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 321 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 322 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 323 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 324 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 325 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 326 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 327 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 328 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 329 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 330 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 331 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 332 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 333 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 334 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 335 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 336 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 337 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 417 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 418 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 419 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 420 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 421 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 422 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 423 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 424 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 425 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 426 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 427 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 428 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 429 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 430 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 431 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 435 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 436 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 437 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 439 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 440 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 441 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 442 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 443 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 444 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 445 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 446 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 447 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 448 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 449 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 450 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 451 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 452 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 453 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 454 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 455 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 456 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 457 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 458 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 459 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 460 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 461 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 462 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 463 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 464 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 465 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 466 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 467 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 468 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.97 |
| Metatranscriptomes | 0 |
| Isolates | 18.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.96 |
| Nodule | 1.99 |
| Rhizoplane | 6.04 |
| Rhizosphere | 75.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_6404 | 2124908027 | Bacteria | 7500 |
| 2 | MRS2a_Contig_916 | 2124908027 | Bacteria | 7402 |
| 3 | SwRhRL2b_contig_1718832 | 2162886007 | Bacteria | 2117 |
| 4 | SwRhRL2b_contig_2047565 | 2162886007 | Bacteria | 1500 |
| 5 | SwRhRL2b_contig_3032464 | 2162886007 | Bacteria | 2423 |
| 6 | JGI25162J39368_1000085 | 3300002737 | Bacteria | 107722 |
| 7 | JGI25154J39366_1003253 | 3300002738 | Bacteria | 3530 |
| 8 | JGI25163J39215_1000217 | 3300002771 | Bacteria | 21584 |
| 9 | JGI25164J39214_1000063 | 3300002772 | Bacteria | 107722 |
| 10 | JGI25165J46597_1000160 | 3300003214 | Bacteria | 107722 |
| 11 | Ga0055538_1000078 | 3300003751 | Bacteria | 86114 |
| 12 | Ga0055539_1000119 | 3300003752 | Bacteria | 86114 |
| 13 | Ga0055533_1000127 | 3300003756 | Bacteria | 86114 |
| 14 | Ga0055532_1000068 | 3300003758 | Bacteria | 138828 |
| 15 | Ga0055525_1000163 | 3300003759 | Bacteria | 86114 |
| 16 | Ga0055536_1000173 | 3300003781 | Bacteria | 53972 |
| 17 | Ga0055536_1000362 | 3300003781 | Bacteria | 33679 |
| 18 | Ga0055536_1000391 | 3300003781 | Bacteria | 31787 |
| 19 | Ga0055530_10000113 | 3300003791 | Bacteria | 70767 |
| 20 | Ga0055530_10000196 | 3300003791 | Bacteria | 54353 |
| 21 | Ga0055530_10023505 | 3300003791 | Bacteria | 1768 |
| 22 | Ga0055530_10024949 | 3300003791 | Bacteria | 1680 |
| 23 | Ga0055540_1000154 | 3300003792 | Bacteria | 67934 |
| 24 | Ga0055540_1000170 | 3300003792 | Bacteria | 64696 |
| 25 | Ga0055540_1000218 | 3300003792 | Bacteria | 54199 |
| 26 | Ga0055531_10000842 | 3300003794 | Bacteria | 25309 |
| 27 | Ga0055541_1000079 | 3300003841 | Bacteria | 86114 |
| 28 | Ga0065714_10002499 | 3300005288 | Bacteria | 16092 |
| 29 | Ga0065714_10003605 | 3300005288 | Bacteria | 6593 |
| 30 | Ga0065714_10009859 | 3300005288 | Bacteria | 2220 |
| 31 | Ga0065714_10011908 | 3300005288 | Bacteria | 3918 |
| 32 | Ga0065714_10065019 | 3300005288 | Bacteria | 13914 |
| 33 | Ga0065714_10066956 | 3300005288 | Bacteria | 6058 |
| 34 | Ga0065714_10079310 | 3300005288 | Bacteria | 2526 |
| 35 | Ga0065714_10081673 | 3300005288 | Bacteria | 2358 |
| 36 | Ga0065714_10083084 | 3300005288 | Bacteria | 2270 |
| 37 | Ga0065714_10086053 | 3300005288 | Bacteria | 2119 |
| 38 | Ga0065714_10086697 | 3300005288 | Bacteria | 2086 |
| 39 | Ga0065714_10108174 | 3300005288 | Bacteria | 1492 |
| 40 | Ga0065704_10003637 | 3300005289 | Bacteria | 4069 |
| 41 | Ga0065704_10072784 | 3300005289 | Bacteria | 8012 |
| 42 | Ga0065704_10119990 | 3300005289 | Bacteria | 1790 |
| 43 | Ga0065704_10128981 | 3300005289 | Bacteria | 1655 |
| 44 | Ga0065704_10138562 | 3300005289 | Bacteria | 1542 |
| 45 | Ga0065712_10002299 | 3300005290 | Bacteria | 6611 |
| 46 | Ga0065715_10005136 | 3300005293 | Bacteria | 3683 |
| 47 | Ga0070670_100001033 | 3300005331 | Bacteria | 22053 |
| 48 | Ga0070661_100000060 | 3300005344 | Bacteria | 86915 |
| 49 | Ga0070669_100000997 | 3300005353 | Bacteria | 20611 |
| 50 | Ga0070662_100002077 | 3300005457 | Bacteria | 12277 |
| 51 | Ga0070662_100011144 | 3300005457 | Bacteria | 5923 |
| 52 | Ga0068853_100035771 | 3300005539 | Bacteria | 4220 |
| 53 | Ga0070665_100030324 | 3300005548 | Bacteria | 5443 |
| 54 | Ga0070664_100000202 | 3300005564 | Bacteria | 42546 |
| 55 | Ga0068854_100067332 | 3300005578 | Bacteria | 2608 |
| 56 | Ga0068851_10000055 | 3300005834 | Bacteria | 67442 |
| 57 | Ga0075364_10090124 | 3300006051 | Bacteria | 2034 |
| 58 | Ga0075432_10005628 | 3300006058 | Bacteria | 4267 |
| 59 | Ga0075432_10026538 | 3300006058 | Bacteria | 1990 |
| 60 | Ga0075432_10035240 | 3300006058 | Bacteria | 1739 |
| 61 | Ga0075432_10050081 | 3300006058 | Bacteria | 1472 |
| 62 | Ga0075362_10069546 | 3300006177 | Bacteria | 1605 |
| 63 | Ga0075362_10096897 | 3300006177 | Bacteria | 1375 |
| 64 | Ga0075369_10081088 | 3300006186 | Bacteria | 1439 |
| 65 | Ga0099823_1000074 | 3300006944 | Bacteria | 48327 |
| 66 | Ga0079104_1000145 | 3300006946 | Bacteria | 100111 |
| 67 | Ga0079104_1001936 | 3300006946 | Bacteria | 12328 |
| 68 | Ga0099826_10045335 | 3300006948 | Bacteria | 3007 |
| 69 | Ga0105251_10000847 | 3300009011 | Bacteria | 27434 |
| 70 | Ga0105251_10001298 | 3300009011 | Bacteria | 21569 |
| 71 | Ga0105251_10003325 | 3300009011 | Bacteria | 11738 |
| 72 | Ga0105251_10013205 | 3300009011 | Bacteria | 4630 |
| 73 | Ga0105251_10023484 | 3300009011 | Bacteria | 3182 |
| 74 | Ga0105251_10052492 | 3300009011 | Bacteria | 1941 |
| 75 | Ga0105251_10053840 | 3300009011 | Bacteria | 1912 |
| 76 | Ga0105244_10000248 | 3300009036 | Bacteria | 55384 |
| 77 | Ga0105244_10000274 | 3300009036 | Bacteria | 51929 |
| 78 | Ga0105244_10002675 | 3300009036 | Bacteria | 13334 |
| 79 | Ga0105244_10019664 | 3300009036 | Bacteria | 3763 |
| 80 | Ga0105244_10035696 | 3300009036 | Bacteria | 2610 |
| 81 | Ga0105244_10035795 | 3300009036 | Bacteria | 2605 |
| 82 | Ga0105244_10044890 | 3300009036 | Bacteria | 2275 |
| 83 | Ga0105244_10058187 | 3300009036 | Bacteria | 1951 |
| 84 | Ga0105244_10065661 | 3300009036 | Bacteria | 1817 |
| 85 | Ga0105244_10084642 | 3300009036 | Bacteria | 1566 |
| 86 | Ga0105244_10125968 | 3300009036 | Bacteria | 1238 |
| 87 | Ga0105250_10000534 | 3300009092 | Bacteria | 26333 |
| 88 | Ga0105250_10001316 | 3300009092 | Bacteria | 13557 |
| 89 | Ga0105250_10015682 | 3300009092 | Bacteria | 3102 |
| 90 | Ga0105250_10044958 | 3300009092 | Bacteria | 1771 |
| 91 | Ga0105250_10060972 | 3300009092 | Bacteria | 1516 |
| 92 | Ga0105243_10000451 | 3300009148 | Bacteria | 42796 |
| 93 | Ga0105243_10001719 | 3300009148 | Bacteria | 18837 |
| 94 | Ga0105243_10087612 | 3300009148 | Bacteria | 2556 |
| 95 | Ga0105242_10007609 | 3300009176 | Bacteria | 8339 |
| 96 | Ga0105237_10000640 | 3300009545 | Bacteria | 48895 |
| 97 | Ga0105249_10026157 | 3300009553 | Bacteria | 5256 |
| 98 | Ga0105246_10000117 | 3300011119 | Bacteria | 35942 |
| 99 | Ga0105246_10016446 | 3300011119 | Bacteria | 4686 |
| 100 | Ga0105246_10084560 | 3300011119 | Bacteria | 2270 |
| 101 | Ga0105246_10095329 | 3300011119 | Bacteria | 2154 |
| 102 | Ga0157345_1000081 | 3300012498 | Bacteria | 20216 |
| 103 | Ga0157347_1002054 | 3300012502 | Bacteria | 1677 |
| 104 | Ga0157373_10000593 | 3300013100 | Bacteria | 28147 |
| 105 | Ga0157373_10003554 | 3300013100 | Bacteria | 11776 |
| 106 | Ga0157373_10016161 | 3300013100 | Bacteria | 5448 |
| 107 | Ga0157373_10021556 | 3300013100 | Bacteria | 4679 |
| 108 | Ga0157373_10055665 | 3300013100 | Bacteria | 2809 |
| 109 | Ga0157373_10056736 | 3300013100 | Bacteria | 2780 |
| 110 | Ga0157373_10056881 | 3300013100 | Bacteria | 2775 |
| 111 | Ga0157371_10000497 | 3300013102 | Bacteria | 47594 |
| 112 | Ga0157371_10000583 | 3300013102 | Bacteria | 43268 |
| 113 | Ga0157371_10003644 | 3300013102 | Bacteria | 13865 |
| 114 | Ga0157371_10017431 | 3300013102 | Bacteria | 5335 |
| 115 | Ga0157370_10026246 | 3300013104 | Bacteria | 5755 |
| 116 | Ga0157370_10033329 | 3300013104 | Bacteria | 5022 |
| 117 | Ga0157370_10039334 | 3300013104 | Bacteria | 4571 |
| 118 | Ga0157370_10097823 | 3300013104 | Bacteria | 2753 |
| 119 | Ga0157370_10106817 | 3300013104 | Bacteria | 2619 |
| 120 | Ga0157370_10152975 | 3300013104 | Bacteria | 2146 |
| 121 | Ga0157370_10334484 | 3300013104 | Bacteria | 1396 |
| 122 | Ga0157369_10008746 | 3300013105 | Bacteria | 11597 |
| 123 | Ga0157369_10110064 | 3300013105 | Bacteria | 2928 |
| 124 | Ga0157369_10114806 | 3300013105 | Bacteria | 2860 |
| 125 | Ga0157369_10138003 | 3300013105 | Bacteria | 2581 |
| 126 | Ga0157369_10416175 | 3300013105 | Bacteria | 1393 |
| 127 | Ga0163162_10004856 | 3300013306 | Bacteria | 12973 |
| 128 | Ga0163162_10099591 | 3300013306 | Bacteria | 2997 |
| 129 | Ga0163162_10276536 | 3300013306 | Bacteria | 1811 |
| 130 | Ga0157372_10000598 | 3300013307 | Bacteria | 39369 |
| 131 | Ga0157372_10033779 | 3300013307 | Bacteria | 5620 |
| 132 | Ga0157375_10140116 | 3300013308 | Bacteria | 2545 |
| 133 | Ga0182008_10000863 | 3300014497 | Bacteria | 21045 |
| 134 | Ga0182008_10003335 | 3300014497 | Bacteria | 9752 |
| 135 | Ga0182008_10006493 | 3300014497 | Bacteria | 6531 |
| 136 | Ga0182008_10012581 | 3300014497 | Bacteria | 4466 |
| 137 | Ga0182008_10029468 | 3300014497 | Bacteria | 2774 |
| 138 | Ga0182008_10031668 | 3300014497 | Bacteria | 2661 |
| 139 | Ga0182008_10033884 | 3300014497 | Bacteria | 2562 |
| 140 | Ga0182008_10034069 | 3300014497 | Bacteria | 2554 |
| 141 | Ga0182008_10050435 | 3300014497 | Bacteria | 2066 |
| 142 | Ga0182006_1001275 | 3300015261 | Bacteria | 15527 |
| 143 | Ga0182006_1003543 | 3300015261 | Bacteria | 7963 |
| 144 | Ga0182006_1005016 | 3300015261 | Bacteria | 6372 |
| 145 | Ga0182006_1017180 | 3300015261 | Bacteria | 3078 |
| 146 | Ga0182006_1021827 | 3300015261 | Bacteria | 2666 |
| 147 | Ga0182006_1024824 | 3300015261 | Bacteria | 2468 |
| 148 | Ga0182006_1056943 | 3300015261 | Bacteria | 1487 |
| 149 | Ga0182007_10000143 | 3300015262 | Bacteria | 47807 |
| 150 | Ga0182007_10015397 | 3300015262 | Bacteria | 2854 |
| 151 | Ga0182007_10020582 | 3300015262 | Bacteria | 2356 |
| 152 | Ga0182005_1002054 | 3300015265 | Bacteria | 7536 |
| 153 | Ga0182005_1035369 | 3300015265 | Bacteria | 1358 |
| 154 | Ga0163161_10001895 | 3300017792 | Bacteria | 15278 |
| 155 | Ga0163161_10020484 | 3300017792 | Bacteria | 4641 |
| 156 | Ga0163161_10022776 | 3300017792 | Bacteria | 4413 |
| 157 | Ga0163161_10036567 | 3300017792 | Bacteria | 3516 |
| 158 | Ga0163161_10054038 | 3300017792 | Bacteria | 2914 |
| 159 | Ga0163161_10058360 | 3300017792 | Bacteria | 2805 |
| 160 | Ga0163161_10063125 | 3300017792 | Bacteria | 2700 |
| 161 | Ga0163161_10077666 | 3300017792 | Bacteria | 2439 |
| 162 | Ga0163161_10106450 | 3300017792 | Bacteria | 2093 |
| 163 | Ga0163161_10226051 | 3300017792 | Bacteria | 1451 |
| 164 | Ga0163161_10245451 | 3300017792 | Bacteria | 1394 |
| 165 | Ga0209435_100837 | 3300025206 | Bacteria | 4839 |
| 166 | Ga0209760_100039 | 3300025207 | Bacteria | 118977 |
| 167 | Ga0209784_100015 | 3300025224 | Bacteria | 482117 |
| 168 | Ga0209566_100012 | 3300025225 | Bacteria | 482281 |
| 169 | Ga0209674_100027 | 3300025226 | Bacteria | 482281 |
| 170 | Ga0209147_100019 | 3300025229 | Bacteria | 482139 |
| 171 | Ga0209563_100031 | 3300025230 | Bacteria | 482281 |
| 172 | Ga0209563_100630 | 3300025230 | Bacteria | 11381 |
| 173 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 174 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 175 | Ga0209437_103617 | 3300025233 | Bacteria | 2774 |
| 176 | Ga0209258_100381 | 3300025242 | Bacteria | 56739 |
| 177 | Ga0209646_1000344 | 3300025246 | Bacteria | 34445 |
| 178 | Ga0209677_100016 | 3300025253 | Bacteria | 482117 |
| 179 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 180 | Ga0209675_1009404 | 3300025291 | Bacteria | 3457 |
| 181 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 182 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 183 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 184 | Ga0209676_1000532 | 3300025292 | Bacteria | 59471 |
| 185 | Ga0209676_1011310 | 3300025292 | Bacteria | 3613 |
| 186 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 187 | Ga0209050_1000036 | 3300025298 | Bacteria | 423070 |
| 188 | Ga0209050_1000107 | 3300025298 | Bacteria | 223303 |
| 189 | Ga0209050_1019088 | 3300025298 | Bacteria | 2626 |
| 190 | Ga0209051_1000043 | 3300025303 | Bacteria | 305473 |
| 191 | Ga0209051_1000053 | 3300025303 | Bacteria | 281564 |
| 192 | Ga0209051_1000090 | 3300025303 | Bacteria | 173748 |
| 193 | Ga0209051_1003100 | 3300025303 | Bacteria | 11211 |
| 194 | Ga0209257_1000098 | 3300025304 | Bacteria | 256390 |
| 195 | Ga0209257_1011864 | 3300025304 | Bacteria | 4121 |
| 196 | Ga0207656_10000075 | 3300025321 | Bacteria | 36715 |
| 197 | Ga0207696_1000010 | 3300025711 | Bacteria | 534681 |
| 198 | Ga0207696_1000063 | 3300025711 | Bacteria | 239123 |
| 199 | Ga0207696_1000158 | 3300025711 | Bacteria | 112178 |
| 200 | Ga0207696_1002599 | 3300025711 | Bacteria | 8757 |
| 201 | Ga0207696_1004643 | 3300025711 | Bacteria | 5879 |
| 202 | Ga0207696_1006768 | 3300025711 | Bacteria | 4571 |
| 203 | Ga0207696_1010018 | 3300025711 | Bacteria | 3498 |
| 204 | Ga0207696_1013851 | 3300025711 | Bacteria | 2786 |
| 205 | Ga0207696_1028596 | 3300025711 | Bacteria | 1709 |
| 206 | Ga0207696_1035733 | 3300025711 | Bacteria | 1478 |
| 207 | Ga0207655_1000019 | 3300025728 | Bacteria | 536324 |
| 208 | Ga0207655_1000151 | 3300025728 | Bacteria | 127538 |
| 209 | Ga0207655_1000197 | 3300025728 | Bacteria | 106282 |
| 210 | Ga0207655_1000250 | 3300025728 | Bacteria | 86806 |
| 211 | Ga0207655_1001272 | 3300025728 | Bacteria | 24073 |
| 212 | Ga0207655_1005501 | 3300025728 | Bacteria | 8598 |
| 213 | Ga0207655_1009222 | 3300025728 | Bacteria | 6155 |
| 214 | Ga0207655_1009805 | 3300025728 | Bacteria | 5902 |
| 215 | Ga0207655_1014540 | 3300025728 | Bacteria | 4442 |
| 216 | Ga0207655_1015788 | 3300025728 | Bacteria | 4174 |
| 217 | Ga0207655_1035764 | 3300025728 | Bacteria | 2212 |
| 218 | Ga0207655_1036484 | 3300025728 | Bacteria | 2178 |
| 219 | Ga0207655_1041047 | 3300025728 | Bacteria | 1987 |
| 220 | Ga0207713_1000380 | 3300025735 | Bacteria | 48035 |
| 221 | Ga0207713_1000882 | 3300025735 | Bacteria | 27343 |
| 222 | Ga0207713_1001994 | 3300025735 | Bacteria | 15348 |
| 223 | Ga0207713_1001997 | 3300025735 | Bacteria | 15333 |
| 224 | Ga0207713_1005079 | 3300025735 | Bacteria | 8353 |
| 225 | Ga0207713_1006442 | 3300025735 | Bacteria | 7148 |
| 226 | Ga0207713_1011564 | 3300025735 | Bacteria | 4785 |
| 227 | Ga0207713_1012122 | 3300025735 | Bacteria | 4634 |
| 228 | Ga0207713_1023540 | 3300025735 | Bacteria | 2896 |
| 229 | Ga0207713_1049961 | 3300025735 | Bacteria | 1673 |
| 230 | Ga0207713_1051667 | 3300025735 | Bacteria | 1632 |
| 231 | Ga0207671_10000566 | 3300025914 | Bacteria | 49574 |
| 232 | Ga0207649_10000002 | 3300025920 | Bacteria | 498633 |
| 233 | Ga0207681_10003012 | 3300025923 | Bacteria | 10586 |
| 234 | Ga0207650_10000742 | 3300025925 | Bacteria | 25165 |
| 235 | Ga0207706_10000903 | 3300025933 | Bacteria | 30514 |
| 236 | Ga0207706_10026289 | 3300025933 | Bacteria | 5209 |
| 237 | Ga0207686_10032576 | 3300025934 | Bacteria | 3103 |
| 238 | Ga0207709_10000036 | 3300025935 | Bacteria | 292568 |
| 239 | Ga0207709_10000350 | 3300025935 | Bacteria | 47371 |
| 240 | Ga0207709_10009838 | 3300025935 | Bacteria | 5267 |
| 241 | Ga0207709_10111584 | 3300025935 | Bacteria | 1829 |
| 242 | Ga0207679_10000006 | 3300025945 | Bacteria | 498868 |
| 243 | Ga0207712_10103808 | 3300025961 | Bacteria | 2118 |
| 244 | Ga0207639_10036851 | 3300026041 | Bacteria | 3628 |
| 245 | Ga0209281_1000172 | 3300027111 | Bacteria | 151766 |
| 246 | Ga0209281_1000271 | 3300027111 | Bacteria | 100141 |
| 247 | Ga0209281_1003274 | 3300027111 | Bacteria | 5485 |
| 248 | Ga0209389_1000063 | 3300027296 | Bacteria | 102403 |
| 249 | Ga0209371_1000576 | 3300027312 | Bacteria | 33041 |
| 250 | Ga0207428_10042336 | 3300027907 | Bacteria | 3683 |
| 251 | Ga0207428_10105134 | 3300027907 | Bacteria | 2178 |
| 252 | Ga0207428_10201260 | 3300027907 | Bacteria | 1498 |
| 253 | Ga0268266_10006047 | 3300028379 | Bacteria | 11154 |
| 254 | Ga0268256_1000503 | 3300030500 | Bacteria | 33041 |
| 255 | Ga0307511_10038488 | 3300030521 | Bacteria | 4105 |
| 256 | Ga0316177_1050534 | 3300030731 | Bacteria | 2819 |
| 257 | Ga0316179_1078275 | 3300030734 | Bacteria | 3890 |
| 258 | Ga0316178_1161793 | 3300030735 | Bacteria | 38251 |
| 259 | Ga0316183_1015099 | 3300030742 | Bacteria | 4141 |
| 260 | Ga0307408_100011056 | 3300031548 | Bacteria | 5958 |
| 261 | Ga0307408_100020260 | 3300031548 | Bacteria | 4486 |
| 262 | Ga0307408_100028563 | 3300031548 | Bacteria | 3855 |
| 263 | Ga0307408_100127976 | 3300031548 | Bacteria | 1977 |
| 264 | Ga0307408_100137461 | 3300031548 | Bacteria | 1913 |
| 265 | Ga0307405_10015580 | 3300031731 | Bacteria | 4122 |
| 266 | Ga0307405_10020411 | 3300031731 | Bacteria | 3701 |
| 267 | Ga0307405_10035186 | 3300031731 | Bacteria | 2988 |
| 268 | Ga0307405_10047546 | 3300031731 | Bacteria | 2642 |
| 269 | Ga0307413_10206950 | 3300031824 | Bacteria | 1421 |
| 270 | Ga0307406_10054623 | 3300031901 | Bacteria | 2549 |
| 271 | Ga0307406_10177528 | 3300031901 | Bacteria | 1547 |
| 272 | Ga0307412_10004978 | 3300031911 | Bacteria | 7425 |
| 273 | Ga0307412_10010098 | 3300031911 | Bacteria | 5430 |
| 274 | Ga0307412_10011635 | 3300031911 | Bacteria | 5101 |
| 275 | Ga0307412_10070663 | 3300031911 | Bacteria | 2380 |
| 276 | Ga0307412_10136679 | 3300031911 | Bacteria | 1789 |
| 277 | Ga0307412_10342345 | 3300031911 | Bacteria | 1197 |
| 278 | Ga0307409_100308695 | 3300031995 | Bacteria | 1475 |
| 279 | Ga0307414_10010683 | 3300032004 | Bacteria | 5344 |
| 280 | Ga0307414_10080054 | 3300032004 | Bacteria | 2387 |
| 281 | Ga0307414_10167106 | 3300032004 | Bacteria | 1754 |
| 282 | Ga0307411_10004175 | 3300032005 | Bacteria | 6866 |
| 283 | Ga0307411_10061013 | 3300032005 | Bacteria | 2507 |
| 284 | Ga0307510_10080780 | 3300033180 | Bacteria | 3159 |
| 285 | Ga0237819_01651 | 3300038705 | Bacteria | 5481 |
| 286 | Ga0439438_003063 | 3300041405 | Bacteria | 6875 |
| 287 | Ga0439438_004123 | 3300041405 | Bacteria | 5675 |
| 288 | Ga0439438_004424 | 3300041405 | Bacteria | 5397 |
| 289 | Ga0439438_004842 | 3300041405 | Bacteria | 5066 |
| 290 | Ga0439438_007724 | 3300041405 | Bacteria | 3642 |
| 291 | Ga0439438_008159 | 3300041405 | Bacteria | 3502 |
| 292 | Ga0439438_010286 | 3300041405 | Bacteria | 2965 |
| 293 | Ga0439438_010599 | 3300041405 | Bacteria | 2905 |
| 294 | Ga0439447_002909 | 3300041407 | Bacteria | 6128 |
| 295 | Ga0439447_004126 | 3300041407 | Bacteria | 5053 |
| 296 | Ga0439447_010213 | 3300041407 | Bacteria | 2797 |
| 297 | Ga0439447_010268 | 3300041407 | Bacteria | 2787 |
| 298 | Ga0439447_013779 | 3300041407 | Bacteria | 2285 |
| 299 | Ga0439447_014464 | 3300041407 | Bacteria | 2213 |
| 300 | Ga0439447_025490 | 3300041407 | Bacteria | 1523 |
| 301 | Ga0439466_0001263 | 3300041411 | Bacteria | 9829 |
| 302 | Ga0439466_0002304 | 3300041411 | Bacteria | 7490 |
| 303 | Ga0439466_0011798 | 3300041411 | Bacteria | 3226 |
| 304 | Ga0439466_0011884 | 3300041411 | Bacteria | 3215 |
| 305 | Ga0439466_0048523 | 3300041411 | Bacteria | 1396 |
| 306 | Ga0439465_0006145 | 3300041413 | Bacteria | 3819 |
| 307 | Ga0439431_0015133 | 3300041997 | Bacteria | 1793 |
| 308 | Ga0439445_0017603 | 3300042004 | Bacteria | 1767 |
| 309 | Ga0439432_001052 | 3300042006 | Bacteria | 10485 |
| 310 | Ga0439432_001239 | 3300042006 | Bacteria | 9653 |
| 311 | Ga0439432_013331 | 3300042006 | Bacteria | 2797 |
| 312 | Ga0439432_013845 | 3300042006 | Bacteria | 2735 |
| 313 | Ga0439432_024392 | 3300042006 | Bacteria | 1988 |
| 314 | Ga0439432_053368 | 3300042006 | Bacteria | 1257 |
| 315 | Ga0439451_001638 | 3300042009 | Bacteria | 4446 |
| 316 | Ga0439451_007465 | 3300042009 | Bacteria | 2228 |
| 317 | Ga0439451_011741 | 3300042009 | Bacteria | 1766 |
| 318 | Ga0439452_000503 | 3300042010 | Bacteria | 21254 |
| 319 | Ga0439452_000725 | 3300042010 | Bacteria | 15973 |
| 320 | Ga0439452_001131 | 3300042010 | Bacteria | 11656 |
| 321 | Ga0439452_009692 | 3300042010 | Bacteria | 2829 |
| 322 | Ga0439456_000271 | 3300042013 | Bacteria | 12605 |
| 323 | Ga0439456_002594 | 3300042013 | Bacteria | 3639 |
| 324 | Ga0439456_011225 | 3300042013 | Bacteria | 1851 |
| 325 | Ga0439456_021475 | 3300042013 | Bacteria | 1366 |
| 326 | Ga0439463_000376 | 3300042016 | Bacteria | 12350 |
| 327 | Ga0450911_000556 | 3300042115 | Bacteria | 11582 |
| 328 | Ga0450911_001193 | 3300042115 | Bacteria | 6338 |
| 329 | Ga0450911_006325 | 3300042115 | Bacteria | 1772 |
| 330 | Ga0450919_000614 | 3300042121 | Bacteria | 4509 |
| 331 | Ga0450920_007247 | 3300042122 | Bacteria | 2008 |
| 332 | Ga0450922_000514 | 3300042124 | Bacteria | 4107 |
| 333 | Ga0450922_002582 | 3300042124 | Bacteria | 1695 |
| 334 | Ga0450890_000186 | 3300042127 | Bacteria | 9401 |
| 335 | Ga0450898_010644 | 3300042134 | Bacteria | 1493 |
| 336 | Ga0450899_005350 | 3300042135 | Bacteria | 1378 |
| 337 | Ga0450900_002786 | 3300042136 | Bacteria | 1885 |
| 338 | Ga0450902_001984 | 3300042137 | Bacteria | 2862 |
| 339 | Ga0450902_003594 | 3300042137 | Bacteria | 2276 |
| 340 | Ga0450902_005568 | 3300042137 | Bacteria | 1908 |
| 341 | Ga0450903_001216 | 3300042138 | Bacteria | 4841 |
| 342 | Ga0450903_002098 | 3300042138 | Bacteria | 3585 |
| 343 | Ga0450905_000029 | 3300042142 | Bacteria | 11982 |
| 344 | Ga0450905_004857 | 3300042142 | Bacteria | 1795 |
| 345 | Ga0450907_000132 | 3300042146 | Bacteria | 28311 |
| 346 | Ga0450907_002076 | 3300042146 | Bacteria | 3972 |
| 347 | Ga0450907_003696 | 3300042146 | Bacteria | 2693 |
| 348 | Ga0450910_000124 | 3300042147 | Bacteria | 8173 |
| 349 | Ga0439446_0008405 | 3300042156 | Bacteria | 2739 |
| 350 | Ga0450908_005178 | 3300042184 | Bacteria | 2500 |
| 351 | Ga0450909_002104 | 3300042185 | Bacteria | 2810 |
| 352 | Ga0439434_0000469 | 3300042435 | Bacteria | 11490 |
| 353 | Ga0439464_0001884 | 3300042439 | Bacteria | 5070 |
| 354 | Ga0439460_0001104 | 3300042461 | Bacteria | 6297 |
| 355 | Ga0439460_0005590 | 3300042461 | Bacteria | 3091 |
| 356 | Ga0439460_0015732 | 3300042461 | Bacteria | 2006 |
| 357 | Ga0450918_006823 | 3300042531 | Bacteria | 2029 |
| 358 | Ga0450918_007755 | 3300042531 | Bacteria | 1893 |
| 359 | Ga0450893_0005323 | 3300042532 | Bacteria | 2065 |
| 360 | Ga0450893_0006099 | 3300042532 | Bacteria | 1945 |
| 361 | Ga0450901_001003 | 3300042533 | Bacteria | 3277 |
| 362 | Ga0439440_0003112 | 3300042993 | Bacteria | 3173 |
| 363 | Ga0495617_000327 | 3300046452 | Bacteria | 26705 |
| 364 | Ga0495617_007544 | 3300046452 | Bacteria | 3772 |
| 365 | Ga0495617_007874 | 3300046452 | Bacteria | 3686 |
| 366 | Ga0495617_008135 | 3300046452 | Bacteria | 3624 |
| 367 | Ga0495617_013419 | 3300046452 | Bacteria | 2788 |
| 368 | Ga0495617_034397 | 3300046452 | Bacteria | 1701 |
| 369 | Ga0495617_035578 | 3300046452 | Bacteria | 1672 |
| 370 | Ga0495617_063456 | 3300046452 | Bacteria | 1220 |
| 371 | Ga0495627_000040 | 3300046453 | Bacteria | 195248 |
| 372 | Ga0495627_001088 | 3300046453 | Bacteria | 17809 |
| 373 | Ga0495627_001530 | 3300046453 | Bacteria | 13262 |
| 374 | Ga0495627_002082 | 3300046453 | Bacteria | 10187 |
| 375 | Ga0495627_002418 | 3300046453 | Bacteria | 9016 |
| 376 | Ga0495627_019177 | 3300046453 | Bacteria | 2298 |
| 377 | Ga0495627_027563 | 3300046453 | Bacteria | 1821 |
| 378 | Ga0495627_034930 | 3300046453 | Bacteria | 1568 |
| 379 | Ga0495627_046484 | 3300046453 | Bacteria | 1318 |
| 380 | Ga0495603_0093853 | 3300046455 | Bacteria | 1753 |
| 381 | Ga0495590_0018607 | 3300046457 | Bacteria | 2485 |
| 382 | Ga0495590_0022982 | 3300046457 | Bacteria | 2203 |
| 383 | Ga0495590_0040802 | 3300046457 | Bacteria | 1618 |
| 384 | Ga0495590_0063481 | 3300046457 | Bacteria | 1292 |
| 385 | Ga0495591_000232 | 3300046458 | Bacteria | 54458 |
| 386 | Ga0495591_002090 | 3300046458 | Bacteria | 11503 |
| 387 | Ga0495591_004045 | 3300046458 | Bacteria | 7325 |
| 388 | Ga0495591_005488 | 3300046458 | Bacteria | 5861 |
| 389 | Ga0495591_009586 | 3300046458 | Bacteria | 3831 |
| 390 | Ga0495591_011334 | 3300046458 | Bacteria | 3383 |
| 391 | Ga0495591_014750 | 3300046458 | Bacteria | 2790 |
| 392 | Ga0495591_020147 | 3300046458 | Bacteria | 2211 |
| 393 | Ga0495591_022755 | 3300046458 | Bacteria | 2020 |
| 394 | Ga0495591_024718 | 3300046458 | Bacteria | 1898 |
| 395 | Ga0495591_028244 | 3300046458 | Bacteria | 1718 |
| 396 | Ga0495591_030373 | 3300046458 | Bacteria | 1631 |
| 397 | Ga0495638_0001278 | 3300046460 | Bacteria | 23475 |
| 398 | Ga0495638_0001733 | 3300046460 | Bacteria | 19207 |
| 399 | Ga0495638_0003235 | 3300046460 | Bacteria | 12878 |
| 400 | Ga0495638_0007902 | 3300046460 | Bacteria | 7587 |
| 401 | Ga0495638_0016807 | 3300046460 | Bacteria | 4892 |
| 402 | Ga0495638_0032805 | 3300046460 | Bacteria | 3324 |
| 403 | Ga0495638_0039275 | 3300046460 | Bacteria | 3005 |
| 404 | Ga0495638_0039406 | 3300046460 | Bacteria | 2999 |
| 405 | Ga0495638_0043708 | 3300046460 | Bacteria | 2825 |
| 406 | Ga0495638_0053634 | 3300046460 | Bacteria | 2509 |
| 407 | Ga0495638_0072609 | 3300046460 | Bacteria | 2102 |
| 408 | Ga0495638_0136818 | 3300046460 | Bacteria | 1433 |
| 409 | Ga0495653_0003427 | 3300046463 | Bacteria | 12755 |
| 410 | Ga0495653_0061150 | 3300046463 | Bacteria | 2850 |
| 411 | Ga0495653_0108837 | 3300046463 | Bacteria | 1995 |
| 412 | Ga0495650_0000620 | 3300046471 | Bacteria | 48027 |
| 413 | Ga0495650_0003352 | 3300046471 | Bacteria | 11756 |
| 414 | Ga0495650_0003804 | 3300046471 | Bacteria | 10743 |
| 415 | Ga0495650_0009633 | 3300046471 | Bacteria | 5476 |
| 416 | Ga0495650_0018018 | 3300046471 | Bacteria | 3521 |
| 417 | Ga0495650_0019745 | 3300046471 | Bacteria | 3305 |
| 418 | Ga0495650_0021006 | 3300046471 | Bacteria | 3167 |
| 419 | Ga0495650_0028854 | 3300046471 | Bacteria | 2537 |
| 420 | Ga0495650_0032030 | 3300046471 | Bacteria | 2356 |
| 421 | Ga0495650_0041544 | 3300046471 | Bacteria | 1965 |
| 422 | Ga0495650_0053585 | 3300046471 | Bacteria | 1651 |
| 423 | Ga0495582_0032844 | 3300046473 | Bacteria | 2852 |
| 424 | Ga0495605_0000011 | 3300046474 | Bacteria | 314856 |
| 425 | Ga0495605_0004680 | 3300046474 | Bacteria | 7999 |
| 426 | Ga0495605_0006308 | 3300046474 | Bacteria | 6834 |
| 427 | Ga0495605_0019149 | 3300046474 | Bacteria | 3661 |
| 428 | Ga0495605_0031595 | 3300046474 | Bacteria | 2703 |
| 429 | Ga0495605_0041700 | 3300046474 | Bacteria | 2285 |
| 430 | Ga0495605_0045198 | 3300046474 | Bacteria | 2172 |
| 431 | Ga0495605_0057322 | 3300046474 | Bacteria | 1875 |
| 432 | Ga0495605_0064398 | 3300046474 | Bacteria | 1746 |
| 433 | Ga0495639_0000714 | 3300046475 | Bacteria | 15193 |
| 434 | Ga0495639_0007670 | 3300046475 | Bacteria | 4643 |
| 435 | Ga0495639_0022907 | 3300046475 | Bacteria | 2742 |
| 436 | Ga0495664_0143103 | 3300046477 | Bacteria | 1450 |
| 437 | Ga0495584_0000733 | 3300046491 | Bacteria | 21643 |
| 438 | Ga0495584_0001356 | 3300046491 | Bacteria | 14814 |
| 439 | Ga0495584_0004349 | 3300046491 | Bacteria | 7629 |
| 440 | Ga0495584_0004438 | 3300046491 | Bacteria | 7549 |
| 441 | Ga0495584_0020003 | 3300046491 | Bacteria | 3400 |
| 442 | Ga0495584_0024123 | 3300046491 | Bacteria | 3083 |
| 443 | Ga0495584_0041935 | 3300046491 | Bacteria | 2310 |
| 444 | Ga0495584_0051925 | 3300046491 | Bacteria | 2063 |
| 445 | Ga0495584_0064320 | 3300046491 | Bacteria | 1844 |
| 446 | Ga0495584_0067625 | 3300046491 | Bacteria | 1795 |
| 447 | Ga0495584_0071595 | 3300046491 | Bacteria | 1742 |
| 448 | Ga0495584_0087044 | 3300046491 | Bacteria | 1574 |
| 449 | Ga0495585_0000376 | 3300046492 | Bacteria | 42971 |
| 450 | Ga0495585_0001401 | 3300046492 | Bacteria | 18994 |
| 451 | Ga0495585_0002451 | 3300046492 | Bacteria | 13282 |
| 452 | Ga0495585_0004975 | 3300046492 | Bacteria | 8498 |
| 453 | Ga0495585_0009335 | 3300046492 | Bacteria | 5889 |
| 454 | Ga0495585_0017146 | 3300046492 | Bacteria | 4189 |
| 455 | Ga0495585_0022896 | 3300046492 | Bacteria | 3585 |
| 456 | Ga0495585_0027527 | 3300046492 | Bacteria | 3244 |
| 457 | Ga0495585_0032590 | 3300046492 | Bacteria | 2951 |
| 458 | Ga0495585_0049406 | 3300046492 | Bacteria | 2335 |
| 459 | Ga0495585_0098129 | 3300046492 | Bacteria | 1570 |
| 460 | Ga0495594_0003631 | 3300046499 | Bacteria | 7933 |
| 461 | Ga0495594_0006659 | 3300046499 | Bacteria | 5946 |
| 462 | Ga0495594_0017044 | 3300046499 | Bacteria | 3834 |
| 463 | Ga0495594_0036640 | 3300046499 | Bacteria | 2675 |
| 464 | Ga0495594_0090479 | 3300046499 | Bacteria | 1715 |
| 465 | Ga0495596_0000597 | 3300046500 | Bacteria | 22660 |
| 466 | Ga0495596_0032707 | 3300046500 | Bacteria | 2072 |
| 467 | Ga0495607_0000349 | 3300046501 | Bacteria | 47780 |
| 468 | Ga0495607_0001009 | 3300046501 | Bacteria | 25910 |
| 469 | Ga0495607_0002511 | 3300046501 | Bacteria | 14867 |
| 470 | Ga0495607_0005314 | 3300046501 | Bacteria | 9260 |
| 471 | Ga0495607_0006278 | 3300046501 | Bacteria | 8378 |
| 472 | Ga0495607_0008011 | 3300046501 | Bacteria | 7258 |
| 473 | Ga0495607_0009933 | 3300046501 | Bacteria | 6408 |
| 474 | Ga0495607_0021862 | 3300046501 | Bacteria | 4022 |
| 475 | Ga0495607_0024767 | 3300046501 | Bacteria | 3737 |
| 476 | Ga0495607_0033217 | 3300046501 | Bacteria | 3140 |
| 477 | Ga0495607_0050009 | 3300046501 | Bacteria | 2435 |
| 478 | Ga0495607_0057633 | 3300046501 | Bacteria | 2225 |
| 479 | Ga0495607_0067430 | 3300046501 | Bacteria | 2010 |
| 480 | Ga0495607_0109417 | 3300046501 | Bacteria | 1467 |
| 481 | Ga0495607_0150109 | 3300046501 | Bacteria | 1193 |
| 482 | Ga0495583_0000047 | 3300046506 | Bacteria | 217720 |
| 483 | Ga0495583_0001432 | 3300046506 | Bacteria | 24231 |
| 484 | Ga0495583_0006317 | 3300046506 | Bacteria | 7780 |
| 485 | Ga0495583_0013044 | 3300046506 | Bacteria | 4664 |
| 486 | Ga0495583_0017557 | 3300046506 | Bacteria | 3794 |
| 487 | Ga0495583_0024957 | 3300046506 | Bacteria | 2994 |
| 488 | Ga0495583_0025371 | 3300046506 | Bacteria | 2961 |
| 489 | Ga0495583_0032503 | 3300046506 | Bacteria | 2518 |
| 490 | Ga0495606_0001195 | 3300046507 | Bacteria | 36567 |
| 491 | Ga0495606_0004689 | 3300046507 | Bacteria | 13510 |
| 492 | Ga0495606_0008803 | 3300046507 | Bacteria | 8665 |
| 493 | Ga0495606_0020545 | 3300046507 | Bacteria | 4864 |
| 494 | Ga0495606_0035400 | 3300046507 | Bacteria | 3412 |
| 495 | Ga0495606_0042245 | 3300046507 | Bacteria | 3050 |
| 496 | Ga0495606_0045550 | 3300046507 | Bacteria | 2905 |
| 497 | Ga0495606_0062943 | 3300046507 | Bacteria | 2366 |
| 498 | Ga0495606_0100675 | 3300046507 | Bacteria | 1759 |
| 499 | Ga0495610_0001544 | 3300046512 | Bacteria | 20283 |
| 500 | Ga0495610_0010879 | 3300046512 | Bacteria | 5614 |
| 501 | Ga0495610_0012081 | 3300046512 | Bacteria | 5222 |
| 502 | Ga0495610_0015944 | 3300046512 | Bacteria | 4345 |
| 503 | Ga0495610_0016333 | 3300046512 | Bacteria | 4279 |
| 504 | Ga0495610_0016615 | 3300046512 | Bacteria | 4227 |
| 505 | Ga0495610_0017950 | 3300046512 | Bacteria | 4013 |
| 506 | Ga0495610_0018259 | 3300046512 | Bacteria | 3966 |
| 507 | Ga0495610_0025843 | 3300046512 | Bacteria | 3144 |
| 508 | Ga0495610_0029057 | 3300046512 | Bacteria | 2916 |
| 509 | Ga0495610_0034270 | 3300046512 | Bacteria | 2616 |
| 510 | Ga0495610_0039474 | 3300046512 | Bacteria | 2387 |
| 511 | Ga0495610_0040082 | 3300046512 | Bacteria | 2363 |
| 512 | Ga0495610_0044321 | 3300046512 | Bacteria | 2208 |
| 513 | Ga0495610_0050340 | 3300046512 | Bacteria | 2034 |
| 514 | Ga0495610_0059085 | 3300046512 | Bacteria | 1831 |
| 515 | Ga0495616_0002009 | 3300046513 | Bacteria | 13690 |
| 516 | Ga0495616_0002585 | 3300046513 | Bacteria | 11920 |
| 517 | Ga0495616_0003866 | 3300046513 | Bacteria | 9545 |
| 518 | Ga0495616_0004161 | 3300046513 | Bacteria | 9170 |
| 519 | Ga0495616_0014930 | 3300046513 | Bacteria | 4333 |
| 520 | Ga0495616_0029487 | 3300046513 | Bacteria | 2896 |
| 521 | Ga0495616_0032457 | 3300046513 | Bacteria | 2727 |
| 522 | Ga0495616_0042164 | 3300046513 | Bacteria | 2324 |
| 523 | Ga0495620_0000002 | 3300046515 | Bacteria | 373737 |
| 524 | Ga0495620_0000225 | 3300046515 | Bacteria | 42537 |
| 525 | Ga0495620_0001337 | 3300046515 | Bacteria | 14977 |
| 526 | Ga0495620_0002160 | 3300046515 | Bacteria | 11430 |
| 527 | Ga0495620_0003662 | 3300046515 | Bacteria | 8772 |
| 528 | Ga0495620_0004065 | 3300046515 | Bacteria | 8298 |
| 529 | Ga0495620_0004722 | 3300046515 | Bacteria | 7656 |
| 530 | Ga0495620_0004859 | 3300046515 | Bacteria | 7538 |
| 531 | Ga0495630_0001621 | 3300046517 | Bacteria | 15640 |
| 532 | Ga0495630_0073954 | 3300046517 | Bacteria | 2566 |
| 533 | Ga0495630_0105657 | 3300046517 | Bacteria | 2132 |
| 534 | Ga0495630_0115477 | 3300046517 | Bacteria | 2034 |
| 535 | Ga0495631_0000280 | 3300046518 | Bacteria | 35558 |
| 536 | Ga0495631_0014162 | 3300046518 | Bacteria | 3854 |
| 537 | Ga0495631_0014537 | 3300046518 | Bacteria | 3796 |
| 538 | Ga0495631_0020511 | 3300046518 | Bacteria | 3088 |
| 539 | Ga0495631_0050474 | 3300046518 | Bacteria | 1819 |
| 540 | Ga0495631_0071067 | 3300046518 | Bacteria | 1504 |
| 541 | Ga0495632_0000215 | 3300046519 | Bacteria | 58392 |
| 542 | Ga0495632_0002507 | 3300046519 | Bacteria | 13918 |
| 543 | Ga0495632_0004158 | 3300046519 | Bacteria | 9921 |
| 544 | Ga0495632_0004287 | 3300046519 | Bacteria | 9736 |
| 545 | Ga0495632_0004931 | 3300046519 | Bacteria | 8949 |
| 546 | Ga0495632_0012843 | 3300046519 | Bacteria | 4804 |
| 547 | Ga0495632_0017873 | 3300046519 | Bacteria | 3901 |
| 548 | Ga0495632_0019958 | 3300046519 | Bacteria | 3640 |
| 549 | Ga0495632_0021504 | 3300046519 | Bacteria | 3475 |
| 550 | Ga0495632_0023780 | 3300046519 | Bacteria | 3266 |
| 551 | Ga0495632_0025528 | 3300046519 | Bacteria | 3123 |
| 552 | Ga0495632_0064390 | 3300046519 | Bacteria | 1773 |
| 553 | Ga0495637_0000630 | 3300046520 | Bacteria | 24850 |
| 554 | Ga0495637_0000871 | 3300046520 | Bacteria | 19649 |
| 555 | Ga0495637_0001699 | 3300046520 | Bacteria | 12710 |
| 556 | Ga0495637_0005266 | 3300046520 | Bacteria | 6619 |
| 557 | Ga0495637_0013339 | 3300046520 | Bacteria | 3900 |
| 558 | Ga0495637_0013341 | 3300046520 | Bacteria | 3900 |
| 559 | Ga0495637_0015994 | 3300046520 | Bacteria | 3513 |
| 560 | Ga0495637_0016726 | 3300046520 | Bacteria | 3426 |
| 561 | Ga0495637_0026158 | 3300046520 | Bacteria | 2623 |
| 562 | Ga0495637_0030335 | 3300046520 | Bacteria | 2399 |
| 563 | Ga0495637_0031521 | 3300046520 | Bacteria | 2344 |
| 564 | Ga0495637_0042147 | 3300046520 | Bacteria | 1954 |
| 565 | Ga0495637_0043340 | 3300046520 | Bacteria | 1921 |
| 566 | Ga0495643_0000303 | 3300046522 | Bacteria | 68802 |
| 567 | Ga0495643_0002672 | 3300046522 | Bacteria | 13791 |
| 568 | Ga0495643_0003509 | 3300046522 | Bacteria | 11416 |
| 569 | Ga0495643_0015736 | 3300046522 | Bacteria | 4461 |
| 570 | Ga0495643_0016385 | 3300046522 | Bacteria | 4352 |
| 571 | Ga0495643_0025996 | 3300046522 | Bacteria | 3308 |
| 572 | Ga0495643_0026415 | 3300046522 | Bacteria | 3277 |
| 573 | Ga0495643_0117827 | 3300046522 | Bacteria | 1344 |
| 574 | Ga0495644_0002507 | 3300046523 | Bacteria | 7324 |
| 575 | Ga0495644_0002520 | 3300046523 | Bacteria | 7306 |
| 576 | Ga0495644_0006504 | 3300046523 | Bacteria | 4525 |
| 577 | Ga0495644_0015259 | 3300046523 | Bacteria | 2942 |
| 578 | Ga0495644_0021597 | 3300046523 | Bacteria | 2455 |
| 579 | Ga0495644_0031138 | 3300046523 | Bacteria | 2015 |
| 580 | Ga0495648_0000521 | 3300046524 | Bacteria | 41448 |
| 581 | Ga0495648_0001868 | 3300046524 | Bacteria | 20138 |
| 582 | Ga0495648_0002196 | 3300046524 | Bacteria | 18284 |
| 583 | Ga0495648_0018563 | 3300046524 | Bacteria | 4918 |
| 584 | Ga0495648_0025968 | 3300046524 | Bacteria | 3954 |
| 585 | Ga0495648_0044527 | 3300046524 | Bacteria | 2769 |
| 586 | Ga0495648_0045100 | 3300046524 | Bacteria | 2745 |
| 587 | Ga0495648_0049359 | 3300046524 | Bacteria | 2580 |
| 588 | Ga0495648_0076690 | 3300046524 | Bacteria | 1918 |
| 589 | Ga0495648_0086476 | 3300046524 | Bacteria | 1768 |
| 590 | Ga0495648_0138334 | 3300046524 | Bacteria | 1285 |
| 591 | Ga0495648_0138876 | 3300046524 | Bacteria | 1281 |
| 592 | Ga0495648_0138881 | 3300046524 | Bacteria | 1281 |
| 593 | Ga0495648_0151883 | 3300046524 | Bacteria | 1207 |
| 594 | Ga0495666_0006061 | 3300046526 | Bacteria | 6090 |
| 595 | Ga0495666_0028391 | 3300046526 | Bacteria | 2752 |
| 596 | Ga0495666_0040403 | 3300046526 | Bacteria | 2262 |
| 597 | Ga0495642_0000027 | 3300046528 | Bacteria | 89620 |
| 598 | Ga0495642_0001462 | 3300046528 | Bacteria | 10574 |
| 599 | Ga0495642_0003766 | 3300046528 | Bacteria | 5936 |
| 600 | Ga0495654_0000096 | 3300046530 | Bacteria | 99777 |
| 601 | Ga0495654_0002752 | 3300046530 | Bacteria | 11090 |
| 602 | Ga0495654_0003864 | 3300046530 | Bacteria | 9046 |
| 603 | Ga0495654_0005166 | 3300046530 | Bacteria | 7614 |
| 604 | Ga0495654_0006125 | 3300046530 | Bacteria | 6886 |
| 605 | Ga0495654_0008426 | 3300046530 | Bacteria | 5697 |
| 606 | Ga0495654_0009678 | 3300046530 | Bacteria | 5278 |
| 607 | Ga0495654_0010751 | 3300046530 | Bacteria | 4971 |
| 608 | Ga0495654_0011226 | 3300046530 | Bacteria | 4857 |
| 609 | Ga0495654_0013108 | 3300046530 | Bacteria | 4440 |
| 610 | Ga0495654_0015333 | 3300046530 | Bacteria | 4071 |
| 611 | Ga0495654_0028011 | 3300046530 | Bacteria | 2883 |
| 612 | Ga0495654_0029064 | 3300046530 | Bacteria | 2821 |
| 613 | Ga0495654_0035397 | 3300046530 | Bacteria | 2514 |
| 614 | Ga0495654_0043786 | 3300046530 | Bacteria | 2217 |
| 615 | Ga0495654_0048813 | 3300046530 | Bacteria | 2075 |
| 616 | Ga0495654_0052083 | 3300046530 | Bacteria | 1995 |
| 617 | Ga0495654_0058245 | 3300046530 | Bacteria | 1864 |
| 618 | Ga0495654_0063942 | 3300046530 | Bacteria | 1760 |
| 619 | Ga0495654_0081285 | 3300046530 | Bacteria | 1519 |
| 620 | Ga0495654_0083604 | 3300046530 | Bacteria | 1492 |
| 621 | Ga0495654_0085782 | 3300046530 | Bacteria | 1468 |
| 622 | Ga0495586_0011665 | 3300046535 | Bacteria | 4675 |
| 623 | Ga0495587_0001493 | 3300046536 | Bacteria | 15596 |
| 624 | Ga0495587_0011869 | 3300046536 | Bacteria | 5506 |
| 625 | Ga0495609_0000004 | 3300046538 | Bacteria | 697346 |
| 626 | Ga0495609_0000079 | 3300046538 | Bacteria | 118997 |
| 627 | Ga0495609_0000360 | 3300046538 | Bacteria | 39526 |
| 628 | Ga0495609_0001254 | 3300046538 | Bacteria | 17456 |
| 629 | Ga0495609_0003270 | 3300046538 | Bacteria | 9357 |
| 630 | Ga0495609_0005619 | 3300046538 | Bacteria | 6538 |
| 631 | Ga0495609_0008683 | 3300046538 | Bacteria | 4955 |
| 632 | Ga0495609_0022256 | 3300046538 | Bacteria | 2920 |
| 633 | Ga0495609_0022419 | 3300046538 | Bacteria | 2909 |
| 634 | Ga0495609_0043418 | 3300046538 | Bacteria | 2018 |
| 635 | Ga0495609_0044125 | 3300046538 | Bacteria | 2000 |
| 636 | Ga0495597_0001669 | 3300046542 | Bacteria | 15445 |
| 637 | Ga0495597_0011466 | 3300046542 | Bacteria | 4296 |
| 638 | Ga0495597_0011624 | 3300046542 | Bacteria | 4264 |
| 639 | Ga0495597_0011634 | 3300046542 | Bacteria | 4262 |
| 640 | Ga0495597_0026156 | 3300046542 | Bacteria | 2681 |
| 641 | Ga0495597_0026339 | 3300046542 | Bacteria | 2671 |
| 642 | Ga0495597_0036370 | 3300046542 | Bacteria | 2217 |
| 643 | Ga0495597_0036815 | 3300046542 | Bacteria | 2200 |
| 644 | Ga0495597_0038287 | 3300046542 | Bacteria | 2149 |
| 645 | Ga0495645_0141105 | 3300046543 | Bacteria | 1680 |
| 646 | Ga0495622_0000809 | 3300046557 | Bacteria | 17316 |
| 647 | Ga0495622_0001364 | 3300046557 | Bacteria | 12491 |
| 648 | Ga0495622_0002770 | 3300046557 | Bacteria | 8374 |
| 649 | Ga0495622_0029990 | 3300046557 | Bacteria | 2541 |
| 650 | Ga0495622_0042043 | 3300046557 | Bacteria | 2125 |
| 651 | Ga0495622_0052666 | 3300046557 | Bacteria | 1888 |
| 652 | Ga0495622_0112533 | 3300046557 | Bacteria | 1246 |
| 653 | Ga0495633_0000206 | 3300046558 | Bacteria | 74675 |
| 654 | Ga0495633_0006362 | 3300046558 | Bacteria | 7018 |
| 655 | Ga0495633_0023386 | 3300046558 | Bacteria | 3063 |
| 656 | Ga0495633_0065661 | 3300046558 | Bacteria | 1695 |
| 657 | Ga0495633_0082593 | 3300046558 | Bacteria | 1495 |
| 658 | Ga0495656_0060819 | 3300046615 | Bacteria | 1647 |
| 659 | Ga0495656_0115997 | 3300046615 | Bacteria | 1258 |
| 660 | Ga0495668_0001701 | 3300046616 | Bacteria | 20338 |
| 661 | Ga0495668_0003203 | 3300046616 | Bacteria | 12520 |
| 662 | Ga0495668_0028596 | 3300046616 | Bacteria | 3152 |
| 663 | Ga0495668_0033494 | 3300046616 | Bacteria | 2886 |
| 664 | Ga0495668_0044190 | 3300046616 | Bacteria | 2476 |
| 665 | Ga0495634_0000967 | 3300046642 | Bacteria | 27121 |
| 666 | Ga0495611_0000594 | 3300046648 | Bacteria | 20905 |
| 667 | Ga0495611_0000656 | 3300046648 | Bacteria | 19743 |
| 668 | Ga0495611_0000770 | 3300046648 | Bacteria | 17962 |
| 669 | Ga0495611_0016202 | 3300046648 | Bacteria | 3186 |
| 670 | Ga0495611_0035498 | 3300046648 | Bacteria | 2209 |
| 671 | Ga0495611_0055092 | 3300046648 | Bacteria | 1798 |
| 672 | Ga0495625_0000076 | 3300046660 | Bacteria | 163580 |
| 673 | Ga0495625_0004417 | 3300046660 | Bacteria | 13308 |
| 674 | Ga0495625_0007516 | 3300046660 | Bacteria | 9469 |
| 675 | Ga0495625_0016243 | 3300046660 | Bacteria | 5864 |
| 676 | Ga0495625_0023825 | 3300046660 | Bacteria | 4671 |
| 677 | Ga0495625_0050568 | 3300046660 | Bacteria | 2982 |
| 678 | Ga0495625_0083892 | 3300046660 | Bacteria | 2214 |
| 679 | Ga0495625_0145433 | 3300046660 | Bacteria | 1596 |
| 680 | Ga0495635_0000752 | 3300046663 | Bacteria | 21018 |
| 681 | Ga0495635_0001802 | 3300046663 | Bacteria | 14476 |
| 682 | Ga0495659_0001347 | 3300046664 | Bacteria | 8436 |
| 683 | Ga0495659_0004979 | 3300046664 | Bacteria | 4177 |
| 684 | Ga0495659_0017477 | 3300046664 | Bacteria | 2377 |
| 685 | Ga0495661_0000005 | 3300046665 | Bacteria | 433622 |
| 686 | Ga0495661_0000099 | 3300046665 | Bacteria | 106462 |
| 687 | Ga0495661_0000127 | 3300046665 | Bacteria | 92684 |
| 688 | Ga0495661_0000146 | 3300046665 | Bacteria | 82292 |
| 689 | Ga0495661_0000773 | 3300046665 | Bacteria | 30663 |
| 690 | Ga0495661_0007011 | 3300046665 | Bacteria | 7878 |
| 691 | Ga0495661_0039141 | 3300046665 | Bacteria | 2948 |
| 692 | Ga0495661_0042222 | 3300046665 | Bacteria | 2812 |
| 693 | Ga0495661_0097094 | 3300046665 | Bacteria | 1665 |
| 694 | Ga0495661_0098029 | 3300046665 | Bacteria | 1655 |
| 695 | Ga0495588_0004580 | 3300046674 | Bacteria | 6111 |
| 696 | Ga0495588_0028030 | 3300046674 | Bacteria | 2817 |
| 697 | Ga0495588_0028901 | 3300046674 | Bacteria | 2778 |
| 698 | Ga0495588_0113369 | 3300046674 | Bacteria | 1428 |
| 699 | Ga0495623_0001889 | 3300046679 | Bacteria | 14069 |
| 700 | Ga0495623_0021455 | 3300046679 | Bacteria | 4170 |
| 701 | Ga0495646_0005511 | 3300046680 | Bacteria | 8003 |
| 702 | Ga0495646_0011937 | 3300046680 | Bacteria | 5525 |
| 703 | Ga0495646_0042659 | 3300046680 | Bacteria | 2783 |
| 704 | Ga0495669_0016103 | 3300046684 | Bacteria | 3201 |
| 705 | Ga0495669_0034601 | 3300046684 | Bacteria | 2227 |
| 706 | Ga0495613_0022420 | 3300046689 | Bacteria | 4706 |
| 707 | Ga0495613_0040240 | 3300046689 | Bacteria | 3464 |
| 708 | Ga0495613_0103158 | 3300046689 | Bacteria | 2059 |
| 709 | Ga0495613_0228727 | 3300046689 | Bacteria | 1303 |
| 710 | Ga0495624_0004783 | 3300046690 | Bacteria | 9847 |
| 711 | Ga0495670_0001322 | 3300046691 | Bacteria | 12081 |
| 712 | Ga0495670_0002495 | 3300046691 | Bacteria | 9090 |
| 713 | Ga0495670_0003468 | 3300046691 | Bacteria | 7747 |
| 714 | Ga0495670_0006604 | 3300046691 | Bacteria | 5703 |
| 715 | Ga0495670_0039610 | 3300046691 | Bacteria | 2350 |
| 716 | Ga0495671_0000908 | 3300046692 | Bacteria | 21076 |
| 717 | Ga0495671_0003363 | 3300046692 | Bacteria | 9864 |
| 718 | Ga0495671_0004322 | 3300046692 | Bacteria | 8540 |
| 719 | Ga0495671_0010112 | 3300046692 | Bacteria | 5244 |
| 720 | Ga0495671_0010611 | 3300046692 | Bacteria | 5094 |
| 721 | Ga0495671_0014752 | 3300046692 | Bacteria | 4199 |
| 722 | Ga0495671_0016273 | 3300046692 | Bacteria | 3974 |
| 723 | Ga0495671_0020993 | 3300046692 | Bacteria | 3435 |
| 724 | Ga0495671_0028218 | 3300046692 | Bacteria | 2893 |
| 725 | Ga0495671_0038625 | 3300046692 | Bacteria | 2412 |
| 726 | Ga0495671_0044861 | 3300046692 | Bacteria | 2215 |
| 727 | Ga0495671_0054332 | 3300046692 | Bacteria | 1986 |
| 728 | Ga0495671_0062466 | 3300046692 | Bacteria | 1835 |
| 729 | Ga0495671_0090416 | 3300046692 | Bacteria | 1498 |
| 730 | Ga0495671_0099551 | 3300046692 | Bacteria | 1421 |
| 731 | Ga0495649_0003430 | 3300046694 | Bacteria | 10699 |
| 732 | Ga0495649_0006888 | 3300046694 | Bacteria | 7033 |
| 733 | Ga0495649_0010145 | 3300046694 | Bacteria | 5567 |
| 734 | Ga0495649_0011489 | 3300046694 | Bacteria | 5190 |
| 735 | Ga0495649_0023301 | 3300046694 | Bacteria | 3459 |
| 736 | Ga0495649_0032213 | 3300046694 | Bacteria | 2888 |
| 737 | Ga0495649_0045152 | 3300046694 | Bacteria | 2403 |
| 738 | Ga0495649_0058418 | 3300046694 | Bacteria | 2078 |
| 739 | Ga0495649_0067577 | 3300046694 | Bacteria | 1917 |
| 740 | Ga0495649_0087866 | 3300046694 | Bacteria | 1658 |
| 741 | Ga0495649_0134911 | 3300046694 | Bacteria | 1301 |
| 742 | Ga0495589_0000194 | 3300046794 | Bacteria | 53082 |
| 743 | Ga0495589_0000777 | 3300046794 | Bacteria | 20260 |
| 744 | Ga0495589_0003301 | 3300046794 | Bacteria | 8755 |
| 745 | Ga0495589_0007266 | 3300046794 | Bacteria | 5801 |
| 746 | Ga0495589_0018660 | 3300046794 | Bacteria | 3556 |
| 747 | Ga0495589_0022307 | 3300046794 | Bacteria | 3231 |
| 748 | Ga0495589_0024274 | 3300046794 | Bacteria | 3082 |
| 749 | Ga0495589_0027652 | 3300046794 | Bacteria | 2867 |
| 750 | Ga0495589_0056830 | 3300046794 | Bacteria | 1925 |
| 751 | Ga0495589_0073266 | 3300046794 | Bacteria | 1671 |
| 752 | Ga0495589_0074064 | 3300046794 | Bacteria | 1661 |
| 753 | Ga0495600_0007252 | 3300046809 | Bacteria | 6770 |
| 754 | Ga0495600_0028848 | 3300046809 | Bacteria | 3591 |
| 755 | Ga0495600_0036464 | 3300046809 | Bacteria | 3195 |
| 756 | Ga0495660_0002363 | 3300046810 | Bacteria | 12059 |
| 757 | Ga0495660_0003734 | 3300046810 | Bacteria | 9347 |
| 758 | Ga0495660_0012950 | 3300046810 | Bacteria | 4835 |
| 759 | Ga0495660_0020560 | 3300046810 | Bacteria | 3783 |
| 760 | Ga0495660_0025858 | 3300046810 | Bacteria | 3331 |
| 761 | Ga0495660_0028570 | 3300046810 | Bacteria | 3149 |
| 762 | Ga0495660_0040404 | 3300046810 | Bacteria | 2585 |
| 763 | Ga0495660_0055122 | 3300046810 | Bacteria | 2152 |
| 764 | Ga0495660_0062743 | 3300046810 | Bacteria | 1991 |
| 765 | Ga0495660_0071586 | 3300046810 | Bacteria | 1838 |
| 766 | Ga0495660_0100401 | 3300046810 | Bacteria | 1490 |
| 767 | Ga0495581_0015921 | 3300047315 | Bacteria | 4369 |
| 768 | Ga0495581_0068343 | 3300047315 | Bacteria | 2054 |
| 769 | Ga0495604_0033465 | 3300047317 | Bacteria | 4069 |
| 770 | Ga0495604_0072913 | 3300047317 | Bacteria | 2593 |
| 771 | Ga0495636_0000764 | 3300047318 | Bacteria | 11844 |
| 772 | Ga0495636_0106463 | 3300047318 | Bacteria | 1230 |
| 773 | Ga0495674_0005437 | 3300047319 | Bacteria | 12235 |
| 774 | Ga0495672_0000952 | 3300047320 | Bacteria | 30191 |
| 775 | Ga0495672_0001238 | 3300047320 | Bacteria | 25658 |
| 776 | Ga0495672_0005100 | 3300047320 | Bacteria | 10485 |
| 777 | Ga0495672_0005823 | 3300047320 | Bacteria | 9675 |
| 778 | Ga0495672_0008463 | 3300047320 | Bacteria | 7588 |
| 779 | Ga0495672_0043255 | 3300047320 | Bacteria | 2709 |
| 780 | Ga0495672_0050193 | 3300047320 | Bacteria | 2464 |
| 781 | Ga0495672_0055929 | 3300047320 | Bacteria | 2299 |
| 782 | Ga0495672_0057269 | 3300047320 | Bacteria | 2264 |
| 783 | Ga0495672_0057795 | 3300047320 | Bacteria | 2251 |
| 784 | Ga0495672_0067620 | 3300047320 | Bacteria | 2034 |
| 785 | Ga0495672_0073903 | 3300047320 | Bacteria | 1921 |
| 786 | Ga0495672_0090339 | 3300047320 | Bacteria | 1683 |
| 787 | Ga0495672_0118341 | 3300047320 | Bacteria | 1412 |
| 788 | Ga0495676_0000016 | 3300047321 | Bacteria | 196310 |
| 789 | Ga0495676_0002566 | 3300047321 | Bacteria | 16178 |
| 790 | Ga0495676_0082399 | 3300047321 | Bacteria | 2435 |
| 791 | Ga0495680_0004320 | 3300047322 | Bacteria | 13619 |
| 792 | Ga0495680_0018000 | 3300047322 | Bacteria | 6011 |
| 793 | Ga0495680_0056009 | 3300047322 | Bacteria | 3054 |
| 794 | Ga0495683_0000031 | 3300047323 | Bacteria | 150363 |
| 795 | Ga0495683_0000322 | 3300047323 | Bacteria | 40105 |
| 796 | Ga0495683_0000902 | 3300047323 | Bacteria | 20949 |
| 797 | Ga0495683_0004157 | 3300047323 | Bacteria | 8284 |
| 798 | Ga0495683_0019630 | 3300047323 | Bacteria | 3487 |
| 799 | Ga0495683_0125714 | 3300047323 | Bacteria | 1213 |
| 800 | Ga0495687_006222 | 3300047443 | Bacteria | 7365 |
| 801 | Ga0495687_020533 | 3300047443 | Bacteria | 3215 |
| 802 | Ga0495675_0018128 | 3300047444 | Bacteria | 4464 |
| 803 | Ga0495675_0063457 | 3300047444 | Bacteria | 2337 |
| 804 | Ga0495675_0086791 | 3300047444 | Bacteria | 1966 |
| 805 | Ga0495677_0003900 | 3300047445 | Bacteria | 5768 |
| 806 | Ga0495679_000087 | 3300047446 | Bacteria | 85691 |
| 807 | Ga0495679_000154 | 3300047446 | Bacteria | 61634 |
| 808 | Ga0495679_012040 | 3300047446 | Bacteria | 3313 |
| 809 | Ga0495679_014298 | 3300047446 | Bacteria | 2946 |
| 810 | Ga0495679_014799 | 3300047446 | Bacteria | 2875 |
| 811 | Ga0495679_016261 | 3300047446 | Bacteria | 2695 |
| 812 | Ga0495679_018743 | 3300047446 | Bacteria | 2447 |
| 813 | Ga0495685_019273 | 3300047447 | Bacteria | 2344 |
| 814 | Ga0495673_0000704 | 3300047469 | Bacteria | 32460 |
| 815 | Ga0495673_0001106 | 3300047469 | Bacteria | 23217 |
| 816 | Ga0495673_0001933 | 3300047469 | Bacteria | 15387 |
| 817 | Ga0495673_0002323 | 3300047469 | Bacteria | 13555 |
| 818 | Ga0495673_0002388 | 3300047469 | Bacteria | 13276 |
| 819 | Ga0495673_0004200 | 3300047469 | Bacteria | 9086 |
| 820 | Ga0495673_0006307 | 3300047469 | Bacteria | 6988 |
| 821 | Ga0495673_0011518 | 3300047469 | Bacteria | 4751 |
| 822 | Ga0495673_0015126 | 3300047469 | Bacteria | 3986 |
| 823 | Ga0495673_0015438 | 3300047469 | Bacteria | 3935 |
| 824 | Ga0495673_0018836 | 3300047469 | Bacteria | 3471 |
| 825 | Ga0495673_0022794 | 3300047469 | Bacteria | 3061 |
| 826 | Ga0495673_0025050 | 3300047469 | Bacteria | 2871 |
| 827 | Ga0495673_0030887 | 3300047469 | Bacteria | 2512 |
| 828 | Ga0495673_0033711 | 3300047469 | Bacteria | 2373 |
| 829 | Ga0495673_0036977 | 3300047469 | Bacteria | 2234 |
| 830 | Ga0495673_0045850 | 3300047469 | Bacteria | 1940 |
| 831 | Ga0495673_0046077 | 3300047469 | Bacteria | 1934 |
| 832 | Ga0495673_0070511 | 3300047469 | Bacteria | 1471 |
| 833 | Ga0495681_0001149 | 3300047470 | Bacteria | 20081 |
| 834 | Ga0495681_0003041 | 3300047470 | Bacteria | 11788 |
| 835 | Ga0495681_0003165 | 3300047470 | Bacteria | 11520 |
| 836 | Ga0495681_0003188 | 3300047470 | Bacteria | 11445 |
| 837 | Ga0495681_0003564 | 3300047470 | Bacteria | 10834 |
| 838 | Ga0495681_0004680 | 3300047470 | Bacteria | 9276 |
| 839 | Ga0495681_0005315 | 3300047470 | Bacteria | 8640 |
| 840 | Ga0495681_0005862 | 3300047470 | Bacteria | 8159 |
| 841 | Ga0495681_0013963 | 3300047470 | Bacteria | 4631 |
| 842 | Ga0495681_0019405 | 3300047470 | Bacteria | 3713 |
| 843 | Ga0495681_0023876 | 3300047470 | Bacteria | 3235 |
| 844 | Ga0495681_0024143 | 3300047470 | Bacteria | 3212 |
| 845 | Ga0495681_0027203 | 3300047470 | Bacteria | 2963 |
| 846 | Ga0495681_0039999 | 3300047470 | Bacteria | 2286 |
| 847 | Ga0495681_0040015 | 3300047470 | Bacteria | 2285 |
| 848 | Ga0495681_0051887 | 3300047470 | Bacteria | 1927 |
| 849 | Ga0495681_0081495 | 3300047470 | Bacteria | 1443 |
| 850 | Ga0495684_0046103 | 3300047471 | Bacteria | 3335 |
| 851 | Ga0495686_0002947 | 3300047472 | Bacteria | 15226 |
| 852 | Ga0495686_0016378 | 3300047472 | Bacteria | 5027 |
| 853 | Ga0495686_0018446 | 3300047472 | Bacteria | 4683 |
| 854 | Ga0495686_0029408 | 3300047472 | Bacteria | 3574 |
| 855 | Ga0495686_0095488 | 3300047472 | Bacteria | 1800 |
| 856 | Ga0495686_0109163 | 3300047472 | Bacteria | 1661 |
| 857 | Ga0495593_0028044 | 3300047673 | Bacteria | 3094 |
| 858 | Ga0495593_0045035 | 3300047673 | Bacteria | 2356 |
| 859 | Ga0495593_0084041 | 3300047673 | Bacteria | 1643 |
| 860 | Ga0495602_0110889 | 3300048088 | Bacteria | 2229 |
| 861 | Ga0495626_0000098 | 3300048091 | Bacteria | 113821 |
| 862 | Ga0495626_0000230 | 3300048091 | Bacteria | 65859 |
| 863 | Ga0495626_0000263 | 3300048091 | Bacteria | 59779 |
| 864 | Ga0495626_0000577 | 3300048091 | Bacteria | 36311 |
| 865 | Ga0495626_0001223 | 3300048091 | Bacteria | 21166 |
| 866 | Ga0495626_0004178 | 3300048091 | Bacteria | 8957 |
| 867 | Ga0495626_0004696 | 3300048091 | Bacteria | 8284 |
| 868 | Ga0495626_0005042 | 3300048091 | Bacteria | 7881 |
| 869 | Ga0495626_0006801 | 3300048091 | Bacteria | 6463 |
| 870 | Ga0495626_0025224 | 3300048091 | Bacteria | 2908 |
| 871 | Ga0495626_0066570 | 3300048091 | Bacteria | 1628 |
| 872 | Ga0496102_0000991 | 3300048905 | Bacteria | 26693 |
| 873 | Ga0496103_0000997 | 3300048906 | Bacteria | 19928 |
| 874 | Ga0496106_0110942 | 3300048909 | Bacteria | 2135 |
| 875 | Ga0496106_0152882 | 3300048909 | Bacteria | 1821 |
| 876 | Ga0496110_0056893 | 3300048913 | Bacteria | 3441 |
| 877 | Ga0496110_0241448 | 3300048913 | Bacteria | 1644 |
| 878 | Ga0496116_0000085 | 3300048919 | Bacteria | 219553 |
| 879 | Ga0496116_0002312 | 3300048919 | Bacteria | 20203 |
| 880 | Ga0496116_0007971 | 3300048919 | Bacteria | 9278 |
| 881 | Ga0496116_0010359 | 3300048919 | Bacteria | 7826 |
| 882 | Ga0496116_0033598 | 3300048919 | Bacteria | 3637 |
| 883 | Ga0496116_0045906 | 3300048919 | Bacteria | 2953 |
| 884 | Ga0496116_0076728 | 3300048919 | Bacteria | 2092 |
| 885 | Ga0496117_0001323 | 3300048920 | Bacteria | 36451 |
| 886 | Ga0496117_0001620 | 3300048920 | Bacteria | 31800 |
| 887 | Ga0496117_0003088 | 3300048920 | Bacteria | 19934 |
| 888 | Ga0496117_0012255 | 3300048920 | Bacteria | 7580 |
| 889 | Ga0496117_0018402 | 3300048920 | Bacteria | 5786 |
| 890 | Ga0496117_0022061 | 3300048920 | Bacteria | 5118 |
| 891 | Ga0496117_0024440 | 3300048920 | Bacteria | 4780 |
| 892 | Ga0496117_0050277 | 3300048920 | Bacteria | 2956 |
| 893 | Ga0496117_0077709 | 3300048920 | Bacteria | 2195 |
| 894 | Ga0496117_0149519 | 3300048920 | Bacteria | 1384 |
| 895 | Ga0496118_0002712 | 3300048921 | Bacteria | 23338 |
| 896 | Ga0496118_0002985 | 3300048921 | Bacteria | 21881 |
| 897 | Ga0496118_0008257 | 3300048921 | Bacteria | 10796 |
| 898 | Ga0496118_0021501 | 3300048921 | Bacteria | 5674 |
| 899 | Ga0496118_0052475 | 3300048921 | Bacteria | 3109 |
| 900 | Ga0496118_0054134 | 3300048921 | Bacteria | 3042 |
| 901 | Ga0496118_0065624 | 3300048921 | Bacteria | 2655 |
| 902 | Ga0496118_0079460 | 3300048921 | Bacteria | 2314 |
| 903 | Ga0496118_0083334 | 3300048921 | Bacteria | 2236 |
| 904 | Ga0496118_0152586 | 3300048921 | Bacteria | 1443 |
| 905 | Ga0496118_0156975 | 3300048921 | Bacteria | 1413 |
| 906 | Ga0496119_0000612 | 3300048922 | Bacteria | 48284 |
| 907 | Ga0496119_0063537 | 3300048922 | Bacteria | 2195 |
| 908 | Ga0496119_0071589 | 3300048922 | Bacteria | 2029 |
| 909 | Ga0496119_0082378 | 3300048922 | Bacteria | 1850 |
| 910 | Ga0496119_0122838 | 3300048922 | Bacteria | 1425 |
| 911 | Ga0496120_0001054 | 3300048923 | Bacteria | 36515 |
| 912 | Ga0496120_0008485 | 3300048923 | Bacteria | 7452 |
| 913 | Ga0496120_0067004 | 3300048923 | Bacteria | 1984 |
| 914 | Ga0496120_0149730 | 3300048923 | Bacteria | 1174 |
| 915 | Ga0496121_0000179 | 3300048924 | Bacteria | 141214 |
| 916 | Ga0496121_0011251 | 3300048924 | Bacteria | 9971 |
| 917 | Ga0496121_0023305 | 3300048924 | Bacteria | 5968 |
| 918 | Ga0496121_0062161 | 3300048924 | Bacteria | 3061 |
| 919 | Ga0496121_0090060 | 3300048924 | Bacteria | 2399 |
| 920 | Ga0496121_0101989 | 3300048924 | Bacteria | 2212 |
| 921 | Ga0496121_0170592 | 3300048924 | Bacteria | 1581 |
| 922 | Ga0496122_0002404 | 3300048925 | Bacteria | 26680 |
| 923 | Ga0496122_0007083 | 3300048925 | Bacteria | 12597 |
| 924 | Ga0496122_0029324 | 3300048925 | Bacteria | 4643 |
| 925 | Ga0496122_0048877 | 3300048925 | Bacteria | 3247 |
| 926 | Ga0496122_0077274 | 3300048925 | Bacteria | 2338 |
| 927 | Ga0496122_0108927 | 3300048925 | Bacteria | 1825 |
| 928 | Ga0496122_0119113 | 3300048925 | Bacteria | 1708 |
| 929 | Ga0496122_0123958 | 3300048925 | Bacteria | 1659 |
| 930 | Ga0496123_0000439 | 3300048926 | Bacteria | 74838 |
| 931 | Ga0496123_0048907 | 3300048926 | Bacteria | 2840 |
| 932 | Ga0496123_0054519 | 3300048926 | Bacteria | 2631 |
| 933 | Ga0496123_0076472 | 3300048926 | Bacteria | 2060 |
| 934 | Ga0496123_0107849 | 3300048926 | Bacteria | 1601 |
| 935 | Ga0496123_0137627 | 3300048926 | Bacteria | 1341 |
| 936 | Ga0496124_0000132 | 3300048927 | Bacteria | 155405 |
| 937 | Ga0496124_0001693 | 3300048927 | Bacteria | 31219 |
| 938 | Ga0496124_0002847 | 3300048927 | Bacteria | 21864 |
| 939 | Ga0496124_0006195 | 3300048927 | Bacteria | 13110 |
| 940 | Ga0496124_0015103 | 3300048927 | Bacteria | 7424 |
| 941 | Ga0496124_0027297 | 3300048927 | Bacteria | 5127 |
| 942 | Ga0496124_0038452 | 3300048927 | Bacteria | 4155 |
| 943 | Ga0496124_0060348 | 3300048927 | Bacteria | 3181 |
| 944 | Ga0496124_0068606 | 3300048927 | Bacteria | 2946 |
| 945 | Ga0496124_0134045 | 3300048927 | Bacteria | 1964 |
| 946 | Ga0496124_0152295 | 3300048927 | Bacteria | 1812 |
| 947 | Ga0496124_0160168 | 3300048927 | Bacteria | 1755 |
| 948 | Ga0496125_0000380 | 3300048928 | Bacteria | 82955 |
| 949 | Ga0496125_0001691 | 3300048928 | Bacteria | 30828 |
| 950 | Ga0496125_0005312 | 3300048928 | Bacteria | 14399 |
| 951 | Ga0496125_0038928 | 3300048928 | Bacteria | 4105 |
| 952 | Ga0496125_0068930 | 3300048928 | Bacteria | 2779 |
| 953 | Ga0496125_0085987 | 3300048928 | Bacteria | 2380 |
| 954 | Ga0496125_0157542 | 3300048928 | Bacteria | 1548 |
| 955 | Ga0496125_0187946 | 3300048928 | Bacteria | 1367 |
| 956 | Ga0496126_0009446 | 3300048929 | Bacteria | 10352 |
| 957 | Ga0496126_0097180 | 3300048929 | Bacteria | 2581 |
| 958 | Ga0496126_0177264 | 3300048929 | Bacteria | 1812 |
| 959 | Ga0496126_0250389 | 3300048929 | Bacteria | 1476 |
| 960 | Ga0495678_000186 | 3300049459 | Bacteria | 72357 |
| 961 | Ga0495678_002417 | 3300049459 | Bacteria | 12714 |
| 962 | Ga0495678_003788 | 3300049459 | Bacteria | 9127 |
| 963 | Ga0495678_006374 | 3300049459 | Bacteria | 6291 |
| 964 | Ga0495678_008931 | 3300049459 | Bacteria | 5011 |
| 965 | Ga0495678_008976 | 3300049459 | Bacteria | 4993 |
| 966 | Ga0495678_011686 | 3300049459 | Bacteria | 4192 |
| 967 | Ga0495678_014787 | 3300049459 | Bacteria | 3616 |
| 968 | Ga0495678_018255 | 3300049459 | Bacteria | 3158 |
| 969 | Ga0495678_018731 | 3300049459 | Bacteria | 3106 |
| 970 | Ga0495678_022834 | 3300049459 | Bacteria | 2729 |
| 971 | Ga0495678_034970 | 3300049459 | Bacteria | 2064 |
| 972 | Ga0495678_035291 | 3300049459 | Bacteria | 2051 |
| 973 | Ga0495678_035381 | 3300049459 | Bacteria | 2048 |
| 974 | Ga0495678_060052 | 3300049459 | Bacteria | 1431 |
| 975 | Ga0495678_064926 | 3300049459 | Bacteria | 1357 |
| 976 | Ga0495682_0002928 | 3300049460 | Bacteria | 7818 |
| 977 | Ga0495682_0013169 | 3300049460 | Bacteria | 3153 |
| 978 | Ga0495682_0017012 | 3300049460 | Bacteria | 2749 |
| 979 | Ga0495682_0017566 | 3300049460 | Bacteria | 2697 |
| 980 | Ga0495682_0032018 | 3300049460 | Bacteria | 1942 |
| 981 | Ga0495682_0038854 | 3300049460 | Bacteria | 1748 |
| 982 | Ga0495682_0073128 | 3300049460 | Bacteria | 1233 |
| 983 | Ga0501034_0000041 | 3300049571 | Bacteria | 229264 |
| 984 | Ga0501241_002093 | 3300049758 | Bacteria | 3912 |
| 985 | nmdc:mga03683_48851_c1 | 3300050489 | Bacteria | 1760 |
| 986 | nmdc:mga00v17_134465_c1 | 3300050491 | Bacteria | 1582 |
| 987 | nmdc:mga00v17_153125_c1 | 3300050491 | Bacteria | 1482 |
| 988 | nmdc:mga08x19_292552_c1 | 3300050514 | Bacteria | 1130 |
| 989 | Ga0500572_012531 | 3300053111 | Bacteria | 2079 |
| 990 | Ga0500659_0035137 | 3300053135 | Bacteria | 2731 |
| 991 | Ga0500573_0079969 | 3300053140 | Bacteria | 1858 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009036 | Ga0105244_10002675 | Ga0105244_100026757 | 316 |
| 2 | 3300025711 | Ga0207696_1010018 | Ga0207696_10100182 | 316 |
| 3 | 3300025728 | Ga0207655_1000151 | Ga0207655_100015148 | 316 |
| 4 | 3300025735 | Ga0207713_1012122 | Ga0207713_10121224 | 316 |
| 5 | 3300048920 | Ga0496117_0003088 | Ga0496117_0003088_303_1376 | 316 |
| 6 | 3300048921 | Ga0496118_0002712 | Ga0496118_0002712_18559_19632 | 316 |
| 7 | 3300048925 | Ga0496122_0002404 | Ga0496122_0002404_8838_10046 | 316 |
| 8 | 3300048926 | Ga0496123_0000439 | Ga0496123_0000439_54631_55839 | 316 |
| 9 | 3300048927 | Ga0496124_0060348 | Ga0496124_0060348_1721_2794 | 316 |
| 10 | 3300009036 | Ga0105244_10000274 | Ga0105244_100002746 | 317 |
| 11 | 3300025728 | Ga0207655_1000197 | Ga0207655_100019742 | 317 |
| 12 | 3300027312 | Ga0209371_1000576 | Ga0209371_10005762 | 317 |
| 13 | 3300030500 | Ga0268256_1000503 | Ga0268256_100050329 | 317 |
| 14 | 3300046522 | Ga0495643_0000303 | Ga0495643_0000303_307_1380 | 317 |
| 15 | 3300048924 | Ga0496121_0170592 | Ga0496121_0170592_391_1464 | 317 |
| 16 | 3300006944 | Ga0099823_1000074 | Ga0099823_100007440 | 324 |
| 17 | 3300027296 | Ga0209389_1000063 | Ga0209389_10000638 | 324 |
| 18 | 3300046660 | Ga0495625_0145433 | Ga0495625_0145433_68_1225 | 324 |
| 19 | 3300049571 | Ga0501034_0000041 | Ga0501034_0000041_26382_27455 | 324 |
| 20 | 3300053135 | Ga0500659_0035137 | Ga0500659_0035137_148_1221 | 324 |
| 21 | 3300013100 | Ga0157373_10055665 | Ga0157373_100556652 | 338 |
| 22 | 3300015262 | Ga0182007_10015397 | Ga0182007_100153973 | 338 |
| 23 | 3300046810 | Ga0495660_0062743 | Ga0495660_0062743_99_1175 | 339 |
| 24 | 3300015261 | Ga0182006_1003543 | Ga0182006_10035433 | 342 |
| 25 | 3300015262 | Ga0182007_10000143 | Ga0182007_1000014323 | 342 |
| 26 | 3300015265 | Ga0182005_1002054 | Ga0182005_10020546 | 342 |
| 27 | 3300041405 | Ga0439438_004842 | Ga0439438_004842_3848_4876 | 342 |
| 28 | 3300042013 | Ga0439456_021475 | Ga0439456_021475_23_1051 | 342 |
| 29 | 3300046452 | Ga0495617_000327 | Ga0495617_000327_13232_14260 | 342 |
| 30 | 3300046457 | Ga0495590_0018607 | Ga0495590_0018607_1320_2348 | 342 |
| 31 | 3300046471 | Ga0495650_0009633 | Ga0495650_0009633_561_1589 | 342 |
| 32 | 3300046475 | Ga0495639_0000714 | Ga0495639_0000714_2013_3041 | 342 |
| 33 | 3300046499 | Ga0495594_0036640 | Ga0495594_0036640_331_1359 | 342 |
| 34 | 3300046501 | Ga0495607_0000349 | Ga0495607_0000349_35918_36946 | 342 |
| 35 | 3300046513 | Ga0495616_0004161 | Ga0495616_0004161_6825_7853 | 342 |
| 36 | 3300046524 | Ga0495648_0025968 | Ga0495648_0025968_899_1927 | 342 |
| 37 | 3300046524 | Ga0495648_0138876 | Ga0495648_0138876_31_1059 | 342 |
| 38 | 3300046524 | Ga0495648_0138881 | Ga0495648_0138881_31_1059 | 342 |
| 39 | 3300046530 | Ga0495654_0010751 | Ga0495654_0010751_429_1457 | 342 |
| 40 | 3300046542 | Ga0495597_0036815 | Ga0495597_0036815_701_1729 | 342 |
| 41 | 3300046557 | Ga0495622_0000809 | Ga0495622_0000809_5524_6552 | 342 |
| 42 | 3300046648 | Ga0495611_0016202 | Ga0495611_0016202_503_1531 | 342 |
| 43 | 3300046664 | Ga0495659_0001347 | Ga0495659_0001347_5981_7009 | 342 |
| 44 | 3300046674 | Ga0495588_0113369 | Ga0495588_0113369_32_1060 | 342 |
| 45 | 3300046694 | Ga0495649_0010145 | Ga0495649_0010145_349_1377 | 342 |
| 46 | 3300046694 | Ga0495649_0058418 | Ga0495649_0058418_138_1166 | 342 |
| 47 | 3300046794 | Ga0495589_0000194 | Ga0495589_0000194_16508_17536 | 342 |
| 48 | 3300046794 | Ga0495589_0024274 | Ga0495589_0024274_1579_2607 | 342 |
| 49 | 3300047318 | Ga0495636_0000764 | Ga0495636_0000764_68_1096 | 342 |
| 50 | 3300047318 | Ga0495636_0106463 | Ga0495636_0106463_135_1163 | 342 |
| 51 | 3300047320 | Ga0495672_0005100 | Ga0495672_0005100_6689_7717 | 342 |
| 52 | 3300047320 | Ga0495672_0090339 | Ga0495672_0090339_304_1332 | 342 |
| 53 | 3300047443 | Ga0495687_006222 | Ga0495687_006222_5978_7006 | 342 |
| 54 | 3300047443 | Ga0495687_020533 | Ga0495687_020533_1324_2352 | 342 |
| 55 | 3300047469 | Ga0495673_0001933 | Ga0495673_0001933_8858_9886 | 342 |
| 56 | 3300047470 | Ga0495681_0005862 | Ga0495681_0005862_1934_2962 | 342 |
| 57 | 3300047673 | Ga0495593_0084041 | Ga0495593_0084041_174_1202 | 342 |
| 58 | 3300048909 | Ga0496106_0152882 | Ga0496106_0152882_605_1633 | 342 |
| 59 | 3300048919 | Ga0496116_0010359 | Ga0496116_0010359_4956_5984 | 342 |
| 60 | 3300048923 | Ga0496120_0149730 | Ga0496120_0149730_31_1059 | 342 |
| 61 | 3300048925 | Ga0496122_0007083 | Ga0496122_0007083_3976_5004 | 342 |
| 62 | 3300048926 | Ga0496123_0054519 | Ga0496123_0054519_1396_2424 | 342 |
| 63 | 3300048927 | Ga0496124_0152295 | Ga0496124_0152295_204_1232 | 342 |
| 64 | 3300049460 | Ga0495682_0032018 | Ga0495682_0032018_44_1072 | 342 |
| 65 | 3300049460 | Ga0495682_0073128 | Ga0495682_0073128_138_1166 | 342 |
| 66 | 3300002738 | JGI25154J39366_1003253 | JGI25154J39366_10032533 | 343 |
| 67 | 3300003751 | Ga0055538_1000078 | Ga0055538_100007847 | 343 |
| 68 | 3300003752 | Ga0055539_1000119 | Ga0055539_100011947 | 343 |
| 69 | 3300003756 | Ga0055533_1000127 | Ga0055533_100012747 | 343 |
| 70 | 3300003758 | Ga0055532_1000068 | Ga0055532_100006837 | 343 |
| 71 | 3300003759 | Ga0055525_1000163 | Ga0055525_100016347 | 343 |
| 72 | 3300003841 | Ga0055541_1000079 | Ga0055541_100007947 | 343 |
| 73 | 3300025206 | Ga0209435_100837 | Ga0209435_1008372 | 343 |
| 74 | 3300025224 | Ga0209784_100015 | Ga0209784_100015396 | 343 |
| 75 | 3300025225 | Ga0209566_100012 | Ga0209566_100012396 | 343 |
| 76 | 3300025226 | Ga0209674_100027 | Ga0209674_100027396 | 343 |
| 77 | 3300025229 | Ga0209147_100019 | Ga0209147_100019396 | 343 |
| 78 | 3300025230 | Ga0209563_100031 | Ga0209563_100031396 | 343 |
| 79 | 3300025233 | Ga0209437_103617 | Ga0209437_1036172 | 343 |
| 80 | 3300025242 | Ga0209258_100381 | Ga0209258_10038118 | 343 |
| 81 | 3300025246 | Ga0209646_1000344 | Ga0209646_100034422 | 343 |
| 82 | 3300025253 | Ga0209677_100016 | Ga0209677_100016396 | 343 |
| 83 | 3300011119 | Ga0105246_10000117 | Ga0105246_1000011711 | 344 |
| 84 | 3300017792 | Ga0163161_10077666 | Ga0163161_100776662 | 344 |
| 85 | 3300048928 | Ga0496125_0068930 | Ga0496125_0068930_245_1321 | 344 |
| 86 | 3300046501 | Ga0495607_0021862 | Ga0495607_0021862_2911_3984 | 345 |
| 87 | 3300006177 | Ga0075362_10096897 | Ga0075362_100968972 | 347 |
| 88 | 3300017792 | Ga0163161_10054038 | Ga0163161_100540383 | 347 |
| 89 | 3300027907 | Ga0207428_10105134 | Ga0207428_101051342 | 347 |
| 90 | 3300046457 | Ga0495590_0022982 | Ga0495590_0022982_303_1379 | 347 |
| 91 | 3300046460 | Ga0495638_0072609 | Ga0495638_0072609_694_1770 | 347 |
| 92 | 3300046471 | Ga0495650_0003352 | Ga0495650_0003352_9665_10741 | 347 |
| 93 | 3300046501 | Ga0495607_0002511 | Ga0495607_0002511_12026_13102 | 347 |
| 94 | 3300046513 | Ga0495616_0002585 | Ga0495616_0002585_1016_2092 | 347 |
| 95 | 3300046515 | Ga0495620_0001337 | Ga0495620_0001337_623_1699 | 347 |
| 96 | 3300046520 | Ga0495637_0026158 | Ga0495637_0026158_428_1504 | 347 |
| 97 | 3300046530 | Ga0495654_0043786 | Ga0495654_0043786_1014_2090 | 347 |
| 98 | 3300046692 | Ga0495671_0038625 | Ga0495671_0038625_1013_2089 | 347 |
| 99 | 3300047469 | Ga0495673_0002323 | Ga0495673_0002323_778_1854 | 347 |
| 100 | 3300047470 | Ga0495681_0003041 | Ga0495681_0003041_1014_2090 | 347 |
| 101 | 3300049460 | Ga0495682_0002928 | Ga0495682_0002928_5717_6793 | 347 |
| 102 | 3300050491 | nmdc:mga00v17_153125_c1 | nmdc:mga00v17_153125_c1_158_1264 | 347 |
| 103 | 3300046506 | Ga0495583_0025371 | Ga0495583_0025371_293_1384 | 348 |
| 104 | 3300046530 | Ga0495654_0029064 | Ga0495654_0029064_1613_2704 | 348 |
| 105 | 3300005288 | Ga0065714_10081673 | Ga0065714_100816732 | 349 |
| 106 | 3300005331 | Ga0070670_100001033 | Ga0070670_10000103310 | 349 |
| 107 | 3300005353 | Ga0070669_100000997 | Ga0070669_1000009972 | 349 |
| 108 | 3300005457 | Ga0070662_100002077 | Ga0070662_1000020777 | 349 |
| 109 | 3300005539 | Ga0068853_100035771 | Ga0068853_1000357713 | 349 |
| 110 | 3300005578 | Ga0068854_100067332 | Ga0068854_1000673322 | 349 |
| 111 | 3300009011 | Ga0105251_10000847 | Ga0105251_1000084725 | 349 |
| 112 | 3300013100 | Ga0157373_10056881 | Ga0157373_100568812 | 349 |
| 113 | 3300013104 | Ga0157370_10152975 | Ga0157370_101529752 | 349 |
| 114 | 3300013105 | Ga0157369_10110064 | Ga0157369_101100642 | 349 |
| 115 | 3300014497 | Ga0182008_10029468 | Ga0182008_100294683 | 349 |
| 116 | 3300017792 | Ga0163161_10226051 | Ga0163161_102260512 | 349 |
| 117 | 3300025735 | Ga0207713_1000882 | Ga0207713_10008824 | 349 |
| 118 | 3300025923 | Ga0207681_10003012 | Ga0207681_100030128 | 349 |
| 119 | 3300025925 | Ga0207650_10000742 | Ga0207650_1000074211 | 349 |
| 120 | 3300025933 | Ga0207706_10000903 | Ga0207706_100009036 | 349 |
| 121 | 3300026041 | Ga0207639_10036851 | Ga0207639_100368512 | 349 |
| 122 | 3300046512 | Ga0495610_0029057 | Ga0495610_0029057_1412_2488 | 349 |
| 123 | 3300046530 | Ga0495654_0035397 | Ga0495654_0035397_1293_2369 | 349 |
| 124 | 3300048926 | Ga0496123_0137627 | Ga0496123_0137627_171_1247 | 349 |
| 125 | 3300050514 | nmdc:mga08x19_292552_c1 | nmdc:mga08x19_292552_c1_16_1068 | 350 |
| 126 | iso_pu_bacteria | 2599185155 | 2599328569 | 351 |
| 127 | iso_pu_bacteria | 2511231006 | 2511266121 | 353 |
| 128 | iso_pu_bacteria | 2511231012 | 2511300452 | 353 |
| 129 | iso_pu_bacteria | 2511231024 | 2511374797 | 353 |
| 130 | iso_pu_bacteria | 2512047018 | 2512329551 | 353 |
| 131 | iso_pu_bacteria | 2554235231 | 2555246087 | 353 |
| 132 | iso_pu_bacteria | 2582580891 | 2583790898 | 353 |
| 133 | iso_pu_bacteria | 2597489887 | 2597856667 | 353 |
| 134 | iso_pu_bacteria | 2599185185 | 2599483082 | 353 |
| 135 | iso_pu_bacteria | 2599185257 | 2599804983 | 353 |
| 136 | iso_pu_bacteria | 2671180172 | 2671768283 | 353 |
| 137 | iso_pu_bacteria | 2675903420 | 2677896681 | 353 |
| 138 | iso_pu_bacteria | 2738541271 | 2738691411 | 353 |
| 139 | iso_pu_bacteria | 2738543016 | 2739267186 | 353 |
| 140 | iso_pu_bacteria | 2740892503 | 2743736091 | 353 |
| 141 | iso_pu_bacteria | 2765235841 | 2765582575 | 353 |
| 142 | iso_pu_bacteria | 2806310737 | 2807409657 | 353 |
| 143 | iso_pu_bacteria | 2806310745 | 2807457958 | 353 |
| 144 | iso_pu_bacteria | 2908446538 | 2908448401 | 353 |
| 145 | iso_pu_bacteria | 2912963787 | 2912965140 | 353 |
| 146 | iso_pu_bacteria | 2919155634 | 2919160058 | 353 |
| 147 | iso_pu_bacteria | 2923153595 | 2923155103 | 353 |
| 148 | iso_pu_bacteria | 2939636861 | 2939642535 | 353 |
| 149 | iso_pu_bacteria | 2939651529 | 2939653500 | 353 |
| 150 | iso_pu_bacteria | 2946006987 | 2946011339 | 353 |
| 151 | iso_pu_bacteria | 3007803356 | 3007806353 | 353 |
| 152 | iso_pu_bacteria | 3007872151 | 3007876024 | 353 |
| 153 | iso_pu_bacteria | 8015687852 | 8015689323 | 353 |
| 154 | iso_pu_bacteria | 8052494512 | 8052498646 | 353 |
| 155 | iso_pu_bacteria | 8054929484 | 8054933914 | 353 |
| 156 | iso_pu_bacteria | 8055770955 | 8055772451 | 353 |
| 157 | iso_pu_bacteria | 8055878733 | 8055880245 | 353 |
| 158 | iso_pu_bacteria | 8056115690 | 8056119959 | 353 |
| 159 | iso_pu_bacteria | 8056120720 | 8056122117 | 353 |
| 160 | iso_pu_bacteria | 8056125926 | 8056130365 | 353 |
| 161 | iso_pu_bacteria | 8056137416 | 8056141601 | 353 |
| 162 | iso_pu_bacteria | 8056155041 | 8056159315 | 353 |
| 163 | 3300042146 | Ga0450907_002076 | Ga0450907_002076_2702_3766 | 354 |
| 164 | iso_pu_bacteria | 2511231004 | 2511254483 | 354 |
| 165 | iso_pu_bacteria | 2511231008 | 2511278677 | 354 |
| 166 | iso_pu_bacteria | 2511231010 | 2511291035 | 354 |
| 167 | iso_pu_bacteria | 2511231011 | 2511298766 | 354 |
| 168 | iso_pu_bacteria | 2511231016 | 2511329180 | 354 |
| 169 | iso_pu_bacteria | 2511231018 | 2511341333 | 354 |
| 170 | iso_pu_bacteria | 2511231019 | 2511347512 | 354 |
| 171 | iso_pu_bacteria | 2511231020 | 2511349906 | 354 |
| 172 | iso_pu_bacteria | 2511231021 | 2511354259 | 354 |
| 173 | iso_pu_bacteria | 2511231022 | 2511360642 | 354 |
| 174 | iso_pu_bacteria | 2511231023 | 2511371293 | 354 |
| 175 | iso_pu_bacteria | 2511231031 | 2511412192 | 354 |
| 176 | iso_pu_bacteria | 2511231156 | 2511823453 | 354 |
| 177 | iso_pu_bacteria | 2554235341 | 2555668499 | 354 |
| 178 | iso_pu_bacteria | 2597489888 | 2597862829 | 354 |
| 179 | iso_pu_bacteria | 2597489889 | 2597868630 | 354 |
| 180 | iso_pu_bacteria | 2599185160 | 2599355496 | 354 |
| 181 | iso_pu_bacteria | 2599185161 | 2599360665 | 354 |
| 182 | iso_pu_bacteria | 2599185162 | 2599366987 | 354 |
| 183 | iso_pu_bacteria | 2599185163 | 2599373777 | 354 |
| 184 | iso_pu_bacteria | 2599185164 | 2599380602 | 354 |
| 185 | iso_pu_bacteria | 2599185165 | 2599387049 | 354 |
| 186 | iso_pu_bacteria | 2599185166 | 2599392635 | 354 |
| 187 | iso_pu_bacteria | 2599185167 | 2599396609 | 354 |
| 188 | iso_pu_bacteria | 2599185168 | 2599404402 | 354 |
| 189 | iso_pu_bacteria | 2599185179 | 2599453331 | 354 |
| 190 | iso_pu_bacteria | 2599185181 | 2599462330 | 354 |
| 191 | iso_pu_bacteria | 2599185182 | 2599466611 | 354 |
| 192 | iso_pu_bacteria | 2599185186 | 2599490578 | 354 |
| 193 | iso_pu_bacteria | 2599185188 | 2599503932 | 354 |
| 194 | iso_pu_bacteria | 2599185189 | 2599507590 | 354 |
| 195 | iso_pu_bacteria | 2599185190 | 2599514663 | 354 |
| 196 | iso_pu_bacteria | 2599185191 | 2599517406 | 354 |
| 197 | iso_pu_bacteria | 2599185212 | 2599615812 | 354 |
| 198 | iso_pu_bacteria | 2599185248 | 2599772730 | 354 |
| 199 | iso_pu_bacteria | 2599185288 | 2599880099 | 354 |
| 200 | iso_pu_bacteria | 2599185289 | 2599889227 | 354 |
| 201 | iso_pu_bacteria | 2599185290 | 2599894072 | 354 |
| 202 | iso_pu_bacteria | 2599185291 | 2599896548 | 354 |
| 203 | iso_pu_bacteria | 2599185300 | 2599931900 | 354 |
| 204 | iso_pu_bacteria | 2599185302 | 2599945550 | 354 |
| 205 | iso_pu_bacteria | 2599185303 | 2599948599 | 354 |
| 206 | iso_pu_bacteria | 2599185304 | 2599956668 | 354 |
| 207 | iso_pu_bacteria | 2599185305 | 2599962621 | 354 |
| 208 | iso_pu_bacteria | 2599185306 | 2599965241 | 354 |
| 209 | iso_pu_bacteria | 2599185308 | 2599978787 | 354 |
| 210 | iso_pu_bacteria | 2599185309 | 2599985410 | 354 |
| 211 | iso_pu_bacteria | 2599185310 | 2599991839 | 354 |
| 212 | iso_pu_bacteria | 2599185311 | 2599996562 | 354 |
| 213 | iso_pu_bacteria | 2599185312 | 2600002364 | 354 |
| 214 | iso_pu_bacteria | 2599185313 | 2600006883 | 354 |
| 215 | iso_pu_bacteria | 2599185314 | 2600010473 | 354 |
| 216 | iso_pu_bacteria | 2599185315 | 2600021396 | 354 |
| 217 | iso_pu_bacteria | 2599185316 | 2600026383 | 354 |
| 218 | iso_pu_bacteria | 2599185317 | 2600032462 | 354 |
| 219 | iso_pu_bacteria | 2599185318 | 2600036319 | 354 |
| 220 | iso_pu_bacteria | 2599185319 | 2600043616 | 354 |
| 221 | iso_pu_bacteria | 2599185320 | 2600049897 | 354 |
| 222 | iso_pu_bacteria | 2599185321 | 2600053522 | 354 |
| 223 | iso_pu_bacteria | 2599185322 | 2600061462 | 354 |
| 224 | iso_pu_bacteria | 2599185323 | 2600067386 | 354 |
| 225 | iso_pu_bacteria | 2599185324 | 2600070393 | 354 |
| 226 | iso_pu_bacteria | 2599185325 | 2600080221 | 354 |
| 227 | iso_pu_bacteria | 2599185356 | 2600214952 | 354 |
| 228 | iso_pu_bacteria | 2600254930 | 2600362024 | 354 |
| 229 | iso_pu_bacteria | 2600254931 | 2600363698 | 354 |
| 230 | iso_pu_bacteria | 2600254954 | 2600445520 | 354 |
| 231 | iso_pu_bacteria | 2600255283 | 2601626536 | 354 |
| 232 | iso_pu_bacteria | 2600255296 | 2601691365 | 354 |
| 233 | iso_pu_bacteria | 2600255313 | 2601774343 | 354 |
| 234 | iso_pu_bacteria | 2600255318 | 2601799962 | 354 |
| 235 | iso_pu_bacteria | 2600255389 | 2602009929 | 354 |
| 236 | iso_pu_bacteria | 2603880185 | 2606074239 | 354 |
| 237 | iso_pu_bacteria | 2603880199 | 2606127101 | 354 |
| 238 | iso_pu_bacteria | 2623620443 | 2624479252 | 354 |
| 239 | iso_pu_bacteria | 2623620446 | 2624493753 | 354 |
| 240 | iso_pu_bacteria | 2643221565 | 2643845161 | 354 |
| 241 | iso_pu_bacteria | 2643221571 | 2643872990 | 354 |
| 242 | iso_pu_bacteria | 2643221589 | 2643952401 | 354 |
| 243 | iso_pu_bacteria | 2643221602 | 2644022165 | 354 |
| 244 | iso_pu_bacteria | 2643221633 | 2644187583 | 354 |
| 245 | iso_pu_bacteria | 2643221650 | 2644283633 | 354 |
| 246 | iso_pu_bacteria | 2643221713 | 2644625112 | 354 |
| 247 | iso_pu_bacteria | 2651869719 | 2652547490 | 354 |
| 248 | iso_pu_bacteria | 2667528170 | 2671090424 | 354 |
| 249 | iso_pu_bacteria | 2667528171 | 2671098116 | 354 |
| 250 | iso_pu_bacteria | 2667528176 | 2671130396 | 354 |
| 251 | iso_pu_bacteria | 2675903515 | 2678262379 | 354 |
| 252 | iso_pu_bacteria | 2713897148 | 2715751789 | 354 |
| 253 | iso_pu_bacteria | 2713897149 | 2715759665 | 354 |
| 254 | iso_pu_bacteria | 2718217725 | 2718633108 | 354 |
| 255 | iso_pu_bacteria | 2721755607 | 2723247658 | 354 |
| 256 | iso_pu_bacteria | 2738541294 | 2738809570 | 354 |
| 257 | iso_pu_bacteria | 2738541309 | 2738896930 | 354 |
| 258 | iso_pu_bacteria | 2738543025 | 2739314288 | 354 |
| 259 | iso_pu_bacteria | 2744054620 | 2745008725 | 354 |
| 260 | iso_pu_bacteria | 2773857670 | 2774121350 | 354 |
| 261 | iso_pu_bacteria | 2773857673 | 2774135983 | 354 |
| 262 | iso_pu_bacteria | 2784132063 | 2784259993 | 354 |
| 263 | iso_pu_bacteria | 2784132072 | 2784317307 | 354 |
| 264 | iso_pu_bacteria | 2791355520 | 2794596175 | 354 |
| 265 | iso_pu_bacteria | 2808606361 | 2808858228 | 354 |
| 266 | iso_pu_bacteria | 2808606376 | 2808924149 | 354 |
| 267 | iso_pu_bacteria | 2808606377 | 2808929989 | 354 |
| 268 | iso_pu_bacteria | 2808606378 | 2808938383 | 354 |
| 269 | iso_pu_bacteria | 2808606380 | 2808946090 | 354 |
| 270 | iso_pu_bacteria | 2808606381 | 2808951935 | 354 |
| 271 | iso_pu_bacteria | 2808606382 | 2808957513 | 354 |
| 272 | iso_pu_bacteria | 2808606383 | 2808966713 | 354 |
| 273 | iso_pu_bacteria | 2808606385 | 2808975712 | 354 |
| 274 | iso_pu_bacteria | 2808606388 | 2808990649 | 354 |
| 275 | iso_pu_bacteria | 2808606389 | 2809001543 | 354 |
| 276 | iso_pu_bacteria | 2808606445 | 2809216211 | 354 |
| 277 | iso_pu_bacteria | 2818991456 | 2819654505 | 354 |
| 278 | iso_pu_bacteria | 2818991464 | 2819703183 | 354 |
| 279 | iso_pu_bacteria | 2823421272 | 2823424233 | 354 |
| 280 | iso_pu_bacteria | 2825651385 | 2825653260 | 354 |
| 281 | iso_pu_bacteria | 2834028612 | 2834029485 | 354 |
| 282 | iso_pu_bacteria | 2842826826 | 2842830949 | 354 |
| 283 | iso_pu_bacteria | 2842832357 | 2842832927 | 354 |
| 284 | iso_pu_bacteria | 2842837860 | 2842840060 | 354 |
| 285 | iso_pu_bacteria | 2842843487 | 2842848456 | 354 |
| 286 | iso_pu_bacteria | 2842854478 | 2842858988 | 354 |
| 287 | iso_pu_bacteria | 2844665904 | 2844668997 | 354 |
| 288 | iso_pu_bacteria | 2852612431 | 2852614996 | 354 |
| 289 | iso_pu_bacteria | 2852657418 | 2852658717 | 354 |
| 290 | iso_pu_bacteria | 2852667396 | 2852669964 | 354 |
| 291 | iso_pu_bacteria | 2860339153 | 2860340224 | 354 |
| 292 | iso_pu_bacteria | 2860867994 | 2860869476 | 354 |
| 293 | iso_pu_bacteria | 2878029506 | 2878031260 | 354 |
| 294 | iso_pu_bacteria | 2880230671 | 2880232107 | 354 |
| 295 | iso_pu_bacteria | 2904518522 | 2904522363 | 354 |
| 296 | iso_pu_bacteria | 2913036834 | 2913038351 | 354 |
| 297 | iso_pu_bacteria | 2917070673 | 2917072267 | 354 |
| 298 | iso_pu_bacteria | 2919063839 | 2919064269 | 354 |
| 299 | iso_pu_bacteria | 2919385768 | 2919386231 | 354 |
| 300 | iso_pu_bacteria | 2919456309 | 2919461972 | 354 |
| 301 | iso_pu_bacteria | 2919481497 | 2919481619 | 354 |
| 302 | iso_pu_bacteria | 2919487758 | 2919491682 | 354 |
| 303 | iso_pu_bacteria | 2919697872 | 2919700338 | 354 |
| 304 | iso_pu_bacteria | 2923586266 | 2923587524 | 354 |
| 305 | iso_pu_bacteria | 2929144301 | 2929145796 | 354 |
| 306 | iso_pu_bacteria | 2929189879 | 2929191454 | 354 |
| 307 | iso_pu_bacteria | 2931369376 | 2931370864 | 354 |
| 308 | iso_pu_bacteria | 2931390751 | 2931392495 | 354 |
| 309 | iso_pu_bacteria | 2931396565 | 2931399873 | 354 |
| 310 | iso_pu_bacteria | 2935353572 | 2935354437 | 354 |
| 311 | iso_pu_bacteria | 2945928738 | 2945929109 | 354 |
| 312 | iso_pu_bacteria | 2945961074 | 2945961816 | 354 |
| 313 | iso_pu_bacteria | 2946027586 | 2946029682 | 354 |
| 314 | iso_pu_bacteria | 2969304461 | 2969306032 | 354 |
| 315 | iso_pu_bacteria | 2974289157 | 2974292303 | 354 |
| 316 | iso_pu_bacteria | 2984286254 | 2984290939 | 354 |
| 317 | iso_pu_bacteria | 2988728565 | 2988733331 | 354 |
| 318 | iso_pu_bacteria | 2998139840 | 2998141443 | 354 |
| 319 | iso_pu_bacteria | 3007511990 | 3007512824 | 354 |
| 320 | iso_pu_bacteria | 3007614139 | 3007616281 | 354 |
| 321 | iso_pu_bacteria | 3007619802 | 3007620560 | 354 |
| 322 | iso_pu_bacteria | 3007718800 | 3007719646 | 354 |
| 323 | iso_pu_bacteria | 3007855910 | 3007856038 | 354 |
| 324 | iso_pu_bacteria | 3007861166 | 3007863327 | 354 |
| 325 | iso_pu_bacteria | 3007866637 | 3007867985 | 354 |
| 326 | iso_pu_bacteria | 637000220 | 637318858 | 354 |
| 327 | iso_pu_bacteria | 8019769354 | 8019771042 | 354 |
| 328 | iso_pu_bacteria | 8019775933 | 8019776993 | 354 |
| 329 | iso_pu_bacteria | 8029995093 | 8029999307 | 354 |
| 330 | iso_pu_bacteria | 8034962539 | 8034965739 | 354 |
| 331 | iso_pu_bacteria | 8054285046 | 8054286128 | 354 |
| 332 | iso_pu_bacteria | 8054347763 | 8054351916 | 354 |
| 333 | iso_pu_bacteria | 8054503363 | 8054505019 | 354 |
| 334 | iso_pu_bacteria | 8055817908 | 8055819526 | 354 |
| 335 | iso_pu_bacteria | 8056131705 | 8056133393 | 354 |
| 336 | iso_pu_bacteria | 8056143049 | 8056147479 | 354 |
| 337 | iso_pu_bacteria | 8056148874 | 8056149664 | 354 |
| 338 | iso_pu_bacteria | 8056161164 | 8056164809 | 354 |
| 339 | iso_pu_bacteria | 8056166840 | 8056169617 | 354 |
| 340 | iso_pu_bacteria | 8056172158 | 8056175733 | 354 |
| 341 | iso_pu_bacteria | 8056177738 | 8056180185 | 354 |
| 342 | iso_pu_bacteria | 8056569372 | 8056570103 | 354 |
| 343 | iso_pu_bacteria | 8057798959 | 8057803794 | 354 |
| 344 | 3300005288 | Ga0065714_10066956 | Ga0065714_100669562 | 355 |
| 345 | 3300009036 | Ga0105244_10000248 | Ga0105244_1000024821 | 355 |
| 346 | 3300025728 | Ga0207655_1001272 | Ga0207655_100127225 | 355 |
| 347 | 3300046453 | Ga0495627_000040 | Ga0495627_000040_158940_160007 | 355 |
| 348 | 3300047469 | Ga0495673_0011518 | Ga0495673_0011518_236_1351 | 355 |
| 349 | 3300047470 | Ga0495681_0051887 | Ga0495681_0051887_644_1759 | 355 |
| 350 | 3300048927 | Ga0496124_0134045 | Ga0496124_0134045_286_1401 | 355 |
| 351 | 3300053140 | Ga0500573_0079969 | Ga0500573_0079969_527_1594 | 355 |
| 352 | 3300042134 | Ga0450898_010644 | Ga0450898_010644_208_1278 | 356 |
| 353 | 3300046501 | Ga0495607_0001009 | Ga0495607_0001009_24394_25464 | 356 |
| 354 | 3300046519 | Ga0495632_0004287 | Ga0495632_0004287_1470_2588 | 356 |
| 355 | 3300046520 | Ga0495637_0015994 | Ga0495637_0015994_1554_2672 | 356 |
| 356 | 3300046665 | Ga0495661_0000146 | Ga0495661_0000146_18040_19158 | 356 |
| 357 | 3300047469 | Ga0495673_0033711 | Ga0495673_0033711_400_1518 | 356 |
| 358 | 2162886007 | SwRhRL2b_contig_1718832 | SwRhRL2b_0032.00000480 | 357 |
| 359 | 2162886007 | SwRhRL2b_contig_2047565 | SwRhRL2b_0834.00000020 | 357 |
| 360 | 3300003791 | Ga0055530_10023505 | Ga0055530_100235052 | 357 |
| 361 | 3300005288 | Ga0065714_10003605 | Ga0065714_100036052 | 357 |
| 362 | 3300005289 | Ga0065704_10119990 | Ga0065704_101199902 | 357 |
| 363 | 3300005289 | Ga0065704_10128981 | Ga0065704_101289811 | 357 |
| 364 | 3300005289 | Ga0065704_10138562 | Ga0065704_101385621 | 357 |
| 365 | 3300006051 | Ga0075364_10090124 | Ga0075364_100901242 | 357 |
| 366 | 3300006058 | Ga0075432_10026538 | Ga0075432_100265382 | 357 |
| 367 | 3300009011 | Ga0105251_10003325 | Ga0105251_100033253 | 357 |
| 368 | 3300009011 | Ga0105251_10023484 | Ga0105251_100234843 | 357 |
| 369 | 3300009036 | Ga0105244_10035696 | Ga0105244_100356962 | 357 |
| 370 | 3300009036 | Ga0105244_10035795 | Ga0105244_100357952 | 357 |
| 371 | 3300009036 | Ga0105244_10044890 | Ga0105244_100448902 | 357 |
| 372 | 3300009036 | Ga0105244_10065661 | Ga0105244_100656612 | 357 |
| 373 | 3300009036 | Ga0105244_10125968 | Ga0105244_101259681 | 357 |
| 374 | 3300013307 | Ga0157372_10000598 | Ga0157372_1000059835 | 357 |
| 375 | 3300017792 | Ga0163161_10063125 | Ga0163161_100631252 | 357 |
| 376 | 3300025292 | Ga0209676_1000532 | Ga0209676_100053237 | 357 |
| 377 | 3300025298 | Ga0209050_1019088 | Ga0209050_10190882 | 357 |
| 378 | 3300025303 | Ga0209051_1003100 | Ga0209051_10031009 | 357 |
| 379 | 3300025711 | Ga0207696_1000010 | Ga0207696_1000010145 | 357 |
| 380 | 3300025711 | Ga0207696_1028596 | Ga0207696_10285962 | 357 |
| 381 | 3300025711 | Ga0207696_1035733 | Ga0207696_10357331 | 357 |
| 382 | 3300025728 | Ga0207655_1015788 | Ga0207655_10157883 | 357 |
| 383 | 3300025728 | Ga0207655_1036484 | Ga0207655_10364842 | 357 |
| 384 | 3300025735 | Ga0207713_1011564 | Ga0207713_10115643 | 357 |
| 385 | 3300025735 | Ga0207713_1023540 | Ga0207713_10235401 | 357 |
| 386 | 3300025735 | Ga0207713_1049961 | Ga0207713_10499612 | 357 |
| 387 | 3300025935 | Ga0207709_10009838 | Ga0207709_100098382 | 357 |
| 388 | 3300025935 | Ga0207709_10111584 | Ga0207709_101115842 | 357 |
| 389 | 3300027907 | Ga0207428_10042336 | Ga0207428_100423361 | 357 |
| 390 | 3300041405 | Ga0439438_004123 | Ga0439438_004123_2743_3846 | 357 |
| 391 | 3300041407 | Ga0439447_010268 | Ga0439447_010268_207_1310 | 357 |
| 392 | 3300041407 | Ga0439447_014464 | Ga0439447_014464_875_1978 | 357 |
| 393 | 3300041411 | Ga0439466_0001263 | Ga0439466_0001263_1256_2359 | 357 |
| 394 | 3300041411 | Ga0439466_0011798 | Ga0439466_0011798_1670_2743 | 357 |
| 395 | 3300042006 | Ga0439432_024392 | Ga0439432_024392_745_1818 | 357 |
| 396 | 3300042013 | Ga0439456_000271 | Ga0439456_000271_1398_2471 | 357 |
| 397 | 3300042013 | Ga0439456_011225 | Ga0439456_011225_182_1255 | 357 |
| 398 | 3300042016 | Ga0439463_000376 | Ga0439463_000376_303_1382 | 357 |
| 399 | 3300042122 | Ga0450920_007247 | Ga0450920_007247_668_1771 | 357 |
| 400 | 3300042124 | Ga0450922_000514 | Ga0450922_000514_2788_3891 | 357 |
| 401 | 3300042136 | Ga0450900_002786 | Ga0450900_002786_166_1239 | 357 |
| 402 | 3300042137 | Ga0450902_005568 | Ga0450902_005568_210_1283 | 357 |
| 403 | 3300042142 | Ga0450905_000029 | Ga0450905_000029_527_1600 | 357 |
| 404 | 3300042146 | Ga0450907_003696 | Ga0450907_003696_113_1216 | 357 |
| 405 | 3300042147 | Ga0450910_000124 | Ga0450910_000124_4105_5208 | 357 |
| 406 | 3300042461 | Ga0439460_0015732 | Ga0439460_0015732_217_1320 | 357 |
| 407 | 3300042533 | Ga0450901_001003 | Ga0450901_001003_1306_2379 | 357 |
| 408 | 3300046460 | Ga0495638_0039275 | Ga0495638_0039275_343_1416 | 357 |
| 409 | 3300046507 | Ga0495606_0042245 | Ga0495606_0042245_1471_2559 | 357 |
| 410 | 3300046515 | Ga0495620_0000002 | Ga0495620_0000002_248956_250164 | 357 |
| 411 | 3300046519 | Ga0495632_0000215 | Ga0495632_0000215_37984_39057 | 357 |
| 412 | 3300046522 | Ga0495643_0002672 | Ga0495643_0002672_3178_4386 | 357 |
| 413 | 3300046524 | Ga0495648_0000521 | Ga0495648_0000521_37816_39024 | 357 |
| 414 | 3300046524 | Ga0495648_0001868 | Ga0495648_0001868_550_1623 | 357 |
| 415 | 3300046530 | Ga0495654_0081285 | Ga0495654_0081285_104_1177 | 357 |
| 416 | 3300046538 | Ga0495609_0000079 | Ga0495609_0000079_79405_80607 | 357 |
| 417 | 3300047470 | Ga0495681_0005315 | Ga0495681_0005315_480_1553 | 357 |
| 418 | 3300047470 | Ga0495681_0023876 | Ga0495681_0023876_1646_2719 | 357 |
| 419 | 3300048919 | Ga0496116_0076728 | Ga0496116_0076728_741_1814 | 357 |
| 420 | 3300048920 | Ga0496117_0001323 | Ga0496117_0001323_14636_15709 | 357 |
| 421 | 3300048920 | Ga0496117_0012255 | Ga0496117_0012255_2056_3264 | 357 |
| 422 | 3300048921 | Ga0496118_0002985 | Ga0496118_0002985_20031_21239 | 357 |
| 423 | 3300048922 | Ga0496119_0000612 | Ga0496119_0000612_31455_32528 | 357 |
| 424 | 3300048922 | Ga0496119_0122838 | Ga0496119_0122838_79_1287 | 357 |
| 425 | 3300048923 | Ga0496120_0001054 | Ga0496120_0001054_31258_32331 | 357 |
| 426 | 3300048924 | Ga0496121_0101989 | Ga0496121_0101989_684_1892 | 357 |
| 427 | 3300048925 | Ga0496122_0123958 | Ga0496122_0123958_262_1335 | 357 |
| 428 | 3300048926 | Ga0496123_0107849 | Ga0496123_0107849_387_1460 | 357 |
| 429 | 3300048927 | Ga0496124_0000132 | Ga0496124_0000132_127868_128941 | 357 |
| 430 | 3300048927 | Ga0496124_0006195 | Ga0496124_0006195_181_1254 | 357 |
| 431 | 3300048927 | Ga0496124_0015103 | Ga0496124_0015103_860_1933 | 357 |
| 432 | 3300048927 | Ga0496124_0038452 | Ga0496124_0038452_361_1569 | 357 |
| 433 | 3300048927 | Ga0496124_0160168 | Ga0496124_0160168_477_1550 | 357 |
| 434 | 3300048928 | Ga0496125_0000380 | Ga0496125_0000380_44537_45745 | 357 |
| 435 | 3300048928 | Ga0496125_0157542 | Ga0496125_0157542_295_1368 | 357 |
| 436 | 3300048929 | Ga0496126_0250389 | Ga0496126_0250389_233_1306 | 357 |
| 437 | 3300050491 | nmdc:mga00v17_134465_c1 | nmdc:mga00v17_134465_c1_210_1283 | 357 |
| 438 | 2124908027 | MRS2a_Contig_6404 | MRS2a_00294580 | 358 |
| 439 | 2124908027 | MRS2a_Contig_916 | MRS2a_00761790 | 358 |
| 440 | 2162886007 | SwRhRL2b_contig_3032464 | SwRhRL2b_0497.00003720 | 358 |
| 441 | 3300002737 | JGI25162J39368_1000085 | JGI25162J39368_100008571 | 358 |
| 442 | 3300002771 | JGI25163J39215_1000217 | JGI25163J39215_100021715 | 358 |
| 443 | 3300002772 | JGI25164J39214_1000063 | JGI25164J39214_100006371 | 358 |
| 444 | 3300003214 | JGI25165J46597_1000160 | JGI25165J46597_100016071 | 358 |
| 445 | 3300003781 | Ga0055536_1000173 | Ga0055536_10001736 | 358 |
| 446 | 3300003781 | Ga0055536_1000362 | Ga0055536_100036211 | 358 |
| 447 | 3300003781 | Ga0055536_1000391 | Ga0055536_100039112 | 358 |
| 448 | 3300003791 | Ga0055530_10000113 | Ga0055530_1000011346 | 358 |
| 449 | 3300003791 | Ga0055530_10000196 | Ga0055530_100001966 | 358 |
| 450 | 3300003791 | Ga0055530_10024949 | Ga0055530_100249491 | 358 |
| 451 | 3300003792 | Ga0055540_1000154 | Ga0055540_100015424 | 358 |
| 452 | 3300003792 | Ga0055540_1000170 | Ga0055540_100017026 | 358 |
| 453 | 3300003792 | Ga0055540_1000218 | Ga0055540_10002186 | 358 |
| 454 | 3300003794 | Ga0055531_10000842 | Ga0055531_100008425 | 358 |
| 455 | 3300005288 | Ga0065714_10002499 | Ga0065714_1000249915 | 358 |
| 456 | 3300005288 | Ga0065714_10009859 | Ga0065714_100098592 | 358 |
| 457 | 3300005288 | Ga0065714_10011908 | Ga0065714_100119085 | 358 |
| 458 | 3300005288 | Ga0065714_10065019 | Ga0065714_100650199 | 358 |
| 459 | 3300005288 | Ga0065714_10079310 | Ga0065714_100793102 | 358 |
| 460 | 3300005288 | Ga0065714_10083084 | Ga0065714_100830841 | 358 |
| 461 | 3300005288 | Ga0065714_10086053 | Ga0065714_100860532 | 358 |
| 462 | 3300005288 | Ga0065714_10086697 | Ga0065714_100866972 | 358 |
| 463 | 3300005288 | Ga0065714_10108174 | Ga0065714_101081741 | 358 |
| 464 | 3300005289 | Ga0065704_10003637 | Ga0065704_100036375 | 358 |
| 465 | 3300005289 | Ga0065704_10072784 | Ga0065704_100727847 | 358 |
| 466 | 3300005290 | Ga0065712_10002299 | Ga0065712_100022993 | 358 |
| 467 | 3300005293 | Ga0065715_10005136 | Ga0065715_100051362 | 358 |
| 468 | 3300005344 | Ga0070661_100000060 | Ga0070661_10000006046 | 358 |
| 469 | 3300005457 | Ga0070662_100011144 | Ga0070662_1000111447 | 358 |
| 470 | 3300005548 | Ga0070665_100030324 | Ga0070665_1000303242 | 358 |
| 471 | 3300005564 | Ga0070664_100000202 | Ga0070664_10000020228 | 358 |
| 472 | 3300005834 | Ga0068851_10000055 | Ga0068851_1000005515 | 358 |
| 473 | 3300006058 | Ga0075432_10005628 | Ga0075432_100056283 | 358 |
| 474 | 3300006058 | Ga0075432_10035240 | Ga0075432_100352402 | 358 |
| 475 | 3300006058 | Ga0075432_10050081 | Ga0075432_100500812 | 358 |
| 476 | 3300006177 | Ga0075362_10069546 | Ga0075362_100695462 | 358 |
| 477 | 3300006186 | Ga0075369_10081088 | Ga0075369_100810882 | 358 |
| 478 | 3300006946 | Ga0079104_1000145 | Ga0079104_100014537 | 358 |
| 479 | 3300006946 | Ga0079104_1001936 | Ga0079104_10019366 | 358 |
| 480 | 3300006948 | Ga0099826_10045335 | Ga0099826_100453352 | 358 |
| 481 | 3300009011 | Ga0105251_10001298 | Ga0105251_100012987 | 358 |
| 482 | 3300009011 | Ga0105251_10013205 | Ga0105251_100132052 | 358 |
| 483 | 3300009011 | Ga0105251_10052492 | Ga0105251_100524922 | 358 |
| 484 | 3300009011 | Ga0105251_10053840 | Ga0105251_100538401 | 358 |
| 485 | 3300009036 | Ga0105244_10019664 | Ga0105244_100196644 | 358 |
| 486 | 3300009036 | Ga0105244_10058187 | Ga0105244_100581872 | 358 |
| 487 | 3300009036 | Ga0105244_10084642 | Ga0105244_100846422 | 358 |
| 488 | 3300009092 | Ga0105250_10000534 | Ga0105250_1000053422 | 358 |
| 489 | 3300009092 | Ga0105250_10001316 | Ga0105250_1000131614 | 358 |
| 490 | 3300009092 | Ga0105250_10015682 | Ga0105250_100156821 | 358 |
| 491 | 3300009092 | Ga0105250_10044958 | Ga0105250_100449582 | 358 |
| 492 | 3300009092 | Ga0105250_10060972 | Ga0105250_100609721 | 358 |
| 493 | 3300009148 | Ga0105243_10000451 | Ga0105243_100004519 | 358 |
| 494 | 3300009148 | Ga0105243_10001719 | Ga0105243_100017193 | 358 |
| 495 | 3300009148 | Ga0105243_10087612 | Ga0105243_100876122 | 358 |
| 496 | 3300009176 | Ga0105242_10007609 | Ga0105242_100076094 | 358 |
| 497 | 3300009545 | Ga0105237_10000640 | Ga0105237_100006402 | 358 |
| 498 | 3300009553 | Ga0105249_10026157 | Ga0105249_100261571 | 358 |
| 499 | 3300011119 | Ga0105246_10016446 | Ga0105246_100164464 | 358 |
| 500 | 3300011119 | Ga0105246_10084560 | Ga0105246_100845602 | 358 |
| 501 | 3300011119 | Ga0105246_10095329 | Ga0105246_100953292 | 358 |
| 502 | 3300012498 | Ga0157345_1000081 | Ga0157345_100008116 | 358 |
| 503 | 3300012502 | Ga0157347_1002054 | Ga0157347_10020541 | 358 |
| 504 | 3300013100 | Ga0157373_10000593 | Ga0157373_1000059325 | 358 |
| 505 | 3300013100 | Ga0157373_10003554 | Ga0157373_100035549 | 358 |
| 506 | 3300013100 | Ga0157373_10016161 | Ga0157373_100161616 | 358 |
| 507 | 3300013100 | Ga0157373_10021556 | Ga0157373_100215565 | 358 |
| 508 | 3300013100 | Ga0157373_10056736 | Ga0157373_100567363 | 358 |
| 509 | 3300013102 | Ga0157371_10000497 | Ga0157371_1000049743 | 358 |
| 510 | 3300013102 | Ga0157371_10000583 | Ga0157371_1000058335 | 358 |
| 511 | 3300013102 | Ga0157371_10003644 | Ga0157371_100036449 | 358 |
| 512 | 3300013102 | Ga0157371_10017431 | Ga0157371_100174316 | 358 |
| 513 | 3300013104 | Ga0157370_10026246 | Ga0157370_100262464 | 358 |
| 514 | 3300013104 | Ga0157370_10033329 | Ga0157370_100333295 | 358 |
| 515 | 3300013104 | Ga0157370_10039334 | Ga0157370_100393345 | 358 |
| 516 | 3300013104 | Ga0157370_10097823 | Ga0157370_100978232 | 358 |
| 517 | 3300013104 | Ga0157370_10106817 | Ga0157370_101068172 | 358 |
| 518 | 3300013104 | Ga0157370_10334484 | Ga0157370_103344841 | 358 |
| 519 | 3300013105 | Ga0157369_10008746 | Ga0157369_1000874611 | 358 |
| 520 | 3300013105 | Ga0157369_10114806 | Ga0157369_101148063 | 358 |
| 521 | 3300013105 | Ga0157369_10138003 | Ga0157369_101380032 | 358 |
| 522 | 3300013105 | Ga0157369_10416175 | Ga0157369_104161751 | 358 |
| 523 | 3300013306 | Ga0163162_10004856 | Ga0163162_100048565 | 358 |
| 524 | 3300013306 | Ga0163162_10099591 | Ga0163162_100995912 | 358 |
| 525 | 3300013306 | Ga0163162_10276536 | Ga0163162_102765362 | 358 |
| 526 | 3300013307 | Ga0157372_10033779 | Ga0157372_100337792 | 358 |
| 527 | 3300013308 | Ga0157375_10140116 | Ga0157375_101401162 | 358 |
| 528 | 3300014497 | Ga0182008_10000863 | Ga0182008_1000086315 | 358 |
| 529 | 3300014497 | Ga0182008_10003335 | Ga0182008_100033351 | 358 |
| 530 | 3300014497 | Ga0182008_10006493 | Ga0182008_100064933 | 358 |
| 531 | 3300014497 | Ga0182008_10012581 | Ga0182008_100125813 | 358 |
| 532 | 3300014497 | Ga0182008_10031668 | Ga0182008_100316682 | 358 |
| 533 | 3300014497 | Ga0182008_10033884 | Ga0182008_100338843 | 358 |
| 534 | 3300014497 | Ga0182008_10034069 | Ga0182008_100340691 | 358 |
| 535 | 3300014497 | Ga0182008_10050435 | Ga0182008_100504352 | 358 |
| 536 | 3300015261 | Ga0182006_1001275 | Ga0182006_100127510 | 358 |
| 537 | 3300015261 | Ga0182006_1005016 | Ga0182006_10050163 | 358 |
| 538 | 3300015261 | Ga0182006_1017180 | Ga0182006_10171802 | 358 |
| 539 | 3300015261 | Ga0182006_1021827 | Ga0182006_10218273 | 358 |
| 540 | 3300015261 | Ga0182006_1024824 | Ga0182006_10248242 | 358 |
| 541 | 3300015261 | Ga0182006_1056943 | Ga0182006_10569431 | 358 |
| 542 | 3300015262 | Ga0182007_10020582 | Ga0182007_100205821 | 358 |
| 543 | 3300015265 | Ga0182005_1035369 | Ga0182005_10353691 | 358 |
| 544 | 3300017792 | Ga0163161_10001895 | Ga0163161_100018954 | 358 |
| 545 | 3300017792 | Ga0163161_10020484 | Ga0163161_100204844 | 358 |
| 546 | 3300017792 | Ga0163161_10022776 | Ga0163161_100227764 | 358 |
| 547 | 3300017792 | Ga0163161_10036567 | Ga0163161_100365673 | 358 |
| 548 | 3300017792 | Ga0163161_10058360 | Ga0163161_100583602 | 358 |
| 549 | 3300017792 | Ga0163161_10106450 | Ga0163161_101064503 | 358 |
| 550 | 3300017792 | Ga0163161_10245451 | Ga0163161_102454511 | 358 |
| 551 | 3300025207 | Ga0209760_100039 | Ga0209760_10003983 | 358 |
| 552 | 3300025230 | Ga0209563_100630 | Ga0209563_1006303 | 358 |
| 553 | 3300025231 | Ga0207427_100001 | Ga0207427_100001757 | 358 |
| 554 | 3300025233 | Ga0209437_100003 | Ga0209437_100003615 | 358 |
| 555 | 3300025261 | Ga0209233_1000007 | Ga0209233_1000007757 | 358 |
| 556 | 3300025291 | Ga0209675_1009404 | Ga0209675_10094042 | 358 |
| 557 | 3300025292 | Ga0209676_1000016 | Ga0209676_1000016359 | 358 |
| 558 | 3300025292 | Ga0209676_1000021 | Ga0209676_100002147 | 358 |
| 559 | 3300025292 | Ga0209676_1000033 | Ga0209676_1000033187 | 358 |
| 560 | 3300025292 | Ga0209676_1011310 | Ga0209676_10113103 | 358 |
| 561 | 3300025298 | Ga0209050_1000009 | Ga0209050_1000009127 | 358 |
| 562 | 3300025298 | Ga0209050_1000036 | Ga0209050_1000036199 | 358 |
| 563 | 3300025298 | Ga0209050_1000107 | Ga0209050_100010746 | 358 |
| 564 | 3300025303 | Ga0209051_1000043 | Ga0209051_1000043271 | 358 |
| 565 | 3300025303 | Ga0209051_1000053 | Ga0209051_1000053127 | 358 |
| 566 | 3300025303 | Ga0209051_1000090 | Ga0209051_1000090110 | 358 |
| 567 | 3300025304 | Ga0209257_1000098 | Ga0209257_100009842 | 358 |
| 568 | 3300025304 | Ga0209257_1011864 | Ga0209257_10118644 | 358 |
| 569 | 3300025321 | Ga0207656_10000075 | Ga0207656_1000007519 | 358 |
| 570 | 3300025711 | Ga0207696_1000063 | Ga0207696_100006386 | 358 |
| 571 | 3300025711 | Ga0207696_1000158 | Ga0207696_100015858 | 358 |
| 572 | 3300025711 | Ga0207696_1002599 | Ga0207696_10025995 | 358 |
| 573 | 3300025711 | Ga0207696_1004643 | Ga0207696_10046432 | 358 |
| 574 | 3300025711 | Ga0207696_1006768 | Ga0207696_10067681 | 358 |
| 575 | 3300025711 | Ga0207696_1013851 | Ga0207696_10138512 | 358 |
| 576 | 3300025728 | Ga0207655_1000019 | Ga0207655_1000019443 | 358 |
| 577 | 3300025728 | Ga0207655_1000250 | Ga0207655_100025079 | 358 |
| 578 | 3300025728 | Ga0207655_1005501 | Ga0207655_10055015 | 358 |
| 579 | 3300025728 | Ga0207655_1009222 | Ga0207655_10092224 | 358 |
| 580 | 3300025728 | Ga0207655_1009805 | Ga0207655_10098057 | 358 |
| 581 | 3300025728 | Ga0207655_1014540 | Ga0207655_10145403 | 358 |
| 582 | 3300025728 | Ga0207655_1035764 | Ga0207655_10357643 | 358 |
| 583 | 3300025728 | Ga0207655_1041047 | Ga0207655_10410471 | 358 |
| 584 | 3300025735 | Ga0207713_1000380 | Ga0207713_10003805 | 358 |
| 585 | 3300025735 | Ga0207713_1001994 | Ga0207713_10019948 | 358 |
| 586 | 3300025735 | Ga0207713_1001997 | Ga0207713_10019979 | 358 |
| 587 | 3300025735 | Ga0207713_1005079 | Ga0207713_10050795 | 358 |
| 588 | 3300025735 | Ga0207713_1006442 | Ga0207713_10064425 | 358 |
| 589 | 3300025735 | Ga0207713_1051667 | Ga0207713_10516672 | 358 |
| 590 | 3300025914 | Ga0207671_10000566 | Ga0207671_100005662 | 358 |
| 591 | 3300025920 | Ga0207649_10000002 | Ga0207649_10000002132 | 358 |
| 592 | 3300025933 | Ga0207706_10026289 | Ga0207706_100262892 | 358 |
| 593 | 3300025934 | Ga0207686_10032576 | Ga0207686_100325762 | 358 |
| 594 | 3300025935 | Ga0207709_10000036 | Ga0207709_10000036223 | 358 |
| 595 | 3300025935 | Ga0207709_10000350 | Ga0207709_1000035012 | 358 |
| 596 | 3300025945 | Ga0207679_10000006 | Ga0207679_10000006359 | 358 |
| 597 | 3300025961 | Ga0207712_10103808 | Ga0207712_101038082 | 358 |
| 598 | 3300027111 | Ga0209281_1000172 | Ga0209281_1000172112 | 358 |
| 599 | 3300027111 | Ga0209281_1000271 | Ga0209281_100027156 | 358 |
| 600 | 3300027111 | Ga0209281_1003274 | Ga0209281_10032743 | 358 |
| 601 | 3300027907 | Ga0207428_10201260 | Ga0207428_102012602 | 358 |
| 602 | 3300028379 | Ga0268266_10006047 | Ga0268266_100060478 | 358 |
| 603 | 3300030521 | Ga0307511_10038488 | Ga0307511_100384883 | 358 |
| 604 | 3300030731 | Ga0316177_1050534 | Ga0316177_10505342 | 358 |
| 605 | 3300030734 | Ga0316179_1078275 | Ga0316179_10782752 | 358 |
| 606 | 3300030735 | Ga0316178_1161793 | Ga0316178_116179314 | 358 |
| 607 | 3300030742 | Ga0316183_1015099 | Ga0316183_10150994 | 358 |
| 608 | 3300031548 | Ga0307408_100011056 | Ga0307408_1000110564 | 358 |
| 609 | 3300031548 | Ga0307408_100020260 | Ga0307408_1000202604 | 358 |
| 610 | 3300031548 | Ga0307408_100028563 | Ga0307408_1000285632 | 358 |
| 611 | 3300031548 | Ga0307408_100127976 | Ga0307408_1001279762 | 358 |
| 612 | 3300031548 | Ga0307408_100137461 | Ga0307408_1001374612 | 358 |
| 613 | 3300031731 | Ga0307405_10015580 | Ga0307405_100155802 | 358 |
| 614 | 3300031731 | Ga0307405_10020411 | Ga0307405_100204112 | 358 |
| 615 | 3300031731 | Ga0307405_10035186 | Ga0307405_100351863 | 358 |
| 616 | 3300031731 | Ga0307405_10047546 | Ga0307405_100475463 | 358 |
| 617 | 3300031824 | Ga0307413_10206950 | Ga0307413_102069502 | 358 |
| 618 | 3300031901 | Ga0307406_10054623 | Ga0307406_100546231 | 358 |
| 619 | 3300031901 | Ga0307406_10177528 | Ga0307406_101775281 | 358 |
| 620 | 3300031911 | Ga0307412_10004978 | Ga0307412_100049782 | 358 |
| 621 | 3300031911 | Ga0307412_10010098 | Ga0307412_100100983 | 358 |
| 622 | 3300031911 | Ga0307412_10011635 | Ga0307412_100116353 | 358 |
| 623 | 3300031911 | Ga0307412_10070663 | Ga0307412_100706634 | 358 |
| 624 | 3300031911 | Ga0307412_10136679 | Ga0307412_101366791 | 358 |
| 625 | 3300031911 | Ga0307412_10342345 | Ga0307412_103423451 | 358 |
| 626 | 3300031995 | Ga0307409_100308695 | Ga0307409_1003086951 | 358 |
| 627 | 3300032004 | Ga0307414_10010683 | Ga0307414_100106832 | 358 |
| 628 | 3300032004 | Ga0307414_10080054 | Ga0307414_100800541 | 358 |
| 629 | 3300032004 | Ga0307414_10167106 | Ga0307414_101671061 | 358 |
| 630 | 3300032005 | Ga0307411_10004175 | Ga0307411_100041756 | 358 |
| 631 | 3300032005 | Ga0307411_10061013 | Ga0307411_100610132 | 358 |
| 632 | 3300033180 | Ga0307510_10080780 | Ga0307510_100807802 | 358 |
| 633 | 3300038705 | Ga0237819_01651 | Ga0237819_01651_1834_2910 | 358 |
| 634 | 3300041405 | Ga0439438_003063 | Ga0439438_003063_1264_2340 | 358 |
| 635 | 3300041405 | Ga0439438_004424 | Ga0439438_004424_1668_2744 | 358 |
| 636 | 3300041405 | Ga0439438_007724 | Ga0439438_007724_2301_3377 | 358 |
| 637 | 3300041405 | Ga0439438_008159 | Ga0439438_008159_1029_2105 | 358 |
| 638 | 3300041405 | Ga0439438_010286 | Ga0439438_010286_1365_2441 | 358 |
| 639 | 3300041405 | Ga0439438_010599 | Ga0439438_010599_812_1888 | 358 |
| 640 | 3300041407 | Ga0439447_002909 | Ga0439447_002909_2154_3230 | 358 |
| 641 | 3300041407 | Ga0439447_004126 | Ga0439447_004126_2980_4086 | 358 |
| 642 | 3300041407 | Ga0439447_010213 | Ga0439447_010213_1323_2399 | 358 |
| 643 | 3300041407 | Ga0439447_013779 | Ga0439447_013779_479_1555 | 358 |
| 644 | 3300041407 | Ga0439447_025490 | Ga0439447_025490_202_1278 | 358 |
| 645 | 3300041411 | Ga0439466_0002304 | Ga0439466_0002304_6016_7092 | 358 |
| 646 | 3300041411 | Ga0439466_0011884 | Ga0439466_0011884_1894_2970 | 358 |
| 647 | 3300041411 | Ga0439466_0048523 | Ga0439466_0048523_129_1205 | 358 |
| 648 | 3300041413 | Ga0439465_0006145 | Ga0439465_0006145_2042_3118 | 358 |
| 649 | 3300041997 | Ga0439431_0015133 | Ga0439431_0015133_266_1342 | 358 |
| 650 | 3300042004 | Ga0439445_0017603 | Ga0439445_0017603_458_1534 | 358 |
| 651 | 3300042006 | Ga0439432_001052 | Ga0439432_001052_1351_2427 | 358 |
| 652 | 3300042006 | Ga0439432_001239 | Ga0439432_001239_8019_9095 | 358 |
| 653 | 3300042006 | Ga0439432_013331 | Ga0439432_013331_484_1560 | 358 |
| 654 | 3300042006 | Ga0439432_013845 | Ga0439432_013845_652_1728 | 358 |
| 655 | 3300042006 | Ga0439432_053368 | Ga0439432_053368_165_1241 | 358 |
| 656 | 3300042009 | Ga0439451_001638 | Ga0439451_001638_1858_2964 | 358 |
| 657 | 3300042009 | Ga0439451_007465 | Ga0439451_007465_187_1263 | 358 |
| 658 | 3300042009 | Ga0439451_011741 | Ga0439451_011741_193_1299 | 358 |
| 659 | 3300042010 | Ga0439452_000503 | Ga0439452_000503_392_1468 | 358 |
| 660 | 3300042010 | Ga0439452_000725 | Ga0439452_000725_12257_13333 | 358 |
| 661 | 3300042010 | Ga0439452_001131 | Ga0439452_001131_9017_10093 | 358 |
| 662 | 3300042010 | Ga0439452_009692 | Ga0439452_009692_715_1863 | 358 |
| 663 | 3300042013 | Ga0439456_002594 | Ga0439456_002594_2297_3373 | 358 |
| 664 | 3300042115 | Ga0450911_000556 | Ga0450911_000556_8989_10065 | 358 |
| 665 | 3300042115 | Ga0450911_001193 | Ga0450911_001193_5048_6124 | 358 |
| 666 | 3300042115 | Ga0450911_006325 | Ga0450911_006325_450_1526 | 358 |
| 667 | 3300042121 | Ga0450919_000614 | Ga0450919_000614_3236_4312 | 358 |
| 668 | 3300042124 | Ga0450922_002582 | Ga0450922_002582_27_1103 | 358 |
| 669 | 3300042127 | Ga0450890_000186 | Ga0450890_000186_3091_4167 | 358 |
| 670 | 3300042135 | Ga0450899_005350 | Ga0450899_005350_45_1121 | 358 |
| 671 | 3300042137 | Ga0450902_001984 | Ga0450902_001984_1715_2791 | 358 |
| 672 | 3300042137 | Ga0450902_003594 | Ga0450902_003594_841_1947 | 358 |
| 673 | 3300042138 | Ga0450903_001216 | Ga0450903_001216_986_2092 | 358 |
| 674 | 3300042138 | Ga0450903_002098 | Ga0450903_002098_1652_2758 | 358 |
| 675 | 3300042142 | Ga0450905_004857 | Ga0450905_004857_454_1560 | 358 |
| 676 | 3300042146 | Ga0450907_000132 | Ga0450907_000132_24917_26023 | 358 |
| 677 | 3300042156 | Ga0439446_0008405 | Ga0439446_0008405_342_1418 | 358 |
| 678 | 3300042184 | Ga0450908_005178 | Ga0450908_005178_1211_2287 | 358 |
| 679 | 3300042185 | Ga0450909_002104 | Ga0450909_002104_1648_2754 | 358 |
| 680 | 3300042435 | Ga0439434_0000469 | Ga0439434_0000469_9206_10312 | 358 |
| 681 | 3300042439 | Ga0439464_0001884 | Ga0439464_0001884_918_2000 | 358 |
| 682 | 3300042461 | Ga0439460_0001104 | Ga0439460_0001104_3678_4784 | 358 |
| 683 | 3300042461 | Ga0439460_0005590 | Ga0439460_0005590_228_1304 | 358 |
| 684 | 3300042531 | Ga0450918_006823 | Ga0450918_006823_412_1488 | 358 |
| 685 | 3300042531 | Ga0450918_007755 | Ga0450918_007755_156_1232 | 358 |
| 686 | 3300042532 | Ga0450893_0005323 | Ga0450893_0005323_969_2045 | 358 |
| 687 | 3300042532 | Ga0450893_0006099 | Ga0450893_0006099_640_1716 | 358 |
| 688 | 3300042993 | Ga0439440_0003112 | Ga0439440_0003112_223_1299 | 358 |
| 689 | 3300046452 | Ga0495617_007544 | Ga0495617_007544_2000_3163 | 358 |
| 690 | 3300046452 | Ga0495617_007874 | Ga0495617_007874_887_1963 | 358 |
| 691 | 3300046452 | Ga0495617_008135 | Ga0495617_008135_2189_3265 | 358 |
| 692 | 3300046452 | Ga0495617_013419 | Ga0495617_013419_1153_2229 | 358 |
| 693 | 3300046452 | Ga0495617_034397 | Ga0495617_034397_441_1517 | 358 |
| 694 | 3300046452 | Ga0495617_035578 | Ga0495617_035578_293_1369 | 358 |
| 695 | 3300046452 | Ga0495617_063456 | Ga0495617_063456_49_1155 | 358 |
| 696 | 3300046453 | Ga0495627_001088 | Ga0495627_001088_16432_17508 | 358 |
| 697 | 3300046453 | Ga0495627_001530 | Ga0495627_001530_11594_12685 | 358 |
| 698 | 3300046453 | Ga0495627_002082 | Ga0495627_002082_8776_9852 | 358 |
| 699 | 3300046453 | Ga0495627_002418 | Ga0495627_002418_302_1378 | 358 |
| 700 | 3300046453 | Ga0495627_019177 | Ga0495627_019177_906_1982 | 358 |
| 701 | 3300046453 | Ga0495627_027563 | Ga0495627_027563_220_1296 | 358 |
| 702 | 3300046453 | Ga0495627_034930 | Ga0495627_034930_273_1349 | 358 |
| 703 | 3300046453 | Ga0495627_046484 | Ga0495627_046484_182_1258 | 358 |
| 704 | 3300046455 | Ga0495603_0093853 | Ga0495603_0093853_489_1595 | 358 |
| 705 | 3300046457 | Ga0495590_0040802 | Ga0495590_0040802_77_1153 | 358 |
| 706 | 3300046457 | Ga0495590_0063481 | Ga0495590_0063481_127_1203 | 358 |
| 707 | 3300046458 | Ga0495591_000232 | Ga0495591_000232_1603_2709 | 358 |
| 708 | 3300046458 | Ga0495591_002090 | Ga0495591_002090_925_2001 | 358 |
| 709 | 3300046458 | Ga0495591_004045 | Ga0495591_004045_594_1685 | 358 |
| 710 | 3300046458 | Ga0495591_005488 | Ga0495591_005488_2293_3369 | 358 |
| 711 | 3300046458 | Ga0495591_009586 | Ga0495591_009586_883_1959 | 358 |
| 712 | 3300046458 | Ga0495591_011334 | Ga0495591_011334_1494_2570 | 358 |
| 713 | 3300046458 | Ga0495591_014750 | Ga0495591_014750_416_1492 | 358 |
| 714 | 3300046458 | Ga0495591_020147 | Ga0495591_020147_129_1205 | 358 |
| 715 | 3300046458 | Ga0495591_022755 | Ga0495591_022755_444_1607 | 358 |
| 716 | 3300046458 | Ga0495591_024718 | Ga0495591_024718_604_1680 | 358 |
| 717 | 3300046458 | Ga0495591_028244 | Ga0495591_028244_316_1422 | 358 |
| 718 | 3300046458 | Ga0495591_030373 | Ga0495591_030373_327_1403 | 358 |
| 719 | 3300046460 | Ga0495638_0001278 | Ga0495638_0001278_22059_23135 | 358 |
| 720 | 3300046460 | Ga0495638_0001733 | Ga0495638_0001733_17917_18993 | 358 |
| 721 | 3300046460 | Ga0495638_0003235 | Ga0495638_0003235_10312_11388 | 358 |
| 722 | 3300046460 | Ga0495638_0007902 | Ga0495638_0007902_3669_4745 | 358 |
| 723 | 3300046460 | Ga0495638_0016807 | Ga0495638_0016807_1219_2295 | 358 |
| 724 | 3300046460 | Ga0495638_0032805 | Ga0495638_0032805_1314_2390 | 358 |
| 725 | 3300046460 | Ga0495638_0039406 | Ga0495638_0039406_310_1416 | 358 |
| 726 | 3300046460 | Ga0495638_0043708 | Ga0495638_0043708_982_2088 | 358 |
| 727 | 3300046460 | Ga0495638_0053634 | Ga0495638_0053634_1402_2478 | 358 |
| 728 | 3300046460 | Ga0495638_0136818 | Ga0495638_0136818_202_1308 | 358 |
| 729 | 3300046463 | Ga0495653_0003427 | Ga0495653_0003427_9463_10569 | 358 |
| 730 | 3300046463 | Ga0495653_0061150 | Ga0495653_0061150_1548_2624 | 358 |
| 731 | 3300046463 | Ga0495653_0108837 | Ga0495653_0108837_680_1759 | 358 |
| 732 | 3300046471 | Ga0495650_0000620 | Ga0495650_0000620_8623_9699 | 358 |
| 733 | 3300046471 | Ga0495650_0003804 | Ga0495650_0003804_2705_3781 | 358 |
| 734 | 3300046471 | Ga0495650_0018018 | Ga0495650_0018018_1142_2248 | 358 |
| 735 | 3300046471 | Ga0495650_0019745 | Ga0495650_0019745_1585_2661 | 358 |
| 736 | 3300046471 | Ga0495650_0021006 | Ga0495650_0021006_1559_2635 | 358 |
| 737 | 3300046471 | Ga0495650_0028854 | Ga0495650_0028854_1059_2135 | 358 |
| 738 | 3300046471 | Ga0495650_0032030 | Ga0495650_0032030_645_1721 | 358 |
| 739 | 3300046471 | Ga0495650_0041544 | Ga0495650_0041544_388_1551 | 358 |
| 740 | 3300046471 | Ga0495650_0053585 | Ga0495650_0053585_145_1221 | 358 |
| 741 | 3300046473 | Ga0495582_0032844 | Ga0495582_0032844_870_1976 | 358 |
| 742 | 3300046474 | Ga0495605_0000011 | Ga0495605_0000011_102975_104051 | 358 |
| 743 | 3300046474 | Ga0495605_0004680 | Ga0495605_0004680_1316_2422 | 358 |
| 744 | 3300046474 | Ga0495605_0006308 | Ga0495605_0006308_2064_3140 | 358 |
| 745 | 3300046474 | Ga0495605_0019149 | Ga0495605_0019149_958_2034 | 358 |
| 746 | 3300046474 | Ga0495605_0031595 | Ga0495605_0031595_1109_2185 | 358 |
| 747 | 3300046474 | Ga0495605_0041700 | Ga0495605_0041700_238_1314 | 358 |
| 748 | 3300046474 | Ga0495605_0045198 | Ga0495605_0045198_315_1391 | 358 |
| 749 | 3300046474 | Ga0495605_0057322 | Ga0495605_0057322_399_1562 | 358 |
| 750 | 3300046474 | Ga0495605_0064398 | Ga0495605_0064398_200_1276 | 358 |
| 751 | 3300046475 | Ga0495639_0007670 | Ga0495639_0007670_2318_3424 | 358 |
| 752 | 3300046475 | Ga0495639_0022907 | Ga0495639_0022907_870_1976 | 358 |
| 753 | 3300046477 | Ga0495664_0143103 | Ga0495664_0143103_267_1373 | 358 |
| 754 | 3300046491 | Ga0495584_0000733 | Ga0495584_0000733_986_2062 | 358 |
| 755 | 3300046491 | Ga0495584_0001356 | Ga0495584_0001356_13614_14690 | 358 |
| 756 | 3300046491 | Ga0495584_0004349 | Ga0495584_0004349_5939_7015 | 358 |
| 757 | 3300046491 | Ga0495584_0004438 | Ga0495584_0004438_5761_6837 | 358 |
| 758 | 3300046491 | Ga0495584_0020003 | Ga0495584_0020003_1296_2372 | 358 |
| 759 | 3300046491 | Ga0495584_0024123 | Ga0495584_0024123_1299_2375 | 358 |
| 760 | 3300046491 | Ga0495584_0041935 | Ga0495584_0041935_502_1578 | 358 |
| 761 | 3300046491 | Ga0495584_0051925 | Ga0495584_0051925_224_1330 | 358 |
| 762 | 3300046491 | Ga0495584_0064320 | Ga0495584_0064320_380_1456 | 358 |
| 763 | 3300046491 | Ga0495584_0067625 | Ga0495584_0067625_528_1766 | 358 |
| 764 | 3300046491 | Ga0495584_0071595 | Ga0495584_0071595_519_1595 | 358 |
| 765 | 3300046491 | Ga0495584_0087044 | Ga0495584_0087044_74_1150 | 358 |
| 766 | 3300046492 | Ga0495585_0000376 | Ga0495585_0000376_2501_3577 | 358 |
| 767 | 3300046492 | Ga0495585_0001401 | Ga0495585_0001401_232_1308 | 358 |
| 768 | 3300046492 | Ga0495585_0002451 | Ga0495585_0002451_11322_12398 | 358 |
| 769 | 3300046492 | Ga0495585_0004975 | Ga0495585_0004975_864_1940 | 358 |
| 770 | 3300046492 | Ga0495585_0009335 | Ga0495585_0009335_98_1261 | 358 |
| 771 | 3300046492 | Ga0495585_0017146 | Ga0495585_0017146_2876_3982 | 358 |
| 772 | 3300046492 | Ga0495585_0022896 | Ga0495585_0022896_851_1927 | 358 |
| 773 | 3300046492 | Ga0495585_0027527 | Ga0495585_0027527_2017_3096 | 358 |
| 774 | 3300046492 | Ga0495585_0032590 | Ga0495585_0032590_596_1672 | 358 |
| 775 | 3300046492 | Ga0495585_0049406 | Ga0495585_0049406_1023_2099 | 358 |
| 776 | 3300046492 | Ga0495585_0098129 | Ga0495585_0098129_293_1369 | 358 |
| 777 | 3300046499 | Ga0495594_0003631 | Ga0495594_0003631_6358_7434 | 358 |
| 778 | 3300046499 | Ga0495594_0006659 | Ga0495594_0006659_1228_2334 | 358 |
| 779 | 3300046499 | Ga0495594_0017044 | Ga0495594_0017044_1709_2815 | 358 |
| 780 | 3300046499 | Ga0495594_0090479 | Ga0495594_0090479_228_1304 | 358 |
| 781 | 3300046500 | Ga0495596_0000597 | Ga0495596_0000597_20520_21626 | 358 |
| 782 | 3300046500 | Ga0495596_0032707 | Ga0495596_0032707_174_1250 | 358 |
| 783 | 3300046501 | Ga0495607_0005314 | Ga0495607_0005314_651_1727 | 358 |
| 784 | 3300046501 | Ga0495607_0006278 | Ga0495607_0006278_7111_8187 | 358 |
| 785 | 3300046501 | Ga0495607_0008011 | Ga0495607_0008011_231_1307 | 358 |
| 786 | 3300046501 | Ga0495607_0009933 | Ga0495607_0009933_830_1936 | 358 |
| 787 | 3300046501 | Ga0495607_0024767 | Ga0495607_0024767_966_2072 | 358 |
| 788 | 3300046501 | Ga0495607_0033217 | Ga0495607_0033217_1708_2832 | 358 |
| 789 | 3300046501 | Ga0495607_0050009 | Ga0495607_0050009_1224_2300 | 358 |
| 790 | 3300046501 | Ga0495607_0057633 | Ga0495607_0057633_582_1661 | 358 |
| 791 | 3300046501 | Ga0495607_0067430 | Ga0495607_0067430_258_1421 | 358 |
| 792 | 3300046501 | Ga0495607_0109417 | Ga0495607_0109417_230_1306 | 358 |
| 793 | 3300046501 | Ga0495607_0150109 | Ga0495607_0150109_80_1156 | 358 |
| 794 | 3300046506 | Ga0495583_0000047 | Ga0495583_0000047_210378_211454 | 358 |
| 795 | 3300046506 | Ga0495583_0001432 | Ga0495583_0001432_15469_16593 | 358 |
| 796 | 3300046506 | Ga0495583_0006317 | Ga0495583_0006317_4153_5229 | 358 |
| 797 | 3300046506 | Ga0495583_0013044 | Ga0495583_0013044_2940_4016 | 358 |
| 798 | 3300046506 | Ga0495583_0017557 | Ga0495583_0017557_1476_2552 | 358 |
| 799 | 3300046506 | Ga0495583_0024957 | Ga0495583_0024957_1728_2804 | 358 |
| 800 | 3300046506 | Ga0495583_0032503 | Ga0495583_0032503_479_1555 | 358 |
| 801 | 3300046507 | Ga0495606_0001195 | Ga0495606_0001195_244_1350 | 358 |
| 802 | 3300046507 | Ga0495606_0004689 | Ga0495606_0004689_886_1962 | 358 |
| 803 | 3300046507 | Ga0495606_0008803 | Ga0495606_0008803_7327_8403 | 358 |
| 804 | 3300046507 | Ga0495606_0020545 | Ga0495606_0020545_982_2058 | 358 |
| 805 | 3300046507 | Ga0495606_0035400 | Ga0495606_0035400_478_1557 | 358 |
| 806 | 3300046507 | Ga0495606_0045550 | Ga0495606_0045550_1265_2341 | 358 |
| 807 | 3300046507 | Ga0495606_0062943 | Ga0495606_0062943_1174_2250 | 358 |
| 808 | 3300046507 | Ga0495606_0100675 | Ga0495606_0100675_542_1618 | 358 |
| 809 | 3300046512 | Ga0495610_0001544 | Ga0495610_0001544_960_2036 | 358 |
| 810 | 3300046512 | Ga0495610_0010879 | Ga0495610_0010879_1052_2128 | 358 |
| 811 | 3300046512 | Ga0495610_0012081 | Ga0495610_0012081_832_1956 | 358 |
| 812 | 3300046512 | Ga0495610_0015944 | Ga0495610_0015944_769_1845 | 358 |
| 813 | 3300046512 | Ga0495610_0016333 | Ga0495610_0016333_998_2074 | 358 |
| 814 | 3300046512 | Ga0495610_0016615 | Ga0495610_0016615_1840_2916 | 358 |
| 815 | 3300046512 | Ga0495610_0017950 | Ga0495610_0017950_2708_3814 | 358 |
| 816 | 3300046512 | Ga0495610_0018259 | Ga0495610_0018259_2412_3488 | 358 |
| 817 | 3300046512 | Ga0495610_0025843 | Ga0495610_0025843_1474_2550 | 358 |
| 818 | 3300046512 | Ga0495610_0034270 | Ga0495610_0034270_187_1278 | 358 |
| 819 | 3300046512 | Ga0495610_0039474 | Ga0495610_0039474_946_2052 | 358 |
| 820 | 3300046512 | Ga0495610_0040082 | Ga0495610_0040082_185_1261 | 358 |
| 821 | 3300046512 | Ga0495610_0044321 | Ga0495610_0044321_272_1348 | 358 |
| 822 | 3300046512 | Ga0495610_0050340 | Ga0495610_0050340_201_1364 | 358 |
| 823 | 3300046512 | Ga0495610_0059085 | Ga0495610_0059085_158_1264 | 358 |
| 824 | 3300046513 | Ga0495616_0002009 | Ga0495616_0002009_9732_10808 | 358 |
| 825 | 3300046513 | Ga0495616_0003866 | Ga0495616_0003866_520_1596 | 358 |
| 826 | 3300046513 | Ga0495616_0014930 | Ga0495616_0014930_2562_3668 | 358 |
| 827 | 3300046513 | Ga0495616_0029487 | Ga0495616_0029487_527_1603 | 358 |
| 828 | 3300046513 | Ga0495616_0032457 | Ga0495616_0032457_337_1413 | 358 |
| 829 | 3300046513 | Ga0495616_0042164 | Ga0495616_0042164_1035_2141 | 358 |
| 830 | 3300046515 | Ga0495620_0000225 | Ga0495620_0000225_5328_6404 | 358 |
| 831 | 3300046515 | Ga0495620_0002160 | Ga0495620_0002160_9482_10558 | 358 |
| 832 | 3300046515 | Ga0495620_0003662 | Ga0495620_0003662_6658_7821 | 358 |
| 833 | 3300046515 | Ga0495620_0004065 | Ga0495620_0004065_1012_2088 | 358 |
| 834 | 3300046515 | Ga0495620_0004722 | Ga0495620_0004722_6237_7313 | 358 |
| 835 | 3300046515 | Ga0495620_0004859 | Ga0495620_0004859_5894_6985 | 358 |
| 836 | 3300046517 | Ga0495630_0001621 | Ga0495630_0001621_14527_15603 | 358 |
| 837 | 3300046517 | Ga0495630_0073954 | Ga0495630_0073954_1264_2535 | 358 |
| 838 | 3300046517 | Ga0495630_0105657 | Ga0495630_0105657_830_2101 | 358 |
| 839 | 3300046517 | Ga0495630_0115477 | Ga0495630_0115477_282_1358 | 358 |
| 840 | 3300046518 | Ga0495631_0000280 | Ga0495631_0000280_12414_13577 | 358 |
| 841 | 3300046518 | Ga0495631_0014162 | Ga0495631_0014162_1087_2211 | 358 |
| 842 | 3300046518 | Ga0495631_0014537 | Ga0495631_0014537_2381_3457 | 358 |
| 843 | 3300046518 | Ga0495631_0020511 | Ga0495631_0020511_1675_2751 | 358 |
| 844 | 3300046518 | Ga0495631_0050474 | Ga0495631_0050474_260_1336 | 358 |
| 845 | 3300046518 | Ga0495631_0071067 | Ga0495631_0071067_198_1304 | 358 |
| 846 | 3300046519 | Ga0495632_0002507 | Ga0495632_0002507_12300_13376 | 358 |
| 847 | 3300046519 | Ga0495632_0004158 | Ga0495632_0004158_7700_8776 | 358 |
| 848 | 3300046519 | Ga0495632_0004931 | Ga0495632_0004931_564_1670 | 358 |
| 849 | 3300046519 | Ga0495632_0012843 | Ga0495632_0012843_594_1670 | 358 |
| 850 | 3300046519 | Ga0495632_0017873 | Ga0495632_0017873_1000_2076 | 358 |
| 851 | 3300046519 | Ga0495632_0019958 | Ga0495632_0019958_216_1292 | 358 |
| 852 | 3300046519 | Ga0495632_0021504 | Ga0495632_0021504_1519_2595 | 358 |
| 853 | 3300046519 | Ga0495632_0023780 | Ga0495632_0023780_580_1671 | 358 |
| 854 | 3300046519 | Ga0495632_0025528 | Ga0495632_0025528_1453_2529 | 358 |
| 855 | 3300046519 | Ga0495632_0064390 | Ga0495632_0064390_201_1277 | 358 |
| 856 | 3300046520 | Ga0495637_0000630 | Ga0495637_0000630_8872_9948 | 358 |
| 857 | 3300046520 | Ga0495637_0000871 | Ga0495637_0000871_17524_18630 | 358 |
| 858 | 3300046520 | Ga0495637_0001699 | Ga0495637_0001699_10442_11518 | 358 |
| 859 | 3300046520 | Ga0495637_0005266 | Ga0495637_0005266_4494_5570 | 358 |
| 860 | 3300046520 | Ga0495637_0013339 | Ga0495637_0013339_2527_3690 | 358 |
| 861 | 3300046520 | Ga0495637_0013341 | Ga0495637_0013341_1716_2792 | 358 |
| 862 | 3300046520 | Ga0495637_0016726 | Ga0495637_0016726_1541_2617 | 358 |
| 863 | 3300046520 | Ga0495637_0030335 | Ga0495637_0030335_1109_2185 | 358 |
| 864 | 3300046520 | Ga0495637_0031521 | Ga0495637_0031521_905_1981 | 358 |
| 865 | 3300046520 | Ga0495637_0042147 | Ga0495637_0042147_502_1578 | 358 |
| 866 | 3300046520 | Ga0495637_0043340 | Ga0495637_0043340_637_1713 | 358 |
| 867 | 3300046522 | Ga0495643_0003509 | Ga0495643_0003509_645_1721 | 358 |
| 868 | 3300046522 | Ga0495643_0015736 | Ga0495643_0015736_2937_4013 | 358 |
| 869 | 3300046522 | Ga0495643_0016385 | Ga0495643_0016385_1010_2116 | 358 |
| 870 | 3300046522 | Ga0495643_0025996 | Ga0495643_0025996_856_2094 | 358 |
| 871 | 3300046522 | Ga0495643_0026415 | Ga0495643_0026415_1109_2233 | 358 |
| 872 | 3300046522 | Ga0495643_0117827 | Ga0495643_0117827_95_1201 | 358 |
| 873 | 3300046523 | Ga0495644_0002507 | Ga0495644_0002507_5574_6650 | 358 |
| 874 | 3300046523 | Ga0495644_0002520 | Ga0495644_0002520_5662_6738 | 358 |
| 875 | 3300046523 | Ga0495644_0006504 | Ga0495644_0006504_3301_4377 | 358 |
| 876 | 3300046523 | Ga0495644_0015259 | Ga0495644_0015259_1363_2439 | 358 |
| 877 | 3300046523 | Ga0495644_0021597 | Ga0495644_0021597_1013_2119 | 358 |
| 878 | 3300046523 | Ga0495644_0031138 | Ga0495644_0031138_712_1788 | 358 |
| 879 | 3300046524 | Ga0495648_0002196 | Ga0495648_0002196_3638_4714 | 358 |
| 880 | 3300046524 | Ga0495648_0018563 | Ga0495648_0018563_520_1596 | 358 |
| 881 | 3300046524 | Ga0495648_0044527 | Ga0495648_0044527_213_1319 | 358 |
| 882 | 3300046524 | Ga0495648_0045100 | Ga0495648_0045100_1461_2537 | 358 |
| 883 | 3300046524 | Ga0495648_0049359 | Ga0495648_0049359_233_1339 | 358 |
| 884 | 3300046524 | Ga0495648_0076690 | Ga0495648_0076690_323_1399 | 358 |
| 885 | 3300046524 | Ga0495648_0086476 | Ga0495648_0086476_338_1414 | 358 |
| 886 | 3300046524 | Ga0495648_0138334 | Ga0495648_0138334_73_1179 | 358 |
| 887 | 3300046524 | Ga0495648_0151883 | Ga0495648_0151883_35_1111 | 358 |
| 888 | 3300046526 | Ga0495666_0006061 | Ga0495666_0006061_4740_5816 | 358 |
| 889 | 3300046526 | Ga0495666_0028391 | Ga0495666_0028391_738_1814 | 358 |
| 890 | 3300046526 | Ga0495666_0040403 | Ga0495666_0040403_891_1967 | 358 |
| 891 | 3300046528 | Ga0495642_0000027 | Ga0495642_0000027_21897_23003 | 358 |
| 892 | 3300046528 | Ga0495642_0001462 | Ga0495642_0001462_1259_2335 | 358 |
| 893 | 3300046528 | Ga0495642_0003766 | Ga0495642_0003766_4419_5495 | 358 |
| 894 | 3300046530 | Ga0495654_0000096 | Ga0495654_0000096_89690_90766 | 358 |
| 895 | 3300046530 | Ga0495654_0002752 | Ga0495654_0002752_4871_5947 | 358 |
| 896 | 3300046530 | Ga0495654_0003864 | Ga0495654_0003864_7835_8911 | 358 |
| 897 | 3300046530 | Ga0495654_0005166 | Ga0495654_0005166_2576_3652 | 358 |
| 898 | 3300046530 | Ga0495654_0006125 | Ga0495654_0006125_4784_5860 | 358 |
| 899 | 3300046530 | Ga0495654_0008426 | Ga0495654_0008426_205_1311 | 358 |
| 900 | 3300046530 | Ga0495654_0009678 | Ga0495654_0009678_3851_4957 | 358 |
| 901 | 3300046530 | Ga0495654_0011226 | Ga0495654_0011226_136_1212 | 358 |
| 902 | 3300046530 | Ga0495654_0013108 | Ga0495654_0013108_1559_2665 | 358 |
| 903 | 3300046530 | Ga0495654_0015333 | Ga0495654_0015333_1300_2406 | 358 |
| 904 | 3300046530 | Ga0495654_0028011 | Ga0495654_0028011_491_1597 | 358 |
| 905 | 3300046530 | Ga0495654_0048813 | Ga0495654_0048813_777_1940 | 358 |
| 906 | 3300046530 | Ga0495654_0052083 | Ga0495654_0052083_826_1902 | 358 |
| 907 | 3300046530 | Ga0495654_0058245 | Ga0495654_0058245_757_1833 | 358 |
| 908 | 3300046530 | Ga0495654_0063942 | Ga0495654_0063942_585_1661 | 358 |
| 909 | 3300046530 | Ga0495654_0083604 | Ga0495654_0083604_197_1273 | 358 |
| 910 | 3300046530 | Ga0495654_0085782 | Ga0495654_0085782_210_1286 | 358 |
| 911 | 3300046535 | Ga0495586_0011665 | Ga0495586_0011665_3394_4500 | 358 |
| 912 | 3300046536 | Ga0495587_0001493 | Ga0495587_0001493_2217_3293 | 358 |
| 913 | 3300046536 | Ga0495587_0011869 | Ga0495587_0011869_3321_4427 | 358 |
| 914 | 3300046538 | Ga0495609_0000004 | Ga0495609_0000004_490216_491292 | 358 |
| 915 | 3300046538 | Ga0495609_0000360 | Ga0495609_0000360_5694_6770 | 358 |
| 916 | 3300046538 | Ga0495609_0001254 | Ga0495609_0001254_15449_16525 | 358 |
| 917 | 3300046538 | Ga0495609_0003270 | Ga0495609_0003270_7896_8972 | 358 |
| 918 | 3300046538 | Ga0495609_0005619 | Ga0495609_0005619_4797_5873 | 358 |
| 919 | 3300046538 | Ga0495609_0008683 | Ga0495609_0008683_394_1470 | 358 |
| 920 | 3300046538 | Ga0495609_0022256 | Ga0495609_0022256_1450_2526 | 358 |
| 921 | 3300046538 | Ga0495609_0022419 | Ga0495609_0022419_1053_2159 | 358 |
| 922 | 3300046538 | Ga0495609_0043418 | Ga0495609_0043418_358_1434 | 358 |
| 923 | 3300046538 | Ga0495609_0044125 | Ga0495609_0044125_74_1150 | 358 |
| 924 | 3300046542 | Ga0495597_0001669 | Ga0495597_0001669_523_1599 | 358 |
| 925 | 3300046542 | Ga0495597_0011466 | Ga0495597_0011466_1016_2092 | 358 |
| 926 | 3300046542 | Ga0495597_0011624 | Ga0495597_0011624_438_1514 | 358 |
| 927 | 3300046542 | Ga0495597_0011634 | Ga0495597_0011634_803_1879 | 358 |
| 928 | 3300046542 | Ga0495597_0026156 | Ga0495597_0026156_1271_2347 | 358 |
| 929 | 3300046542 | Ga0495597_0026339 | Ga0495597_0026339_1501_2577 | 358 |
| 930 | 3300046542 | Ga0495597_0036370 | Ga0495597_0036370_1001_2077 | 358 |
| 931 | 3300046542 | Ga0495597_0038287 | Ga0495597_0038287_991_2067 | 358 |
| 932 | 3300046543 | Ga0495645_0141105 | Ga0495645_0141105_462_1586 | 358 |
| 933 | 3300046557 | Ga0495622_0001364 | Ga0495622_0001364_1294_2370 | 358 |
| 934 | 3300046557 | Ga0495622_0002770 | Ga0495622_0002770_6761_7837 | 358 |
| 935 | 3300046557 | Ga0495622_0029990 | Ga0495622_0029990_1422_2498 | 358 |
| 936 | 3300046557 | Ga0495622_0042043 | Ga0495622_0042043_811_1917 | 358 |
| 937 | 3300046557 | Ga0495622_0052666 | Ga0495622_0052666_135_1211 | 358 |
| 938 | 3300046557 | Ga0495622_0112533 | Ga0495622_0112533_146_1222 | 358 |
| 939 | 3300046558 | Ga0495633_0000206 | Ga0495633_0000206_5457_6533 | 358 |
| 940 | 3300046558 | Ga0495633_0006362 | Ga0495633_0006362_5845_7008 | 358 |
| 941 | 3300046558 | Ga0495633_0023386 | Ga0495633_0023386_1473_2549 | 358 |
| 942 | 3300046558 | Ga0495633_0065661 | Ga0495633_0065661_276_1382 | 358 |
| 943 | 3300046558 | Ga0495633_0082593 | Ga0495633_0082593_382_1458 | 358 |
| 944 | 3300046615 | Ga0495656_0060819 | Ga0495656_0060819_112_1218 | 358 |
| 945 | 3300046615 | Ga0495656_0115997 | Ga0495656_0115997_45_1121 | 358 |
| 946 | 3300046616 | Ga0495668_0001701 | Ga0495668_0001701_1261_2367 | 358 |
| 947 | 3300046616 | Ga0495668_0003203 | Ga0495668_0003203_156_1232 | 358 |
| 948 | 3300046616 | Ga0495668_0028596 | Ga0495668_0028596_999_2075 | 358 |
| 949 | 3300046616 | Ga0495668_0033494 | Ga0495668_0033494_1587_2663 | 358 |
| 950 | 3300046616 | Ga0495668_0044190 | Ga0495668_0044190_585_1661 | 358 |
| 951 | 3300046642 | Ga0495634_0000967 | Ga0495634_0000967_1843_2919 | 358 |
| 952 | 3300046648 | Ga0495611_0000594 | Ga0495611_0000594_13594_14670 | 358 |
| 953 | 3300046648 | Ga0495611_0000656 | Ga0495611_0000656_13944_15020 | 358 |
| 954 | 3300046648 | Ga0495611_0000770 | Ga0495611_0000770_592_1668 | 358 |
| 955 | 3300046648 | Ga0495611_0035498 | Ga0495611_0035498_1039_2115 | 358 |
| 956 | 3300046648 | Ga0495611_0055092 | Ga0495611_0055092_613_1689 | 358 |
| 957 | 3300046660 | Ga0495625_0000076 | Ga0495625_0000076_67494_68570 | 358 |
| 958 | 3300046660 | Ga0495625_0004417 | Ga0495625_0004417_11519_12682 | 358 |
| 959 | 3300046660 | Ga0495625_0007516 | Ga0495625_0007516_7803_8879 | 358 |
| 960 | 3300046660 | Ga0495625_0016243 | Ga0495625_0016243_1013_2119 | 358 |
| 961 | 3300046660 | Ga0495625_0023825 | Ga0495625_0023825_1973_3049 | 358 |
| 962 | 3300046660 | Ga0495625_0050568 | Ga0495625_0050568_493_1569 | 358 |
| 963 | 3300046660 | Ga0495625_0083892 | Ga0495625_0083892_760_1836 | 358 |
| 964 | 3300046663 | Ga0495635_0000752 | Ga0495635_0000752_1552_2628 | 358 |
| 965 | 3300046663 | Ga0495635_0001802 | Ga0495635_0001802_1167_2273 | 358 |
| 966 | 3300046664 | Ga0495659_0004979 | Ga0495659_0004979_2093_3169 | 358 |
| 967 | 3300046664 | Ga0495659_0017477 | Ga0495659_0017477_1239_2315 | 358 |
| 968 | 3300046665 | Ga0495661_0000005 | Ga0495661_0000005_217216_218292 | 358 |
| 969 | 3300046665 | Ga0495661_0000099 | Ga0495661_0000099_85786_86862 | 358 |
| 970 | 3300046665 | Ga0495661_0000127 | Ga0495661_0000127_80511_81590 | 358 |
| 971 | 3300046665 | Ga0495661_0000773 | Ga0495661_0000773_782_1873 | 358 |
| 972 | 3300046665 | Ga0495661_0007011 | Ga0495661_0007011_6659_7822 | 358 |
| 973 | 3300046665 | Ga0495661_0039141 | Ga0495661_0039141_859_1935 | 358 |
| 974 | 3300046665 | Ga0495661_0042222 | Ga0495661_0042222_1663_2739 | 358 |
| 975 | 3300046665 | Ga0495661_0097094 | Ga0495661_0097094_358_1464 | 358 |
| 976 | 3300046665 | Ga0495661_0098029 | Ga0495661_0098029_76_1152 | 358 |
| 977 | 3300046674 | Ga0495588_0004580 | Ga0495588_0004580_501_1577 | 358 |
| 978 | 3300046674 | Ga0495588_0028030 | Ga0495588_0028030_1004_2110 | 358 |
| 979 | 3300046674 | Ga0495588_0028901 | Ga0495588_0028901_30_1136 | 358 |
| 980 | 3300046679 | Ga0495623_0001889 | Ga0495623_0001889_12347_13423 | 358 |
| 981 | 3300046679 | Ga0495623_0021455 | Ga0495623_0021455_2846_3922 | 358 |
| 982 | 3300046680 | Ga0495646_0005511 | Ga0495646_0005511_1078_2184 | 358 |
| 983 | 3300046680 | Ga0495646_0011937 | Ga0495646_0011937_1358_2434 | 358 |
| 984 | 3300046680 | Ga0495646_0042659 | Ga0495646_0042659_300_1538 | 358 |
| 985 | 3300046684 | Ga0495669_0016103 | Ga0495669_0016103_936_2012 | 358 |
| 986 | 3300046684 | Ga0495669_0034601 | Ga0495669_0034601_157_1263 | 358 |
| 987 | 3300046689 | Ga0495613_0022420 | Ga0495613_0022420_1203_2309 | 358 |
| 988 | 3300046689 | Ga0495613_0040240 | Ga0495613_0040240_1028_2266 | 358 |
| 989 | 3300046689 | Ga0495613_0103158 | Ga0495613_0103158_155_1231 | 358 |
| 990 | 3300046689 | Ga0495613_0228727 | Ga0495613_0228727_103_1179 | 358 |
| 991 | 3300046690 | Ga0495624_0004783 | Ga0495624_0004783_8030_9268 | 358 |
| 992 | 3300046691 | Ga0495670_0001322 | Ga0495670_0001322_9317_10393 | 358 |
| 993 | 3300046691 | Ga0495670_0002495 | Ga0495670_0002495_7575_8651 | 358 |
| 994 | 3300046691 | Ga0495670_0003468 | Ga0495670_0003468_1301_2407 | 358 |
| 995 | 3300046691 | Ga0495670_0006604 | Ga0495670_0006604_424_1500 | 358 |
| 996 | 3300046691 | Ga0495670_0039610 | Ga0495670_0039610_1069_2145 | 358 |
| 997 | 3300046692 | Ga0495671_0000908 | Ga0495671_0000908_18724_19830 | 358 |
| 998 | 3300046692 | Ga0495671_0003363 | Ga0495671_0003363_519_1757 | 358 |
| 999 | 3300046692 | Ga0495671_0004322 | Ga0495671_0004322_7273_8349 | 358 |
| 1000 | 3300046692 | Ga0495671_0010112 | Ga0495671_0010112_3804_4910 | 358 |
| 1001 | 3300046692 | Ga0495671_0010611 | Ga0495671_0010611_1667_2791 | 358 |
| 1002 | 3300046692 | Ga0495671_0014752 | Ga0495671_0014752_2584_3660 | 358 |
| 1003 | 3300046692 | Ga0495671_0016273 | Ga0495671_0016273_132_1208 | 358 |
| 1004 | 3300046692 | Ga0495671_0020993 | Ga0495671_0020993_1580_2656 | 358 |
| 1005 | 3300046692 | Ga0495671_0028218 | Ga0495671_0028218_413_1489 | 358 |
| 1006 | 3300046692 | Ga0495671_0044861 | Ga0495671_0044861_965_2041 | 358 |
| 1007 | 3300046692 | Ga0495671_0054332 | Ga0495671_0054332_460_1536 | 358 |
| 1008 | 3300046692 | Ga0495671_0062466 | Ga0495671_0062466_334_1410 | 358 |
| 1009 | 3300046692 | Ga0495671_0090416 | Ga0495671_0090416_183_1265 | 358 |
| 1010 | 3300046692 | Ga0495671_0099551 | Ga0495671_0099551_191_1297 | 358 |
| 1011 | 3300046694 | Ga0495649_0003430 | Ga0495649_0003430_252_1328 | 358 |
| 1012 | 3300046694 | Ga0495649_0006888 | Ga0495649_0006888_999_2105 | 358 |
| 1013 | 3300046694 | Ga0495649_0011489 | Ga0495649_0011489_218_1324 | 358 |
| 1014 | 3300046694 | Ga0495649_0023301 | Ga0495649_0023301_880_1956 | 358 |
| 1015 | 3300046694 | Ga0495649_0032213 | Ga0495649_0032213_765_1871 | 358 |
| 1016 | 3300046694 | Ga0495649_0045152 | Ga0495649_0045152_104_1180 | 358 |
| 1017 | 3300046694 | Ga0495649_0067577 | Ga0495649_0067577_318_1394 | 358 |
| 1018 | 3300046694 | Ga0495649_0087866 | Ga0495649_0087866_57_1133 | 358 |
| 1019 | 3300046694 | Ga0495649_0134911 | Ga0495649_0134911_90_1166 | 358 |
| 1020 | 3300046794 | Ga0495589_0000777 | Ga0495589_0000777_18625_19731 | 358 |
| 1021 | 3300046794 | Ga0495589_0003301 | Ga0495589_0003301_1591_2667 | 358 |
| 1022 | 3300046794 | Ga0495589_0007266 | Ga0495589_0007266_801_1907 | 358 |
| 1023 | 3300046794 | Ga0495589_0018660 | Ga0495589_0018660_1790_2953 | 358 |
| 1024 | 3300046794 | Ga0495589_0022307 | Ga0495589_0022307_263_1339 | 358 |
| 1025 | 3300046794 | Ga0495589_0027652 | Ga0495589_0027652_867_1973 | 358 |
| 1026 | 3300046794 | Ga0495589_0056830 | Ga0495589_0056830_138_1214 | 358 |
| 1027 | 3300046794 | Ga0495589_0073266 | Ga0495589_0073266_116_1192 | 358 |
| 1028 | 3300046794 | Ga0495589_0074064 | Ga0495589_0074064_271_1347 | 358 |
| 1029 | 3300046809 | Ga0495600_0007252 | Ga0495600_0007252_3805_4911 | 358 |
| 1030 | 3300046809 | Ga0495600_0028848 | Ga0495600_0028848_2233_3309 | 358 |
| 1031 | 3300046809 | Ga0495600_0036464 | Ga0495600_0036464_444_1682 | 358 |
| 1032 | 3300046810 | Ga0495660_0002363 | Ga0495660_0002363_5835_6911 | 358 |
| 1033 | 3300046810 | Ga0495660_0003734 | Ga0495660_0003734_7371_8447 | 358 |
| 1034 | 3300046810 | Ga0495660_0012950 | Ga0495660_0012950_2774_3880 | 358 |
| 1035 | 3300046810 | Ga0495660_0020560 | Ga0495660_0020560_1870_2946 | 358 |
| 1036 | 3300046810 | Ga0495660_0025858 | Ga0495660_0025858_1004_2080 | 358 |
| 1037 | 3300046810 | Ga0495660_0028570 | Ga0495660_0028570_541_1617 | 358 |
| 1038 | 3300046810 | Ga0495660_0040404 | Ga0495660_0040404_520_1596 | 358 |
| 1039 | 3300046810 | Ga0495660_0055122 | Ga0495660_0055122_367_1443 | 358 |
| 1040 | 3300046810 | Ga0495660_0071586 | Ga0495660_0071586_350_1513 | 358 |
| 1041 | 3300046810 | Ga0495660_0100401 | Ga0495660_0100401_253_1329 | 358 |
| 1042 | 3300047315 | Ga0495581_0015921 | Ga0495581_0015921_3075_4181 | 358 |
| 1043 | 3300047315 | Ga0495581_0068343 | Ga0495581_0068343_451_1527 | 358 |
| 1044 | 3300047317 | Ga0495604_0033465 | Ga0495604_0033465_2754_3830 | 358 |
| 1045 | 3300047317 | Ga0495604_0072913 | Ga0495604_0072913_783_1889 | 358 |
| 1046 | 3300047319 | Ga0495674_0005437 | Ga0495674_0005437_632_1708 | 358 |
| 1047 | 3300047320 | Ga0495672_0000952 | Ga0495672_0000952_929_2035 | 358 |
| 1048 | 3300047320 | Ga0495672_0001238 | Ga0495672_0001238_4535_5641 | 358 |
| 1049 | 3300047320 | Ga0495672_0005823 | Ga0495672_0005823_7756_8832 | 358 |
| 1050 | 3300047320 | Ga0495672_0008463 | Ga0495672_0008463_1106_2182 | 358 |
| 1051 | 3300047320 | Ga0495672_0043255 | Ga0495672_0043255_1417_2541 | 358 |
| 1052 | 3300047320 | Ga0495672_0050193 | Ga0495672_0050193_165_1241 | 358 |
| 1053 | 3300047320 | Ga0495672_0055929 | Ga0495672_0055929_643_1719 | 358 |
| 1054 | 3300047320 | Ga0495672_0057269 | Ga0495672_0057269_693_1769 | 358 |
| 1055 | 3300047320 | Ga0495672_0057795 | Ga0495672_0057795_148_1254 | 358 |
| 1056 | 3300047320 | Ga0495672_0067620 | Ga0495672_0067620_45_1121 | 358 |
| 1057 | 3300047320 | Ga0495672_0073903 | Ga0495672_0073903_483_1559 | 358 |
| 1058 | 3300047320 | Ga0495672_0118341 | Ga0495672_0118341_88_1164 | 358 |
| 1059 | 3300047321 | Ga0495676_0000016 | Ga0495676_0000016_66760_67836 | 358 |
| 1060 | 3300047321 | Ga0495676_0002566 | Ga0495676_0002566_14113_15189 | 358 |
| 1061 | 3300047321 | Ga0495676_0082399 | Ga0495676_0082399_988_2064 | 358 |
| 1062 | 3300047322 | Ga0495680_0004320 | Ga0495680_0004320_159_1265 | 358 |
| 1063 | 3300047322 | Ga0495680_0018000 | Ga0495680_0018000_660_1736 | 358 |
| 1064 | 3300047322 | Ga0495680_0056009 | Ga0495680_0056009_1237_2313 | 358 |
| 1065 | 3300047323 | Ga0495683_0000031 | Ga0495683_0000031_81196_82272 | 358 |
| 1066 | 3300047323 | Ga0495683_0000322 | Ga0495683_0000322_18725_19888 | 358 |
| 1067 | 3300047323 | Ga0495683_0000902 | Ga0495683_0000902_19219_20295 | 358 |
| 1068 | 3300047323 | Ga0495683_0004157 | Ga0495683_0004157_368_1474 | 358 |
| 1069 | 3300047323 | Ga0495683_0019630 | Ga0495683_0019630_2189_3265 | 358 |
| 1070 | 3300047323 | Ga0495683_0125714 | Ga0495683_0125714_44_1120 | 358 |
| 1071 | 3300047444 | Ga0495675_0018128 | Ga0495675_0018128_1300_2406 | 358 |
| 1072 | 3300047444 | Ga0495675_0063457 | Ga0495675_0063457_534_1610 | 358 |
| 1073 | 3300047444 | Ga0495675_0086791 | Ga0495675_0086791_787_1863 | 358 |
| 1074 | 3300047445 | Ga0495677_0003900 | Ga0495677_0003900_3559_4635 | 358 |
| 1075 | 3300047446 | Ga0495679_000087 | Ga0495679_000087_4649_5725 | 358 |
| 1076 | 3300047446 | Ga0495679_000154 | Ga0495679_000154_46965_48041 | 358 |
| 1077 | 3300047446 | Ga0495679_012040 | Ga0495679_012040_1436_2512 | 358 |
| 1078 | 3300047446 | Ga0495679_014298 | Ga0495679_014298_919_1995 | 358 |
| 1079 | 3300047446 | Ga0495679_014799 | Ga0495679_014799_1588_2664 | 358 |
| 1080 | 3300047446 | Ga0495679_016261 | Ga0495679_016261_211_1287 | 358 |
| 1081 | 3300047446 | Ga0495679_018743 | Ga0495679_018743_528_1604 | 358 |
| 1082 | 3300047447 | Ga0495685_019273 | Ga0495685_019273_161_1237 | 358 |
| 1083 | 3300047469 | Ga0495673_0000704 | Ga0495673_0000704_1627_2703 | 358 |
| 1084 | 3300047469 | Ga0495673_0001106 | Ga0495673_0001106_20067_21230 | 358 |
| 1085 | 3300047469 | Ga0495673_0002388 | Ga0495673_0002388_1327_2403 | 358 |
| 1086 | 3300047469 | Ga0495673_0004200 | Ga0495673_0004200_7305_8411 | 358 |
| 1087 | 3300047469 | Ga0495673_0006307 | Ga0495673_0006307_5641_6717 | 358 |
| 1088 | 3300047469 | Ga0495673_0015126 | Ga0495673_0015126_340_1416 | 358 |
| 1089 | 3300047469 | Ga0495673_0015438 | Ga0495673_0015438_1616_2740 | 358 |
| 1090 | 3300047469 | Ga0495673_0018836 | Ga0495673_0018836_1526_2602 | 358 |
| 1091 | 3300047469 | Ga0495673_0022794 | Ga0495673_0022794_1858_2934 | 358 |
| 1092 | 3300047469 | Ga0495673_0025050 | Ga0495673_0025050_1294_2370 | 358 |
| 1093 | 3300047469 | Ga0495673_0030887 | Ga0495673_0030887_437_1543 | 358 |
| 1094 | 3300047469 | Ga0495673_0036977 | Ga0495673_0036977_655_1731 | 358 |
| 1095 | 3300047469 | Ga0495673_0045850 | Ga0495673_0045850_159_1265 | 358 |
| 1096 | 3300047469 | Ga0495673_0046077 | Ga0495673_0046077_196_1272 | 358 |
| 1097 | 3300047469 | Ga0495673_0070511 | Ga0495673_0070511_179_1255 | 358 |
| 1098 | 3300047470 | Ga0495681_0001149 | Ga0495681_0001149_1003_2109 | 358 |
| 1099 | 3300047470 | Ga0495681_0003165 | Ga0495681_0003165_5745_6821 | 358 |
| 1100 | 3300047470 | Ga0495681_0003188 | Ga0495681_0003188_10121_11227 | 358 |
| 1101 | 3300047470 | Ga0495681_0003564 | Ga0495681_0003564_8729_9835 | 358 |
| 1102 | 3300047470 | Ga0495681_0004680 | Ga0495681_0004680_270_1346 | 358 |
| 1103 | 3300047470 | Ga0495681_0013963 | Ga0495681_0013963_2570_3646 | 358 |
| 1104 | 3300047470 | Ga0495681_0019405 | Ga0495681_0019405_2247_3353 | 358 |
| 1105 | 3300047470 | Ga0495681_0024143 | Ga0495681_0024143_1924_3000 | 358 |
| 1106 | 3300047470 | Ga0495681_0027203 | Ga0495681_0027203_1443_2606 | 358 |
| 1107 | 3300047470 | Ga0495681_0039999 | Ga0495681_0039999_963_2069 | 358 |
| 1108 | 3300047470 | Ga0495681_0040015 | Ga0495681_0040015_603_1694 | 358 |
| 1109 | 3300047470 | Ga0495681_0081495 | Ga0495681_0081495_18_1094 | 358 |
| 1110 | 3300047471 | Ga0495684_0046103 | Ga0495684_0046103_1139_2377 | 358 |
| 1111 | 3300047472 | Ga0495686_0002947 | Ga0495686_0002947_528_1766 | 358 |
| 1112 | 3300047472 | Ga0495686_0016378 | Ga0495686_0016378_3178_4254 | 358 |
| 1113 | 3300047472 | Ga0495686_0018446 | Ga0495686_0018446_233_1339 | 358 |
| 1114 | 3300047472 | Ga0495686_0029408 | Ga0495686_0029408_1887_2963 | 358 |
| 1115 | 3300047472 | Ga0495686_0095488 | Ga0495686_0095488_275_1381 | 358 |
| 1116 | 3300047472 | Ga0495686_0109163 | Ga0495686_0109163_369_1445 | 358 |
| 1117 | 3300047673 | Ga0495593_0028044 | Ga0495593_0028044_1750_2826 | 358 |
| 1118 | 3300047673 | Ga0495593_0045035 | Ga0495593_0045035_38_1114 | 358 |
| 1119 | 3300048088 | Ga0495602_0110889 | Ga0495602_0110889_847_1923 | 358 |
| 1120 | 3300048091 | Ga0495626_0000098 | Ga0495626_0000098_17182_18258 | 358 |
| 1121 | 3300048091 | Ga0495626_0000230 | Ga0495626_0000230_28983_30059 | 358 |
| 1122 | 3300048091 | Ga0495626_0000263 | Ga0495626_0000263_57665_58741 | 358 |
| 1123 | 3300048091 | Ga0495626_0000577 | Ga0495626_0000577_35011_36087 | 358 |
| 1124 | 3300048091 | Ga0495626_0001223 | Ga0495626_0001223_227_1303 | 358 |
| 1125 | 3300048091 | Ga0495626_0004178 | Ga0495626_0004178_7766_8842 | 358 |
| 1126 | 3300048091 | Ga0495626_0004696 | Ga0495626_0004696_6661_7737 | 358 |
| 1127 | 3300048091 | Ga0495626_0005042 | Ga0495626_0005042_646_1884 | 358 |
| 1128 | 3300048091 | Ga0495626_0006801 | Ga0495626_0006801_3937_5013 | 358 |
| 1129 | 3300048091 | Ga0495626_0025224 | Ga0495626_0025224_1753_2829 | 358 |
| 1130 | 3300048091 | Ga0495626_0066570 | Ga0495626_0066570_136_1212 | 358 |
| 1131 | 3300048905 | Ga0496102_0000991 | Ga0496102_0000991_1548_2624 | 358 |
| 1132 | 3300048906 | Ga0496103_0000997 | Ga0496103_0000997_673_1749 | 358 |
| 1133 | 3300048909 | Ga0496106_0110942 | Ga0496106_0110942_383_1459 | 358 |
| 1134 | 3300048913 | Ga0496110_0056893 | Ga0496110_0056893_658_1734 | 358 |
| 1135 | 3300048913 | Ga0496110_0241448 | Ga0496110_0241448_454_1560 | 358 |
| 1136 | 3300048919 | Ga0496116_0000085 | Ga0496116_0000085_557_1663 | 358 |
| 1137 | 3300048919 | Ga0496116_0002312 | Ga0496116_0002312_1322_2560 | 358 |
| 1138 | 3300048919 | Ga0496116_0007971 | Ga0496116_0007971_7901_8977 | 358 |
| 1139 | 3300048919 | Ga0496116_0033598 | Ga0496116_0033598_988_2064 | 358 |
| 1140 | 3300048919 | Ga0496116_0045906 | Ga0496116_0045906_605_1681 | 358 |
| 1141 | 3300048920 | Ga0496117_0001620 | Ga0496117_0001620_30303_31394 | 358 |
| 1142 | 3300048920 | Ga0496117_0018402 | Ga0496117_0018402_683_1759 | 358 |
| 1143 | 3300048920 | Ga0496117_0022061 | Ga0496117_0022061_833_1909 | 358 |
| 1144 | 3300048920 | Ga0496117_0024440 | Ga0496117_0024440_639_1745 | 358 |
| 1145 | 3300048920 | Ga0496117_0050277 | Ga0496117_0050277_290_1366 | 358 |
| 1146 | 3300048920 | Ga0496117_0077709 | Ga0496117_0077709_523_1629 | 358 |
| 1147 | 3300048920 | Ga0496117_0149519 | Ga0496117_0149519_164_1240 | 358 |
| 1148 | 3300048921 | Ga0496118_0008257 | Ga0496118_0008257_283_1359 | 358 |
| 1149 | 3300048921 | Ga0496118_0021501 | Ga0496118_0021501_996_2072 | 358 |
| 1150 | 3300048921 | Ga0496118_0052475 | Ga0496118_0052475_1699_2775 | 358 |
| 1151 | 3300048921 | Ga0496118_0054134 | Ga0496118_0054134_546_1652 | 358 |
| 1152 | 3300048921 | Ga0496118_0065624 | Ga0496118_0065624_780_1856 | 358 |
| 1153 | 3300048921 | Ga0496118_0079460 | Ga0496118_0079460_429_1520 | 358 |
| 1154 | 3300048921 | Ga0496118_0083334 | Ga0496118_0083334_978_2084 | 358 |
| 1155 | 3300048921 | Ga0496118_0152586 | Ga0496118_0152586_257_1333 | 358 |
| 1156 | 3300048921 | Ga0496118_0156975 | Ga0496118_0156975_225_1301 | 358 |
| 1157 | 3300048922 | Ga0496119_0063537 | Ga0496119_0063537_736_1827 | 358 |
| 1158 | 3300048922 | Ga0496119_0071589 | Ga0496119_0071589_466_1542 | 358 |
| 1159 | 3300048922 | Ga0496119_0082378 | Ga0496119_0082378_645_1721 | 358 |
| 1160 | 3300048923 | Ga0496120_0008485 | Ga0496120_0008485_660_1751 | 358 |
| 1161 | 3300048923 | Ga0496120_0067004 | Ga0496120_0067004_394_1470 | 358 |
| 1162 | 3300048924 | Ga0496121_0000179 | Ga0496121_0000179_603_1709 | 358 |
| 1163 | 3300048924 | Ga0496121_0011251 | Ga0496121_0011251_7928_9004 | 358 |
| 1164 | 3300048924 | Ga0496121_0023305 | Ga0496121_0023305_4386_5549 | 358 |
| 1165 | 3300048924 | Ga0496121_0062161 | Ga0496121_0062161_897_2003 | 358 |
| 1166 | 3300048924 | Ga0496121_0090060 | Ga0496121_0090060_102_1178 | 358 |
| 1167 | 3300048925 | Ga0496122_0029324 | Ga0496122_0029324_850_1926 | 358 |
| 1168 | 3300048925 | Ga0496122_0048877 | Ga0496122_0048877_540_1646 | 358 |
| 1169 | 3300048925 | Ga0496122_0077274 | Ga0496122_0077274_283_1359 | 358 |
| 1170 | 3300048925 | Ga0496122_0108927 | Ga0496122_0108927_525_1601 | 358 |
| 1171 | 3300048925 | Ga0496122_0119113 | Ga0496122_0119113_283_1374 | 358 |
| 1172 | 3300048926 | Ga0496123_0048907 | Ga0496123_0048907_978_2054 | 358 |
| 1173 | 3300048926 | Ga0496123_0076472 | Ga0496123_0076472_637_1743 | 358 |
| 1174 | 3300048927 | Ga0496124_0001693 | Ga0496124_0001693_679_1755 | 358 |
| 1175 | 3300048927 | Ga0496124_0002847 | Ga0496124_0002847_20529_21605 | 358 |
| 1176 | 3300048927 | Ga0496124_0027297 | Ga0496124_0027297_1001_2077 | 358 |
| 1177 | 3300048927 | Ga0496124_0068606 | Ga0496124_0068606_1734_2840 | 358 |
| 1178 | 3300048928 | Ga0496125_0001691 | Ga0496125_0001691_443_1519 | 358 |
| 1179 | 3300048928 | Ga0496125_0005312 | Ga0496125_0005312_12212_13375 | 358 |
| 1180 | 3300048928 | Ga0496125_0038928 | Ga0496125_0038928_1316_2392 | 358 |
| 1181 | 3300048928 | Ga0496125_0085987 | Ga0496125_0085987_318_1394 | 358 |
| 1182 | 3300048928 | Ga0496125_0187946 | Ga0496125_0187946_126_1202 | 358 |
| 1183 | 3300048929 | Ga0496126_0009446 | Ga0496126_0009446_804_1880 | 358 |
| 1184 | 3300048929 | Ga0496126_0097180 | Ga0496126_0097180_1322_2398 | 358 |
| 1185 | 3300048929 | Ga0496126_0177264 | Ga0496126_0177264_379_1470 | 358 |
| 1186 | 3300049459 | Ga0495678_000186 | Ga0495678_000186_6265_7341 | 358 |
| 1187 | 3300049459 | Ga0495678_002417 | Ga0495678_002417_213_1289 | 358 |
| 1188 | 3300049459 | Ga0495678_003788 | Ga0495678_003788_7808_8884 | 358 |
| 1189 | 3300049459 | Ga0495678_006374 | Ga0495678_006374_4700_5776 | 358 |
| 1190 | 3300049459 | Ga0495678_008931 | Ga0495678_008931_3434_4510 | 358 |
| 1191 | 3300049459 | Ga0495678_008976 | Ga0495678_008976_946_2022 | 358 |
| 1192 | 3300049459 | Ga0495678_011686 | Ga0495678_011686_548_1624 | 358 |
| 1193 | 3300049459 | Ga0495678_014787 | Ga0495678_014787_886_2124 | 358 |
| 1194 | 3300049459 | Ga0495678_018255 | Ga0495678_018255_881_1957 | 358 |
| 1195 | 3300049459 | Ga0495678_018731 | Ga0495678_018731_1015_2121 | 358 |
| 1196 | 3300049459 | Ga0495678_022834 | Ga0495678_022834_1516_2592 | 358 |
| 1197 | 3300049459 | Ga0495678_034970 | Ga0495678_034970_804_1880 | 358 |
| 1198 | 3300049459 | Ga0495678_035291 | Ga0495678_035291_551_1630 | 358 |
| 1199 | 3300049459 | Ga0495678_035381 | Ga0495678_035381_734_1840 | 358 |
| 1200 | 3300049459 | Ga0495678_060052 | Ga0495678_060052_116_1222 | 358 |
| 1201 | 3300049459 | Ga0495678_064926 | Ga0495678_064926_115_1191 | 358 |
| 1202 | 3300049460 | Ga0495682_0013169 | Ga0495682_0013169_528_1604 | 358 |
| 1203 | 3300049460 | Ga0495682_0017012 | Ga0495682_0017012_78_1154 | 358 |
| 1204 | 3300049460 | Ga0495682_0017566 | Ga0495682_0017566_1402_2508 | 358 |
| 1205 | 3300049460 | Ga0495682_0038854 | Ga0495682_0038854_174_1250 | 358 |
| 1206 | 3300049758 | Ga0501241_002093 | Ga0501241_002093_1196_2272 | 358 |
| 1207 | 3300050489 | nmdc:mga03683_48851_c1 | nmdc:mga03683_48851_c1_466_1542 | 358 |
| 1208 | 3300053111 | Ga0500572_012531 | Ga0500572_012531_639_1715 | 358 |
| 1209 | iso_pu_bacteria | 3007419365 | 3007421129 | 358 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7f0y-assembly1.cif.gz_B | crystal structure of isomerase nsrq f58a in complex with substrate analogue | 0.7452 | 39 | 87 |
| 5wip-assembly1.cif.gz_D | trae protein in complex with 2-(2-furyl)isonicotinic acid | 0.6682 | 42 | 87 |
| 7f0o-assembly1.cif.gz_A | crystal structure of selenomethionine-labeled isomerase nsrq | 0.6367 | 39 | 86 |
| 7f14-assembly1.cif.gz_B | crystal structure of isomerase dcr3 complex with substrate analogue 3 | 0.6195 | 39 | 86 |
| 4pej-assembly1.cif.gz_A | crystal structure of a computationally designed retro-aldolase, ra110.4 (cys free) | 0.6082 | 41 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q95Y26_80_379_3.90.190.10 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.6377 | 40 | 75 | 3.90.190.10 |
| af_I6XW93_5_142_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.6211 | 42 | 86 | 3.10.450.50 |
| 5i97A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein | 0.5955 | 42 | 87 | 3.10.450.230 |
| af_Q18242_36_164_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.5689 | 36 | 68 | 3.10.450.50 |
| af_Q54KU9_11_139_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.5668 | 39 | 87 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2DCM4-F1-model_v4 | deleted | 0.9072 | 1 | 220 |
|
| AF-A0A6M0CRR9-F1-model_v4 | DUF748 domain-containing protein | 0.8989 | 1 | 151 |
|
| AF-A0A6M0CRR9-F1-model_v4 | DUF748 domain-containing protein | 0.8877 | 1 | 151 |
|
| AF-A0A5C5Q9Q0-F1-model_v4 | deleted | 0.8835 | 61 | 253 |
|
| AF-A0A1X0N277-F1-model_v4 | DUF748 domain-containing protein | 0.882 | 1 | 192 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar