F491714

General Info

Members Datasets Scaffolds Average Seq Length
1209 468 991 359

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0073954|Ga0495630_0073954_1264_2535
Length 423
Sequence MRLICTSGVLPMEWALSAKIRLMAGSLYSVELTAKGMLLACSRPVQANVQAPQQSMALQRQRFAIMNRRYSWPLWTLAGVVVLLIALHIALPYMVRNYLNDKLADMGAYRGQINDVDLALWRGAYKINGLKIVKIDGKIPVPFVNAPLIDLSVSWHSLWYNHAVVAEVQFFHPEVNFVDGGANKQNSQTGQGTDWRAQLGKLLPITLNEVRIFDGKISFRNFNSKPPVNMNATQVNASIFNLTNVVDTKGKRDARFEGKALLLGQAPLETTATFDPLSNFEDFEFRLRVKDIELKRMNDFASAYGKFDFNAGHGDVVIEAQAKKAQLNGYIKPLLKDVDVFNWQQDVENKDKGIFRSIWEAIVGGSETVLKNQAKNQFATRVELSGSVHRQDVSAFQAFLQILRNGFIQAFNARYERPKPDAG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231016 Pseudomonas sp. GM50 Isolate Nodule
10 2511231018 Pseudomonas sp. GM60 Isolate Nodule
11 2511231019 Pseudomonas sp. GM67 Isolate Nodule
12 2511231020 Pseudomonas sp. GM74 Isolate Nodule
13 2511231021 Pseudomonas sp. GM78 Isolate Nodule
14 2511231022 Pseudomonas sp. GM79 Isolate Nodule
15 2511231023 Pseudomonas sp. GM80 Isolate Nodule
16 2511231024 Pseudomonas sp. GM84 Isolate Nodule
17 2511231031 Pseudomonas sp. GM16 Isolate Nodule
18 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
19 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
20 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
21 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
22 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
23 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
24 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
25 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
26 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
27 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
28 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
29 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
30 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
31 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
32 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
33 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
34 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
35 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
36 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
37 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
38 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
39 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
40 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
41 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
42 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
43 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
44 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
45 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
46 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
47 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
48 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
49 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
50 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
51 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
52 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
53 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
54 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
55 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
56 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
57 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
58 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
59 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
60 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
61 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
62 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
63 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
64 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
65 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
66 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
67 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
68 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
69 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
70 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
71 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
72 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
73 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
74 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
75 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
76 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
77 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
78 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
79 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
80 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
81 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
82 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
83 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
84 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
85 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
86 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
87 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
88 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
89 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
90 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
91 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
92 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
93 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
94 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
95 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
96 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
97 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
98 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
99 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
100 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
101 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
102 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
103 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
104 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
105 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
106 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
107 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
108 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
109 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
110 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
111 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
112 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
113 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
114 2765235841 Pseudomonas putida AA7 Isolate Unclassified
115 2773857670 Pseudomonas sp. 478 Isolate Unclassified
116 2773857673 Pseudomonas sp. 443 Isolate Unclassified
117 2784132063 Pseudomonas sp. 424 Isolate Unclassified
118 2784132072 Pseudomonas sp. 460 Isolate Unclassified
119 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
120 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
121 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
122 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
123 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
124 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
125 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
126 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
127 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
128 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
129 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
130 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
131 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
132 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
133 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
134 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
135 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
136 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
137 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
138 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
139 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
140 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
141 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
142 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
143 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
144 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
145 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
146 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
147 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
148 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
149 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
150 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
151 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
152 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
153 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
154 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
155 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
156 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
157 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
158 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
159 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
160 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
161 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
162 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
163 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
164 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
165 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
166 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
167 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
168 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
169 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
170 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
171 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
172 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
173 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
174 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
175 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
176 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
177 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
178 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
179 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
180 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
181 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
182 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
183 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
184 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
185 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
186 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
187 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
188 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
189 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
190 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
191 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
192 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
193 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
194 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
195 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
196 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
197 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
198 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
199 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
200 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
201 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
202 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
203 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
204 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
205 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
206 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
207 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
208 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
209 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
210 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
211 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
212 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
213 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
214 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
215 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
216 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
217 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
218 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
219 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
220 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
221 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
222 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
223 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
224 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
225 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
226 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
227 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
228 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
229 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
230 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
231 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
232 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
233 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
234 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
235 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
236 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
237 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
238 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
239 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
240 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
241 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
242 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
243 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
244 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
245 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
246 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
247 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
248 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
249 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
250 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
251 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
252 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
258 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
259 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
261 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
263 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
264 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
283 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
284 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
286 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
288 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
289 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
290 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
291 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
292 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
293 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
294 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
295 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
296 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
297 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
298 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
299 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
300 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
301 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
302 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
303 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
304 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
305 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
306 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
307 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
308 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
309 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
310 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
311 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
312 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
313 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
314 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
315 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
316 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
317 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
318 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
319 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
320 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
321 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
322 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
323 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
324 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
325 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
326 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
327 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
328 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
329 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
330 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
331 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
332 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
333 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
334 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
335 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
336 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
337 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
338 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
339 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
340 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
341 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
342 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
343 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
344 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
345 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
346 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
347 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
348 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
349 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
350 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
351 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
352 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
353 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
354 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
355 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
356 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
357 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
358 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
359 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
360 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
361 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
362 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
363 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
364 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
365 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
366 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
367 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
368 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
369 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
370 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
371 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
372 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
373 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
374 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
375 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
376 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
377 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
378 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
379 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
380 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
381 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
382 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
383 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
384 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
385 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
386 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
387 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
388 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
389 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
390 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
391 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
392 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
393 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
394 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
395 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
396 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
397 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
398 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
399 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
400 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
401 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
402 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
403 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
404 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
405 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
406 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
407 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
408 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
409 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
410 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
411 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
412 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
413 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
414 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
415 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
416 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
417 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
418 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
419 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
420 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
421 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
422 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
423 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
424 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
425 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
426 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
427 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
428 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
429 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
430 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
431 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
432 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
433 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
435 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
436 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
437 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
438 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
439 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
440 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
441 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
442 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
443 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
444 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
445 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
446 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
447 8052494512 Pseudomonas putida LD6 Isolate Unclassified
448 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
449 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
450 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
451 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
452 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
453 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
454 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
455 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
456 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
457 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
458 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
459 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
460 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
461 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
462 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
463 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
464 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
465 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
466 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
467 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
468 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.97
Metatranscriptomes 0
Isolates 18.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.96
Nodule 1.99
Rhizoplane 6.04
Rhizosphere 75.35
Stem 0
Stem Tuber 0
Unclassified 11.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6404 2124908027 Bacteria 7500
2 MRS2a_Contig_916 2124908027 Bacteria 7402
3 SwRhRL2b_contig_1718832 2162886007 Bacteria 2117
4 SwRhRL2b_contig_2047565 2162886007 Bacteria 1500
5 SwRhRL2b_contig_3032464 2162886007 Bacteria 2423
6 JGI25162J39368_1000085 3300002737 Bacteria 107722
7 JGI25154J39366_1003253 3300002738 Bacteria 3530
8 JGI25163J39215_1000217 3300002771 Bacteria 21584
9 JGI25164J39214_1000063 3300002772 Bacteria 107722
10 JGI25165J46597_1000160 3300003214 Bacteria 107722
11 Ga0055538_1000078 3300003751 Bacteria 86114
12 Ga0055539_1000119 3300003752 Bacteria 86114
13 Ga0055533_1000127 3300003756 Bacteria 86114
14 Ga0055532_1000068 3300003758 Bacteria 138828
15 Ga0055525_1000163 3300003759 Bacteria 86114
16 Ga0055536_1000173 3300003781 Bacteria 53972
17 Ga0055536_1000362 3300003781 Bacteria 33679
18 Ga0055536_1000391 3300003781 Bacteria 31787
19 Ga0055530_10000113 3300003791 Bacteria 70767
20 Ga0055530_10000196 3300003791 Bacteria 54353
21 Ga0055530_10023505 3300003791 Bacteria 1768
22 Ga0055530_10024949 3300003791 Bacteria 1680
23 Ga0055540_1000154 3300003792 Bacteria 67934
24 Ga0055540_1000170 3300003792 Bacteria 64696
25 Ga0055540_1000218 3300003792 Bacteria 54199
26 Ga0055531_10000842 3300003794 Bacteria 25309
27 Ga0055541_1000079 3300003841 Bacteria 86114
28 Ga0065714_10002499 3300005288 Bacteria 16092
29 Ga0065714_10003605 3300005288 Bacteria 6593
30 Ga0065714_10009859 3300005288 Bacteria 2220
31 Ga0065714_10011908 3300005288 Bacteria 3918
32 Ga0065714_10065019 3300005288 Bacteria 13914
33 Ga0065714_10066956 3300005288 Bacteria 6058
34 Ga0065714_10079310 3300005288 Bacteria 2526
35 Ga0065714_10081673 3300005288 Bacteria 2358
36 Ga0065714_10083084 3300005288 Bacteria 2270
37 Ga0065714_10086053 3300005288 Bacteria 2119
38 Ga0065714_10086697 3300005288 Bacteria 2086
39 Ga0065714_10108174 3300005288 Bacteria 1492
40 Ga0065704_10003637 3300005289 Bacteria 4069
41 Ga0065704_10072784 3300005289 Bacteria 8012
42 Ga0065704_10119990 3300005289 Bacteria 1790
43 Ga0065704_10128981 3300005289 Bacteria 1655
44 Ga0065704_10138562 3300005289 Bacteria 1542
45 Ga0065712_10002299 3300005290 Bacteria 6611
46 Ga0065715_10005136 3300005293 Bacteria 3683
47 Ga0070670_100001033 3300005331 Bacteria 22053
48 Ga0070661_100000060 3300005344 Bacteria 86915
49 Ga0070669_100000997 3300005353 Bacteria 20611
50 Ga0070662_100002077 3300005457 Bacteria 12277
51 Ga0070662_100011144 3300005457 Bacteria 5923
52 Ga0068853_100035771 3300005539 Bacteria 4220
53 Ga0070665_100030324 3300005548 Bacteria 5443
54 Ga0070664_100000202 3300005564 Bacteria 42546
55 Ga0068854_100067332 3300005578 Bacteria 2608
56 Ga0068851_10000055 3300005834 Bacteria 67442
57 Ga0075364_10090124 3300006051 Bacteria 2034
58 Ga0075432_10005628 3300006058 Bacteria 4267
59 Ga0075432_10026538 3300006058 Bacteria 1990
60 Ga0075432_10035240 3300006058 Bacteria 1739
61 Ga0075432_10050081 3300006058 Bacteria 1472
62 Ga0075362_10069546 3300006177 Bacteria 1605
63 Ga0075362_10096897 3300006177 Bacteria 1375
64 Ga0075369_10081088 3300006186 Bacteria 1439
65 Ga0099823_1000074 3300006944 Bacteria 48327
66 Ga0079104_1000145 3300006946 Bacteria 100111
67 Ga0079104_1001936 3300006946 Bacteria 12328
68 Ga0099826_10045335 3300006948 Bacteria 3007
69 Ga0105251_10000847 3300009011 Bacteria 27434
70 Ga0105251_10001298 3300009011 Bacteria 21569
71 Ga0105251_10003325 3300009011 Bacteria 11738
72 Ga0105251_10013205 3300009011 Bacteria 4630
73 Ga0105251_10023484 3300009011 Bacteria 3182
74 Ga0105251_10052492 3300009011 Bacteria 1941
75 Ga0105251_10053840 3300009011 Bacteria 1912
76 Ga0105244_10000248 3300009036 Bacteria 55384
77 Ga0105244_10000274 3300009036 Bacteria 51929
78 Ga0105244_10002675 3300009036 Bacteria 13334
79 Ga0105244_10019664 3300009036 Bacteria 3763
80 Ga0105244_10035696 3300009036 Bacteria 2610
81 Ga0105244_10035795 3300009036 Bacteria 2605
82 Ga0105244_10044890 3300009036 Bacteria 2275
83 Ga0105244_10058187 3300009036 Bacteria 1951
84 Ga0105244_10065661 3300009036 Bacteria 1817
85 Ga0105244_10084642 3300009036 Bacteria 1566
86 Ga0105244_10125968 3300009036 Bacteria 1238
87 Ga0105250_10000534 3300009092 Bacteria 26333
88 Ga0105250_10001316 3300009092 Bacteria 13557
89 Ga0105250_10015682 3300009092 Bacteria 3102
90 Ga0105250_10044958 3300009092 Bacteria 1771
91 Ga0105250_10060972 3300009092 Bacteria 1516
92 Ga0105243_10000451 3300009148 Bacteria 42796
93 Ga0105243_10001719 3300009148 Bacteria 18837
94 Ga0105243_10087612 3300009148 Bacteria 2556
95 Ga0105242_10007609 3300009176 Bacteria 8339
96 Ga0105237_10000640 3300009545 Bacteria 48895
97 Ga0105249_10026157 3300009553 Bacteria 5256
98 Ga0105246_10000117 3300011119 Bacteria 35942
99 Ga0105246_10016446 3300011119 Bacteria 4686
100 Ga0105246_10084560 3300011119 Bacteria 2270
101 Ga0105246_10095329 3300011119 Bacteria 2154
102 Ga0157345_1000081 3300012498 Bacteria 20216
103 Ga0157347_1002054 3300012502 Bacteria 1677
104 Ga0157373_10000593 3300013100 Bacteria 28147
105 Ga0157373_10003554 3300013100 Bacteria 11776
106 Ga0157373_10016161 3300013100 Bacteria 5448
107 Ga0157373_10021556 3300013100 Bacteria 4679
108 Ga0157373_10055665 3300013100 Bacteria 2809
109 Ga0157373_10056736 3300013100 Bacteria 2780
110 Ga0157373_10056881 3300013100 Bacteria 2775
111 Ga0157371_10000497 3300013102 Bacteria 47594
112 Ga0157371_10000583 3300013102 Bacteria 43268
113 Ga0157371_10003644 3300013102 Bacteria 13865
114 Ga0157371_10017431 3300013102 Bacteria 5335
115 Ga0157370_10026246 3300013104 Bacteria 5755
116 Ga0157370_10033329 3300013104 Bacteria 5022
117 Ga0157370_10039334 3300013104 Bacteria 4571
118 Ga0157370_10097823 3300013104 Bacteria 2753
119 Ga0157370_10106817 3300013104 Bacteria 2619
120 Ga0157370_10152975 3300013104 Bacteria 2146
121 Ga0157370_10334484 3300013104 Bacteria 1396
122 Ga0157369_10008746 3300013105 Bacteria 11597
123 Ga0157369_10110064 3300013105 Bacteria 2928
124 Ga0157369_10114806 3300013105 Bacteria 2860
125 Ga0157369_10138003 3300013105 Bacteria 2581
126 Ga0157369_10416175 3300013105 Bacteria 1393
127 Ga0163162_10004856 3300013306 Bacteria 12973
128 Ga0163162_10099591 3300013306 Bacteria 2997
129 Ga0163162_10276536 3300013306 Bacteria 1811
130 Ga0157372_10000598 3300013307 Bacteria 39369
131 Ga0157372_10033779 3300013307 Bacteria 5620
132 Ga0157375_10140116 3300013308 Bacteria 2545
133 Ga0182008_10000863 3300014497 Bacteria 21045
134 Ga0182008_10003335 3300014497 Bacteria 9752
135 Ga0182008_10006493 3300014497 Bacteria 6531
136 Ga0182008_10012581 3300014497 Bacteria 4466
137 Ga0182008_10029468 3300014497 Bacteria 2774
138 Ga0182008_10031668 3300014497 Bacteria 2661
139 Ga0182008_10033884 3300014497 Bacteria 2562
140 Ga0182008_10034069 3300014497 Bacteria 2554
141 Ga0182008_10050435 3300014497 Bacteria 2066
142 Ga0182006_1001275 3300015261 Bacteria 15527
143 Ga0182006_1003543 3300015261 Bacteria 7963
144 Ga0182006_1005016 3300015261 Bacteria 6372
145 Ga0182006_1017180 3300015261 Bacteria 3078
146 Ga0182006_1021827 3300015261 Bacteria 2666
147 Ga0182006_1024824 3300015261 Bacteria 2468
148 Ga0182006_1056943 3300015261 Bacteria 1487
149 Ga0182007_10000143 3300015262 Bacteria 47807
150 Ga0182007_10015397 3300015262 Bacteria 2854
151 Ga0182007_10020582 3300015262 Bacteria 2356
152 Ga0182005_1002054 3300015265 Bacteria 7536
153 Ga0182005_1035369 3300015265 Bacteria 1358
154 Ga0163161_10001895 3300017792 Bacteria 15278
155 Ga0163161_10020484 3300017792 Bacteria 4641
156 Ga0163161_10022776 3300017792 Bacteria 4413
157 Ga0163161_10036567 3300017792 Bacteria 3516
158 Ga0163161_10054038 3300017792 Bacteria 2914
159 Ga0163161_10058360 3300017792 Bacteria 2805
160 Ga0163161_10063125 3300017792 Bacteria 2700
161 Ga0163161_10077666 3300017792 Bacteria 2439
162 Ga0163161_10106450 3300017792 Bacteria 2093
163 Ga0163161_10226051 3300017792 Bacteria 1451
164 Ga0163161_10245451 3300017792 Bacteria 1394
165 Ga0209435_100837 3300025206 Bacteria 4839
166 Ga0209760_100039 3300025207 Bacteria 118977
167 Ga0209784_100015 3300025224 Bacteria 482117
168 Ga0209566_100012 3300025225 Bacteria 482281
169 Ga0209674_100027 3300025226 Bacteria 482281
170 Ga0209147_100019 3300025229 Bacteria 482139
171 Ga0209563_100031 3300025230 Bacteria 482281
172 Ga0209563_100630 3300025230 Bacteria 11381
173 Ga0207427_100001 3300025231 Bacteria 1410763
174 Ga0209437_100003 3300025233 Bacteria 1517827
175 Ga0209437_103617 3300025233 Bacteria 2774
176 Ga0209258_100381 3300025242 Bacteria 56739
177 Ga0209646_1000344 3300025246 Bacteria 34445
178 Ga0209677_100016 3300025253 Bacteria 482117
179 Ga0209233_1000007 3300025261 Bacteria 1411234
180 Ga0209675_1009404 3300025291 Bacteria 3457
181 Ga0209676_1000016 3300025292 Bacteria 655561
182 Ga0209676_1000021 3300025292 Bacteria 609534
183 Ga0209676_1000033 3300025292 Bacteria 463236
184 Ga0209676_1000532 3300025292 Bacteria 59471
185 Ga0209676_1011310 3300025292 Bacteria 3613
186 Ga0209050_1000009 3300025298 Bacteria 1047265
187 Ga0209050_1000036 3300025298 Bacteria 423070
188 Ga0209050_1000107 3300025298 Bacteria 223303
189 Ga0209050_1019088 3300025298 Bacteria 2626
190 Ga0209051_1000043 3300025303 Bacteria 305473
191 Ga0209051_1000053 3300025303 Bacteria 281564
192 Ga0209051_1000090 3300025303 Bacteria 173748
193 Ga0209051_1003100 3300025303 Bacteria 11211
194 Ga0209257_1000098 3300025304 Bacteria 256390
195 Ga0209257_1011864 3300025304 Bacteria 4121
196 Ga0207656_10000075 3300025321 Bacteria 36715
197 Ga0207696_1000010 3300025711 Bacteria 534681
198 Ga0207696_1000063 3300025711 Bacteria 239123
199 Ga0207696_1000158 3300025711 Bacteria 112178
200 Ga0207696_1002599 3300025711 Bacteria 8757
201 Ga0207696_1004643 3300025711 Bacteria 5879
202 Ga0207696_1006768 3300025711 Bacteria 4571
203 Ga0207696_1010018 3300025711 Bacteria 3498
204 Ga0207696_1013851 3300025711 Bacteria 2786
205 Ga0207696_1028596 3300025711 Bacteria 1709
206 Ga0207696_1035733 3300025711 Bacteria 1478
207 Ga0207655_1000019 3300025728 Bacteria 536324
208 Ga0207655_1000151 3300025728 Bacteria 127538
209 Ga0207655_1000197 3300025728 Bacteria 106282
210 Ga0207655_1000250 3300025728 Bacteria 86806
211 Ga0207655_1001272 3300025728 Bacteria 24073
212 Ga0207655_1005501 3300025728 Bacteria 8598
213 Ga0207655_1009222 3300025728 Bacteria 6155
214 Ga0207655_1009805 3300025728 Bacteria 5902
215 Ga0207655_1014540 3300025728 Bacteria 4442
216 Ga0207655_1015788 3300025728 Bacteria 4174
217 Ga0207655_1035764 3300025728 Bacteria 2212
218 Ga0207655_1036484 3300025728 Bacteria 2178
219 Ga0207655_1041047 3300025728 Bacteria 1987
220 Ga0207713_1000380 3300025735 Bacteria 48035
221 Ga0207713_1000882 3300025735 Bacteria 27343
222 Ga0207713_1001994 3300025735 Bacteria 15348
223 Ga0207713_1001997 3300025735 Bacteria 15333
224 Ga0207713_1005079 3300025735 Bacteria 8353
225 Ga0207713_1006442 3300025735 Bacteria 7148
226 Ga0207713_1011564 3300025735 Bacteria 4785
227 Ga0207713_1012122 3300025735 Bacteria 4634
228 Ga0207713_1023540 3300025735 Bacteria 2896
229 Ga0207713_1049961 3300025735 Bacteria 1673
230 Ga0207713_1051667 3300025735 Bacteria 1632
231 Ga0207671_10000566 3300025914 Bacteria 49574
232 Ga0207649_10000002 3300025920 Bacteria 498633
233 Ga0207681_10003012 3300025923 Bacteria 10586
234 Ga0207650_10000742 3300025925 Bacteria 25165
235 Ga0207706_10000903 3300025933 Bacteria 30514
236 Ga0207706_10026289 3300025933 Bacteria 5209
237 Ga0207686_10032576 3300025934 Bacteria 3103
238 Ga0207709_10000036 3300025935 Bacteria 292568
239 Ga0207709_10000350 3300025935 Bacteria 47371
240 Ga0207709_10009838 3300025935 Bacteria 5267
241 Ga0207709_10111584 3300025935 Bacteria 1829
242 Ga0207679_10000006 3300025945 Bacteria 498868
243 Ga0207712_10103808 3300025961 Bacteria 2118
244 Ga0207639_10036851 3300026041 Bacteria 3628
245 Ga0209281_1000172 3300027111 Bacteria 151766
246 Ga0209281_1000271 3300027111 Bacteria 100141
247 Ga0209281_1003274 3300027111 Bacteria 5485
248 Ga0209389_1000063 3300027296 Bacteria 102403
249 Ga0209371_1000576 3300027312 Bacteria 33041
250 Ga0207428_10042336 3300027907 Bacteria 3683
251 Ga0207428_10105134 3300027907 Bacteria 2178
252 Ga0207428_10201260 3300027907 Bacteria 1498
253 Ga0268266_10006047 3300028379 Bacteria 11154
254 Ga0268256_1000503 3300030500 Bacteria 33041
255 Ga0307511_10038488 3300030521 Bacteria 4105
256 Ga0316177_1050534 3300030731 Bacteria 2819
257 Ga0316179_1078275 3300030734 Bacteria 3890
258 Ga0316178_1161793 3300030735 Bacteria 38251
259 Ga0316183_1015099 3300030742 Bacteria 4141
260 Ga0307408_100011056 3300031548 Bacteria 5958
261 Ga0307408_100020260 3300031548 Bacteria 4486
262 Ga0307408_100028563 3300031548 Bacteria 3855
263 Ga0307408_100127976 3300031548 Bacteria 1977
264 Ga0307408_100137461 3300031548 Bacteria 1913
265 Ga0307405_10015580 3300031731 Bacteria 4122
266 Ga0307405_10020411 3300031731 Bacteria 3701
267 Ga0307405_10035186 3300031731 Bacteria 2988
268 Ga0307405_10047546 3300031731 Bacteria 2642
269 Ga0307413_10206950 3300031824 Bacteria 1421
270 Ga0307406_10054623 3300031901 Bacteria 2549
271 Ga0307406_10177528 3300031901 Bacteria 1547
272 Ga0307412_10004978 3300031911 Bacteria 7425
273 Ga0307412_10010098 3300031911 Bacteria 5430
274 Ga0307412_10011635 3300031911 Bacteria 5101
275 Ga0307412_10070663 3300031911 Bacteria 2380
276 Ga0307412_10136679 3300031911 Bacteria 1789
277 Ga0307412_10342345 3300031911 Bacteria 1197
278 Ga0307409_100308695 3300031995 Bacteria 1475
279 Ga0307414_10010683 3300032004 Bacteria 5344
280 Ga0307414_10080054 3300032004 Bacteria 2387
281 Ga0307414_10167106 3300032004 Bacteria 1754
282 Ga0307411_10004175 3300032005 Bacteria 6866
283 Ga0307411_10061013 3300032005 Bacteria 2507
284 Ga0307510_10080780 3300033180 Bacteria 3159
285 Ga0237819_01651 3300038705 Bacteria 5481
286 Ga0439438_003063 3300041405 Bacteria 6875
287 Ga0439438_004123 3300041405 Bacteria 5675
288 Ga0439438_004424 3300041405 Bacteria 5397
289 Ga0439438_004842 3300041405 Bacteria 5066
290 Ga0439438_007724 3300041405 Bacteria 3642
291 Ga0439438_008159 3300041405 Bacteria 3502
292 Ga0439438_010286 3300041405 Bacteria 2965
293 Ga0439438_010599 3300041405 Bacteria 2905
294 Ga0439447_002909 3300041407 Bacteria 6128
295 Ga0439447_004126 3300041407 Bacteria 5053
296 Ga0439447_010213 3300041407 Bacteria 2797
297 Ga0439447_010268 3300041407 Bacteria 2787
298 Ga0439447_013779 3300041407 Bacteria 2285
299 Ga0439447_014464 3300041407 Bacteria 2213
300 Ga0439447_025490 3300041407 Bacteria 1523
301 Ga0439466_0001263 3300041411 Bacteria 9829
302 Ga0439466_0002304 3300041411 Bacteria 7490
303 Ga0439466_0011798 3300041411 Bacteria 3226
304 Ga0439466_0011884 3300041411 Bacteria 3215
305 Ga0439466_0048523 3300041411 Bacteria 1396
306 Ga0439465_0006145 3300041413 Bacteria 3819
307 Ga0439431_0015133 3300041997 Bacteria 1793
308 Ga0439445_0017603 3300042004 Bacteria 1767
309 Ga0439432_001052 3300042006 Bacteria 10485
310 Ga0439432_001239 3300042006 Bacteria 9653
311 Ga0439432_013331 3300042006 Bacteria 2797
312 Ga0439432_013845 3300042006 Bacteria 2735
313 Ga0439432_024392 3300042006 Bacteria 1988
314 Ga0439432_053368 3300042006 Bacteria 1257
315 Ga0439451_001638 3300042009 Bacteria 4446
316 Ga0439451_007465 3300042009 Bacteria 2228
317 Ga0439451_011741 3300042009 Bacteria 1766
318 Ga0439452_000503 3300042010 Bacteria 21254
319 Ga0439452_000725 3300042010 Bacteria 15973
320 Ga0439452_001131 3300042010 Bacteria 11656
321 Ga0439452_009692 3300042010 Bacteria 2829
322 Ga0439456_000271 3300042013 Bacteria 12605
323 Ga0439456_002594 3300042013 Bacteria 3639
324 Ga0439456_011225 3300042013 Bacteria 1851
325 Ga0439456_021475 3300042013 Bacteria 1366
326 Ga0439463_000376 3300042016 Bacteria 12350
327 Ga0450911_000556 3300042115 Bacteria 11582
328 Ga0450911_001193 3300042115 Bacteria 6338
329 Ga0450911_006325 3300042115 Bacteria 1772
330 Ga0450919_000614 3300042121 Bacteria 4509
331 Ga0450920_007247 3300042122 Bacteria 2008
332 Ga0450922_000514 3300042124 Bacteria 4107
333 Ga0450922_002582 3300042124 Bacteria 1695
334 Ga0450890_000186 3300042127 Bacteria 9401
335 Ga0450898_010644 3300042134 Bacteria 1493
336 Ga0450899_005350 3300042135 Bacteria 1378
337 Ga0450900_002786 3300042136 Bacteria 1885
338 Ga0450902_001984 3300042137 Bacteria 2862
339 Ga0450902_003594 3300042137 Bacteria 2276
340 Ga0450902_005568 3300042137 Bacteria 1908
341 Ga0450903_001216 3300042138 Bacteria 4841
342 Ga0450903_002098 3300042138 Bacteria 3585
343 Ga0450905_000029 3300042142 Bacteria 11982
344 Ga0450905_004857 3300042142 Bacteria 1795
345 Ga0450907_000132 3300042146 Bacteria 28311
346 Ga0450907_002076 3300042146 Bacteria 3972
347 Ga0450907_003696 3300042146 Bacteria 2693
348 Ga0450910_000124 3300042147 Bacteria 8173
349 Ga0439446_0008405 3300042156 Bacteria 2739
350 Ga0450908_005178 3300042184 Bacteria 2500
351 Ga0450909_002104 3300042185 Bacteria 2810
352 Ga0439434_0000469 3300042435 Bacteria 11490
353 Ga0439464_0001884 3300042439 Bacteria 5070
354 Ga0439460_0001104 3300042461 Bacteria 6297
355 Ga0439460_0005590 3300042461 Bacteria 3091
356 Ga0439460_0015732 3300042461 Bacteria 2006
357 Ga0450918_006823 3300042531 Bacteria 2029
358 Ga0450918_007755 3300042531 Bacteria 1893
359 Ga0450893_0005323 3300042532 Bacteria 2065
360 Ga0450893_0006099 3300042532 Bacteria 1945
361 Ga0450901_001003 3300042533 Bacteria 3277
362 Ga0439440_0003112 3300042993 Bacteria 3173
363 Ga0495617_000327 3300046452 Bacteria 26705
364 Ga0495617_007544 3300046452 Bacteria 3772
365 Ga0495617_007874 3300046452 Bacteria 3686
366 Ga0495617_008135 3300046452 Bacteria 3624
367 Ga0495617_013419 3300046452 Bacteria 2788
368 Ga0495617_034397 3300046452 Bacteria 1701
369 Ga0495617_035578 3300046452 Bacteria 1672
370 Ga0495617_063456 3300046452 Bacteria 1220
371 Ga0495627_000040 3300046453 Bacteria 195248
372 Ga0495627_001088 3300046453 Bacteria 17809
373 Ga0495627_001530 3300046453 Bacteria 13262
374 Ga0495627_002082 3300046453 Bacteria 10187
375 Ga0495627_002418 3300046453 Bacteria 9016
376 Ga0495627_019177 3300046453 Bacteria 2298
377 Ga0495627_027563 3300046453 Bacteria 1821
378 Ga0495627_034930 3300046453 Bacteria 1568
379 Ga0495627_046484 3300046453 Bacteria 1318
380 Ga0495603_0093853 3300046455 Bacteria 1753
381 Ga0495590_0018607 3300046457 Bacteria 2485
382 Ga0495590_0022982 3300046457 Bacteria 2203
383 Ga0495590_0040802 3300046457 Bacteria 1618
384 Ga0495590_0063481 3300046457 Bacteria 1292
385 Ga0495591_000232 3300046458 Bacteria 54458
386 Ga0495591_002090 3300046458 Bacteria 11503
387 Ga0495591_004045 3300046458 Bacteria 7325
388 Ga0495591_005488 3300046458 Bacteria 5861
389 Ga0495591_009586 3300046458 Bacteria 3831
390 Ga0495591_011334 3300046458 Bacteria 3383
391 Ga0495591_014750 3300046458 Bacteria 2790
392 Ga0495591_020147 3300046458 Bacteria 2211
393 Ga0495591_022755 3300046458 Bacteria 2020
394 Ga0495591_024718 3300046458 Bacteria 1898
395 Ga0495591_028244 3300046458 Bacteria 1718
396 Ga0495591_030373 3300046458 Bacteria 1631
397 Ga0495638_0001278 3300046460 Bacteria 23475
398 Ga0495638_0001733 3300046460 Bacteria 19207
399 Ga0495638_0003235 3300046460 Bacteria 12878
400 Ga0495638_0007902 3300046460 Bacteria 7587
401 Ga0495638_0016807 3300046460 Bacteria 4892
402 Ga0495638_0032805 3300046460 Bacteria 3324
403 Ga0495638_0039275 3300046460 Bacteria 3005
404 Ga0495638_0039406 3300046460 Bacteria 2999
405 Ga0495638_0043708 3300046460 Bacteria 2825
406 Ga0495638_0053634 3300046460 Bacteria 2509
407 Ga0495638_0072609 3300046460 Bacteria 2102
408 Ga0495638_0136818 3300046460 Bacteria 1433
409 Ga0495653_0003427 3300046463 Bacteria 12755
410 Ga0495653_0061150 3300046463 Bacteria 2850
411 Ga0495653_0108837 3300046463 Bacteria 1995
412 Ga0495650_0000620 3300046471 Bacteria 48027
413 Ga0495650_0003352 3300046471 Bacteria 11756
414 Ga0495650_0003804 3300046471 Bacteria 10743
415 Ga0495650_0009633 3300046471 Bacteria 5476
416 Ga0495650_0018018 3300046471 Bacteria 3521
417 Ga0495650_0019745 3300046471 Bacteria 3305
418 Ga0495650_0021006 3300046471 Bacteria 3167
419 Ga0495650_0028854 3300046471 Bacteria 2537
420 Ga0495650_0032030 3300046471 Bacteria 2356
421 Ga0495650_0041544 3300046471 Bacteria 1965
422 Ga0495650_0053585 3300046471 Bacteria 1651
423 Ga0495582_0032844 3300046473 Bacteria 2852
424 Ga0495605_0000011 3300046474 Bacteria 314856
425 Ga0495605_0004680 3300046474 Bacteria 7999
426 Ga0495605_0006308 3300046474 Bacteria 6834
427 Ga0495605_0019149 3300046474 Bacteria 3661
428 Ga0495605_0031595 3300046474 Bacteria 2703
429 Ga0495605_0041700 3300046474 Bacteria 2285
430 Ga0495605_0045198 3300046474 Bacteria 2172
431 Ga0495605_0057322 3300046474 Bacteria 1875
432 Ga0495605_0064398 3300046474 Bacteria 1746
433 Ga0495639_0000714 3300046475 Bacteria 15193
434 Ga0495639_0007670 3300046475 Bacteria 4643
435 Ga0495639_0022907 3300046475 Bacteria 2742
436 Ga0495664_0143103 3300046477 Bacteria 1450
437 Ga0495584_0000733 3300046491 Bacteria 21643
438 Ga0495584_0001356 3300046491 Bacteria 14814
439 Ga0495584_0004349 3300046491 Bacteria 7629
440 Ga0495584_0004438 3300046491 Bacteria 7549
441 Ga0495584_0020003 3300046491 Bacteria 3400
442 Ga0495584_0024123 3300046491 Bacteria 3083
443 Ga0495584_0041935 3300046491 Bacteria 2310
444 Ga0495584_0051925 3300046491 Bacteria 2063
445 Ga0495584_0064320 3300046491 Bacteria 1844
446 Ga0495584_0067625 3300046491 Bacteria 1795
447 Ga0495584_0071595 3300046491 Bacteria 1742
448 Ga0495584_0087044 3300046491 Bacteria 1574
449 Ga0495585_0000376 3300046492 Bacteria 42971
450 Ga0495585_0001401 3300046492 Bacteria 18994
451 Ga0495585_0002451 3300046492 Bacteria 13282
452 Ga0495585_0004975 3300046492 Bacteria 8498
453 Ga0495585_0009335 3300046492 Bacteria 5889
454 Ga0495585_0017146 3300046492 Bacteria 4189
455 Ga0495585_0022896 3300046492 Bacteria 3585
456 Ga0495585_0027527 3300046492 Bacteria 3244
457 Ga0495585_0032590 3300046492 Bacteria 2951
458 Ga0495585_0049406 3300046492 Bacteria 2335
459 Ga0495585_0098129 3300046492 Bacteria 1570
460 Ga0495594_0003631 3300046499 Bacteria 7933
461 Ga0495594_0006659 3300046499 Bacteria 5946
462 Ga0495594_0017044 3300046499 Bacteria 3834
463 Ga0495594_0036640 3300046499 Bacteria 2675
464 Ga0495594_0090479 3300046499 Bacteria 1715
465 Ga0495596_0000597 3300046500 Bacteria 22660
466 Ga0495596_0032707 3300046500 Bacteria 2072
467 Ga0495607_0000349 3300046501 Bacteria 47780
468 Ga0495607_0001009 3300046501 Bacteria 25910
469 Ga0495607_0002511 3300046501 Bacteria 14867
470 Ga0495607_0005314 3300046501 Bacteria 9260
471 Ga0495607_0006278 3300046501 Bacteria 8378
472 Ga0495607_0008011 3300046501 Bacteria 7258
473 Ga0495607_0009933 3300046501 Bacteria 6408
474 Ga0495607_0021862 3300046501 Bacteria 4022
475 Ga0495607_0024767 3300046501 Bacteria 3737
476 Ga0495607_0033217 3300046501 Bacteria 3140
477 Ga0495607_0050009 3300046501 Bacteria 2435
478 Ga0495607_0057633 3300046501 Bacteria 2225
479 Ga0495607_0067430 3300046501 Bacteria 2010
480 Ga0495607_0109417 3300046501 Bacteria 1467
481 Ga0495607_0150109 3300046501 Bacteria 1193
482 Ga0495583_0000047 3300046506 Bacteria 217720
483 Ga0495583_0001432 3300046506 Bacteria 24231
484 Ga0495583_0006317 3300046506 Bacteria 7780
485 Ga0495583_0013044 3300046506 Bacteria 4664
486 Ga0495583_0017557 3300046506 Bacteria 3794
487 Ga0495583_0024957 3300046506 Bacteria 2994
488 Ga0495583_0025371 3300046506 Bacteria 2961
489 Ga0495583_0032503 3300046506 Bacteria 2518
490 Ga0495606_0001195 3300046507 Bacteria 36567
491 Ga0495606_0004689 3300046507 Bacteria 13510
492 Ga0495606_0008803 3300046507 Bacteria 8665
493 Ga0495606_0020545 3300046507 Bacteria 4864
494 Ga0495606_0035400 3300046507 Bacteria 3412
495 Ga0495606_0042245 3300046507 Bacteria 3050
496 Ga0495606_0045550 3300046507 Bacteria 2905
497 Ga0495606_0062943 3300046507 Bacteria 2366
498 Ga0495606_0100675 3300046507 Bacteria 1759
499 Ga0495610_0001544 3300046512 Bacteria 20283
500 Ga0495610_0010879 3300046512 Bacteria 5614
501 Ga0495610_0012081 3300046512 Bacteria 5222
502 Ga0495610_0015944 3300046512 Bacteria 4345
503 Ga0495610_0016333 3300046512 Bacteria 4279
504 Ga0495610_0016615 3300046512 Bacteria 4227
505 Ga0495610_0017950 3300046512 Bacteria 4013
506 Ga0495610_0018259 3300046512 Bacteria 3966
507 Ga0495610_0025843 3300046512 Bacteria 3144
508 Ga0495610_0029057 3300046512 Bacteria 2916
509 Ga0495610_0034270 3300046512 Bacteria 2616
510 Ga0495610_0039474 3300046512 Bacteria 2387
511 Ga0495610_0040082 3300046512 Bacteria 2363
512 Ga0495610_0044321 3300046512 Bacteria 2208
513 Ga0495610_0050340 3300046512 Bacteria 2034
514 Ga0495610_0059085 3300046512 Bacteria 1831
515 Ga0495616_0002009 3300046513 Bacteria 13690
516 Ga0495616_0002585 3300046513 Bacteria 11920
517 Ga0495616_0003866 3300046513 Bacteria 9545
518 Ga0495616_0004161 3300046513 Bacteria 9170
519 Ga0495616_0014930 3300046513 Bacteria 4333
520 Ga0495616_0029487 3300046513 Bacteria 2896
521 Ga0495616_0032457 3300046513 Bacteria 2727
522 Ga0495616_0042164 3300046513 Bacteria 2324
523 Ga0495620_0000002 3300046515 Bacteria 373737
524 Ga0495620_0000225 3300046515 Bacteria 42537
525 Ga0495620_0001337 3300046515 Bacteria 14977
526 Ga0495620_0002160 3300046515 Bacteria 11430
527 Ga0495620_0003662 3300046515 Bacteria 8772
528 Ga0495620_0004065 3300046515 Bacteria 8298
529 Ga0495620_0004722 3300046515 Bacteria 7656
530 Ga0495620_0004859 3300046515 Bacteria 7538
531 Ga0495630_0001621 3300046517 Bacteria 15640
532 Ga0495630_0073954 3300046517 Bacteria 2566
533 Ga0495630_0105657 3300046517 Bacteria 2132
534 Ga0495630_0115477 3300046517 Bacteria 2034
535 Ga0495631_0000280 3300046518 Bacteria 35558
536 Ga0495631_0014162 3300046518 Bacteria 3854
537 Ga0495631_0014537 3300046518 Bacteria 3796
538 Ga0495631_0020511 3300046518 Bacteria 3088
539 Ga0495631_0050474 3300046518 Bacteria 1819
540 Ga0495631_0071067 3300046518 Bacteria 1504
541 Ga0495632_0000215 3300046519 Bacteria 58392
542 Ga0495632_0002507 3300046519 Bacteria 13918
543 Ga0495632_0004158 3300046519 Bacteria 9921
544 Ga0495632_0004287 3300046519 Bacteria 9736
545 Ga0495632_0004931 3300046519 Bacteria 8949
546 Ga0495632_0012843 3300046519 Bacteria 4804
547 Ga0495632_0017873 3300046519 Bacteria 3901
548 Ga0495632_0019958 3300046519 Bacteria 3640
549 Ga0495632_0021504 3300046519 Bacteria 3475
550 Ga0495632_0023780 3300046519 Bacteria 3266
551 Ga0495632_0025528 3300046519 Bacteria 3123
552 Ga0495632_0064390 3300046519 Bacteria 1773
553 Ga0495637_0000630 3300046520 Bacteria 24850
554 Ga0495637_0000871 3300046520 Bacteria 19649
555 Ga0495637_0001699 3300046520 Bacteria 12710
556 Ga0495637_0005266 3300046520 Bacteria 6619
557 Ga0495637_0013339 3300046520 Bacteria 3900
558 Ga0495637_0013341 3300046520 Bacteria 3900
559 Ga0495637_0015994 3300046520 Bacteria 3513
560 Ga0495637_0016726 3300046520 Bacteria 3426
561 Ga0495637_0026158 3300046520 Bacteria 2623
562 Ga0495637_0030335 3300046520 Bacteria 2399
563 Ga0495637_0031521 3300046520 Bacteria 2344
564 Ga0495637_0042147 3300046520 Bacteria 1954
565 Ga0495637_0043340 3300046520 Bacteria 1921
566 Ga0495643_0000303 3300046522 Bacteria 68802
567 Ga0495643_0002672 3300046522 Bacteria 13791
568 Ga0495643_0003509 3300046522 Bacteria 11416
569 Ga0495643_0015736 3300046522 Bacteria 4461
570 Ga0495643_0016385 3300046522 Bacteria 4352
571 Ga0495643_0025996 3300046522 Bacteria 3308
572 Ga0495643_0026415 3300046522 Bacteria 3277
573 Ga0495643_0117827 3300046522 Bacteria 1344
574 Ga0495644_0002507 3300046523 Bacteria 7324
575 Ga0495644_0002520 3300046523 Bacteria 7306
576 Ga0495644_0006504 3300046523 Bacteria 4525
577 Ga0495644_0015259 3300046523 Bacteria 2942
578 Ga0495644_0021597 3300046523 Bacteria 2455
579 Ga0495644_0031138 3300046523 Bacteria 2015
580 Ga0495648_0000521 3300046524 Bacteria 41448
581 Ga0495648_0001868 3300046524 Bacteria 20138
582 Ga0495648_0002196 3300046524 Bacteria 18284
583 Ga0495648_0018563 3300046524 Bacteria 4918
584 Ga0495648_0025968 3300046524 Bacteria 3954
585 Ga0495648_0044527 3300046524 Bacteria 2769
586 Ga0495648_0045100 3300046524 Bacteria 2745
587 Ga0495648_0049359 3300046524 Bacteria 2580
588 Ga0495648_0076690 3300046524 Bacteria 1918
589 Ga0495648_0086476 3300046524 Bacteria 1768
590 Ga0495648_0138334 3300046524 Bacteria 1285
591 Ga0495648_0138876 3300046524 Bacteria 1281
592 Ga0495648_0138881 3300046524 Bacteria 1281
593 Ga0495648_0151883 3300046524 Bacteria 1207
594 Ga0495666_0006061 3300046526 Bacteria 6090
595 Ga0495666_0028391 3300046526 Bacteria 2752
596 Ga0495666_0040403 3300046526 Bacteria 2262
597 Ga0495642_0000027 3300046528 Bacteria 89620
598 Ga0495642_0001462 3300046528 Bacteria 10574
599 Ga0495642_0003766 3300046528 Bacteria 5936
600 Ga0495654_0000096 3300046530 Bacteria 99777
601 Ga0495654_0002752 3300046530 Bacteria 11090
602 Ga0495654_0003864 3300046530 Bacteria 9046
603 Ga0495654_0005166 3300046530 Bacteria 7614
604 Ga0495654_0006125 3300046530 Bacteria 6886
605 Ga0495654_0008426 3300046530 Bacteria 5697
606 Ga0495654_0009678 3300046530 Bacteria 5278
607 Ga0495654_0010751 3300046530 Bacteria 4971
608 Ga0495654_0011226 3300046530 Bacteria 4857
609 Ga0495654_0013108 3300046530 Bacteria 4440
610 Ga0495654_0015333 3300046530 Bacteria 4071
611 Ga0495654_0028011 3300046530 Bacteria 2883
612 Ga0495654_0029064 3300046530 Bacteria 2821
613 Ga0495654_0035397 3300046530 Bacteria 2514
614 Ga0495654_0043786 3300046530 Bacteria 2217
615 Ga0495654_0048813 3300046530 Bacteria 2075
616 Ga0495654_0052083 3300046530 Bacteria 1995
617 Ga0495654_0058245 3300046530 Bacteria 1864
618 Ga0495654_0063942 3300046530 Bacteria 1760
619 Ga0495654_0081285 3300046530 Bacteria 1519
620 Ga0495654_0083604 3300046530 Bacteria 1492
621 Ga0495654_0085782 3300046530 Bacteria 1468
622 Ga0495586_0011665 3300046535 Bacteria 4675
623 Ga0495587_0001493 3300046536 Bacteria 15596
624 Ga0495587_0011869 3300046536 Bacteria 5506
625 Ga0495609_0000004 3300046538 Bacteria 697346
626 Ga0495609_0000079 3300046538 Bacteria 118997
627 Ga0495609_0000360 3300046538 Bacteria 39526
628 Ga0495609_0001254 3300046538 Bacteria 17456
629 Ga0495609_0003270 3300046538 Bacteria 9357
630 Ga0495609_0005619 3300046538 Bacteria 6538
631 Ga0495609_0008683 3300046538 Bacteria 4955
632 Ga0495609_0022256 3300046538 Bacteria 2920
633 Ga0495609_0022419 3300046538 Bacteria 2909
634 Ga0495609_0043418 3300046538 Bacteria 2018
635 Ga0495609_0044125 3300046538 Bacteria 2000
636 Ga0495597_0001669 3300046542 Bacteria 15445
637 Ga0495597_0011466 3300046542 Bacteria 4296
638 Ga0495597_0011624 3300046542 Bacteria 4264
639 Ga0495597_0011634 3300046542 Bacteria 4262
640 Ga0495597_0026156 3300046542 Bacteria 2681
641 Ga0495597_0026339 3300046542 Bacteria 2671
642 Ga0495597_0036370 3300046542 Bacteria 2217
643 Ga0495597_0036815 3300046542 Bacteria 2200
644 Ga0495597_0038287 3300046542 Bacteria 2149
645 Ga0495645_0141105 3300046543 Bacteria 1680
646 Ga0495622_0000809 3300046557 Bacteria 17316
647 Ga0495622_0001364 3300046557 Bacteria 12491
648 Ga0495622_0002770 3300046557 Bacteria 8374
649 Ga0495622_0029990 3300046557 Bacteria 2541
650 Ga0495622_0042043 3300046557 Bacteria 2125
651 Ga0495622_0052666 3300046557 Bacteria 1888
652 Ga0495622_0112533 3300046557 Bacteria 1246
653 Ga0495633_0000206 3300046558 Bacteria 74675
654 Ga0495633_0006362 3300046558 Bacteria 7018
655 Ga0495633_0023386 3300046558 Bacteria 3063
656 Ga0495633_0065661 3300046558 Bacteria 1695
657 Ga0495633_0082593 3300046558 Bacteria 1495
658 Ga0495656_0060819 3300046615 Bacteria 1647
659 Ga0495656_0115997 3300046615 Bacteria 1258
660 Ga0495668_0001701 3300046616 Bacteria 20338
661 Ga0495668_0003203 3300046616 Bacteria 12520
662 Ga0495668_0028596 3300046616 Bacteria 3152
663 Ga0495668_0033494 3300046616 Bacteria 2886
664 Ga0495668_0044190 3300046616 Bacteria 2476
665 Ga0495634_0000967 3300046642 Bacteria 27121
666 Ga0495611_0000594 3300046648 Bacteria 20905
667 Ga0495611_0000656 3300046648 Bacteria 19743
668 Ga0495611_0000770 3300046648 Bacteria 17962
669 Ga0495611_0016202 3300046648 Bacteria 3186
670 Ga0495611_0035498 3300046648 Bacteria 2209
671 Ga0495611_0055092 3300046648 Bacteria 1798
672 Ga0495625_0000076 3300046660 Bacteria 163580
673 Ga0495625_0004417 3300046660 Bacteria 13308
674 Ga0495625_0007516 3300046660 Bacteria 9469
675 Ga0495625_0016243 3300046660 Bacteria 5864
676 Ga0495625_0023825 3300046660 Bacteria 4671
677 Ga0495625_0050568 3300046660 Bacteria 2982
678 Ga0495625_0083892 3300046660 Bacteria 2214
679 Ga0495625_0145433 3300046660 Bacteria 1596
680 Ga0495635_0000752 3300046663 Bacteria 21018
681 Ga0495635_0001802 3300046663 Bacteria 14476
682 Ga0495659_0001347 3300046664 Bacteria 8436
683 Ga0495659_0004979 3300046664 Bacteria 4177
684 Ga0495659_0017477 3300046664 Bacteria 2377
685 Ga0495661_0000005 3300046665 Bacteria 433622
686 Ga0495661_0000099 3300046665 Bacteria 106462
687 Ga0495661_0000127 3300046665 Bacteria 92684
688 Ga0495661_0000146 3300046665 Bacteria 82292
689 Ga0495661_0000773 3300046665 Bacteria 30663
690 Ga0495661_0007011 3300046665 Bacteria 7878
691 Ga0495661_0039141 3300046665 Bacteria 2948
692 Ga0495661_0042222 3300046665 Bacteria 2812
693 Ga0495661_0097094 3300046665 Bacteria 1665
694 Ga0495661_0098029 3300046665 Bacteria 1655
695 Ga0495588_0004580 3300046674 Bacteria 6111
696 Ga0495588_0028030 3300046674 Bacteria 2817
697 Ga0495588_0028901 3300046674 Bacteria 2778
698 Ga0495588_0113369 3300046674 Bacteria 1428
699 Ga0495623_0001889 3300046679 Bacteria 14069
700 Ga0495623_0021455 3300046679 Bacteria 4170
701 Ga0495646_0005511 3300046680 Bacteria 8003
702 Ga0495646_0011937 3300046680 Bacteria 5525
703 Ga0495646_0042659 3300046680 Bacteria 2783
704 Ga0495669_0016103 3300046684 Bacteria 3201
705 Ga0495669_0034601 3300046684 Bacteria 2227
706 Ga0495613_0022420 3300046689 Bacteria 4706
707 Ga0495613_0040240 3300046689 Bacteria 3464
708 Ga0495613_0103158 3300046689 Bacteria 2059
709 Ga0495613_0228727 3300046689 Bacteria 1303
710 Ga0495624_0004783 3300046690 Bacteria 9847
711 Ga0495670_0001322 3300046691 Bacteria 12081
712 Ga0495670_0002495 3300046691 Bacteria 9090
713 Ga0495670_0003468 3300046691 Bacteria 7747
714 Ga0495670_0006604 3300046691 Bacteria 5703
715 Ga0495670_0039610 3300046691 Bacteria 2350
716 Ga0495671_0000908 3300046692 Bacteria 21076
717 Ga0495671_0003363 3300046692 Bacteria 9864
718 Ga0495671_0004322 3300046692 Bacteria 8540
719 Ga0495671_0010112 3300046692 Bacteria 5244
720 Ga0495671_0010611 3300046692 Bacteria 5094
721 Ga0495671_0014752 3300046692 Bacteria 4199
722 Ga0495671_0016273 3300046692 Bacteria 3974
723 Ga0495671_0020993 3300046692 Bacteria 3435
724 Ga0495671_0028218 3300046692 Bacteria 2893
725 Ga0495671_0038625 3300046692 Bacteria 2412
726 Ga0495671_0044861 3300046692 Bacteria 2215
727 Ga0495671_0054332 3300046692 Bacteria 1986
728 Ga0495671_0062466 3300046692 Bacteria 1835
729 Ga0495671_0090416 3300046692 Bacteria 1498
730 Ga0495671_0099551 3300046692 Bacteria 1421
731 Ga0495649_0003430 3300046694 Bacteria 10699
732 Ga0495649_0006888 3300046694 Bacteria 7033
733 Ga0495649_0010145 3300046694 Bacteria 5567
734 Ga0495649_0011489 3300046694 Bacteria 5190
735 Ga0495649_0023301 3300046694 Bacteria 3459
736 Ga0495649_0032213 3300046694 Bacteria 2888
737 Ga0495649_0045152 3300046694 Bacteria 2403
738 Ga0495649_0058418 3300046694 Bacteria 2078
739 Ga0495649_0067577 3300046694 Bacteria 1917
740 Ga0495649_0087866 3300046694 Bacteria 1658
741 Ga0495649_0134911 3300046694 Bacteria 1301
742 Ga0495589_0000194 3300046794 Bacteria 53082
743 Ga0495589_0000777 3300046794 Bacteria 20260
744 Ga0495589_0003301 3300046794 Bacteria 8755
745 Ga0495589_0007266 3300046794 Bacteria 5801
746 Ga0495589_0018660 3300046794 Bacteria 3556
747 Ga0495589_0022307 3300046794 Bacteria 3231
748 Ga0495589_0024274 3300046794 Bacteria 3082
749 Ga0495589_0027652 3300046794 Bacteria 2867
750 Ga0495589_0056830 3300046794 Bacteria 1925
751 Ga0495589_0073266 3300046794 Bacteria 1671
752 Ga0495589_0074064 3300046794 Bacteria 1661
753 Ga0495600_0007252 3300046809 Bacteria 6770
754 Ga0495600_0028848 3300046809 Bacteria 3591
755 Ga0495600_0036464 3300046809 Bacteria 3195
756 Ga0495660_0002363 3300046810 Bacteria 12059
757 Ga0495660_0003734 3300046810 Bacteria 9347
758 Ga0495660_0012950 3300046810 Bacteria 4835
759 Ga0495660_0020560 3300046810 Bacteria 3783
760 Ga0495660_0025858 3300046810 Bacteria 3331
761 Ga0495660_0028570 3300046810 Bacteria 3149
762 Ga0495660_0040404 3300046810 Bacteria 2585
763 Ga0495660_0055122 3300046810 Bacteria 2152
764 Ga0495660_0062743 3300046810 Bacteria 1991
765 Ga0495660_0071586 3300046810 Bacteria 1838
766 Ga0495660_0100401 3300046810 Bacteria 1490
767 Ga0495581_0015921 3300047315 Bacteria 4369
768 Ga0495581_0068343 3300047315 Bacteria 2054
769 Ga0495604_0033465 3300047317 Bacteria 4069
770 Ga0495604_0072913 3300047317 Bacteria 2593
771 Ga0495636_0000764 3300047318 Bacteria 11844
772 Ga0495636_0106463 3300047318 Bacteria 1230
773 Ga0495674_0005437 3300047319 Bacteria 12235
774 Ga0495672_0000952 3300047320 Bacteria 30191
775 Ga0495672_0001238 3300047320 Bacteria 25658
776 Ga0495672_0005100 3300047320 Bacteria 10485
777 Ga0495672_0005823 3300047320 Bacteria 9675
778 Ga0495672_0008463 3300047320 Bacteria 7588
779 Ga0495672_0043255 3300047320 Bacteria 2709
780 Ga0495672_0050193 3300047320 Bacteria 2464
781 Ga0495672_0055929 3300047320 Bacteria 2299
782 Ga0495672_0057269 3300047320 Bacteria 2264
783 Ga0495672_0057795 3300047320 Bacteria 2251
784 Ga0495672_0067620 3300047320 Bacteria 2034
785 Ga0495672_0073903 3300047320 Bacteria 1921
786 Ga0495672_0090339 3300047320 Bacteria 1683
787 Ga0495672_0118341 3300047320 Bacteria 1412
788 Ga0495676_0000016 3300047321 Bacteria 196310
789 Ga0495676_0002566 3300047321 Bacteria 16178
790 Ga0495676_0082399 3300047321 Bacteria 2435
791 Ga0495680_0004320 3300047322 Bacteria 13619
792 Ga0495680_0018000 3300047322 Bacteria 6011
793 Ga0495680_0056009 3300047322 Bacteria 3054
794 Ga0495683_0000031 3300047323 Bacteria 150363
795 Ga0495683_0000322 3300047323 Bacteria 40105
796 Ga0495683_0000902 3300047323 Bacteria 20949
797 Ga0495683_0004157 3300047323 Bacteria 8284
798 Ga0495683_0019630 3300047323 Bacteria 3487
799 Ga0495683_0125714 3300047323 Bacteria 1213
800 Ga0495687_006222 3300047443 Bacteria 7365
801 Ga0495687_020533 3300047443 Bacteria 3215
802 Ga0495675_0018128 3300047444 Bacteria 4464
803 Ga0495675_0063457 3300047444 Bacteria 2337
804 Ga0495675_0086791 3300047444 Bacteria 1966
805 Ga0495677_0003900 3300047445 Bacteria 5768
806 Ga0495679_000087 3300047446 Bacteria 85691
807 Ga0495679_000154 3300047446 Bacteria 61634
808 Ga0495679_012040 3300047446 Bacteria 3313
809 Ga0495679_014298 3300047446 Bacteria 2946
810 Ga0495679_014799 3300047446 Bacteria 2875
811 Ga0495679_016261 3300047446 Bacteria 2695
812 Ga0495679_018743 3300047446 Bacteria 2447
813 Ga0495685_019273 3300047447 Bacteria 2344
814 Ga0495673_0000704 3300047469 Bacteria 32460
815 Ga0495673_0001106 3300047469 Bacteria 23217
816 Ga0495673_0001933 3300047469 Bacteria 15387
817 Ga0495673_0002323 3300047469 Bacteria 13555
818 Ga0495673_0002388 3300047469 Bacteria 13276
819 Ga0495673_0004200 3300047469 Bacteria 9086
820 Ga0495673_0006307 3300047469 Bacteria 6988
821 Ga0495673_0011518 3300047469 Bacteria 4751
822 Ga0495673_0015126 3300047469 Bacteria 3986
823 Ga0495673_0015438 3300047469 Bacteria 3935
824 Ga0495673_0018836 3300047469 Bacteria 3471
825 Ga0495673_0022794 3300047469 Bacteria 3061
826 Ga0495673_0025050 3300047469 Bacteria 2871
827 Ga0495673_0030887 3300047469 Bacteria 2512
828 Ga0495673_0033711 3300047469 Bacteria 2373
829 Ga0495673_0036977 3300047469 Bacteria 2234
830 Ga0495673_0045850 3300047469 Bacteria 1940
831 Ga0495673_0046077 3300047469 Bacteria 1934
832 Ga0495673_0070511 3300047469 Bacteria 1471
833 Ga0495681_0001149 3300047470 Bacteria 20081
834 Ga0495681_0003041 3300047470 Bacteria 11788
835 Ga0495681_0003165 3300047470 Bacteria 11520
836 Ga0495681_0003188 3300047470 Bacteria 11445
837 Ga0495681_0003564 3300047470 Bacteria 10834
838 Ga0495681_0004680 3300047470 Bacteria 9276
839 Ga0495681_0005315 3300047470 Bacteria 8640
840 Ga0495681_0005862 3300047470 Bacteria 8159
841 Ga0495681_0013963 3300047470 Bacteria 4631
842 Ga0495681_0019405 3300047470 Bacteria 3713
843 Ga0495681_0023876 3300047470 Bacteria 3235
844 Ga0495681_0024143 3300047470 Bacteria 3212
845 Ga0495681_0027203 3300047470 Bacteria 2963
846 Ga0495681_0039999 3300047470 Bacteria 2286
847 Ga0495681_0040015 3300047470 Bacteria 2285
848 Ga0495681_0051887 3300047470 Bacteria 1927
849 Ga0495681_0081495 3300047470 Bacteria 1443
850 Ga0495684_0046103 3300047471 Bacteria 3335
851 Ga0495686_0002947 3300047472 Bacteria 15226
852 Ga0495686_0016378 3300047472 Bacteria 5027
853 Ga0495686_0018446 3300047472 Bacteria 4683
854 Ga0495686_0029408 3300047472 Bacteria 3574
855 Ga0495686_0095488 3300047472 Bacteria 1800
856 Ga0495686_0109163 3300047472 Bacteria 1661
857 Ga0495593_0028044 3300047673 Bacteria 3094
858 Ga0495593_0045035 3300047673 Bacteria 2356
859 Ga0495593_0084041 3300047673 Bacteria 1643
860 Ga0495602_0110889 3300048088 Bacteria 2229
861 Ga0495626_0000098 3300048091 Bacteria 113821
862 Ga0495626_0000230 3300048091 Bacteria 65859
863 Ga0495626_0000263 3300048091 Bacteria 59779
864 Ga0495626_0000577 3300048091 Bacteria 36311
865 Ga0495626_0001223 3300048091 Bacteria 21166
866 Ga0495626_0004178 3300048091 Bacteria 8957
867 Ga0495626_0004696 3300048091 Bacteria 8284
868 Ga0495626_0005042 3300048091 Bacteria 7881
869 Ga0495626_0006801 3300048091 Bacteria 6463
870 Ga0495626_0025224 3300048091 Bacteria 2908
871 Ga0495626_0066570 3300048091 Bacteria 1628
872 Ga0496102_0000991 3300048905 Bacteria 26693
873 Ga0496103_0000997 3300048906 Bacteria 19928
874 Ga0496106_0110942 3300048909 Bacteria 2135
875 Ga0496106_0152882 3300048909 Bacteria 1821
876 Ga0496110_0056893 3300048913 Bacteria 3441
877 Ga0496110_0241448 3300048913 Bacteria 1644
878 Ga0496116_0000085 3300048919 Bacteria 219553
879 Ga0496116_0002312 3300048919 Bacteria 20203
880 Ga0496116_0007971 3300048919 Bacteria 9278
881 Ga0496116_0010359 3300048919 Bacteria 7826
882 Ga0496116_0033598 3300048919 Bacteria 3637
883 Ga0496116_0045906 3300048919 Bacteria 2953
884 Ga0496116_0076728 3300048919 Bacteria 2092
885 Ga0496117_0001323 3300048920 Bacteria 36451
886 Ga0496117_0001620 3300048920 Bacteria 31800
887 Ga0496117_0003088 3300048920 Bacteria 19934
888 Ga0496117_0012255 3300048920 Bacteria 7580
889 Ga0496117_0018402 3300048920 Bacteria 5786
890 Ga0496117_0022061 3300048920 Bacteria 5118
891 Ga0496117_0024440 3300048920 Bacteria 4780
892 Ga0496117_0050277 3300048920 Bacteria 2956
893 Ga0496117_0077709 3300048920 Bacteria 2195
894 Ga0496117_0149519 3300048920 Bacteria 1384
895 Ga0496118_0002712 3300048921 Bacteria 23338
896 Ga0496118_0002985 3300048921 Bacteria 21881
897 Ga0496118_0008257 3300048921 Bacteria 10796
898 Ga0496118_0021501 3300048921 Bacteria 5674
899 Ga0496118_0052475 3300048921 Bacteria 3109
900 Ga0496118_0054134 3300048921 Bacteria 3042
901 Ga0496118_0065624 3300048921 Bacteria 2655
902 Ga0496118_0079460 3300048921 Bacteria 2314
903 Ga0496118_0083334 3300048921 Bacteria 2236
904 Ga0496118_0152586 3300048921 Bacteria 1443
905 Ga0496118_0156975 3300048921 Bacteria 1413
906 Ga0496119_0000612 3300048922 Bacteria 48284
907 Ga0496119_0063537 3300048922 Bacteria 2195
908 Ga0496119_0071589 3300048922 Bacteria 2029
909 Ga0496119_0082378 3300048922 Bacteria 1850
910 Ga0496119_0122838 3300048922 Bacteria 1425
911 Ga0496120_0001054 3300048923 Bacteria 36515
912 Ga0496120_0008485 3300048923 Bacteria 7452
913 Ga0496120_0067004 3300048923 Bacteria 1984
914 Ga0496120_0149730 3300048923 Bacteria 1174
915 Ga0496121_0000179 3300048924 Bacteria 141214
916 Ga0496121_0011251 3300048924 Bacteria 9971
917 Ga0496121_0023305 3300048924 Bacteria 5968
918 Ga0496121_0062161 3300048924 Bacteria 3061
919 Ga0496121_0090060 3300048924 Bacteria 2399
920 Ga0496121_0101989 3300048924 Bacteria 2212
921 Ga0496121_0170592 3300048924 Bacteria 1581
922 Ga0496122_0002404 3300048925 Bacteria 26680
923 Ga0496122_0007083 3300048925 Bacteria 12597
924 Ga0496122_0029324 3300048925 Bacteria 4643
925 Ga0496122_0048877 3300048925 Bacteria 3247
926 Ga0496122_0077274 3300048925 Bacteria 2338
927 Ga0496122_0108927 3300048925 Bacteria 1825
928 Ga0496122_0119113 3300048925 Bacteria 1708
929 Ga0496122_0123958 3300048925 Bacteria 1659
930 Ga0496123_0000439 3300048926 Bacteria 74838
931 Ga0496123_0048907 3300048926 Bacteria 2840
932 Ga0496123_0054519 3300048926 Bacteria 2631
933 Ga0496123_0076472 3300048926 Bacteria 2060
934 Ga0496123_0107849 3300048926 Bacteria 1601
935 Ga0496123_0137627 3300048926 Bacteria 1341
936 Ga0496124_0000132 3300048927 Bacteria 155405
937 Ga0496124_0001693 3300048927 Bacteria 31219
938 Ga0496124_0002847 3300048927 Bacteria 21864
939 Ga0496124_0006195 3300048927 Bacteria 13110
940 Ga0496124_0015103 3300048927 Bacteria 7424
941 Ga0496124_0027297 3300048927 Bacteria 5127
942 Ga0496124_0038452 3300048927 Bacteria 4155
943 Ga0496124_0060348 3300048927 Bacteria 3181
944 Ga0496124_0068606 3300048927 Bacteria 2946
945 Ga0496124_0134045 3300048927 Bacteria 1964
946 Ga0496124_0152295 3300048927 Bacteria 1812
947 Ga0496124_0160168 3300048927 Bacteria 1755
948 Ga0496125_0000380 3300048928 Bacteria 82955
949 Ga0496125_0001691 3300048928 Bacteria 30828
950 Ga0496125_0005312 3300048928 Bacteria 14399
951 Ga0496125_0038928 3300048928 Bacteria 4105
952 Ga0496125_0068930 3300048928 Bacteria 2779
953 Ga0496125_0085987 3300048928 Bacteria 2380
954 Ga0496125_0157542 3300048928 Bacteria 1548
955 Ga0496125_0187946 3300048928 Bacteria 1367
956 Ga0496126_0009446 3300048929 Bacteria 10352
957 Ga0496126_0097180 3300048929 Bacteria 2581
958 Ga0496126_0177264 3300048929 Bacteria 1812
959 Ga0496126_0250389 3300048929 Bacteria 1476
960 Ga0495678_000186 3300049459 Bacteria 72357
961 Ga0495678_002417 3300049459 Bacteria 12714
962 Ga0495678_003788 3300049459 Bacteria 9127
963 Ga0495678_006374 3300049459 Bacteria 6291
964 Ga0495678_008931 3300049459 Bacteria 5011
965 Ga0495678_008976 3300049459 Bacteria 4993
966 Ga0495678_011686 3300049459 Bacteria 4192
967 Ga0495678_014787 3300049459 Bacteria 3616
968 Ga0495678_018255 3300049459 Bacteria 3158
969 Ga0495678_018731 3300049459 Bacteria 3106
970 Ga0495678_022834 3300049459 Bacteria 2729
971 Ga0495678_034970 3300049459 Bacteria 2064
972 Ga0495678_035291 3300049459 Bacteria 2051
973 Ga0495678_035381 3300049459 Bacteria 2048
974 Ga0495678_060052 3300049459 Bacteria 1431
975 Ga0495678_064926 3300049459 Bacteria 1357
976 Ga0495682_0002928 3300049460 Bacteria 7818
977 Ga0495682_0013169 3300049460 Bacteria 3153
978 Ga0495682_0017012 3300049460 Bacteria 2749
979 Ga0495682_0017566 3300049460 Bacteria 2697
980 Ga0495682_0032018 3300049460 Bacteria 1942
981 Ga0495682_0038854 3300049460 Bacteria 1748
982 Ga0495682_0073128 3300049460 Bacteria 1233
983 Ga0501034_0000041 3300049571 Bacteria 229264
984 Ga0501241_002093 3300049758 Bacteria 3912
985 nmdc:mga03683_48851_c1 3300050489 Bacteria 1760
986 nmdc:mga00v17_134465_c1 3300050491 Bacteria 1582
987 nmdc:mga00v17_153125_c1 3300050491 Bacteria 1482
988 nmdc:mga08x19_292552_c1 3300050514 Bacteria 1130
989 Ga0500572_012531 3300053111 Bacteria 2079
990 Ga0500659_0035137 3300053135 Bacteria 2731
991 Ga0500573_0079969 3300053140 Bacteria 1858

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009036 Ga0105244_10002675 Ga0105244_100026757 316
2 3300025711 Ga0207696_1010018 Ga0207696_10100182 316
3 3300025728 Ga0207655_1000151 Ga0207655_100015148 316
4 3300025735 Ga0207713_1012122 Ga0207713_10121224 316
5 3300048920 Ga0496117_0003088 Ga0496117_0003088_303_1376 316
6 3300048921 Ga0496118_0002712 Ga0496118_0002712_18559_19632 316
7 3300048925 Ga0496122_0002404 Ga0496122_0002404_8838_10046 316
8 3300048926 Ga0496123_0000439 Ga0496123_0000439_54631_55839 316
9 3300048927 Ga0496124_0060348 Ga0496124_0060348_1721_2794 316
10 3300009036 Ga0105244_10000274 Ga0105244_100002746 317
11 3300025728 Ga0207655_1000197 Ga0207655_100019742 317
12 3300027312 Ga0209371_1000576 Ga0209371_10005762 317
13 3300030500 Ga0268256_1000503 Ga0268256_100050329 317
14 3300046522 Ga0495643_0000303 Ga0495643_0000303_307_1380 317
15 3300048924 Ga0496121_0170592 Ga0496121_0170592_391_1464 317
16 3300006944 Ga0099823_1000074 Ga0099823_100007440 324
17 3300027296 Ga0209389_1000063 Ga0209389_10000638 324
18 3300046660 Ga0495625_0145433 Ga0495625_0145433_68_1225 324
19 3300049571 Ga0501034_0000041 Ga0501034_0000041_26382_27455 324
20 3300053135 Ga0500659_0035137 Ga0500659_0035137_148_1221 324
21 3300013100 Ga0157373_10055665 Ga0157373_100556652 338
22 3300015262 Ga0182007_10015397 Ga0182007_100153973 338
23 3300046810 Ga0495660_0062743 Ga0495660_0062743_99_1175 339
24 3300015261 Ga0182006_1003543 Ga0182006_10035433 342
25 3300015262 Ga0182007_10000143 Ga0182007_1000014323 342
26 3300015265 Ga0182005_1002054 Ga0182005_10020546 342
27 3300041405 Ga0439438_004842 Ga0439438_004842_3848_4876 342
28 3300042013 Ga0439456_021475 Ga0439456_021475_23_1051 342
29 3300046452 Ga0495617_000327 Ga0495617_000327_13232_14260 342
30 3300046457 Ga0495590_0018607 Ga0495590_0018607_1320_2348 342
31 3300046471 Ga0495650_0009633 Ga0495650_0009633_561_1589 342
32 3300046475 Ga0495639_0000714 Ga0495639_0000714_2013_3041 342
33 3300046499 Ga0495594_0036640 Ga0495594_0036640_331_1359 342
34 3300046501 Ga0495607_0000349 Ga0495607_0000349_35918_36946 342
35 3300046513 Ga0495616_0004161 Ga0495616_0004161_6825_7853 342
36 3300046524 Ga0495648_0025968 Ga0495648_0025968_899_1927 342
37 3300046524 Ga0495648_0138876 Ga0495648_0138876_31_1059 342
38 3300046524 Ga0495648_0138881 Ga0495648_0138881_31_1059 342
39 3300046530 Ga0495654_0010751 Ga0495654_0010751_429_1457 342
40 3300046542 Ga0495597_0036815 Ga0495597_0036815_701_1729 342
41 3300046557 Ga0495622_0000809 Ga0495622_0000809_5524_6552 342
42 3300046648 Ga0495611_0016202 Ga0495611_0016202_503_1531 342
43 3300046664 Ga0495659_0001347 Ga0495659_0001347_5981_7009 342
44 3300046674 Ga0495588_0113369 Ga0495588_0113369_32_1060 342
45 3300046694 Ga0495649_0010145 Ga0495649_0010145_349_1377 342
46 3300046694 Ga0495649_0058418 Ga0495649_0058418_138_1166 342
47 3300046794 Ga0495589_0000194 Ga0495589_0000194_16508_17536 342
48 3300046794 Ga0495589_0024274 Ga0495589_0024274_1579_2607 342
49 3300047318 Ga0495636_0000764 Ga0495636_0000764_68_1096 342
50 3300047318 Ga0495636_0106463 Ga0495636_0106463_135_1163 342
51 3300047320 Ga0495672_0005100 Ga0495672_0005100_6689_7717 342
52 3300047320 Ga0495672_0090339 Ga0495672_0090339_304_1332 342
53 3300047443 Ga0495687_006222 Ga0495687_006222_5978_7006 342
54 3300047443 Ga0495687_020533 Ga0495687_020533_1324_2352 342
55 3300047469 Ga0495673_0001933 Ga0495673_0001933_8858_9886 342
56 3300047470 Ga0495681_0005862 Ga0495681_0005862_1934_2962 342
57 3300047673 Ga0495593_0084041 Ga0495593_0084041_174_1202 342
58 3300048909 Ga0496106_0152882 Ga0496106_0152882_605_1633 342
59 3300048919 Ga0496116_0010359 Ga0496116_0010359_4956_5984 342
60 3300048923 Ga0496120_0149730 Ga0496120_0149730_31_1059 342
61 3300048925 Ga0496122_0007083 Ga0496122_0007083_3976_5004 342
62 3300048926 Ga0496123_0054519 Ga0496123_0054519_1396_2424 342
63 3300048927 Ga0496124_0152295 Ga0496124_0152295_204_1232 342
64 3300049460 Ga0495682_0032018 Ga0495682_0032018_44_1072 342
65 3300049460 Ga0495682_0073128 Ga0495682_0073128_138_1166 342
66 3300002738 JGI25154J39366_1003253 JGI25154J39366_10032533 343
67 3300003751 Ga0055538_1000078 Ga0055538_100007847 343
68 3300003752 Ga0055539_1000119 Ga0055539_100011947 343
69 3300003756 Ga0055533_1000127 Ga0055533_100012747 343
70 3300003758 Ga0055532_1000068 Ga0055532_100006837 343
71 3300003759 Ga0055525_1000163 Ga0055525_100016347 343
72 3300003841 Ga0055541_1000079 Ga0055541_100007947 343
73 3300025206 Ga0209435_100837 Ga0209435_1008372 343
74 3300025224 Ga0209784_100015 Ga0209784_100015396 343
75 3300025225 Ga0209566_100012 Ga0209566_100012396 343
76 3300025226 Ga0209674_100027 Ga0209674_100027396 343
77 3300025229 Ga0209147_100019 Ga0209147_100019396 343
78 3300025230 Ga0209563_100031 Ga0209563_100031396 343
79 3300025233 Ga0209437_103617 Ga0209437_1036172 343
80 3300025242 Ga0209258_100381 Ga0209258_10038118 343
81 3300025246 Ga0209646_1000344 Ga0209646_100034422 343
82 3300025253 Ga0209677_100016 Ga0209677_100016396 343
83 3300011119 Ga0105246_10000117 Ga0105246_1000011711 344
84 3300017792 Ga0163161_10077666 Ga0163161_100776662 344
85 3300048928 Ga0496125_0068930 Ga0496125_0068930_245_1321 344
86 3300046501 Ga0495607_0021862 Ga0495607_0021862_2911_3984 345
87 3300006177 Ga0075362_10096897 Ga0075362_100968972 347
88 3300017792 Ga0163161_10054038 Ga0163161_100540383 347
89 3300027907 Ga0207428_10105134 Ga0207428_101051342 347
90 3300046457 Ga0495590_0022982 Ga0495590_0022982_303_1379 347
91 3300046460 Ga0495638_0072609 Ga0495638_0072609_694_1770 347
92 3300046471 Ga0495650_0003352 Ga0495650_0003352_9665_10741 347
93 3300046501 Ga0495607_0002511 Ga0495607_0002511_12026_13102 347
94 3300046513 Ga0495616_0002585 Ga0495616_0002585_1016_2092 347
95 3300046515 Ga0495620_0001337 Ga0495620_0001337_623_1699 347
96 3300046520 Ga0495637_0026158 Ga0495637_0026158_428_1504 347
97 3300046530 Ga0495654_0043786 Ga0495654_0043786_1014_2090 347
98 3300046692 Ga0495671_0038625 Ga0495671_0038625_1013_2089 347
99 3300047469 Ga0495673_0002323 Ga0495673_0002323_778_1854 347
100 3300047470 Ga0495681_0003041 Ga0495681_0003041_1014_2090 347
101 3300049460 Ga0495682_0002928 Ga0495682_0002928_5717_6793 347
102 3300050491 nmdc:mga00v17_153125_c1 nmdc:mga00v17_153125_c1_158_1264 347
103 3300046506 Ga0495583_0025371 Ga0495583_0025371_293_1384 348
104 3300046530 Ga0495654_0029064 Ga0495654_0029064_1613_2704 348
105 3300005288 Ga0065714_10081673 Ga0065714_100816732 349
106 3300005331 Ga0070670_100001033 Ga0070670_10000103310 349
107 3300005353 Ga0070669_100000997 Ga0070669_1000009972 349
108 3300005457 Ga0070662_100002077 Ga0070662_1000020777 349
109 3300005539 Ga0068853_100035771 Ga0068853_1000357713 349
110 3300005578 Ga0068854_100067332 Ga0068854_1000673322 349
111 3300009011 Ga0105251_10000847 Ga0105251_1000084725 349
112 3300013100 Ga0157373_10056881 Ga0157373_100568812 349
113 3300013104 Ga0157370_10152975 Ga0157370_101529752 349
114 3300013105 Ga0157369_10110064 Ga0157369_101100642 349
115 3300014497 Ga0182008_10029468 Ga0182008_100294683 349
116 3300017792 Ga0163161_10226051 Ga0163161_102260512 349
117 3300025735 Ga0207713_1000882 Ga0207713_10008824 349
118 3300025923 Ga0207681_10003012 Ga0207681_100030128 349
119 3300025925 Ga0207650_10000742 Ga0207650_1000074211 349
120 3300025933 Ga0207706_10000903 Ga0207706_100009036 349
121 3300026041 Ga0207639_10036851 Ga0207639_100368512 349
122 3300046512 Ga0495610_0029057 Ga0495610_0029057_1412_2488 349
123 3300046530 Ga0495654_0035397 Ga0495654_0035397_1293_2369 349
124 3300048926 Ga0496123_0137627 Ga0496123_0137627_171_1247 349
125 3300050514 nmdc:mga08x19_292552_c1 nmdc:mga08x19_292552_c1_16_1068 350
126 iso_pu_bacteria 2599185155 2599328569 351
127 iso_pu_bacteria 2511231006 2511266121 353
128 iso_pu_bacteria 2511231012 2511300452 353
129 iso_pu_bacteria 2511231024 2511374797 353
130 iso_pu_bacteria 2512047018 2512329551 353
131 iso_pu_bacteria 2554235231 2555246087 353
132 iso_pu_bacteria 2582580891 2583790898 353
133 iso_pu_bacteria 2597489887 2597856667 353
134 iso_pu_bacteria 2599185185 2599483082 353
135 iso_pu_bacteria 2599185257 2599804983 353
136 iso_pu_bacteria 2671180172 2671768283 353
137 iso_pu_bacteria 2675903420 2677896681 353
138 iso_pu_bacteria 2738541271 2738691411 353
139 iso_pu_bacteria 2738543016 2739267186 353
140 iso_pu_bacteria 2740892503 2743736091 353
141 iso_pu_bacteria 2765235841 2765582575 353
142 iso_pu_bacteria 2806310737 2807409657 353
143 iso_pu_bacteria 2806310745 2807457958 353
144 iso_pu_bacteria 2908446538 2908448401 353
145 iso_pu_bacteria 2912963787 2912965140 353
146 iso_pu_bacteria 2919155634 2919160058 353
147 iso_pu_bacteria 2923153595 2923155103 353
148 iso_pu_bacteria 2939636861 2939642535 353
149 iso_pu_bacteria 2939651529 2939653500 353
150 iso_pu_bacteria 2946006987 2946011339 353
151 iso_pu_bacteria 3007803356 3007806353 353
152 iso_pu_bacteria 3007872151 3007876024 353
153 iso_pu_bacteria 8015687852 8015689323 353
154 iso_pu_bacteria 8052494512 8052498646 353
155 iso_pu_bacteria 8054929484 8054933914 353
156 iso_pu_bacteria 8055770955 8055772451 353
157 iso_pu_bacteria 8055878733 8055880245 353
158 iso_pu_bacteria 8056115690 8056119959 353
159 iso_pu_bacteria 8056120720 8056122117 353
160 iso_pu_bacteria 8056125926 8056130365 353
161 iso_pu_bacteria 8056137416 8056141601 353
162 iso_pu_bacteria 8056155041 8056159315 353
163 3300042146 Ga0450907_002076 Ga0450907_002076_2702_3766 354
164 iso_pu_bacteria 2511231004 2511254483 354
165 iso_pu_bacteria 2511231008 2511278677 354
166 iso_pu_bacteria 2511231010 2511291035 354
167 iso_pu_bacteria 2511231011 2511298766 354
168 iso_pu_bacteria 2511231016 2511329180 354
169 iso_pu_bacteria 2511231018 2511341333 354
170 iso_pu_bacteria 2511231019 2511347512 354
171 iso_pu_bacteria 2511231020 2511349906 354
172 iso_pu_bacteria 2511231021 2511354259 354
173 iso_pu_bacteria 2511231022 2511360642 354
174 iso_pu_bacteria 2511231023 2511371293 354
175 iso_pu_bacteria 2511231031 2511412192 354
176 iso_pu_bacteria 2511231156 2511823453 354
177 iso_pu_bacteria 2554235341 2555668499 354
178 iso_pu_bacteria 2597489888 2597862829 354
179 iso_pu_bacteria 2597489889 2597868630 354
180 iso_pu_bacteria 2599185160 2599355496 354
181 iso_pu_bacteria 2599185161 2599360665 354
182 iso_pu_bacteria 2599185162 2599366987 354
183 iso_pu_bacteria 2599185163 2599373777 354
184 iso_pu_bacteria 2599185164 2599380602 354
185 iso_pu_bacteria 2599185165 2599387049 354
186 iso_pu_bacteria 2599185166 2599392635 354
187 iso_pu_bacteria 2599185167 2599396609 354
188 iso_pu_bacteria 2599185168 2599404402 354
189 iso_pu_bacteria 2599185179 2599453331 354
190 iso_pu_bacteria 2599185181 2599462330 354
191 iso_pu_bacteria 2599185182 2599466611 354
192 iso_pu_bacteria 2599185186 2599490578 354
193 iso_pu_bacteria 2599185188 2599503932 354
194 iso_pu_bacteria 2599185189 2599507590 354
195 iso_pu_bacteria 2599185190 2599514663 354
196 iso_pu_bacteria 2599185191 2599517406 354
197 iso_pu_bacteria 2599185212 2599615812 354
198 iso_pu_bacteria 2599185248 2599772730 354
199 iso_pu_bacteria 2599185288 2599880099 354
200 iso_pu_bacteria 2599185289 2599889227 354
201 iso_pu_bacteria 2599185290 2599894072 354
202 iso_pu_bacteria 2599185291 2599896548 354
203 iso_pu_bacteria 2599185300 2599931900 354
204 iso_pu_bacteria 2599185302 2599945550 354
205 iso_pu_bacteria 2599185303 2599948599 354
206 iso_pu_bacteria 2599185304 2599956668 354
207 iso_pu_bacteria 2599185305 2599962621 354
208 iso_pu_bacteria 2599185306 2599965241 354
209 iso_pu_bacteria 2599185308 2599978787 354
210 iso_pu_bacteria 2599185309 2599985410 354
211 iso_pu_bacteria 2599185310 2599991839 354
212 iso_pu_bacteria 2599185311 2599996562 354
213 iso_pu_bacteria 2599185312 2600002364 354
214 iso_pu_bacteria 2599185313 2600006883 354
215 iso_pu_bacteria 2599185314 2600010473 354
216 iso_pu_bacteria 2599185315 2600021396 354
217 iso_pu_bacteria 2599185316 2600026383 354
218 iso_pu_bacteria 2599185317 2600032462 354
219 iso_pu_bacteria 2599185318 2600036319 354
220 iso_pu_bacteria 2599185319 2600043616 354
221 iso_pu_bacteria 2599185320 2600049897 354
222 iso_pu_bacteria 2599185321 2600053522 354
223 iso_pu_bacteria 2599185322 2600061462 354
224 iso_pu_bacteria 2599185323 2600067386 354
225 iso_pu_bacteria 2599185324 2600070393 354
226 iso_pu_bacteria 2599185325 2600080221 354
227 iso_pu_bacteria 2599185356 2600214952 354
228 iso_pu_bacteria 2600254930 2600362024 354
229 iso_pu_bacteria 2600254931 2600363698 354
230 iso_pu_bacteria 2600254954 2600445520 354
231 iso_pu_bacteria 2600255283 2601626536 354
232 iso_pu_bacteria 2600255296 2601691365 354
233 iso_pu_bacteria 2600255313 2601774343 354
234 iso_pu_bacteria 2600255318 2601799962 354
235 iso_pu_bacteria 2600255389 2602009929 354
236 iso_pu_bacteria 2603880185 2606074239 354
237 iso_pu_bacteria 2603880199 2606127101 354
238 iso_pu_bacteria 2623620443 2624479252 354
239 iso_pu_bacteria 2623620446 2624493753 354
240 iso_pu_bacteria 2643221565 2643845161 354
241 iso_pu_bacteria 2643221571 2643872990 354
242 iso_pu_bacteria 2643221589 2643952401 354
243 iso_pu_bacteria 2643221602 2644022165 354
244 iso_pu_bacteria 2643221633 2644187583 354
245 iso_pu_bacteria 2643221650 2644283633 354
246 iso_pu_bacteria 2643221713 2644625112 354
247 iso_pu_bacteria 2651869719 2652547490 354
248 iso_pu_bacteria 2667528170 2671090424 354
249 iso_pu_bacteria 2667528171 2671098116 354
250 iso_pu_bacteria 2667528176 2671130396 354
251 iso_pu_bacteria 2675903515 2678262379 354
252 iso_pu_bacteria 2713897148 2715751789 354
253 iso_pu_bacteria 2713897149 2715759665 354
254 iso_pu_bacteria 2718217725 2718633108 354
255 iso_pu_bacteria 2721755607 2723247658 354
256 iso_pu_bacteria 2738541294 2738809570 354
257 iso_pu_bacteria 2738541309 2738896930 354
258 iso_pu_bacteria 2738543025 2739314288 354
259 iso_pu_bacteria 2744054620 2745008725 354
260 iso_pu_bacteria 2773857670 2774121350 354
261 iso_pu_bacteria 2773857673 2774135983 354
262 iso_pu_bacteria 2784132063 2784259993 354
263 iso_pu_bacteria 2784132072 2784317307 354
264 iso_pu_bacteria 2791355520 2794596175 354
265 iso_pu_bacteria 2808606361 2808858228 354
266 iso_pu_bacteria 2808606376 2808924149 354
267 iso_pu_bacteria 2808606377 2808929989 354
268 iso_pu_bacteria 2808606378 2808938383 354
269 iso_pu_bacteria 2808606380 2808946090 354
270 iso_pu_bacteria 2808606381 2808951935 354
271 iso_pu_bacteria 2808606382 2808957513 354
272 iso_pu_bacteria 2808606383 2808966713 354
273 iso_pu_bacteria 2808606385 2808975712 354
274 iso_pu_bacteria 2808606388 2808990649 354
275 iso_pu_bacteria 2808606389 2809001543 354
276 iso_pu_bacteria 2808606445 2809216211 354
277 iso_pu_bacteria 2818991456 2819654505 354
278 iso_pu_bacteria 2818991464 2819703183 354
279 iso_pu_bacteria 2823421272 2823424233 354
280 iso_pu_bacteria 2825651385 2825653260 354
281 iso_pu_bacteria 2834028612 2834029485 354
282 iso_pu_bacteria 2842826826 2842830949 354
283 iso_pu_bacteria 2842832357 2842832927 354
284 iso_pu_bacteria 2842837860 2842840060 354
285 iso_pu_bacteria 2842843487 2842848456 354
286 iso_pu_bacteria 2842854478 2842858988 354
287 iso_pu_bacteria 2844665904 2844668997 354
288 iso_pu_bacteria 2852612431 2852614996 354
289 iso_pu_bacteria 2852657418 2852658717 354
290 iso_pu_bacteria 2852667396 2852669964 354
291 iso_pu_bacteria 2860339153 2860340224 354
292 iso_pu_bacteria 2860867994 2860869476 354
293 iso_pu_bacteria 2878029506 2878031260 354
294 iso_pu_bacteria 2880230671 2880232107 354
295 iso_pu_bacteria 2904518522 2904522363 354
296 iso_pu_bacteria 2913036834 2913038351 354
297 iso_pu_bacteria 2917070673 2917072267 354
298 iso_pu_bacteria 2919063839 2919064269 354
299 iso_pu_bacteria 2919385768 2919386231 354
300 iso_pu_bacteria 2919456309 2919461972 354
301 iso_pu_bacteria 2919481497 2919481619 354
302 iso_pu_bacteria 2919487758 2919491682 354
303 iso_pu_bacteria 2919697872 2919700338 354
304 iso_pu_bacteria 2923586266 2923587524 354
305 iso_pu_bacteria 2929144301 2929145796 354
306 iso_pu_bacteria 2929189879 2929191454 354
307 iso_pu_bacteria 2931369376 2931370864 354
308 iso_pu_bacteria 2931390751 2931392495 354
309 iso_pu_bacteria 2931396565 2931399873 354
310 iso_pu_bacteria 2935353572 2935354437 354
311 iso_pu_bacteria 2945928738 2945929109 354
312 iso_pu_bacteria 2945961074 2945961816 354
313 iso_pu_bacteria 2946027586 2946029682 354
314 iso_pu_bacteria 2969304461 2969306032 354
315 iso_pu_bacteria 2974289157 2974292303 354
316 iso_pu_bacteria 2984286254 2984290939 354
317 iso_pu_bacteria 2988728565 2988733331 354
318 iso_pu_bacteria 2998139840 2998141443 354
319 iso_pu_bacteria 3007511990 3007512824 354
320 iso_pu_bacteria 3007614139 3007616281 354
321 iso_pu_bacteria 3007619802 3007620560 354
322 iso_pu_bacteria 3007718800 3007719646 354
323 iso_pu_bacteria 3007855910 3007856038 354
324 iso_pu_bacteria 3007861166 3007863327 354
325 iso_pu_bacteria 3007866637 3007867985 354
326 iso_pu_bacteria 637000220 637318858 354
327 iso_pu_bacteria 8019769354 8019771042 354
328 iso_pu_bacteria 8019775933 8019776993 354
329 iso_pu_bacteria 8029995093 8029999307 354
330 iso_pu_bacteria 8034962539 8034965739 354
331 iso_pu_bacteria 8054285046 8054286128 354
332 iso_pu_bacteria 8054347763 8054351916 354
333 iso_pu_bacteria 8054503363 8054505019 354
334 iso_pu_bacteria 8055817908 8055819526 354
335 iso_pu_bacteria 8056131705 8056133393 354
336 iso_pu_bacteria 8056143049 8056147479 354
337 iso_pu_bacteria 8056148874 8056149664 354
338 iso_pu_bacteria 8056161164 8056164809 354
339 iso_pu_bacteria 8056166840 8056169617 354
340 iso_pu_bacteria 8056172158 8056175733 354
341 iso_pu_bacteria 8056177738 8056180185 354
342 iso_pu_bacteria 8056569372 8056570103 354
343 iso_pu_bacteria 8057798959 8057803794 354
344 3300005288 Ga0065714_10066956 Ga0065714_100669562 355
345 3300009036 Ga0105244_10000248 Ga0105244_1000024821 355
346 3300025728 Ga0207655_1001272 Ga0207655_100127225 355
347 3300046453 Ga0495627_000040 Ga0495627_000040_158940_160007 355
348 3300047469 Ga0495673_0011518 Ga0495673_0011518_236_1351 355
349 3300047470 Ga0495681_0051887 Ga0495681_0051887_644_1759 355
350 3300048927 Ga0496124_0134045 Ga0496124_0134045_286_1401 355
351 3300053140 Ga0500573_0079969 Ga0500573_0079969_527_1594 355
352 3300042134 Ga0450898_010644 Ga0450898_010644_208_1278 356
353 3300046501 Ga0495607_0001009 Ga0495607_0001009_24394_25464 356
354 3300046519 Ga0495632_0004287 Ga0495632_0004287_1470_2588 356
355 3300046520 Ga0495637_0015994 Ga0495637_0015994_1554_2672 356
356 3300046665 Ga0495661_0000146 Ga0495661_0000146_18040_19158 356
357 3300047469 Ga0495673_0033711 Ga0495673_0033711_400_1518 356
358 2162886007 SwRhRL2b_contig_1718832 SwRhRL2b_0032.00000480 357
359 2162886007 SwRhRL2b_contig_2047565 SwRhRL2b_0834.00000020 357
360 3300003791 Ga0055530_10023505 Ga0055530_100235052 357
361 3300005288 Ga0065714_10003605 Ga0065714_100036052 357
362 3300005289 Ga0065704_10119990 Ga0065704_101199902 357
363 3300005289 Ga0065704_10128981 Ga0065704_101289811 357
364 3300005289 Ga0065704_10138562 Ga0065704_101385621 357
365 3300006051 Ga0075364_10090124 Ga0075364_100901242 357
366 3300006058 Ga0075432_10026538 Ga0075432_100265382 357
367 3300009011 Ga0105251_10003325 Ga0105251_100033253 357
368 3300009011 Ga0105251_10023484 Ga0105251_100234843 357
369 3300009036 Ga0105244_10035696 Ga0105244_100356962 357
370 3300009036 Ga0105244_10035795 Ga0105244_100357952 357
371 3300009036 Ga0105244_10044890 Ga0105244_100448902 357
372 3300009036 Ga0105244_10065661 Ga0105244_100656612 357
373 3300009036 Ga0105244_10125968 Ga0105244_101259681 357
374 3300013307 Ga0157372_10000598 Ga0157372_1000059835 357
375 3300017792 Ga0163161_10063125 Ga0163161_100631252 357
376 3300025292 Ga0209676_1000532 Ga0209676_100053237 357
377 3300025298 Ga0209050_1019088 Ga0209050_10190882 357
378 3300025303 Ga0209051_1003100 Ga0209051_10031009 357
379 3300025711 Ga0207696_1000010 Ga0207696_1000010145 357
380 3300025711 Ga0207696_1028596 Ga0207696_10285962 357
381 3300025711 Ga0207696_1035733 Ga0207696_10357331 357
382 3300025728 Ga0207655_1015788 Ga0207655_10157883 357
383 3300025728 Ga0207655_1036484 Ga0207655_10364842 357
384 3300025735 Ga0207713_1011564 Ga0207713_10115643 357
385 3300025735 Ga0207713_1023540 Ga0207713_10235401 357
386 3300025735 Ga0207713_1049961 Ga0207713_10499612 357
387 3300025935 Ga0207709_10009838 Ga0207709_100098382 357
388 3300025935 Ga0207709_10111584 Ga0207709_101115842 357
389 3300027907 Ga0207428_10042336 Ga0207428_100423361 357
390 3300041405 Ga0439438_004123 Ga0439438_004123_2743_3846 357
391 3300041407 Ga0439447_010268 Ga0439447_010268_207_1310 357
392 3300041407 Ga0439447_014464 Ga0439447_014464_875_1978 357
393 3300041411 Ga0439466_0001263 Ga0439466_0001263_1256_2359 357
394 3300041411 Ga0439466_0011798 Ga0439466_0011798_1670_2743 357
395 3300042006 Ga0439432_024392 Ga0439432_024392_745_1818 357
396 3300042013 Ga0439456_000271 Ga0439456_000271_1398_2471 357
397 3300042013 Ga0439456_011225 Ga0439456_011225_182_1255 357
398 3300042016 Ga0439463_000376 Ga0439463_000376_303_1382 357
399 3300042122 Ga0450920_007247 Ga0450920_007247_668_1771 357
400 3300042124 Ga0450922_000514 Ga0450922_000514_2788_3891 357
401 3300042136 Ga0450900_002786 Ga0450900_002786_166_1239 357
402 3300042137 Ga0450902_005568 Ga0450902_005568_210_1283 357
403 3300042142 Ga0450905_000029 Ga0450905_000029_527_1600 357
404 3300042146 Ga0450907_003696 Ga0450907_003696_113_1216 357
405 3300042147 Ga0450910_000124 Ga0450910_000124_4105_5208 357
406 3300042461 Ga0439460_0015732 Ga0439460_0015732_217_1320 357
407 3300042533 Ga0450901_001003 Ga0450901_001003_1306_2379 357
408 3300046460 Ga0495638_0039275 Ga0495638_0039275_343_1416 357
409 3300046507 Ga0495606_0042245 Ga0495606_0042245_1471_2559 357
410 3300046515 Ga0495620_0000002 Ga0495620_0000002_248956_250164 357
411 3300046519 Ga0495632_0000215 Ga0495632_0000215_37984_39057 357
412 3300046522 Ga0495643_0002672 Ga0495643_0002672_3178_4386 357
413 3300046524 Ga0495648_0000521 Ga0495648_0000521_37816_39024 357
414 3300046524 Ga0495648_0001868 Ga0495648_0001868_550_1623 357
415 3300046530 Ga0495654_0081285 Ga0495654_0081285_104_1177 357
416 3300046538 Ga0495609_0000079 Ga0495609_0000079_79405_80607 357
417 3300047470 Ga0495681_0005315 Ga0495681_0005315_480_1553 357
418 3300047470 Ga0495681_0023876 Ga0495681_0023876_1646_2719 357
419 3300048919 Ga0496116_0076728 Ga0496116_0076728_741_1814 357
420 3300048920 Ga0496117_0001323 Ga0496117_0001323_14636_15709 357
421 3300048920 Ga0496117_0012255 Ga0496117_0012255_2056_3264 357
422 3300048921 Ga0496118_0002985 Ga0496118_0002985_20031_21239 357
423 3300048922 Ga0496119_0000612 Ga0496119_0000612_31455_32528 357
424 3300048922 Ga0496119_0122838 Ga0496119_0122838_79_1287 357
425 3300048923 Ga0496120_0001054 Ga0496120_0001054_31258_32331 357
426 3300048924 Ga0496121_0101989 Ga0496121_0101989_684_1892 357
427 3300048925 Ga0496122_0123958 Ga0496122_0123958_262_1335 357
428 3300048926 Ga0496123_0107849 Ga0496123_0107849_387_1460 357
429 3300048927 Ga0496124_0000132 Ga0496124_0000132_127868_128941 357
430 3300048927 Ga0496124_0006195 Ga0496124_0006195_181_1254 357
431 3300048927 Ga0496124_0015103 Ga0496124_0015103_860_1933 357
432 3300048927 Ga0496124_0038452 Ga0496124_0038452_361_1569 357
433 3300048927 Ga0496124_0160168 Ga0496124_0160168_477_1550 357
434 3300048928 Ga0496125_0000380 Ga0496125_0000380_44537_45745 357
435 3300048928 Ga0496125_0157542 Ga0496125_0157542_295_1368 357
436 3300048929 Ga0496126_0250389 Ga0496126_0250389_233_1306 357
437 3300050491 nmdc:mga00v17_134465_c1 nmdc:mga00v17_134465_c1_210_1283 357
438 2124908027 MRS2a_Contig_6404 MRS2a_00294580 358
439 2124908027 MRS2a_Contig_916 MRS2a_00761790 358
440 2162886007 SwRhRL2b_contig_3032464 SwRhRL2b_0497.00003720 358
441 3300002737 JGI25162J39368_1000085 JGI25162J39368_100008571 358
442 3300002771 JGI25163J39215_1000217 JGI25163J39215_100021715 358
443 3300002772 JGI25164J39214_1000063 JGI25164J39214_100006371 358
444 3300003214 JGI25165J46597_1000160 JGI25165J46597_100016071 358
445 3300003781 Ga0055536_1000173 Ga0055536_10001736 358
446 3300003781 Ga0055536_1000362 Ga0055536_100036211 358
447 3300003781 Ga0055536_1000391 Ga0055536_100039112 358
448 3300003791 Ga0055530_10000113 Ga0055530_1000011346 358
449 3300003791 Ga0055530_10000196 Ga0055530_100001966 358
450 3300003791 Ga0055530_10024949 Ga0055530_100249491 358
451 3300003792 Ga0055540_1000154 Ga0055540_100015424 358
452 3300003792 Ga0055540_1000170 Ga0055540_100017026 358
453 3300003792 Ga0055540_1000218 Ga0055540_10002186 358
454 3300003794 Ga0055531_10000842 Ga0055531_100008425 358
455 3300005288 Ga0065714_10002499 Ga0065714_1000249915 358
456 3300005288 Ga0065714_10009859 Ga0065714_100098592 358
457 3300005288 Ga0065714_10011908 Ga0065714_100119085 358
458 3300005288 Ga0065714_10065019 Ga0065714_100650199 358
459 3300005288 Ga0065714_10079310 Ga0065714_100793102 358
460 3300005288 Ga0065714_10083084 Ga0065714_100830841 358
461 3300005288 Ga0065714_10086053 Ga0065714_100860532 358
462 3300005288 Ga0065714_10086697 Ga0065714_100866972 358
463 3300005288 Ga0065714_10108174 Ga0065714_101081741 358
464 3300005289 Ga0065704_10003637 Ga0065704_100036375 358
465 3300005289 Ga0065704_10072784 Ga0065704_100727847 358
466 3300005290 Ga0065712_10002299 Ga0065712_100022993 358
467 3300005293 Ga0065715_10005136 Ga0065715_100051362 358
468 3300005344 Ga0070661_100000060 Ga0070661_10000006046 358
469 3300005457 Ga0070662_100011144 Ga0070662_1000111447 358
470 3300005548 Ga0070665_100030324 Ga0070665_1000303242 358
471 3300005564 Ga0070664_100000202 Ga0070664_10000020228 358
472 3300005834 Ga0068851_10000055 Ga0068851_1000005515 358
473 3300006058 Ga0075432_10005628 Ga0075432_100056283 358
474 3300006058 Ga0075432_10035240 Ga0075432_100352402 358
475 3300006058 Ga0075432_10050081 Ga0075432_100500812 358
476 3300006177 Ga0075362_10069546 Ga0075362_100695462 358
477 3300006186 Ga0075369_10081088 Ga0075369_100810882 358
478 3300006946 Ga0079104_1000145 Ga0079104_100014537 358
479 3300006946 Ga0079104_1001936 Ga0079104_10019366 358
480 3300006948 Ga0099826_10045335 Ga0099826_100453352 358
481 3300009011 Ga0105251_10001298 Ga0105251_100012987 358
482 3300009011 Ga0105251_10013205 Ga0105251_100132052 358
483 3300009011 Ga0105251_10052492 Ga0105251_100524922 358
484 3300009011 Ga0105251_10053840 Ga0105251_100538401 358
485 3300009036 Ga0105244_10019664 Ga0105244_100196644 358
486 3300009036 Ga0105244_10058187 Ga0105244_100581872 358
487 3300009036 Ga0105244_10084642 Ga0105244_100846422 358
488 3300009092 Ga0105250_10000534 Ga0105250_1000053422 358
489 3300009092 Ga0105250_10001316 Ga0105250_1000131614 358
490 3300009092 Ga0105250_10015682 Ga0105250_100156821 358
491 3300009092 Ga0105250_10044958 Ga0105250_100449582 358
492 3300009092 Ga0105250_10060972 Ga0105250_100609721 358
493 3300009148 Ga0105243_10000451 Ga0105243_100004519 358
494 3300009148 Ga0105243_10001719 Ga0105243_100017193 358
495 3300009148 Ga0105243_10087612 Ga0105243_100876122 358
496 3300009176 Ga0105242_10007609 Ga0105242_100076094 358
497 3300009545 Ga0105237_10000640 Ga0105237_100006402 358
498 3300009553 Ga0105249_10026157 Ga0105249_100261571 358
499 3300011119 Ga0105246_10016446 Ga0105246_100164464 358
500 3300011119 Ga0105246_10084560 Ga0105246_100845602 358
501 3300011119 Ga0105246_10095329 Ga0105246_100953292 358
502 3300012498 Ga0157345_1000081 Ga0157345_100008116 358
503 3300012502 Ga0157347_1002054 Ga0157347_10020541 358
504 3300013100 Ga0157373_10000593 Ga0157373_1000059325 358
505 3300013100 Ga0157373_10003554 Ga0157373_100035549 358
506 3300013100 Ga0157373_10016161 Ga0157373_100161616 358
507 3300013100 Ga0157373_10021556 Ga0157373_100215565 358
508 3300013100 Ga0157373_10056736 Ga0157373_100567363 358
509 3300013102 Ga0157371_10000497 Ga0157371_1000049743 358
510 3300013102 Ga0157371_10000583 Ga0157371_1000058335 358
511 3300013102 Ga0157371_10003644 Ga0157371_100036449 358
512 3300013102 Ga0157371_10017431 Ga0157371_100174316 358
513 3300013104 Ga0157370_10026246 Ga0157370_100262464 358
514 3300013104 Ga0157370_10033329 Ga0157370_100333295 358
515 3300013104 Ga0157370_10039334 Ga0157370_100393345 358
516 3300013104 Ga0157370_10097823 Ga0157370_100978232 358
517 3300013104 Ga0157370_10106817 Ga0157370_101068172 358
518 3300013104 Ga0157370_10334484 Ga0157370_103344841 358
519 3300013105 Ga0157369_10008746 Ga0157369_1000874611 358
520 3300013105 Ga0157369_10114806 Ga0157369_101148063 358
521 3300013105 Ga0157369_10138003 Ga0157369_101380032 358
522 3300013105 Ga0157369_10416175 Ga0157369_104161751 358
523 3300013306 Ga0163162_10004856 Ga0163162_100048565 358
524 3300013306 Ga0163162_10099591 Ga0163162_100995912 358
525 3300013306 Ga0163162_10276536 Ga0163162_102765362 358
526 3300013307 Ga0157372_10033779 Ga0157372_100337792 358
527 3300013308 Ga0157375_10140116 Ga0157375_101401162 358
528 3300014497 Ga0182008_10000863 Ga0182008_1000086315 358
529 3300014497 Ga0182008_10003335 Ga0182008_100033351 358
530 3300014497 Ga0182008_10006493 Ga0182008_100064933 358
531 3300014497 Ga0182008_10012581 Ga0182008_100125813 358
532 3300014497 Ga0182008_10031668 Ga0182008_100316682 358
533 3300014497 Ga0182008_10033884 Ga0182008_100338843 358
534 3300014497 Ga0182008_10034069 Ga0182008_100340691 358
535 3300014497 Ga0182008_10050435 Ga0182008_100504352 358
536 3300015261 Ga0182006_1001275 Ga0182006_100127510 358
537 3300015261 Ga0182006_1005016 Ga0182006_10050163 358
538 3300015261 Ga0182006_1017180 Ga0182006_10171802 358
539 3300015261 Ga0182006_1021827 Ga0182006_10218273 358
540 3300015261 Ga0182006_1024824 Ga0182006_10248242 358
541 3300015261 Ga0182006_1056943 Ga0182006_10569431 358
542 3300015262 Ga0182007_10020582 Ga0182007_100205821 358
543 3300015265 Ga0182005_1035369 Ga0182005_10353691 358
544 3300017792 Ga0163161_10001895 Ga0163161_100018954 358
545 3300017792 Ga0163161_10020484 Ga0163161_100204844 358
546 3300017792 Ga0163161_10022776 Ga0163161_100227764 358
547 3300017792 Ga0163161_10036567 Ga0163161_100365673 358
548 3300017792 Ga0163161_10058360 Ga0163161_100583602 358
549 3300017792 Ga0163161_10106450 Ga0163161_101064503 358
550 3300017792 Ga0163161_10245451 Ga0163161_102454511 358
551 3300025207 Ga0209760_100039 Ga0209760_10003983 358
552 3300025230 Ga0209563_100630 Ga0209563_1006303 358
553 3300025231 Ga0207427_100001 Ga0207427_100001757 358
554 3300025233 Ga0209437_100003 Ga0209437_100003615 358
555 3300025261 Ga0209233_1000007 Ga0209233_1000007757 358
556 3300025291 Ga0209675_1009404 Ga0209675_10094042 358
557 3300025292 Ga0209676_1000016 Ga0209676_1000016359 358
558 3300025292 Ga0209676_1000021 Ga0209676_100002147 358
559 3300025292 Ga0209676_1000033 Ga0209676_1000033187 358
560 3300025292 Ga0209676_1011310 Ga0209676_10113103 358
561 3300025298 Ga0209050_1000009 Ga0209050_1000009127 358
562 3300025298 Ga0209050_1000036 Ga0209050_1000036199 358
563 3300025298 Ga0209050_1000107 Ga0209050_100010746 358
564 3300025303 Ga0209051_1000043 Ga0209051_1000043271 358
565 3300025303 Ga0209051_1000053 Ga0209051_1000053127 358
566 3300025303 Ga0209051_1000090 Ga0209051_1000090110 358
567 3300025304 Ga0209257_1000098 Ga0209257_100009842 358
568 3300025304 Ga0209257_1011864 Ga0209257_10118644 358
569 3300025321 Ga0207656_10000075 Ga0207656_1000007519 358
570 3300025711 Ga0207696_1000063 Ga0207696_100006386 358
571 3300025711 Ga0207696_1000158 Ga0207696_100015858 358
572 3300025711 Ga0207696_1002599 Ga0207696_10025995 358
573 3300025711 Ga0207696_1004643 Ga0207696_10046432 358
574 3300025711 Ga0207696_1006768 Ga0207696_10067681 358
575 3300025711 Ga0207696_1013851 Ga0207696_10138512 358
576 3300025728 Ga0207655_1000019 Ga0207655_1000019443 358
577 3300025728 Ga0207655_1000250 Ga0207655_100025079 358
578 3300025728 Ga0207655_1005501 Ga0207655_10055015 358
579 3300025728 Ga0207655_1009222 Ga0207655_10092224 358
580 3300025728 Ga0207655_1009805 Ga0207655_10098057 358
581 3300025728 Ga0207655_1014540 Ga0207655_10145403 358
582 3300025728 Ga0207655_1035764 Ga0207655_10357643 358
583 3300025728 Ga0207655_1041047 Ga0207655_10410471 358
584 3300025735 Ga0207713_1000380 Ga0207713_10003805 358
585 3300025735 Ga0207713_1001994 Ga0207713_10019948 358
586 3300025735 Ga0207713_1001997 Ga0207713_10019979 358
587 3300025735 Ga0207713_1005079 Ga0207713_10050795 358
588 3300025735 Ga0207713_1006442 Ga0207713_10064425 358
589 3300025735 Ga0207713_1051667 Ga0207713_10516672 358
590 3300025914 Ga0207671_10000566 Ga0207671_100005662 358
591 3300025920 Ga0207649_10000002 Ga0207649_10000002132 358
592 3300025933 Ga0207706_10026289 Ga0207706_100262892 358
593 3300025934 Ga0207686_10032576 Ga0207686_100325762 358
594 3300025935 Ga0207709_10000036 Ga0207709_10000036223 358
595 3300025935 Ga0207709_10000350 Ga0207709_1000035012 358
596 3300025945 Ga0207679_10000006 Ga0207679_10000006359 358
597 3300025961 Ga0207712_10103808 Ga0207712_101038082 358
598 3300027111 Ga0209281_1000172 Ga0209281_1000172112 358
599 3300027111 Ga0209281_1000271 Ga0209281_100027156 358
600 3300027111 Ga0209281_1003274 Ga0209281_10032743 358
601 3300027907 Ga0207428_10201260 Ga0207428_102012602 358
602 3300028379 Ga0268266_10006047 Ga0268266_100060478 358
603 3300030521 Ga0307511_10038488 Ga0307511_100384883 358
604 3300030731 Ga0316177_1050534 Ga0316177_10505342 358
605 3300030734 Ga0316179_1078275 Ga0316179_10782752 358
606 3300030735 Ga0316178_1161793 Ga0316178_116179314 358
607 3300030742 Ga0316183_1015099 Ga0316183_10150994 358
608 3300031548 Ga0307408_100011056 Ga0307408_1000110564 358
609 3300031548 Ga0307408_100020260 Ga0307408_1000202604 358
610 3300031548 Ga0307408_100028563 Ga0307408_1000285632 358
611 3300031548 Ga0307408_100127976 Ga0307408_1001279762 358
612 3300031548 Ga0307408_100137461 Ga0307408_1001374612 358
613 3300031731 Ga0307405_10015580 Ga0307405_100155802 358
614 3300031731 Ga0307405_10020411 Ga0307405_100204112 358
615 3300031731 Ga0307405_10035186 Ga0307405_100351863 358
616 3300031731 Ga0307405_10047546 Ga0307405_100475463 358
617 3300031824 Ga0307413_10206950 Ga0307413_102069502 358
618 3300031901 Ga0307406_10054623 Ga0307406_100546231 358
619 3300031901 Ga0307406_10177528 Ga0307406_101775281 358
620 3300031911 Ga0307412_10004978 Ga0307412_100049782 358
621 3300031911 Ga0307412_10010098 Ga0307412_100100983 358
622 3300031911 Ga0307412_10011635 Ga0307412_100116353 358
623 3300031911 Ga0307412_10070663 Ga0307412_100706634 358
624 3300031911 Ga0307412_10136679 Ga0307412_101366791 358
625 3300031911 Ga0307412_10342345 Ga0307412_103423451 358
626 3300031995 Ga0307409_100308695 Ga0307409_1003086951 358
627 3300032004 Ga0307414_10010683 Ga0307414_100106832 358
628 3300032004 Ga0307414_10080054 Ga0307414_100800541 358
629 3300032004 Ga0307414_10167106 Ga0307414_101671061 358
630 3300032005 Ga0307411_10004175 Ga0307411_100041756 358
631 3300032005 Ga0307411_10061013 Ga0307411_100610132 358
632 3300033180 Ga0307510_10080780 Ga0307510_100807802 358
633 3300038705 Ga0237819_01651 Ga0237819_01651_1834_2910 358
634 3300041405 Ga0439438_003063 Ga0439438_003063_1264_2340 358
635 3300041405 Ga0439438_004424 Ga0439438_004424_1668_2744 358
636 3300041405 Ga0439438_007724 Ga0439438_007724_2301_3377 358
637 3300041405 Ga0439438_008159 Ga0439438_008159_1029_2105 358
638 3300041405 Ga0439438_010286 Ga0439438_010286_1365_2441 358
639 3300041405 Ga0439438_010599 Ga0439438_010599_812_1888 358
640 3300041407 Ga0439447_002909 Ga0439447_002909_2154_3230 358
641 3300041407 Ga0439447_004126 Ga0439447_004126_2980_4086 358
642 3300041407 Ga0439447_010213 Ga0439447_010213_1323_2399 358
643 3300041407 Ga0439447_013779 Ga0439447_013779_479_1555 358
644 3300041407 Ga0439447_025490 Ga0439447_025490_202_1278 358
645 3300041411 Ga0439466_0002304 Ga0439466_0002304_6016_7092 358
646 3300041411 Ga0439466_0011884 Ga0439466_0011884_1894_2970 358
647 3300041411 Ga0439466_0048523 Ga0439466_0048523_129_1205 358
648 3300041413 Ga0439465_0006145 Ga0439465_0006145_2042_3118 358
649 3300041997 Ga0439431_0015133 Ga0439431_0015133_266_1342 358
650 3300042004 Ga0439445_0017603 Ga0439445_0017603_458_1534 358
651 3300042006 Ga0439432_001052 Ga0439432_001052_1351_2427 358
652 3300042006 Ga0439432_001239 Ga0439432_001239_8019_9095 358
653 3300042006 Ga0439432_013331 Ga0439432_013331_484_1560 358
654 3300042006 Ga0439432_013845 Ga0439432_013845_652_1728 358
655 3300042006 Ga0439432_053368 Ga0439432_053368_165_1241 358
656 3300042009 Ga0439451_001638 Ga0439451_001638_1858_2964 358
657 3300042009 Ga0439451_007465 Ga0439451_007465_187_1263 358
658 3300042009 Ga0439451_011741 Ga0439451_011741_193_1299 358
659 3300042010 Ga0439452_000503 Ga0439452_000503_392_1468 358
660 3300042010 Ga0439452_000725 Ga0439452_000725_12257_13333 358
661 3300042010 Ga0439452_001131 Ga0439452_001131_9017_10093 358
662 3300042010 Ga0439452_009692 Ga0439452_009692_715_1863 358
663 3300042013 Ga0439456_002594 Ga0439456_002594_2297_3373 358
664 3300042115 Ga0450911_000556 Ga0450911_000556_8989_10065 358
665 3300042115 Ga0450911_001193 Ga0450911_001193_5048_6124 358
666 3300042115 Ga0450911_006325 Ga0450911_006325_450_1526 358
667 3300042121 Ga0450919_000614 Ga0450919_000614_3236_4312 358
668 3300042124 Ga0450922_002582 Ga0450922_002582_27_1103 358
669 3300042127 Ga0450890_000186 Ga0450890_000186_3091_4167 358
670 3300042135 Ga0450899_005350 Ga0450899_005350_45_1121 358
671 3300042137 Ga0450902_001984 Ga0450902_001984_1715_2791 358
672 3300042137 Ga0450902_003594 Ga0450902_003594_841_1947 358
673 3300042138 Ga0450903_001216 Ga0450903_001216_986_2092 358
674 3300042138 Ga0450903_002098 Ga0450903_002098_1652_2758 358
675 3300042142 Ga0450905_004857 Ga0450905_004857_454_1560 358
676 3300042146 Ga0450907_000132 Ga0450907_000132_24917_26023 358
677 3300042156 Ga0439446_0008405 Ga0439446_0008405_342_1418 358
678 3300042184 Ga0450908_005178 Ga0450908_005178_1211_2287 358
679 3300042185 Ga0450909_002104 Ga0450909_002104_1648_2754 358
680 3300042435 Ga0439434_0000469 Ga0439434_0000469_9206_10312 358
681 3300042439 Ga0439464_0001884 Ga0439464_0001884_918_2000 358
682 3300042461 Ga0439460_0001104 Ga0439460_0001104_3678_4784 358
683 3300042461 Ga0439460_0005590 Ga0439460_0005590_228_1304 358
684 3300042531 Ga0450918_006823 Ga0450918_006823_412_1488 358
685 3300042531 Ga0450918_007755 Ga0450918_007755_156_1232 358
686 3300042532 Ga0450893_0005323 Ga0450893_0005323_969_2045 358
687 3300042532 Ga0450893_0006099 Ga0450893_0006099_640_1716 358
688 3300042993 Ga0439440_0003112 Ga0439440_0003112_223_1299 358
689 3300046452 Ga0495617_007544 Ga0495617_007544_2000_3163 358
690 3300046452 Ga0495617_007874 Ga0495617_007874_887_1963 358
691 3300046452 Ga0495617_008135 Ga0495617_008135_2189_3265 358
692 3300046452 Ga0495617_013419 Ga0495617_013419_1153_2229 358
693 3300046452 Ga0495617_034397 Ga0495617_034397_441_1517 358
694 3300046452 Ga0495617_035578 Ga0495617_035578_293_1369 358
695 3300046452 Ga0495617_063456 Ga0495617_063456_49_1155 358
696 3300046453 Ga0495627_001088 Ga0495627_001088_16432_17508 358
697 3300046453 Ga0495627_001530 Ga0495627_001530_11594_12685 358
698 3300046453 Ga0495627_002082 Ga0495627_002082_8776_9852 358
699 3300046453 Ga0495627_002418 Ga0495627_002418_302_1378 358
700 3300046453 Ga0495627_019177 Ga0495627_019177_906_1982 358
701 3300046453 Ga0495627_027563 Ga0495627_027563_220_1296 358
702 3300046453 Ga0495627_034930 Ga0495627_034930_273_1349 358
703 3300046453 Ga0495627_046484 Ga0495627_046484_182_1258 358
704 3300046455 Ga0495603_0093853 Ga0495603_0093853_489_1595 358
705 3300046457 Ga0495590_0040802 Ga0495590_0040802_77_1153 358
706 3300046457 Ga0495590_0063481 Ga0495590_0063481_127_1203 358
707 3300046458 Ga0495591_000232 Ga0495591_000232_1603_2709 358
708 3300046458 Ga0495591_002090 Ga0495591_002090_925_2001 358
709 3300046458 Ga0495591_004045 Ga0495591_004045_594_1685 358
710 3300046458 Ga0495591_005488 Ga0495591_005488_2293_3369 358
711 3300046458 Ga0495591_009586 Ga0495591_009586_883_1959 358
712 3300046458 Ga0495591_011334 Ga0495591_011334_1494_2570 358
713 3300046458 Ga0495591_014750 Ga0495591_014750_416_1492 358
714 3300046458 Ga0495591_020147 Ga0495591_020147_129_1205 358
715 3300046458 Ga0495591_022755 Ga0495591_022755_444_1607 358
716 3300046458 Ga0495591_024718 Ga0495591_024718_604_1680 358
717 3300046458 Ga0495591_028244 Ga0495591_028244_316_1422 358
718 3300046458 Ga0495591_030373 Ga0495591_030373_327_1403 358
719 3300046460 Ga0495638_0001278 Ga0495638_0001278_22059_23135 358
720 3300046460 Ga0495638_0001733 Ga0495638_0001733_17917_18993 358
721 3300046460 Ga0495638_0003235 Ga0495638_0003235_10312_11388 358
722 3300046460 Ga0495638_0007902 Ga0495638_0007902_3669_4745 358
723 3300046460 Ga0495638_0016807 Ga0495638_0016807_1219_2295 358
724 3300046460 Ga0495638_0032805 Ga0495638_0032805_1314_2390 358
725 3300046460 Ga0495638_0039406 Ga0495638_0039406_310_1416 358
726 3300046460 Ga0495638_0043708 Ga0495638_0043708_982_2088 358
727 3300046460 Ga0495638_0053634 Ga0495638_0053634_1402_2478 358
728 3300046460 Ga0495638_0136818 Ga0495638_0136818_202_1308 358
729 3300046463 Ga0495653_0003427 Ga0495653_0003427_9463_10569 358
730 3300046463 Ga0495653_0061150 Ga0495653_0061150_1548_2624 358
731 3300046463 Ga0495653_0108837 Ga0495653_0108837_680_1759 358
732 3300046471 Ga0495650_0000620 Ga0495650_0000620_8623_9699 358
733 3300046471 Ga0495650_0003804 Ga0495650_0003804_2705_3781 358
734 3300046471 Ga0495650_0018018 Ga0495650_0018018_1142_2248 358
735 3300046471 Ga0495650_0019745 Ga0495650_0019745_1585_2661 358
736 3300046471 Ga0495650_0021006 Ga0495650_0021006_1559_2635 358
737 3300046471 Ga0495650_0028854 Ga0495650_0028854_1059_2135 358
738 3300046471 Ga0495650_0032030 Ga0495650_0032030_645_1721 358
739 3300046471 Ga0495650_0041544 Ga0495650_0041544_388_1551 358
740 3300046471 Ga0495650_0053585 Ga0495650_0053585_145_1221 358
741 3300046473 Ga0495582_0032844 Ga0495582_0032844_870_1976 358
742 3300046474 Ga0495605_0000011 Ga0495605_0000011_102975_104051 358
743 3300046474 Ga0495605_0004680 Ga0495605_0004680_1316_2422 358
744 3300046474 Ga0495605_0006308 Ga0495605_0006308_2064_3140 358
745 3300046474 Ga0495605_0019149 Ga0495605_0019149_958_2034 358
746 3300046474 Ga0495605_0031595 Ga0495605_0031595_1109_2185 358
747 3300046474 Ga0495605_0041700 Ga0495605_0041700_238_1314 358
748 3300046474 Ga0495605_0045198 Ga0495605_0045198_315_1391 358
749 3300046474 Ga0495605_0057322 Ga0495605_0057322_399_1562 358
750 3300046474 Ga0495605_0064398 Ga0495605_0064398_200_1276 358
751 3300046475 Ga0495639_0007670 Ga0495639_0007670_2318_3424 358
752 3300046475 Ga0495639_0022907 Ga0495639_0022907_870_1976 358
753 3300046477 Ga0495664_0143103 Ga0495664_0143103_267_1373 358
754 3300046491 Ga0495584_0000733 Ga0495584_0000733_986_2062 358
755 3300046491 Ga0495584_0001356 Ga0495584_0001356_13614_14690 358
756 3300046491 Ga0495584_0004349 Ga0495584_0004349_5939_7015 358
757 3300046491 Ga0495584_0004438 Ga0495584_0004438_5761_6837 358
758 3300046491 Ga0495584_0020003 Ga0495584_0020003_1296_2372 358
759 3300046491 Ga0495584_0024123 Ga0495584_0024123_1299_2375 358
760 3300046491 Ga0495584_0041935 Ga0495584_0041935_502_1578 358
761 3300046491 Ga0495584_0051925 Ga0495584_0051925_224_1330 358
762 3300046491 Ga0495584_0064320 Ga0495584_0064320_380_1456 358
763 3300046491 Ga0495584_0067625 Ga0495584_0067625_528_1766 358
764 3300046491 Ga0495584_0071595 Ga0495584_0071595_519_1595 358
765 3300046491 Ga0495584_0087044 Ga0495584_0087044_74_1150 358
766 3300046492 Ga0495585_0000376 Ga0495585_0000376_2501_3577 358
767 3300046492 Ga0495585_0001401 Ga0495585_0001401_232_1308 358
768 3300046492 Ga0495585_0002451 Ga0495585_0002451_11322_12398 358
769 3300046492 Ga0495585_0004975 Ga0495585_0004975_864_1940 358
770 3300046492 Ga0495585_0009335 Ga0495585_0009335_98_1261 358
771 3300046492 Ga0495585_0017146 Ga0495585_0017146_2876_3982 358
772 3300046492 Ga0495585_0022896 Ga0495585_0022896_851_1927 358
773 3300046492 Ga0495585_0027527 Ga0495585_0027527_2017_3096 358
774 3300046492 Ga0495585_0032590 Ga0495585_0032590_596_1672 358
775 3300046492 Ga0495585_0049406 Ga0495585_0049406_1023_2099 358
776 3300046492 Ga0495585_0098129 Ga0495585_0098129_293_1369 358
777 3300046499 Ga0495594_0003631 Ga0495594_0003631_6358_7434 358
778 3300046499 Ga0495594_0006659 Ga0495594_0006659_1228_2334 358
779 3300046499 Ga0495594_0017044 Ga0495594_0017044_1709_2815 358
780 3300046499 Ga0495594_0090479 Ga0495594_0090479_228_1304 358
781 3300046500 Ga0495596_0000597 Ga0495596_0000597_20520_21626 358
782 3300046500 Ga0495596_0032707 Ga0495596_0032707_174_1250 358
783 3300046501 Ga0495607_0005314 Ga0495607_0005314_651_1727 358
784 3300046501 Ga0495607_0006278 Ga0495607_0006278_7111_8187 358
785 3300046501 Ga0495607_0008011 Ga0495607_0008011_231_1307 358
786 3300046501 Ga0495607_0009933 Ga0495607_0009933_830_1936 358
787 3300046501 Ga0495607_0024767 Ga0495607_0024767_966_2072 358
788 3300046501 Ga0495607_0033217 Ga0495607_0033217_1708_2832 358
789 3300046501 Ga0495607_0050009 Ga0495607_0050009_1224_2300 358
790 3300046501 Ga0495607_0057633 Ga0495607_0057633_582_1661 358
791 3300046501 Ga0495607_0067430 Ga0495607_0067430_258_1421 358
792 3300046501 Ga0495607_0109417 Ga0495607_0109417_230_1306 358
793 3300046501 Ga0495607_0150109 Ga0495607_0150109_80_1156 358
794 3300046506 Ga0495583_0000047 Ga0495583_0000047_210378_211454 358
795 3300046506 Ga0495583_0001432 Ga0495583_0001432_15469_16593 358
796 3300046506 Ga0495583_0006317 Ga0495583_0006317_4153_5229 358
797 3300046506 Ga0495583_0013044 Ga0495583_0013044_2940_4016 358
798 3300046506 Ga0495583_0017557 Ga0495583_0017557_1476_2552 358
799 3300046506 Ga0495583_0024957 Ga0495583_0024957_1728_2804 358
800 3300046506 Ga0495583_0032503 Ga0495583_0032503_479_1555 358
801 3300046507 Ga0495606_0001195 Ga0495606_0001195_244_1350 358
802 3300046507 Ga0495606_0004689 Ga0495606_0004689_886_1962 358
803 3300046507 Ga0495606_0008803 Ga0495606_0008803_7327_8403 358
804 3300046507 Ga0495606_0020545 Ga0495606_0020545_982_2058 358
805 3300046507 Ga0495606_0035400 Ga0495606_0035400_478_1557 358
806 3300046507 Ga0495606_0045550 Ga0495606_0045550_1265_2341 358
807 3300046507 Ga0495606_0062943 Ga0495606_0062943_1174_2250 358
808 3300046507 Ga0495606_0100675 Ga0495606_0100675_542_1618 358
809 3300046512 Ga0495610_0001544 Ga0495610_0001544_960_2036 358
810 3300046512 Ga0495610_0010879 Ga0495610_0010879_1052_2128 358
811 3300046512 Ga0495610_0012081 Ga0495610_0012081_832_1956 358
812 3300046512 Ga0495610_0015944 Ga0495610_0015944_769_1845 358
813 3300046512 Ga0495610_0016333 Ga0495610_0016333_998_2074 358
814 3300046512 Ga0495610_0016615 Ga0495610_0016615_1840_2916 358
815 3300046512 Ga0495610_0017950 Ga0495610_0017950_2708_3814 358
816 3300046512 Ga0495610_0018259 Ga0495610_0018259_2412_3488 358
817 3300046512 Ga0495610_0025843 Ga0495610_0025843_1474_2550 358
818 3300046512 Ga0495610_0034270 Ga0495610_0034270_187_1278 358
819 3300046512 Ga0495610_0039474 Ga0495610_0039474_946_2052 358
820 3300046512 Ga0495610_0040082 Ga0495610_0040082_185_1261 358
821 3300046512 Ga0495610_0044321 Ga0495610_0044321_272_1348 358
822 3300046512 Ga0495610_0050340 Ga0495610_0050340_201_1364 358
823 3300046512 Ga0495610_0059085 Ga0495610_0059085_158_1264 358
824 3300046513 Ga0495616_0002009 Ga0495616_0002009_9732_10808 358
825 3300046513 Ga0495616_0003866 Ga0495616_0003866_520_1596 358
826 3300046513 Ga0495616_0014930 Ga0495616_0014930_2562_3668 358
827 3300046513 Ga0495616_0029487 Ga0495616_0029487_527_1603 358
828 3300046513 Ga0495616_0032457 Ga0495616_0032457_337_1413 358
829 3300046513 Ga0495616_0042164 Ga0495616_0042164_1035_2141 358
830 3300046515 Ga0495620_0000225 Ga0495620_0000225_5328_6404 358
831 3300046515 Ga0495620_0002160 Ga0495620_0002160_9482_10558 358
832 3300046515 Ga0495620_0003662 Ga0495620_0003662_6658_7821 358
833 3300046515 Ga0495620_0004065 Ga0495620_0004065_1012_2088 358
834 3300046515 Ga0495620_0004722 Ga0495620_0004722_6237_7313 358
835 3300046515 Ga0495620_0004859 Ga0495620_0004859_5894_6985 358
836 3300046517 Ga0495630_0001621 Ga0495630_0001621_14527_15603 358
837 3300046517 Ga0495630_0073954 Ga0495630_0073954_1264_2535 358
838 3300046517 Ga0495630_0105657 Ga0495630_0105657_830_2101 358
839 3300046517 Ga0495630_0115477 Ga0495630_0115477_282_1358 358
840 3300046518 Ga0495631_0000280 Ga0495631_0000280_12414_13577 358
841 3300046518 Ga0495631_0014162 Ga0495631_0014162_1087_2211 358
842 3300046518 Ga0495631_0014537 Ga0495631_0014537_2381_3457 358
843 3300046518 Ga0495631_0020511 Ga0495631_0020511_1675_2751 358
844 3300046518 Ga0495631_0050474 Ga0495631_0050474_260_1336 358
845 3300046518 Ga0495631_0071067 Ga0495631_0071067_198_1304 358
846 3300046519 Ga0495632_0002507 Ga0495632_0002507_12300_13376 358
847 3300046519 Ga0495632_0004158 Ga0495632_0004158_7700_8776 358
848 3300046519 Ga0495632_0004931 Ga0495632_0004931_564_1670 358
849 3300046519 Ga0495632_0012843 Ga0495632_0012843_594_1670 358
850 3300046519 Ga0495632_0017873 Ga0495632_0017873_1000_2076 358
851 3300046519 Ga0495632_0019958 Ga0495632_0019958_216_1292 358
852 3300046519 Ga0495632_0021504 Ga0495632_0021504_1519_2595 358
853 3300046519 Ga0495632_0023780 Ga0495632_0023780_580_1671 358
854 3300046519 Ga0495632_0025528 Ga0495632_0025528_1453_2529 358
855 3300046519 Ga0495632_0064390 Ga0495632_0064390_201_1277 358
856 3300046520 Ga0495637_0000630 Ga0495637_0000630_8872_9948 358
857 3300046520 Ga0495637_0000871 Ga0495637_0000871_17524_18630 358
858 3300046520 Ga0495637_0001699 Ga0495637_0001699_10442_11518 358
859 3300046520 Ga0495637_0005266 Ga0495637_0005266_4494_5570 358
860 3300046520 Ga0495637_0013339 Ga0495637_0013339_2527_3690 358
861 3300046520 Ga0495637_0013341 Ga0495637_0013341_1716_2792 358
862 3300046520 Ga0495637_0016726 Ga0495637_0016726_1541_2617 358
863 3300046520 Ga0495637_0030335 Ga0495637_0030335_1109_2185 358
864 3300046520 Ga0495637_0031521 Ga0495637_0031521_905_1981 358
865 3300046520 Ga0495637_0042147 Ga0495637_0042147_502_1578 358
866 3300046520 Ga0495637_0043340 Ga0495637_0043340_637_1713 358
867 3300046522 Ga0495643_0003509 Ga0495643_0003509_645_1721 358
868 3300046522 Ga0495643_0015736 Ga0495643_0015736_2937_4013 358
869 3300046522 Ga0495643_0016385 Ga0495643_0016385_1010_2116 358
870 3300046522 Ga0495643_0025996 Ga0495643_0025996_856_2094 358
871 3300046522 Ga0495643_0026415 Ga0495643_0026415_1109_2233 358
872 3300046522 Ga0495643_0117827 Ga0495643_0117827_95_1201 358
873 3300046523 Ga0495644_0002507 Ga0495644_0002507_5574_6650 358
874 3300046523 Ga0495644_0002520 Ga0495644_0002520_5662_6738 358
875 3300046523 Ga0495644_0006504 Ga0495644_0006504_3301_4377 358
876 3300046523 Ga0495644_0015259 Ga0495644_0015259_1363_2439 358
877 3300046523 Ga0495644_0021597 Ga0495644_0021597_1013_2119 358
878 3300046523 Ga0495644_0031138 Ga0495644_0031138_712_1788 358
879 3300046524 Ga0495648_0002196 Ga0495648_0002196_3638_4714 358
880 3300046524 Ga0495648_0018563 Ga0495648_0018563_520_1596 358
881 3300046524 Ga0495648_0044527 Ga0495648_0044527_213_1319 358
882 3300046524 Ga0495648_0045100 Ga0495648_0045100_1461_2537 358
883 3300046524 Ga0495648_0049359 Ga0495648_0049359_233_1339 358
884 3300046524 Ga0495648_0076690 Ga0495648_0076690_323_1399 358
885 3300046524 Ga0495648_0086476 Ga0495648_0086476_338_1414 358
886 3300046524 Ga0495648_0138334 Ga0495648_0138334_73_1179 358
887 3300046524 Ga0495648_0151883 Ga0495648_0151883_35_1111 358
888 3300046526 Ga0495666_0006061 Ga0495666_0006061_4740_5816 358
889 3300046526 Ga0495666_0028391 Ga0495666_0028391_738_1814 358
890 3300046526 Ga0495666_0040403 Ga0495666_0040403_891_1967 358
891 3300046528 Ga0495642_0000027 Ga0495642_0000027_21897_23003 358
892 3300046528 Ga0495642_0001462 Ga0495642_0001462_1259_2335 358
893 3300046528 Ga0495642_0003766 Ga0495642_0003766_4419_5495 358
894 3300046530 Ga0495654_0000096 Ga0495654_0000096_89690_90766 358
895 3300046530 Ga0495654_0002752 Ga0495654_0002752_4871_5947 358
896 3300046530 Ga0495654_0003864 Ga0495654_0003864_7835_8911 358
897 3300046530 Ga0495654_0005166 Ga0495654_0005166_2576_3652 358
898 3300046530 Ga0495654_0006125 Ga0495654_0006125_4784_5860 358
899 3300046530 Ga0495654_0008426 Ga0495654_0008426_205_1311 358
900 3300046530 Ga0495654_0009678 Ga0495654_0009678_3851_4957 358
901 3300046530 Ga0495654_0011226 Ga0495654_0011226_136_1212 358
902 3300046530 Ga0495654_0013108 Ga0495654_0013108_1559_2665 358
903 3300046530 Ga0495654_0015333 Ga0495654_0015333_1300_2406 358
904 3300046530 Ga0495654_0028011 Ga0495654_0028011_491_1597 358
905 3300046530 Ga0495654_0048813 Ga0495654_0048813_777_1940 358
906 3300046530 Ga0495654_0052083 Ga0495654_0052083_826_1902 358
907 3300046530 Ga0495654_0058245 Ga0495654_0058245_757_1833 358
908 3300046530 Ga0495654_0063942 Ga0495654_0063942_585_1661 358
909 3300046530 Ga0495654_0083604 Ga0495654_0083604_197_1273 358
910 3300046530 Ga0495654_0085782 Ga0495654_0085782_210_1286 358
911 3300046535 Ga0495586_0011665 Ga0495586_0011665_3394_4500 358
912 3300046536 Ga0495587_0001493 Ga0495587_0001493_2217_3293 358
913 3300046536 Ga0495587_0011869 Ga0495587_0011869_3321_4427 358
914 3300046538 Ga0495609_0000004 Ga0495609_0000004_490216_491292 358
915 3300046538 Ga0495609_0000360 Ga0495609_0000360_5694_6770 358
916 3300046538 Ga0495609_0001254 Ga0495609_0001254_15449_16525 358
917 3300046538 Ga0495609_0003270 Ga0495609_0003270_7896_8972 358
918 3300046538 Ga0495609_0005619 Ga0495609_0005619_4797_5873 358
919 3300046538 Ga0495609_0008683 Ga0495609_0008683_394_1470 358
920 3300046538 Ga0495609_0022256 Ga0495609_0022256_1450_2526 358
921 3300046538 Ga0495609_0022419 Ga0495609_0022419_1053_2159 358
922 3300046538 Ga0495609_0043418 Ga0495609_0043418_358_1434 358
923 3300046538 Ga0495609_0044125 Ga0495609_0044125_74_1150 358
924 3300046542 Ga0495597_0001669 Ga0495597_0001669_523_1599 358
925 3300046542 Ga0495597_0011466 Ga0495597_0011466_1016_2092 358
926 3300046542 Ga0495597_0011624 Ga0495597_0011624_438_1514 358
927 3300046542 Ga0495597_0011634 Ga0495597_0011634_803_1879 358
928 3300046542 Ga0495597_0026156 Ga0495597_0026156_1271_2347 358
929 3300046542 Ga0495597_0026339 Ga0495597_0026339_1501_2577 358
930 3300046542 Ga0495597_0036370 Ga0495597_0036370_1001_2077 358
931 3300046542 Ga0495597_0038287 Ga0495597_0038287_991_2067 358
932 3300046543 Ga0495645_0141105 Ga0495645_0141105_462_1586 358
933 3300046557 Ga0495622_0001364 Ga0495622_0001364_1294_2370 358
934 3300046557 Ga0495622_0002770 Ga0495622_0002770_6761_7837 358
935 3300046557 Ga0495622_0029990 Ga0495622_0029990_1422_2498 358
936 3300046557 Ga0495622_0042043 Ga0495622_0042043_811_1917 358
937 3300046557 Ga0495622_0052666 Ga0495622_0052666_135_1211 358
938 3300046557 Ga0495622_0112533 Ga0495622_0112533_146_1222 358
939 3300046558 Ga0495633_0000206 Ga0495633_0000206_5457_6533 358
940 3300046558 Ga0495633_0006362 Ga0495633_0006362_5845_7008 358
941 3300046558 Ga0495633_0023386 Ga0495633_0023386_1473_2549 358
942 3300046558 Ga0495633_0065661 Ga0495633_0065661_276_1382 358
943 3300046558 Ga0495633_0082593 Ga0495633_0082593_382_1458 358
944 3300046615 Ga0495656_0060819 Ga0495656_0060819_112_1218 358
945 3300046615 Ga0495656_0115997 Ga0495656_0115997_45_1121 358
946 3300046616 Ga0495668_0001701 Ga0495668_0001701_1261_2367 358
947 3300046616 Ga0495668_0003203 Ga0495668_0003203_156_1232 358
948 3300046616 Ga0495668_0028596 Ga0495668_0028596_999_2075 358
949 3300046616 Ga0495668_0033494 Ga0495668_0033494_1587_2663 358
950 3300046616 Ga0495668_0044190 Ga0495668_0044190_585_1661 358
951 3300046642 Ga0495634_0000967 Ga0495634_0000967_1843_2919 358
952 3300046648 Ga0495611_0000594 Ga0495611_0000594_13594_14670 358
953 3300046648 Ga0495611_0000656 Ga0495611_0000656_13944_15020 358
954 3300046648 Ga0495611_0000770 Ga0495611_0000770_592_1668 358
955 3300046648 Ga0495611_0035498 Ga0495611_0035498_1039_2115 358
956 3300046648 Ga0495611_0055092 Ga0495611_0055092_613_1689 358
957 3300046660 Ga0495625_0000076 Ga0495625_0000076_67494_68570 358
958 3300046660 Ga0495625_0004417 Ga0495625_0004417_11519_12682 358
959 3300046660 Ga0495625_0007516 Ga0495625_0007516_7803_8879 358
960 3300046660 Ga0495625_0016243 Ga0495625_0016243_1013_2119 358
961 3300046660 Ga0495625_0023825 Ga0495625_0023825_1973_3049 358
962 3300046660 Ga0495625_0050568 Ga0495625_0050568_493_1569 358
963 3300046660 Ga0495625_0083892 Ga0495625_0083892_760_1836 358
964 3300046663 Ga0495635_0000752 Ga0495635_0000752_1552_2628 358
965 3300046663 Ga0495635_0001802 Ga0495635_0001802_1167_2273 358
966 3300046664 Ga0495659_0004979 Ga0495659_0004979_2093_3169 358
967 3300046664 Ga0495659_0017477 Ga0495659_0017477_1239_2315 358
968 3300046665 Ga0495661_0000005 Ga0495661_0000005_217216_218292 358
969 3300046665 Ga0495661_0000099 Ga0495661_0000099_85786_86862 358
970 3300046665 Ga0495661_0000127 Ga0495661_0000127_80511_81590 358
971 3300046665 Ga0495661_0000773 Ga0495661_0000773_782_1873 358
972 3300046665 Ga0495661_0007011 Ga0495661_0007011_6659_7822 358
973 3300046665 Ga0495661_0039141 Ga0495661_0039141_859_1935 358
974 3300046665 Ga0495661_0042222 Ga0495661_0042222_1663_2739 358
975 3300046665 Ga0495661_0097094 Ga0495661_0097094_358_1464 358
976 3300046665 Ga0495661_0098029 Ga0495661_0098029_76_1152 358
977 3300046674 Ga0495588_0004580 Ga0495588_0004580_501_1577 358
978 3300046674 Ga0495588_0028030 Ga0495588_0028030_1004_2110 358
979 3300046674 Ga0495588_0028901 Ga0495588_0028901_30_1136 358
980 3300046679 Ga0495623_0001889 Ga0495623_0001889_12347_13423 358
981 3300046679 Ga0495623_0021455 Ga0495623_0021455_2846_3922 358
982 3300046680 Ga0495646_0005511 Ga0495646_0005511_1078_2184 358
983 3300046680 Ga0495646_0011937 Ga0495646_0011937_1358_2434 358
984 3300046680 Ga0495646_0042659 Ga0495646_0042659_300_1538 358
985 3300046684 Ga0495669_0016103 Ga0495669_0016103_936_2012 358
986 3300046684 Ga0495669_0034601 Ga0495669_0034601_157_1263 358
987 3300046689 Ga0495613_0022420 Ga0495613_0022420_1203_2309 358
988 3300046689 Ga0495613_0040240 Ga0495613_0040240_1028_2266 358
989 3300046689 Ga0495613_0103158 Ga0495613_0103158_155_1231 358
990 3300046689 Ga0495613_0228727 Ga0495613_0228727_103_1179 358
991 3300046690 Ga0495624_0004783 Ga0495624_0004783_8030_9268 358
992 3300046691 Ga0495670_0001322 Ga0495670_0001322_9317_10393 358
993 3300046691 Ga0495670_0002495 Ga0495670_0002495_7575_8651 358
994 3300046691 Ga0495670_0003468 Ga0495670_0003468_1301_2407 358
995 3300046691 Ga0495670_0006604 Ga0495670_0006604_424_1500 358
996 3300046691 Ga0495670_0039610 Ga0495670_0039610_1069_2145 358
997 3300046692 Ga0495671_0000908 Ga0495671_0000908_18724_19830 358
998 3300046692 Ga0495671_0003363 Ga0495671_0003363_519_1757 358
999 3300046692 Ga0495671_0004322 Ga0495671_0004322_7273_8349 358
1000 3300046692 Ga0495671_0010112 Ga0495671_0010112_3804_4910 358
1001 3300046692 Ga0495671_0010611 Ga0495671_0010611_1667_2791 358
1002 3300046692 Ga0495671_0014752 Ga0495671_0014752_2584_3660 358
1003 3300046692 Ga0495671_0016273 Ga0495671_0016273_132_1208 358
1004 3300046692 Ga0495671_0020993 Ga0495671_0020993_1580_2656 358
1005 3300046692 Ga0495671_0028218 Ga0495671_0028218_413_1489 358
1006 3300046692 Ga0495671_0044861 Ga0495671_0044861_965_2041 358
1007 3300046692 Ga0495671_0054332 Ga0495671_0054332_460_1536 358
1008 3300046692 Ga0495671_0062466 Ga0495671_0062466_334_1410 358
1009 3300046692 Ga0495671_0090416 Ga0495671_0090416_183_1265 358
1010 3300046692 Ga0495671_0099551 Ga0495671_0099551_191_1297 358
1011 3300046694 Ga0495649_0003430 Ga0495649_0003430_252_1328 358
1012 3300046694 Ga0495649_0006888 Ga0495649_0006888_999_2105 358
1013 3300046694 Ga0495649_0011489 Ga0495649_0011489_218_1324 358
1014 3300046694 Ga0495649_0023301 Ga0495649_0023301_880_1956 358
1015 3300046694 Ga0495649_0032213 Ga0495649_0032213_765_1871 358
1016 3300046694 Ga0495649_0045152 Ga0495649_0045152_104_1180 358
1017 3300046694 Ga0495649_0067577 Ga0495649_0067577_318_1394 358
1018 3300046694 Ga0495649_0087866 Ga0495649_0087866_57_1133 358
1019 3300046694 Ga0495649_0134911 Ga0495649_0134911_90_1166 358
1020 3300046794 Ga0495589_0000777 Ga0495589_0000777_18625_19731 358
1021 3300046794 Ga0495589_0003301 Ga0495589_0003301_1591_2667 358
1022 3300046794 Ga0495589_0007266 Ga0495589_0007266_801_1907 358
1023 3300046794 Ga0495589_0018660 Ga0495589_0018660_1790_2953 358
1024 3300046794 Ga0495589_0022307 Ga0495589_0022307_263_1339 358
1025 3300046794 Ga0495589_0027652 Ga0495589_0027652_867_1973 358
1026 3300046794 Ga0495589_0056830 Ga0495589_0056830_138_1214 358
1027 3300046794 Ga0495589_0073266 Ga0495589_0073266_116_1192 358
1028 3300046794 Ga0495589_0074064 Ga0495589_0074064_271_1347 358
1029 3300046809 Ga0495600_0007252 Ga0495600_0007252_3805_4911 358
1030 3300046809 Ga0495600_0028848 Ga0495600_0028848_2233_3309 358
1031 3300046809 Ga0495600_0036464 Ga0495600_0036464_444_1682 358
1032 3300046810 Ga0495660_0002363 Ga0495660_0002363_5835_6911 358
1033 3300046810 Ga0495660_0003734 Ga0495660_0003734_7371_8447 358
1034 3300046810 Ga0495660_0012950 Ga0495660_0012950_2774_3880 358
1035 3300046810 Ga0495660_0020560 Ga0495660_0020560_1870_2946 358
1036 3300046810 Ga0495660_0025858 Ga0495660_0025858_1004_2080 358
1037 3300046810 Ga0495660_0028570 Ga0495660_0028570_541_1617 358
1038 3300046810 Ga0495660_0040404 Ga0495660_0040404_520_1596 358
1039 3300046810 Ga0495660_0055122 Ga0495660_0055122_367_1443 358
1040 3300046810 Ga0495660_0071586 Ga0495660_0071586_350_1513 358
1041 3300046810 Ga0495660_0100401 Ga0495660_0100401_253_1329 358
1042 3300047315 Ga0495581_0015921 Ga0495581_0015921_3075_4181 358
1043 3300047315 Ga0495581_0068343 Ga0495581_0068343_451_1527 358
1044 3300047317 Ga0495604_0033465 Ga0495604_0033465_2754_3830 358
1045 3300047317 Ga0495604_0072913 Ga0495604_0072913_783_1889 358
1046 3300047319 Ga0495674_0005437 Ga0495674_0005437_632_1708 358
1047 3300047320 Ga0495672_0000952 Ga0495672_0000952_929_2035 358
1048 3300047320 Ga0495672_0001238 Ga0495672_0001238_4535_5641 358
1049 3300047320 Ga0495672_0005823 Ga0495672_0005823_7756_8832 358
1050 3300047320 Ga0495672_0008463 Ga0495672_0008463_1106_2182 358
1051 3300047320 Ga0495672_0043255 Ga0495672_0043255_1417_2541 358
1052 3300047320 Ga0495672_0050193 Ga0495672_0050193_165_1241 358
1053 3300047320 Ga0495672_0055929 Ga0495672_0055929_643_1719 358
1054 3300047320 Ga0495672_0057269 Ga0495672_0057269_693_1769 358
1055 3300047320 Ga0495672_0057795 Ga0495672_0057795_148_1254 358
1056 3300047320 Ga0495672_0067620 Ga0495672_0067620_45_1121 358
1057 3300047320 Ga0495672_0073903 Ga0495672_0073903_483_1559 358
1058 3300047320 Ga0495672_0118341 Ga0495672_0118341_88_1164 358
1059 3300047321 Ga0495676_0000016 Ga0495676_0000016_66760_67836 358
1060 3300047321 Ga0495676_0002566 Ga0495676_0002566_14113_15189 358
1061 3300047321 Ga0495676_0082399 Ga0495676_0082399_988_2064 358
1062 3300047322 Ga0495680_0004320 Ga0495680_0004320_159_1265 358
1063 3300047322 Ga0495680_0018000 Ga0495680_0018000_660_1736 358
1064 3300047322 Ga0495680_0056009 Ga0495680_0056009_1237_2313 358
1065 3300047323 Ga0495683_0000031 Ga0495683_0000031_81196_82272 358
1066 3300047323 Ga0495683_0000322 Ga0495683_0000322_18725_19888 358
1067 3300047323 Ga0495683_0000902 Ga0495683_0000902_19219_20295 358
1068 3300047323 Ga0495683_0004157 Ga0495683_0004157_368_1474 358
1069 3300047323 Ga0495683_0019630 Ga0495683_0019630_2189_3265 358
1070 3300047323 Ga0495683_0125714 Ga0495683_0125714_44_1120 358
1071 3300047444 Ga0495675_0018128 Ga0495675_0018128_1300_2406 358
1072 3300047444 Ga0495675_0063457 Ga0495675_0063457_534_1610 358
1073 3300047444 Ga0495675_0086791 Ga0495675_0086791_787_1863 358
1074 3300047445 Ga0495677_0003900 Ga0495677_0003900_3559_4635 358
1075 3300047446 Ga0495679_000087 Ga0495679_000087_4649_5725 358
1076 3300047446 Ga0495679_000154 Ga0495679_000154_46965_48041 358
1077 3300047446 Ga0495679_012040 Ga0495679_012040_1436_2512 358
1078 3300047446 Ga0495679_014298 Ga0495679_014298_919_1995 358
1079 3300047446 Ga0495679_014799 Ga0495679_014799_1588_2664 358
1080 3300047446 Ga0495679_016261 Ga0495679_016261_211_1287 358
1081 3300047446 Ga0495679_018743 Ga0495679_018743_528_1604 358
1082 3300047447 Ga0495685_019273 Ga0495685_019273_161_1237 358
1083 3300047469 Ga0495673_0000704 Ga0495673_0000704_1627_2703 358
1084 3300047469 Ga0495673_0001106 Ga0495673_0001106_20067_21230 358
1085 3300047469 Ga0495673_0002388 Ga0495673_0002388_1327_2403 358
1086 3300047469 Ga0495673_0004200 Ga0495673_0004200_7305_8411 358
1087 3300047469 Ga0495673_0006307 Ga0495673_0006307_5641_6717 358
1088 3300047469 Ga0495673_0015126 Ga0495673_0015126_340_1416 358
1089 3300047469 Ga0495673_0015438 Ga0495673_0015438_1616_2740 358
1090 3300047469 Ga0495673_0018836 Ga0495673_0018836_1526_2602 358
1091 3300047469 Ga0495673_0022794 Ga0495673_0022794_1858_2934 358
1092 3300047469 Ga0495673_0025050 Ga0495673_0025050_1294_2370 358
1093 3300047469 Ga0495673_0030887 Ga0495673_0030887_437_1543 358
1094 3300047469 Ga0495673_0036977 Ga0495673_0036977_655_1731 358
1095 3300047469 Ga0495673_0045850 Ga0495673_0045850_159_1265 358
1096 3300047469 Ga0495673_0046077 Ga0495673_0046077_196_1272 358
1097 3300047469 Ga0495673_0070511 Ga0495673_0070511_179_1255 358
1098 3300047470 Ga0495681_0001149 Ga0495681_0001149_1003_2109 358
1099 3300047470 Ga0495681_0003165 Ga0495681_0003165_5745_6821 358
1100 3300047470 Ga0495681_0003188 Ga0495681_0003188_10121_11227 358
1101 3300047470 Ga0495681_0003564 Ga0495681_0003564_8729_9835 358
1102 3300047470 Ga0495681_0004680 Ga0495681_0004680_270_1346 358
1103 3300047470 Ga0495681_0013963 Ga0495681_0013963_2570_3646 358
1104 3300047470 Ga0495681_0019405 Ga0495681_0019405_2247_3353 358
1105 3300047470 Ga0495681_0024143 Ga0495681_0024143_1924_3000 358
1106 3300047470 Ga0495681_0027203 Ga0495681_0027203_1443_2606 358
1107 3300047470 Ga0495681_0039999 Ga0495681_0039999_963_2069 358
1108 3300047470 Ga0495681_0040015 Ga0495681_0040015_603_1694 358
1109 3300047470 Ga0495681_0081495 Ga0495681_0081495_18_1094 358
1110 3300047471 Ga0495684_0046103 Ga0495684_0046103_1139_2377 358
1111 3300047472 Ga0495686_0002947 Ga0495686_0002947_528_1766 358
1112 3300047472 Ga0495686_0016378 Ga0495686_0016378_3178_4254 358
1113 3300047472 Ga0495686_0018446 Ga0495686_0018446_233_1339 358
1114 3300047472 Ga0495686_0029408 Ga0495686_0029408_1887_2963 358
1115 3300047472 Ga0495686_0095488 Ga0495686_0095488_275_1381 358
1116 3300047472 Ga0495686_0109163 Ga0495686_0109163_369_1445 358
1117 3300047673 Ga0495593_0028044 Ga0495593_0028044_1750_2826 358
1118 3300047673 Ga0495593_0045035 Ga0495593_0045035_38_1114 358
1119 3300048088 Ga0495602_0110889 Ga0495602_0110889_847_1923 358
1120 3300048091 Ga0495626_0000098 Ga0495626_0000098_17182_18258 358
1121 3300048091 Ga0495626_0000230 Ga0495626_0000230_28983_30059 358
1122 3300048091 Ga0495626_0000263 Ga0495626_0000263_57665_58741 358
1123 3300048091 Ga0495626_0000577 Ga0495626_0000577_35011_36087 358
1124 3300048091 Ga0495626_0001223 Ga0495626_0001223_227_1303 358
1125 3300048091 Ga0495626_0004178 Ga0495626_0004178_7766_8842 358
1126 3300048091 Ga0495626_0004696 Ga0495626_0004696_6661_7737 358
1127 3300048091 Ga0495626_0005042 Ga0495626_0005042_646_1884 358
1128 3300048091 Ga0495626_0006801 Ga0495626_0006801_3937_5013 358
1129 3300048091 Ga0495626_0025224 Ga0495626_0025224_1753_2829 358
1130 3300048091 Ga0495626_0066570 Ga0495626_0066570_136_1212 358
1131 3300048905 Ga0496102_0000991 Ga0496102_0000991_1548_2624 358
1132 3300048906 Ga0496103_0000997 Ga0496103_0000997_673_1749 358
1133 3300048909 Ga0496106_0110942 Ga0496106_0110942_383_1459 358
1134 3300048913 Ga0496110_0056893 Ga0496110_0056893_658_1734 358
1135 3300048913 Ga0496110_0241448 Ga0496110_0241448_454_1560 358
1136 3300048919 Ga0496116_0000085 Ga0496116_0000085_557_1663 358
1137 3300048919 Ga0496116_0002312 Ga0496116_0002312_1322_2560 358
1138 3300048919 Ga0496116_0007971 Ga0496116_0007971_7901_8977 358
1139 3300048919 Ga0496116_0033598 Ga0496116_0033598_988_2064 358
1140 3300048919 Ga0496116_0045906 Ga0496116_0045906_605_1681 358
1141 3300048920 Ga0496117_0001620 Ga0496117_0001620_30303_31394 358
1142 3300048920 Ga0496117_0018402 Ga0496117_0018402_683_1759 358
1143 3300048920 Ga0496117_0022061 Ga0496117_0022061_833_1909 358
1144 3300048920 Ga0496117_0024440 Ga0496117_0024440_639_1745 358
1145 3300048920 Ga0496117_0050277 Ga0496117_0050277_290_1366 358
1146 3300048920 Ga0496117_0077709 Ga0496117_0077709_523_1629 358
1147 3300048920 Ga0496117_0149519 Ga0496117_0149519_164_1240 358
1148 3300048921 Ga0496118_0008257 Ga0496118_0008257_283_1359 358
1149 3300048921 Ga0496118_0021501 Ga0496118_0021501_996_2072 358
1150 3300048921 Ga0496118_0052475 Ga0496118_0052475_1699_2775 358
1151 3300048921 Ga0496118_0054134 Ga0496118_0054134_546_1652 358
1152 3300048921 Ga0496118_0065624 Ga0496118_0065624_780_1856 358
1153 3300048921 Ga0496118_0079460 Ga0496118_0079460_429_1520 358
1154 3300048921 Ga0496118_0083334 Ga0496118_0083334_978_2084 358
1155 3300048921 Ga0496118_0152586 Ga0496118_0152586_257_1333 358
1156 3300048921 Ga0496118_0156975 Ga0496118_0156975_225_1301 358
1157 3300048922 Ga0496119_0063537 Ga0496119_0063537_736_1827 358
1158 3300048922 Ga0496119_0071589 Ga0496119_0071589_466_1542 358
1159 3300048922 Ga0496119_0082378 Ga0496119_0082378_645_1721 358
1160 3300048923 Ga0496120_0008485 Ga0496120_0008485_660_1751 358
1161 3300048923 Ga0496120_0067004 Ga0496120_0067004_394_1470 358
1162 3300048924 Ga0496121_0000179 Ga0496121_0000179_603_1709 358
1163 3300048924 Ga0496121_0011251 Ga0496121_0011251_7928_9004 358
1164 3300048924 Ga0496121_0023305 Ga0496121_0023305_4386_5549 358
1165 3300048924 Ga0496121_0062161 Ga0496121_0062161_897_2003 358
1166 3300048924 Ga0496121_0090060 Ga0496121_0090060_102_1178 358
1167 3300048925 Ga0496122_0029324 Ga0496122_0029324_850_1926 358
1168 3300048925 Ga0496122_0048877 Ga0496122_0048877_540_1646 358
1169 3300048925 Ga0496122_0077274 Ga0496122_0077274_283_1359 358
1170 3300048925 Ga0496122_0108927 Ga0496122_0108927_525_1601 358
1171 3300048925 Ga0496122_0119113 Ga0496122_0119113_283_1374 358
1172 3300048926 Ga0496123_0048907 Ga0496123_0048907_978_2054 358
1173 3300048926 Ga0496123_0076472 Ga0496123_0076472_637_1743 358
1174 3300048927 Ga0496124_0001693 Ga0496124_0001693_679_1755 358
1175 3300048927 Ga0496124_0002847 Ga0496124_0002847_20529_21605 358
1176 3300048927 Ga0496124_0027297 Ga0496124_0027297_1001_2077 358
1177 3300048927 Ga0496124_0068606 Ga0496124_0068606_1734_2840 358
1178 3300048928 Ga0496125_0001691 Ga0496125_0001691_443_1519 358
1179 3300048928 Ga0496125_0005312 Ga0496125_0005312_12212_13375 358
1180 3300048928 Ga0496125_0038928 Ga0496125_0038928_1316_2392 358
1181 3300048928 Ga0496125_0085987 Ga0496125_0085987_318_1394 358
1182 3300048928 Ga0496125_0187946 Ga0496125_0187946_126_1202 358
1183 3300048929 Ga0496126_0009446 Ga0496126_0009446_804_1880 358
1184 3300048929 Ga0496126_0097180 Ga0496126_0097180_1322_2398 358
1185 3300048929 Ga0496126_0177264 Ga0496126_0177264_379_1470 358
1186 3300049459 Ga0495678_000186 Ga0495678_000186_6265_7341 358
1187 3300049459 Ga0495678_002417 Ga0495678_002417_213_1289 358
1188 3300049459 Ga0495678_003788 Ga0495678_003788_7808_8884 358
1189 3300049459 Ga0495678_006374 Ga0495678_006374_4700_5776 358
1190 3300049459 Ga0495678_008931 Ga0495678_008931_3434_4510 358
1191 3300049459 Ga0495678_008976 Ga0495678_008976_946_2022 358
1192 3300049459 Ga0495678_011686 Ga0495678_011686_548_1624 358
1193 3300049459 Ga0495678_014787 Ga0495678_014787_886_2124 358
1194 3300049459 Ga0495678_018255 Ga0495678_018255_881_1957 358
1195 3300049459 Ga0495678_018731 Ga0495678_018731_1015_2121 358
1196 3300049459 Ga0495678_022834 Ga0495678_022834_1516_2592 358
1197 3300049459 Ga0495678_034970 Ga0495678_034970_804_1880 358
1198 3300049459 Ga0495678_035291 Ga0495678_035291_551_1630 358
1199 3300049459 Ga0495678_035381 Ga0495678_035381_734_1840 358
1200 3300049459 Ga0495678_060052 Ga0495678_060052_116_1222 358
1201 3300049459 Ga0495678_064926 Ga0495678_064926_115_1191 358
1202 3300049460 Ga0495682_0013169 Ga0495682_0013169_528_1604 358
1203 3300049460 Ga0495682_0017012 Ga0495682_0017012_78_1154 358
1204 3300049460 Ga0495682_0017566 Ga0495682_0017566_1402_2508 358
1205 3300049460 Ga0495682_0038854 Ga0495682_0038854_174_1250 358
1206 3300049758 Ga0501241_002093 Ga0501241_002093_1196_2272 358
1207 3300050489 nmdc:mga03683_48851_c1 nmdc:mga03683_48851_c1_466_1542 358
1208 3300053111 Ga0500572_012531 Ga0500572_012531_639_1715 358
1209 iso_pu_bacteria 3007419365 3007421129 358

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05359

DUF748

Domain of Unknown Function (DUF748)

203

348

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f0y-assembly1.cif.gz_B crystal structure of isomerase nsrq f58a in complex with substrate analogue 0.7452 39 87
5wip-assembly1.cif.gz_D trae protein in complex with 2-(2-furyl)isonicotinic acid 0.6682 42 87
7f0o-assembly1.cif.gz_A crystal structure of selenomethionine-labeled isomerase nsrq 0.6367 39 86
7f14-assembly1.cif.gz_B crystal structure of isomerase dcr3 complex with substrate analogue 3 0.6195 39 86
4pej-assembly1.cif.gz_A crystal structure of a computationally designed retro-aldolase, ra110.4 (cys free) 0.6082 41 86
ID Description Score Start End Superfamily
af_Q95Y26_80_379_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6377 40 75 3.90.190.10
af_I6XW93_5_142_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6211 42 86 3.10.450.50
5i97A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.5955 42 87 3.10.450.230
af_Q18242_36_164_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5689 36 68 3.10.450.50
af_Q54KU9_11_139_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5668 39 87 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A3D2DCM4-F1-model_v4 deleted 0.9072 1 220
AF-A0A6M0CRR9-F1-model_v4 DUF748 domain-containing protein 0.8989 1 151
AF-A0A6M0CRR9-F1-model_v4 DUF748 domain-containing protein 0.8877 1 151
AF-A0A5C5Q9Q0-F1-model_v4 deleted 0.8835 61 253
AF-A0A1X0N277-F1-model_v4 DUF748 domain-containing protein 0.882 1 192 GO:0016020

Feature Viewer

pLDDT pTM Quality
70.75 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map