F491662
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1207 | 458 | 2414 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300015265|Ga0182005_1026909|Ga0182005_10269092 |
| Length | 250 |
| Sequence | MSDWLIPDWPAPAGVKACVTTRAGGVSLAPFDSLNLGDHVDDSPEAVAENRRRLTDHFSIQPAWLQQVHGIAVAHADPGQVVTADASWTATPGIACASMTADCLPVLFCNRAGTRVAAAHAGWRGLAAGVLEATLDSLDVPPADVLVWLGPAIGPKAFEVGPEVRETFVEQLPAAAKAFVPSANAGKFMADIYELARLRLAARGVTAVYGGGFCTVTDPRFFSYRRSPQTGRFASLIWLEVPCLTNTVPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 31 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 34 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 35 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 36 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 37 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 38 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 39 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 49 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 50 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 58 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 93 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 96 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 97 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 98 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 99 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 100 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 103 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 105 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 106 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 108 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 109 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 110 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 111 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 112 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 113 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 114 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 115 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 116 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 117 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 118 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 119 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 120 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 121 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 122 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 123 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 124 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 125 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 126 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 127 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 128 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 129 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 130 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 131 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 132 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 133 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 134 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 135 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 136 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 137 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 138 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 139 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 140 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 141 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 142 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 143 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 144 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 145 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 222 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 227 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 228 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 229 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 230 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 231 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 232 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 233 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 234 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 235 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 236 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 237 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 238 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 241 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 242 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 243 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 245 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 246 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 247 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 248 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 249 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 250 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 251 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 252 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 253 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 254 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 255 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 256 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 257 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 258 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 259 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 260 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 261 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 262 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 263 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 264 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 265 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 266 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 267 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 268 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 269 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 270 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 271 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 272 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 273 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 274 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 275 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 276 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 277 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 278 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 279 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 280 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 281 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 282 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 283 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 284 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 285 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 286 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 287 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 288 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 289 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 290 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 291 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 292 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 293 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 294 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 295 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 296 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 297 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 298 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 299 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 300 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 301 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 302 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 303 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 304 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 305 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 306 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 307 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 308 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 309 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 310 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 311 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 312 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 313 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 314 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 315 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 316 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 317 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 318 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 319 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 320 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 321 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 322 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 323 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 324 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 325 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 326 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 327 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 328 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 329 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 330 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 331 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 332 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 333 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 334 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 335 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 336 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 337 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 338 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 339 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 340 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 341 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 342 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 343 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 344 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 345 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 346 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 347 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 348 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 349 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 350 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 351 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 352 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 353 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 354 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 355 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 356 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 357 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 358 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 359 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 360 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 361 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 362 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 363 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 364 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 365 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 366 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 367 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 368 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 369 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 370 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 371 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 372 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 373 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 374 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 375 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 376 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 377 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 378 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 379 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 380 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 381 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 382 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 383 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 384 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 385 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 386 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 387 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 388 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 389 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 390 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 391 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 392 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 393 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 394 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 395 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 396 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 397 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 398 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 399 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 400 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 401 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 402 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 403 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 404 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 405 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 406 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 407 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 408 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 409 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 410 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 411 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 412 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 413 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 414 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 415 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 416 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 417 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 418 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 419 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 420 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 421 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 422 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 423 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 424 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 425 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 426 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 427 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 428 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 429 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 430 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 431 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 432 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 433 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 434 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 435 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 436 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 437 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 438 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 439 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 440 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 441 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 442 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 443 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 444 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 445 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 446 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 447 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 448 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 449 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 450 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 451 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 452 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 453 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 454 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 455 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 456 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 457 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 458 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.27 |
| Metatranscriptomes | 0 |
| Isolates | 17.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.39 |
| Nodule | 2.07 |
| Rhizoplane | 5.97 |
| Rhizosphere | 75.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182005_1026909 | 3300015265 | Bacteria | 1569 |
| 2 | MRS2a_Contig_814 | 2124908027 | Bacteria | 13723 |
| 3 | SwRhRL2b_contig_2472292 | 2162886007 | Bacteria | 2751 |
| 4 | JGI25162J39368_1003240 | 3300002737 | Bacteria | 4984 |
| 5 | JGI25162J39368_1003322 | 3300002737 | Bacteria | 4818 |
| 6 | JGI25163J39215_1001321 | 3300002771 | Bacteria | 4321 |
| 7 | JGI25163J39215_1001357 | 3300002771 | Bacteria | 4164 |
| 8 | JGI25164J39214_1000406 | 3300002772 | Bacteria | 24696 |
| 9 | JGI25164J39214_1000427 | 3300002772 | Bacteria | 23347 |
| 10 | JGI25165J46597_1000762 | 3300003214 | Bacteria | 24696 |
| 11 | JGI25165J46597_1000820 | 3300003214 | Bacteria | 23347 |
| 12 | rootH1_10160472 | 3300003323 | Bacteria | 2025 |
| 13 | Ga0055538_1000223 | 3300003751 | Bacteria | 32294 |
| 14 | Ga0055539_1000265 | 3300003752 | Bacteria | 32294 |
| 15 | Ga0055533_1000254 | 3300003756 | Bacteria | 32294 |
| 16 | Ga0055532_1000285 | 3300003758 | Bacteria | 32294 |
| 17 | Ga0055525_1001060 | 3300003759 | Bacteria | 7045 |
| 18 | Ga0055536_1007308 | 3300003781 | Bacteria | 4967 |
| 19 | Ga0055536_1007658 | 3300003781 | Bacteria | 4788 |
| 20 | Ga0055536_1007989 | 3300003781 | Bacteria | 4630 |
| 21 | Ga0055530_10006505 | 3300003791 | Bacteria | 5200 |
| 22 | Ga0055530_10006839 | 3300003791 | Bacteria | 4951 |
| 23 | Ga0055530_10006991 | 3300003791 | Bacteria | 4867 |
| 24 | Ga0055540_1005967 | 3300003792 | Bacteria | 4949 |
| 25 | Ga0055540_1006149 | 3300003792 | Bacteria | 4832 |
| 26 | Ga0055540_1006222 | 3300003792 | Bacteria | 4792 |
| 27 | Ga0055531_10000213 | 3300003794 | Bacteria | 63699 |
| 28 | Ga0055541_1000164 | 3300003841 | Bacteria | 32294 |
| 29 | Ga0065714_10000103 | 3300005288 | Bacteria | 10627 |
| 30 | Ga0065714_10012417 | 3300005288 | Bacteria | 3831 |
| 31 | Ga0065714_10017391 | 3300005288 | Bacteria | 1331 |
| 32 | Ga0065714_10067949 | 3300005288 | Bacteria | 5080 |
| 33 | Ga0065714_10068269 | 3300005288 | Bacteria | 4851 |
| 34 | Ga0065714_10068900 | 3300005288 | Bacteria | 4487 |
| 35 | Ga0065714_10150266 | 3300005288 | Bacteria | 1111 |
| 36 | Ga0065714_10154347 | 3300005288 | Bacteria | 1084 |
| 37 | Ga0065704_10090316 | 3300005289 | Bacteria | 2795 |
| 38 | Ga0065712_10001951 | 3300005290 | Bacteria | 5051 |
| 39 | Ga0065712_10008723 | 3300005290 | Bacteria | 4221 |
| 40 | Ga0070670_100028218 | 3300005331 | Bacteria | 4830 |
| 41 | Ga0070670_100095318 | 3300005331 | Bacteria | 2560 |
| 42 | Ga0070661_100001983 | 3300005344 | Bacteria | 14155 |
| 43 | Ga0070669_100015352 | 3300005353 | Bacteria | 5458 |
| 44 | Ga0070669_100016472 | 3300005353 | Bacteria | 5274 |
| 45 | Ga0070662_100003527 | 3300005457 | Bacteria | 9756 |
| 46 | Ga0070662_100115383 | 3300005457 | Bacteria | 2051 |
| 47 | Ga0068853_100001084 | 3300005539 | Bacteria | 19250 |
| 48 | Ga0070665_100185284 | 3300005548 | Bacteria | 2082 |
| 49 | Ga0070664_100000106 | 3300005564 | Bacteria | 54177 |
| 50 | Ga0070664_100606906 | 3300005564 | Bacteria | 1015 |
| 51 | Ga0068854_100000750 | 3300005578 | Bacteria | 19188 |
| 52 | Ga0068851_10000021 | 3300005834 | Bacteria | 132824 |
| 53 | Ga0075363_100192117 | 3300006048 | Bacteria | 1165 |
| 54 | Ga0075364_10063238 | 3300006051 | Bacteria | 2429 |
| 55 | Ga0075364_10168018 | 3300006051 | Bacteria | 1482 |
| 56 | Ga0075364_10310670 | 3300006051 | Bacteria | 1073 |
| 57 | Ga0075364_10390230 | 3300006051 | Bacteria | 950 |
| 58 | Ga0075432_10015738 | 3300006058 | Bacteria | 2581 |
| 59 | Ga0075432_10055181 | 3300006058 | Bacteria | 1407 |
| 60 | Ga0075432_10064680 | 3300006058 | Bacteria | 1306 |
| 61 | Ga0075432_10078882 | 3300006058 | Bacteria | 1191 |
| 62 | Ga0075432_10103838 | 3300006058 | Bacteria | 1052 |
| 63 | Ga0075432_10138956 | 3300006058 | Bacteria | 925 |
| 64 | Ga0075432_10141451 | 3300006058 | Bacteria | 918 |
| 65 | Ga0075432_10164831 | 3300006058 | Bacteria | 859 |
| 66 | Ga0075362_10080443 | 3300006177 | Bacteria | 1501 |
| 67 | Ga0075362_10164539 | 3300006177 | Bacteria | 1069 |
| 68 | Ga0075369_10178972 | 3300006186 | Bacteria | 975 |
| 69 | Ga0075436_100120231 | 3300006914 | Bacteria | 1837 |
| 70 | Ga0075436_100144479 | 3300006914 | Bacteria | 1672 |
| 71 | Ga0075436_100255668 | 3300006914 | Bacteria | 1248 |
| 72 | Ga0075436_100283691 | 3300006914 | Bacteria | 1184 |
| 73 | Ga0079104_1005220 | 3300006946 | Bacteria | 5252 |
| 74 | Ga0079104_1005531 | 3300006946 | Bacteria | 5028 |
| 75 | Ga0099826_10016061 | 3300006948 | Bacteria | 5652 |
| 76 | Ga0105251_10011738 | 3300009011 | Bacteria | 4989 |
| 77 | Ga0105251_10012724 | 3300009011 | Bacteria | 4745 |
| 78 | Ga0105251_10032404 | 3300009011 | Bacteria | 2605 |
| 79 | Ga0105251_10050442 | 3300009011 | Bacteria | 1988 |
| 80 | Ga0105251_10058242 | 3300009011 | Bacteria | 1825 |
| 81 | Ga0105251_10066103 | 3300009011 | Bacteria | 1691 |
| 82 | Ga0105244_10013003 | 3300009036 | Bacteria | 4889 |
| 83 | Ga0105244_10016058 | 3300009036 | Bacteria | 4277 |
| 84 | Ga0105244_10034208 | 3300009036 | Bacteria | 2677 |
| 85 | Ga0105244_10057315 | 3300009036 | Bacteria | 1969 |
| 86 | Ga0105244_10061866 | 3300009036 | Bacteria | 1883 |
| 87 | Ga0105244_10087953 | 3300009036 | Bacteria | 1531 |
| 88 | Ga0105244_10128703 | 3300009036 | Bacteria | 1222 |
| 89 | Ga0105244_10185455 | 3300009036 | Bacteria | 985 |
| 90 | Ga0105244_10220554 | 3300009036 | Bacteria | 889 |
| 91 | Ga0105250_10007661 | 3300009092 | Bacteria | 4628 |
| 92 | Ga0105250_10010336 | 3300009092 | Bacteria | 3889 |
| 93 | Ga0105250_10011259 | 3300009092 | Bacteria | 3712 |
| 94 | Ga0105250_10034652 | 3300009092 | Bacteria | 2026 |
| 95 | Ga0105250_10047376 | 3300009092 | Bacteria | 1724 |
| 96 | Ga0105250_10049356 | 3300009092 | Bacteria | 1688 |
| 97 | Ga0105250_10126881 | 3300009092 | Bacteria | 1051 |
| 98 | Ga0105250_10141501 | 3300009092 | Bacteria | 997 |
| 99 | Ga0105243_10020387 | 3300009148 | Bacteria | 5027 |
| 100 | Ga0105243_10021271 | 3300009148 | Bacteria | 4924 |
| 101 | Ga0105243_10022859 | 3300009148 | Bacteria | 4753 |
| 102 | Ga0105243_10291160 | 3300009148 | Bacteria | 1475 |
| 103 | Ga0105242_10020863 | 3300009176 | Bacteria | 5140 |
| 104 | Ga0105248_10168229 | 3300009177 | Bacteria | 2471 |
| 105 | Ga0105237_10000530 | 3300009545 | Bacteria | 53660 |
| 106 | Ga0105249_10172560 | 3300009553 | Bacteria | 2098 |
| 107 | Ga0105246_10014019 | 3300011119 | Bacteria | 5034 |
| 108 | Ga0105246_10015769 | 3300011119 | Bacteria | 4777 |
| 109 | Ga0105246_10047680 | 3300011119 | Bacteria | 2927 |
| 110 | Ga0105246_10052207 | 3300011119 | Bacteria | 2809 |
| 111 | Ga0157336_1000601 | 3300012477 | Bacteria | 1666 |
| 112 | Ga0157345_1000381 | 3300012498 | Bacteria | 4869 |
| 113 | Ga0157373_10020160 | 3300013100 | Bacteria | 4850 |
| 114 | Ga0157373_10024702 | 3300013100 | Bacteria | 4352 |
| 115 | Ga0157373_10054542 | 3300013100 | Bacteria | 2840 |
| 116 | Ga0157373_10057971 | 3300013100 | Bacteria | 2746 |
| 117 | Ga0157373_10073065 | 3300013100 | Bacteria | 2421 |
| 118 | Ga0157373_10157540 | 3300013100 | Bacteria | 1597 |
| 119 | Ga0157373_10189864 | 3300013100 | Bacteria | 1448 |
| 120 | Ga0157373_10203547 | 3300013100 | Bacteria | 1395 |
| 121 | Ga0157373_10366724 | 3300013100 | Bacteria | 1029 |
| 122 | Ga0157371_10020778 | 3300013102 | Bacteria | 4829 |
| 123 | Ga0157371_10021537 | 3300013102 | Bacteria | 4731 |
| 124 | Ga0157371_10411648 | 3300013102 | Bacteria | 990 |
| 125 | Ga0157371_10520308 | 3300013102 | Bacteria | 880 |
| 126 | Ga0157370_10006809 | 3300013104 | Bacteria | 12529 |
| 127 | Ga0157370_10102642 | 3300013104 | Bacteria | 2677 |
| 128 | Ga0157370_10112510 | 3300013104 | Bacteria | 2544 |
| 129 | Ga0157370_10214357 | 3300013104 | Bacteria | 1784 |
| 130 | Ga0157370_10256827 | 3300013104 | Bacteria | 1615 |
| 131 | Ga0157369_10000272 | 3300013105 | Bacteria | 69576 |
| 132 | Ga0157369_10059566 | 3300013105 | Bacteria | 4117 |
| 133 | Ga0157369_10108950 | 3300013105 | Bacteria | 2945 |
| 134 | Ga0157369_10139953 | 3300013105 | Bacteria | 2561 |
| 135 | Ga0157369_10244770 | 3300013105 | Bacteria | 1872 |
| 136 | Ga0157369_10558178 | 3300013105 | Bacteria | 1183 |
| 137 | Ga0163162_10277473 | 3300013306 | Bacteria | 1808 |
| 138 | Ga0163162_11068295 | 3300013306 | Bacteria | 914 |
| 139 | Ga0163162_11068965 | 3300013306 | Bacteria | 914 |
| 140 | Ga0157372_10259372 | 3300013307 | Bacteria | 2018 |
| 141 | Ga0157375_10034966 | 3300013308 | Bacteria | 4792 |
| 142 | Ga0157375_10107201 | 3300013308 | Bacteria | 2887 |
| 143 | Ga0157375_10363421 | 3300013308 | Bacteria | 1614 |
| 144 | Ga0157375_10404859 | 3300013308 | Bacteria | 1531 |
| 145 | Ga0157375_10692154 | 3300013308 | Bacteria | 1173 |
| 146 | Ga0157375_10793409 | 3300013308 | Bacteria | 1096 |
| 147 | Ga0182008_10011148 | 3300014497 | Bacteria | 4794 |
| 148 | Ga0182008_10034090 | 3300014497 | Bacteria | 2553 |
| 149 | Ga0182008_10034107 | 3300014497 | Bacteria | 2552 |
| 150 | Ga0182008_10048551 | 3300014497 | Bacteria | 2108 |
| 151 | Ga0182008_10066089 | 3300014497 | Bacteria | 1779 |
| 152 | Ga0182008_10082457 | 3300014497 | Bacteria | 1583 |
| 153 | Ga0182008_10083374 | 3300014497 | Bacteria | 1574 |
| 154 | Ga0182008_10084456 | 3300014497 | Bacteria | 1563 |
| 155 | Ga0182008_10085441 | 3300014497 | Bacteria | 1554 |
| 156 | Ga0182008_10090144 | 3300014497 | Bacteria | 1511 |
| 157 | Ga0182006_1007442 | 3300015261 | Bacteria | 5008 |
| 158 | Ga0182006_1008668 | 3300015261 | Bacteria | 4603 |
| 159 | Ga0182006_1009743 | 3300015261 | Bacteria | 4295 |
| 160 | Ga0182006_1009869 | 3300015261 | Bacteria | 4269 |
| 161 | Ga0182006_1019639 | 3300015261 | Bacteria | 2842 |
| 162 | Ga0182006_1031024 | 3300015261 | Bacteria | 2156 |
| 163 | Ga0182006_1048778 | 3300015261 | Bacteria | 1636 |
| 164 | Ga0182006_1055507 | 3300015261 | Bacteria | 1512 |
| 165 | Ga0182007_10008289 | 3300015262 | Bacteria | 4277 |
| 166 | Ga0182007_10040240 | 3300015262 | Bacteria | 1561 |
| 167 | Ga0182005_1007441 | 3300015265 | Bacteria | 3284 |
| 168 | Ga0182005_1020064 | 3300015265 | Bacteria | 1841 |
| 169 | Ga0182005_1038404 | 3300015265 | Bacteria | 1302 |
| 170 | Ga0182005_1044673 | 3300015265 | Bacteria | 1204 |
| 171 | Ga0163161_10023328 | 3300017792 | Bacteria | 4365 |
| 172 | Ga0163161_10088088 | 3300017792 | Bacteria | 2294 |
| 173 | Ga0163161_10199345 | 3300017792 | Bacteria | 1542 |
| 174 | Ga0163161_10211561 | 3300017792 | Bacteria | 1498 |
| 175 | Ga0163161_10229484 | 3300017792 | Bacteria | 1440 |
| 176 | Ga0163161_10265326 | 3300017792 | Bacteria | 1342 |
| 177 | Ga0163161_10293915 | 3300017792 | Bacteria | 1278 |
| 178 | Ga0163161_10538544 | 3300017792 | Bacteria | 956 |
| 179 | Ga0209760_100009 | 3300025207 | Bacteria | 207878 |
| 180 | Ga0209760_100240 | 3300025207 | Bacteria | 22994 |
| 181 | Ga0209784_100093 | 3300025224 | Bacteria | 116198 |
| 182 | Ga0209566_100109 | 3300025225 | Bacteria | 116198 |
| 183 | Ga0209674_100133 | 3300025226 | Bacteria | 116198 |
| 184 | Ga0209147_100140 | 3300025229 | Bacteria | 116198 |
| 185 | Ga0209563_100124 | 3300025230 | Bacteria | 116198 |
| 186 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 187 | Ga0207427_100092 | 3300025231 | Bacteria | 128454 |
| 188 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 189 | Ga0209437_100065 | 3300025233 | Bacteria | 332417 |
| 190 | Ga0209437_118972 | 3300025233 | Bacteria | 873 |
| 191 | Ga0209646_1000356 | 3300025246 | Bacteria | 32328 |
| 192 | Ga0209677_100084 | 3300025253 | Bacteria | 116198 |
| 193 | Ga0209759_1009823 | 3300025256 | Bacteria | 2861 |
| 194 | Ga0209759_1013117 | 3300025256 | Bacteria | 2258 |
| 195 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 196 | Ga0209233_1000085 | 3300025261 | Bacteria | 333078 |
| 197 | Ga0209676_1000076 | 3300025292 | Bacteria | 301393 |
| 198 | Ga0209676_1000423 | 3300025292 | Bacteria | 74478 |
| 199 | Ga0209676_1000544 | 3300025292 | Bacteria | 58036 |
| 200 | Ga0209676_1012009 | 3300025292 | Bacteria | 3443 |
| 201 | Ga0209050_1000063 | 3300025298 | Bacteria | 314955 |
| 202 | Ga0209050_1001614 | 3300025298 | Bacteria | 23185 |
| 203 | Ga0209050_1003951 | 3300025298 | Bacteria | 10474 |
| 204 | Ga0209050_1009695 | 3300025298 | Bacteria | 4881 |
| 205 | Ga0209051_1000045 | 3300025303 | Bacteria | 297882 |
| 206 | Ga0209051_1001217 | 3300025303 | Bacteria | 23158 |
| 207 | Ga0209051_1003407 | 3300025303 | Bacteria | 10436 |
| 208 | Ga0209051_1004537 | 3300025303 | Bacteria | 8512 |
| 209 | Ga0209257_1001395 | 3300025304 | Bacteria | 28910 |
| 210 | Ga0209257_1016658 | 3300025304 | Bacteria | 2956 |
| 211 | Ga0207656_10000020 | 3300025321 | Bacteria | 114666 |
| 212 | Ga0207696_1000047 | 3300025711 | Bacteria | 285005 |
| 213 | Ga0207696_1000052 | 3300025711 | Bacteria | 272880 |
| 214 | Ga0207696_1002215 | 3300025711 | Bacteria | 9721 |
| 215 | Ga0207696_1002929 | 3300025711 | Bacteria | 8015 |
| 216 | Ga0207696_1006081 | 3300025711 | Bacteria | 4917 |
| 217 | Ga0207696_1044506 | 3300025711 | Bacteria | 1287 |
| 218 | Ga0207696_1082890 | 3300025711 | Bacteria | 884 |
| 219 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 220 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 221 | Ga0207655_1002404 | 3300025728 | Bacteria | 15243 |
| 222 | Ga0207655_1015242 | 3300025728 | Bacteria | 4285 |
| 223 | Ga0207655_1015503 | 3300025728 | Bacteria | 4228 |
| 224 | Ga0207655_1027070 | 3300025728 | Bacteria | 2740 |
| 225 | Ga0207655_1028284 | 3300025728 | Bacteria | 2647 |
| 226 | Ga0207655_1033530 | 3300025728 | Bacteria | 2325 |
| 227 | Ga0207655_1039869 | 3300025728 | Bacteria | 2035 |
| 228 | Ga0207655_1041720 | 3300025728 | Bacteria | 1963 |
| 229 | Ga0207655_1050728 | 3300025728 | Bacteria | 1684 |
| 230 | Ga0207655_1051763 | 3300025728 | Bacteria | 1657 |
| 231 | Ga0207655_1058255 | 3300025728 | Bacteria | 1512 |
| 232 | Ga0207655_1078597 | 3300025728 | Bacteria | 1198 |
| 233 | Ga0207655_1089501 | 3300025728 | Bacteria | 1087 |
| 234 | Ga0207713_1001126 | 3300025735 | Bacteria | 22727 |
| 235 | Ga0207713_1001381 | 3300025735 | Bacteria | 19706 |
| 236 | Ga0207713_1001558 | 3300025735 | Bacteria | 18053 |
| 237 | Ga0207713_1006595 | 3300025735 | Bacteria | 7044 |
| 238 | Ga0207713_1012862 | 3300025735 | Bacteria | 4445 |
| 239 | Ga0207713_1012974 | 3300025735 | Bacteria | 4423 |
| 240 | Ga0207713_1015521 | 3300025735 | Bacteria | 3904 |
| 241 | Ga0207713_1027738 | 3300025735 | Bacteria | 2567 |
| 242 | Ga0207713_1048964 | 3300025735 | Bacteria | 1698 |
| 243 | Ga0207671_10000091 | 3300025914 | Bacteria | 139661 |
| 244 | Ga0207649_10000020 | 3300025920 | Bacteria | 211018 |
| 245 | Ga0207681_10001200 | 3300025923 | Bacteria | 16648 |
| 246 | Ga0207681_10011442 | 3300025923 | Bacteria | 5453 |
| 247 | Ga0207650_10001806 | 3300025925 | Bacteria | 15134 |
| 248 | Ga0207650_10010215 | 3300025925 | Bacteria | 6433 |
| 249 | Ga0207706_10028814 | 3300025933 | Bacteria | 4957 |
| 250 | Ga0207706_10029073 | 3300025933 | Bacteria | 4935 |
| 251 | Ga0207686_10002435 | 3300025934 | Bacteria | 10134 |
| 252 | Ga0207709_10000030 | 3300025935 | Bacteria | 331710 |
| 253 | Ga0207709_10015459 | 3300025935 | Bacteria | 4232 |
| 254 | Ga0207679_10000023 | 3300025945 | Bacteria | 208356 |
| 255 | Ga0207640_10006652 | 3300025981 | Bacteria | 6350 |
| 256 | Ga0207639_10004305 | 3300026041 | Bacteria | 9589 |
| 257 | Ga0207674_10545440 | 3300026116 | Bacteria | 1120 |
| 258 | Ga0209281_1000070 | 3300027111 | Bacteria | 277098 |
| 259 | Ga0209281_1000249 | 3300027111 | Bacteria | 107266 |
| 260 | Ga0209281_1027647 | 3300027111 | Bacteria | 1037 |
| 261 | Ga0207428_10075011 | 3300027907 | Bacteria | 2652 |
| 262 | Ga0207428_10100559 | 3300027907 | Bacteria | 2235 |
| 263 | Ga0207428_10107541 | 3300027907 | Bacteria | 2149 |
| 264 | Ga0207428_10131711 | 3300027907 | Bacteria | 1913 |
| 265 | Ga0207428_10134771 | 3300027907 | Bacteria | 1889 |
| 266 | Ga0207428_10195628 | 3300027907 | Bacteria | 1523 |
| 267 | Ga0268266_10048925 | 3300028379 | Bacteria | 3624 |
| 268 | Ga0268266_10089030 | 3300028379 | Bacteria | 2702 |
| 269 | Ga0268266_10777985 | 3300028379 | Bacteria | 924 |
| 270 | Ga0307517_10132904 | 3300028786 | Bacteria | 1783 |
| 271 | Ga0307517_10206681 | 3300028786 | Bacteria | 1217 |
| 272 | Ga0307511_10046472 | 3300030521 | Bacteria | 3570 |
| 273 | Ga0307511_10103557 | 3300030521 | Bacteria | 1853 |
| 274 | Ga0316179_1115579 | 3300030734 | Bacteria | 2874 |
| 275 | Ga0316178_1132417 | 3300030735 | Bacteria | 7370 |
| 276 | Ga0316183_1020816 | 3300030742 | Bacteria | 1695 |
| 277 | Ga0316183_1095850 | 3300030742 | Bacteria | 4070 |
| 278 | Ga0316181_1062350 | 3300030744 | Bacteria | 4282 |
| 279 | Ga0316181_1233680 | 3300030744 | Bacteria | 1106 |
| 280 | Ga0307408_100000020 | 3300031548 | Bacteria | 340408 |
| 281 | Ga0307408_100031181 | 3300031548 | Bacteria | 3710 |
| 282 | Ga0307408_100053636 | 3300031548 | Bacteria | 2912 |
| 283 | Ga0307408_100650265 | 3300031548 | Bacteria | 942 |
| 284 | Ga0307408_100808173 | 3300031548 | Bacteria | 851 |
| 285 | Ga0307516_10230646 | 3300031730 | Bacteria | 1555 |
| 286 | Ga0307516_10281767 | 3300031730 | Bacteria | 1344 |
| 287 | Ga0307516_10375978 | 3300031730 | Bacteria | 1083 |
| 288 | Ga0307516_10462449 | 3300031730 | Bacteria | 924 |
| 289 | Ga0307405_10025612 | 3300031731 | Bacteria | 3389 |
| 290 | Ga0307405_10027415 | 3300031731 | Bacteria | 3302 |
| 291 | Ga0307405_10114434 | 3300031731 | Bacteria | 1833 |
| 292 | Ga0307405_10391934 | 3300031731 | Bacteria | 1084 |
| 293 | Ga0307405_10737253 | 3300031731 | Bacteria | 819 |
| 294 | Ga0307413_10043742 | 3300031824 | Bacteria | 2641 |
| 295 | Ga0307407_10043019 | 3300031903 | Bacteria | 2536 |
| 296 | Ga0307407_10192519 | 3300031903 | Bacteria | 1360 |
| 297 | Ga0307412_10013603 | 3300031911 | Bacteria | 4776 |
| 298 | Ga0307412_10163328 | 3300031911 | Bacteria | 1657 |
| 299 | Ga0307412_10222894 | 3300031911 | Bacteria | 1446 |
| 300 | Ga0307412_10736746 | 3300031911 | Bacteria | 849 |
| 301 | Ga0307409_100033599 | 3300031995 | Bacteria | 3735 |
| 302 | Ga0307416_100070637 | 3300032002 | Bacteria | 2896 |
| 303 | Ga0307416_100171920 | 3300032002 | Bacteria | 2018 |
| 304 | Ga0307414_10134089 | 3300032004 | Bacteria | 1927 |
| 305 | Ga0307414_10386549 | 3300032004 | Bacteria | 1211 |
| 306 | Ga0307414_10840056 | 3300032004 | Bacteria | 839 |
| 307 | Ga0307411_10048187 | 3300032005 | Bacteria | 2760 |
| 308 | Ga0307411_10427803 | 3300032005 | Bacteria | 1101 |
| 309 | Ga0307411_10605561 | 3300032005 | Bacteria | 942 |
| 310 | Ga0307510_10050664 | 3300033180 | Bacteria | 4401 |
| 311 | Ga0237819_01017 | 3300038705 | Bacteria | 8424 |
| 312 | Ga0439438_000794 | 3300041405 | Bacteria | 14077 |
| 313 | Ga0439438_009197 | 3300041405 | Bacteria | 3214 |
| 314 | Ga0439438_015215 | 3300041405 | Bacteria | 2269 |
| 315 | Ga0439438_019275 | 3300041405 | Bacteria | 1930 |
| 316 | Ga0439438_027297 | 3300041405 | Bacteria | 1541 |
| 317 | Ga0439438_035766 | 3300041405 | Bacteria | 1304 |
| 318 | Ga0439438_044117 | 3300041405 | Bacteria | 1149 |
| 319 | Ga0439438_047536 | 3300041405 | Bacteria | 1099 |
| 320 | Ga0439438_050218 | 3300041405 | Bacteria | 1063 |
| 321 | Ga0439438_051328 | 3300041405 | Bacteria | 1047 |
| 322 | Ga0439447_004461 | 3300041407 | Bacteria | 4805 |
| 323 | Ga0439447_008817 | 3300041407 | Bacteria | 3099 |
| 324 | Ga0439447_015318 | 3300041407 | Bacteria | 2129 |
| 325 | Ga0439447_025149 | 3300041407 | Bacteria | 1535 |
| 326 | Ga0439447_026643 | 3300041407 | Bacteria | 1480 |
| 327 | Ga0439447_029791 | 3300041407 | Bacteria | 1379 |
| 328 | Ga0439447_033780 | 3300041407 | Bacteria | 1273 |
| 329 | Ga0439447_038686 | 3300041407 | Bacteria | 1171 |
| 330 | Ga0439447_048718 | 3300041407 | Bacteria | 1016 |
| 331 | Ga0439466_0005253 | 3300041411 | Bacteria | 4954 |
| 332 | Ga0439466_0005392 | 3300041411 | Bacteria | 4888 |
| 333 | Ga0439466_0008024 | 3300041411 | Bacteria | 3981 |
| 334 | Ga0439466_0022334 | 3300041411 | Bacteria | 2234 |
| 335 | Ga0439466_0059908 | 3300041411 | Bacteria | 1228 |
| 336 | Ga0439466_0066243 | 3300041411 | Bacteria | 1156 |
| 337 | Ga0439466_0079446 | 3300041411 | Bacteria | 1035 |
| 338 | Ga0439465_0016857 | 3300041413 | Bacteria | 2280 |
| 339 | Ga0439445_0068154 | 3300042004 | Bacteria | 981 |
| 340 | Ga0439432_002066 | 3300042006 | Bacteria | 7587 |
| 341 | Ga0439432_023828 | 3300042006 | Bacteria | 2014 |
| 342 | Ga0439432_031988 | 3300042006 | Bacteria | 1698 |
| 343 | Ga0439432_037697 | 3300042006 | Bacteria | 1541 |
| 344 | Ga0439432_051204 | 3300042006 | Bacteria | 1287 |
| 345 | Ga0439432_062006 | 3300042006 | Bacteria | 1151 |
| 346 | Ga0439432_088632 | 3300042006 | Bacteria | 932 |
| 347 | Ga0439432_092855 | 3300042006 | Bacteria | 907 |
| 348 | Ga0439451_007953 | 3300042009 | Bacteria | 2149 |
| 349 | Ga0439451_010329 | 3300042009 | Bacteria | 1883 |
| 350 | Ga0439451_019023 | 3300042009 | Bacteria | 1385 |
| 351 | Ga0439451_024617 | 3300042009 | Bacteria | 1212 |
| 352 | Ga0439451_026942 | 3300042009 | Bacteria | 1158 |
| 353 | Ga0439452_000338 | 3300042010 | Bacteria | 29057 |
| 354 | Ga0439452_000434 | 3300042010 | Bacteria | 24061 |
| 355 | Ga0439452_008622 | 3300042010 | Bacteria | 3056 |
| 356 | Ga0439452_009155 | 3300042010 | Bacteria | 2933 |
| 357 | Ga0439452_036748 | 3300042010 | Bacteria | 1172 |
| 358 | Ga0439452_053676 | 3300042010 | Bacteria | 916 |
| 359 | Ga0439456_004346 | 3300042013 | Bacteria | 2863 |
| 360 | Ga0439456_017000 | 3300042013 | Bacteria | 1523 |
| 361 | Ga0439456_029346 | 3300042013 | Bacteria | 1174 |
| 362 | Ga0439456_048983 | 3300042013 | Bacteria | 922 |
| 363 | Ga0439456_054726 | 3300042013 | Bacteria | 873 |
| 364 | Ga0439456_066704 | 3300042013 | Bacteria | 795 |
| 365 | Ga0439463_011837 | 3300042016 | Bacteria | 2142 |
| 366 | Ga0439463_035831 | 3300042016 | Bacteria | 1256 |
| 367 | Ga0439463_045203 | 3300042016 | Bacteria | 1121 |
| 368 | Ga0439463_076228 | 3300042016 | Bacteria | 860 |
| 369 | Ga0439463_091199 | 3300042016 | Bacteria | 784 |
| 370 | Ga0450911_001932 | 3300042115 | Bacteria | 4342 |
| 371 | Ga0450911_003246 | 3300042115 | Bacteria | 2917 |
| 372 | Ga0450911_006715 | 3300042115 | Bacteria | 1699 |
| 373 | Ga0450919_003093 | 3300042121 | Bacteria | 2111 |
| 374 | Ga0450919_005982 | 3300042121 | Bacteria | 1449 |
| 375 | Ga0450920_007877 | 3300042122 | Bacteria | 1936 |
| 376 | Ga0450922_000844 | 3300042124 | Bacteria | 3135 |
| 377 | Ga0450922_003191 | 3300042124 | Bacteria | 1512 |
| 378 | Ga0450923_024473 | 3300042125 | Bacteria | 1197 |
| 379 | Ga0450890_003483 | 3300042127 | Bacteria | 2089 |
| 380 | Ga0450892_004510 | 3300042130 | Bacteria | 1141 |
| 381 | Ga0450900_012091 | 3300042136 | Bacteria | 1128 |
| 382 | Ga0450902_025410 | 3300042137 | Bacteria | 988 |
| 383 | Ga0450902_028473 | 3300042137 | Bacteria | 937 |
| 384 | Ga0450902_029401 | 3300042137 | Bacteria | 922 |
| 385 | Ga0450903_011248 | 3300042138 | Bacteria | 1443 |
| 386 | Ga0450905_013147 | 3300042142 | Bacteria | 1171 |
| 387 | Ga0450906_001529 | 3300042145 | Bacteria | 5050 |
| 388 | Ga0450907_001646 | 3300042146 | Bacteria | 4677 |
| 389 | Ga0450907_004561 | 3300042146 | Bacteria | 2380 |
| 390 | Ga0450907_006646 | 3300042146 | Bacteria | 1931 |
| 391 | Ga0450910_018891 | 3300042147 | Bacteria | 1032 |
| 392 | Ga0439446_0003265 | 3300042156 | Bacteria | 4003 |
| 393 | Ga0439446_0010828 | 3300042156 | Bacteria | 2463 |
| 394 | Ga0439446_0030074 | 3300042156 | Bacteria | 1569 |
| 395 | Ga0450908_008011 | 3300042184 | Bacteria | 1982 |
| 396 | Ga0450909_001202 | 3300042185 | Bacteria | 3594 |
| 397 | Ga0450909_005639 | 3300042185 | Bacteria | 1800 |
| 398 | Ga0439434_0020729 | 3300042435 | Bacteria | 1974 |
| 399 | Ga0439434_0048062 | 3300042435 | Bacteria | 1319 |
| 400 | Ga0439464_0026657 | 3300042439 | Bacteria | 1604 |
| 401 | Ga0439464_0048947 | 3300042439 | Bacteria | 1218 |
| 402 | Ga0439460_0002707 | 3300042461 | Bacteria | 4273 |
| 403 | Ga0439460_0028347 | 3300042461 | Bacteria | 1579 |
| 404 | Ga0450918_006703 | 3300042531 | Bacteria | 2050 |
| 405 | Ga0439440_0004459 | 3300042993 | Bacteria | 2749 |
| 406 | Ga0439440_0013367 | 3300042993 | Bacteria | 1759 |
| 407 | Ga0439440_0020002 | 3300042993 | Bacteria | 1498 |
| 408 | Ga0495617_004733 | 3300046452 | Bacteria | 4918 |
| 409 | Ga0495617_025554 | 3300046452 | Bacteria | 1990 |
| 410 | Ga0495617_026081 | 3300046452 | Bacteria | 1967 |
| 411 | Ga0495617_032538 | 3300046452 | Bacteria | 1750 |
| 412 | Ga0495617_036832 | 3300046452 | Bacteria | 1639 |
| 413 | Ga0495617_057652 | 3300046452 | Bacteria | 1287 |
| 414 | Ga0495617_083797 | 3300046452 | Bacteria | 1043 |
| 415 | Ga0495617_103975 | 3300046452 | Bacteria | 921 |
| 416 | Ga0495617_155187 | 3300046452 | Bacteria | 727 |
| 417 | Ga0495627_000719 | 3300046453 | Bacteria | 25113 |
| 418 | Ga0495627_005599 | 3300046453 | Bacteria | 5029 |
| 419 | Ga0495627_006451 | 3300046453 | Bacteria | 4597 |
| 420 | Ga0495627_027250 | 3300046453 | Bacteria | 1835 |
| 421 | Ga0495627_045567 | 3300046453 | Bacteria | 1335 |
| 422 | Ga0495627_057756 | 3300046453 | Bacteria | 1153 |
| 423 | Ga0495627_066307 | 3300046453 | Bacteria | 1060 |
| 424 | Ga0495603_0074423 | 3300046455 | Bacteria | 1994 |
| 425 | Ga0495603_0134300 | 3300046455 | Bacteria | 1440 |
| 426 | Ga0495590_0006964 | 3300046457 | Bacteria | 4384 |
| 427 | Ga0495590_0013917 | 3300046457 | Bacteria | 2947 |
| 428 | Ga0495590_0037730 | 3300046457 | Bacteria | 1684 |
| 429 | Ga0495590_0055797 | 3300046457 | Bacteria | 1380 |
| 430 | Ga0495590_0087235 | 3300046457 | Bacteria | 1102 |
| 431 | Ga0495590_0088629 | 3300046457 | Bacteria | 1093 |
| 432 | Ga0495591_000140 | 3300046458 | Bacteria | 77847 |
| 433 | Ga0495591_006963 | 3300046458 | Bacteria | 4889 |
| 434 | Ga0495591_008623 | 3300046458 | Bacteria | 4154 |
| 435 | Ga0495591_019828 | 3300046458 | Bacteria | 2239 |
| 436 | Ga0495591_021317 | 3300046458 | Bacteria | 2117 |
| 437 | Ga0495591_027752 | 3300046458 | Bacteria | 1741 |
| 438 | Ga0495591_028650 | 3300046458 | Bacteria | 1701 |
| 439 | Ga0495591_040751 | 3300046458 | Bacteria | 1322 |
| 440 | Ga0495591_042828 | 3300046458 | Bacteria | 1277 |
| 441 | Ga0495591_053702 | 3300046458 | Bacteria | 1091 |
| 442 | Ga0495591_059514 | 3300046458 | Bacteria | 1018 |
| 443 | Ga0495591_059612 | 3300046458 | Bacteria | 1017 |
| 444 | Ga0495591_063676 | 3300046458 | Bacteria | 973 |
| 445 | Ga0495591_084019 | 3300046458 | Bacteria | 807 |
| 446 | Ga0495629_0176973 | 3300046459 | Bacteria | 1479 |
| 447 | Ga0495638_0033793 | 3300046460 | Bacteria | 3268 |
| 448 | Ga0495638_0044049 | 3300046460 | Bacteria | 2812 |
| 449 | Ga0495638_0046459 | 3300046460 | Bacteria | 2728 |
| 450 | Ga0495638_0058113 | 3300046460 | Bacteria | 2397 |
| 451 | Ga0495638_0083120 | 3300046460 | Bacteria | 1940 |
| 452 | Ga0495638_0120957 | 3300046460 | Bacteria | 1547 |
| 453 | Ga0495638_0130801 | 3300046460 | Bacteria | 1474 |
| 454 | Ga0495638_0139176 | 3300046460 | Bacteria | 1418 |
| 455 | Ga0495638_0142440 | 3300046460 | Bacteria | 1397 |
| 456 | Ga0495638_0160281 | 3300046460 | Bacteria | 1298 |
| 457 | Ga0495638_0163666 | 3300046460 | Bacteria | 1281 |
| 458 | Ga0495638_0181095 | 3300046460 | Bacteria | 1202 |
| 459 | Ga0495638_0205365 | 3300046460 | Bacteria | 1109 |
| 460 | Ga0495638_0240007 | 3300046460 | Bacteria | 1004 |
| 461 | Ga0495638_0256850 | 3300046460 | Bacteria | 960 |
| 462 | Ga0495638_0323854 | 3300046460 | Bacteria | 822 |
| 463 | Ga0495653_0039027 | 3300046463 | Bacteria | 3723 |
| 464 | Ga0495653_0044648 | 3300046463 | Bacteria | 3439 |
| 465 | Ga0495653_0081925 | 3300046463 | Bacteria | 2383 |
| 466 | Ga0495653_0129352 | 3300046463 | Bacteria | 1789 |
| 467 | Ga0495653_0144839 | 3300046463 | Bacteria | 1666 |
| 468 | Ga0495653_0214118 | 3300046463 | Bacteria | 1299 |
| 469 | Ga0495653_0318605 | 3300046463 | Bacteria | 1008 |
| 470 | Ga0495650_0005915 | 3300046471 | Bacteria | 7772 |
| 471 | Ga0495650_0027723 | 3300046471 | Bacteria | 2612 |
| 472 | Ga0495650_0030241 | 3300046471 | Bacteria | 2455 |
| 473 | Ga0495650_0033426 | 3300046471 | Bacteria | 2288 |
| 474 | Ga0495650_0036416 | 3300046471 | Bacteria | 2153 |
| 475 | Ga0495650_0047162 | 3300046471 | Bacteria | 1803 |
| 476 | Ga0495650_0072009 | 3300046471 | Bacteria | 1353 |
| 477 | Ga0495650_0110844 | 3300046471 | Bacteria | 1019 |
| 478 | Ga0495605_0000156 | 3300046474 | Bacteria | 88405 |
| 479 | Ga0495605_0013132 | 3300046474 | Bacteria | 4575 |
| 480 | Ga0495605_0026616 | 3300046474 | Bacteria | 3005 |
| 481 | Ga0495605_0030282 | 3300046474 | Bacteria | 2776 |
| 482 | Ga0495605_0046391 | 3300046474 | Bacteria | 2136 |
| 483 | Ga0495605_0063086 | 3300046474 | Bacteria | 1768 |
| 484 | Ga0495605_0069226 | 3300046474 | Bacteria | 1671 |
| 485 | Ga0495605_0092012 | 3300046474 | Bacteria | 1404 |
| 486 | Ga0495605_0118436 | 3300046474 | Bacteria | 1202 |
| 487 | Ga0495605_0153936 | 3300046474 | Bacteria | 1024 |
| 488 | Ga0495605_0154578 | 3300046474 | Bacteria | 1021 |
| 489 | Ga0495605_0173192 | 3300046474 | Bacteria | 952 |
| 490 | Ga0495605_0196598 | 3300046474 | Bacteria | 880 |
| 491 | Ga0495639_0000104 | 3300046475 | Bacteria | 42116 |
| 492 | Ga0495639_0070744 | 3300046475 | Bacteria | 1611 |
| 493 | Ga0495584_0013055 | 3300046491 | Bacteria | 4237 |
| 494 | Ga0495584_0013120 | 3300046491 | Bacteria | 4226 |
| 495 | Ga0495584_0013293 | 3300046491 | Bacteria | 4202 |
| 496 | Ga0495584_0046296 | 3300046491 | Bacteria | 2194 |
| 497 | Ga0495584_0078377 | 3300046491 | Bacteria | 1662 |
| 498 | Ga0495584_0129687 | 3300046491 | Bacteria | 1279 |
| 499 | Ga0495584_0141504 | 3300046491 | Bacteria | 1221 |
| 500 | Ga0495584_0141524 | 3300046491 | Bacteria | 1221 |
| 501 | Ga0495584_0155631 | 3300046491 | Bacteria | 1161 |
| 502 | Ga0495584_0184009 | 3300046491 | Bacteria | 1061 |
| 503 | Ga0495585_0013772 | 3300046492 | Bacteria | 4725 |
| 504 | Ga0495585_0053958 | 3300046492 | Bacteria | 2223 |
| 505 | Ga0495585_0059436 | 3300046492 | Bacteria | 2106 |
| 506 | Ga0495585_0064657 | 3300046492 | Bacteria | 2005 |
| 507 | Ga0495585_0132526 | 3300046492 | Bacteria | 1310 |
| 508 | Ga0495585_0164272 | 3300046492 | Bacteria | 1150 |
| 509 | Ga0495585_0167870 | 3300046492 | Bacteria | 1135 |
| 510 | Ga0495585_0175689 | 3300046492 | Bacteria | 1103 |
| 511 | Ga0495585_0219235 | 3300046492 | Bacteria | 960 |
| 512 | Ga0495585_0228401 | 3300046492 | Bacteria | 936 |
| 513 | Ga0495594_0145169 | 3300046499 | Bacteria | 1346 |
| 514 | Ga0495594_0163817 | 3300046499 | Bacteria | 1264 |
| 515 | Ga0495596_0015726 | 3300046500 | Bacteria | 3159 |
| 516 | Ga0495596_0031651 | 3300046500 | Bacteria | 2111 |
| 517 | Ga0495596_0111487 | 3300046500 | Bacteria | 1062 |
| 518 | Ga0495607_0001212 | 3300046501 | Bacteria | 23209 |
| 519 | Ga0495607_0001241 | 3300046501 | Bacteria | 22879 |
| 520 | Ga0495607_0001421 | 3300046501 | Bacteria | 21342 |
| 521 | Ga0495607_0001487 | 3300046501 | Bacteria | 20809 |
| 522 | Ga0495607_0043092 | 3300046501 | Bacteria | 2671 |
| 523 | Ga0495607_0057709 | 3300046501 | Bacteria | 2223 |
| 524 | Ga0495607_0070084 | 3300046501 | Bacteria | 1960 |
| 525 | Ga0495607_0074631 | 3300046501 | Bacteria | 1881 |
| 526 | Ga0495607_0079003 | 3300046501 | Bacteria | 1813 |
| 527 | Ga0495607_0096769 | 3300046501 | Bacteria | 1588 |
| 528 | Ga0495607_0118112 | 3300046501 | Bacteria | 1396 |
| 529 | Ga0495607_0132317 | 3300046501 | Bacteria | 1296 |
| 530 | Ga0495607_0149549 | 3300046501 | Bacteria | 1196 |
| 531 | Ga0495607_0162263 | 3300046501 | Bacteria | 1134 |
| 532 | Ga0495607_0180605 | 3300046501 | Bacteria | 1058 |
| 533 | Ga0495607_0188291 | 3300046501 | Bacteria | 1029 |
| 534 | Ga0495607_0203745 | 3300046501 | Bacteria | 977 |
| 535 | Ga0495607_0216716 | 3300046501 | Bacteria | 939 |
| 536 | Ga0495583_0000579 | 3300046506 | Bacteria | 50220 |
| 537 | Ga0495583_0012034 | 3300046506 | Bacteria | 4926 |
| 538 | Ga0495583_0013591 | 3300046506 | Bacteria | 4531 |
| 539 | Ga0495583_0042558 | 3300046506 | Bacteria | 2120 |
| 540 | Ga0495583_0055166 | 3300046506 | Bacteria | 1796 |
| 541 | Ga0495583_0064221 | 3300046506 | Bacteria | 1629 |
| 542 | Ga0495583_0066898 | 3300046506 | Bacteria | 1588 |
| 543 | Ga0495583_0134568 | 3300046506 | Bacteria | 1032 |
| 544 | Ga0495606_0020111 | 3300046507 | Bacteria | 4935 |
| 545 | Ga0495606_0027789 | 3300046507 | Bacteria | 4003 |
| 546 | Ga0495606_0031646 | 3300046507 | Bacteria | 3674 |
| 547 | Ga0495606_0038681 | 3300046507 | Bacteria | 3224 |
| 548 | Ga0495606_0048785 | 3300046507 | Bacteria | 2781 |
| 549 | Ga0495606_0058399 | 3300046507 | Bacteria | 2479 |
| 550 | Ga0495606_0084289 | 3300046507 | Bacteria | 1968 |
| 551 | Ga0495606_0104821 | 3300046507 | Bacteria | 1715 |
| 552 | Ga0495606_0186646 | 3300046507 | Bacteria | 1191 |
| 553 | Ga0495606_0255231 | 3300046507 | Bacteria | 970 |
| 554 | Ga0495610_0016725 | 3300046512 | Bacteria | 4210 |
| 555 | Ga0495610_0027691 | 3300046512 | Bacteria | 3007 |
| 556 | Ga0495610_0074993 | 3300046512 | Bacteria | 1567 |
| 557 | Ga0495610_0075069 | 3300046512 | Bacteria | 1566 |
| 558 | Ga0495610_0077848 | 3300046512 | Bacteria | 1530 |
| 559 | Ga0495610_0083618 | 3300046512 | Bacteria | 1460 |
| 560 | Ga0495610_0090932 | 3300046512 | Bacteria | 1383 |
| 561 | Ga0495610_0092694 | 3300046512 | Bacteria | 1366 |
| 562 | Ga0495610_0118653 | 3300046512 | Bacteria | 1162 |
| 563 | Ga0495610_0171760 | 3300046512 | Bacteria | 908 |
| 564 | Ga0495610_0185467 | 3300046512 | Bacteria | 862 |
| 565 | Ga0495610_0205173 | 3300046512 | Bacteria | 804 |
| 566 | Ga0495616_0012636 | 3300046513 | Bacteria | 4786 |
| 567 | Ga0495616_0037541 | 3300046513 | Bacteria | 2491 |
| 568 | Ga0495616_0046119 | 3300046513 | Bacteria | 2201 |
| 569 | Ga0495616_0053652 | 3300046513 | Bacteria | 2002 |
| 570 | Ga0495616_0063961 | 3300046513 | Bacteria | 1796 |
| 571 | Ga0495616_0133517 | 3300046513 | Bacteria | 1135 |
| 572 | Ga0495616_0188878 | 3300046513 | Bacteria | 911 |
| 573 | Ga0495620_0017098 | 3300046515 | Bacteria | 3624 |
| 574 | Ga0495620_0026897 | 3300046515 | Bacteria | 2699 |
| 575 | Ga0495620_0038801 | 3300046515 | Bacteria | 2111 |
| 576 | Ga0495620_0068858 | 3300046515 | Bacteria | 1452 |
| 577 | Ga0495620_0092068 | 3300046515 | Bacteria | 1215 |
| 578 | Ga0495620_0093068 | 3300046515 | Bacteria | 1207 |
| 579 | Ga0495620_0103453 | 3300046515 | Bacteria | 1133 |
| 580 | Ga0495628_0313408 | 3300046516 | Bacteria | 1159 |
| 581 | Ga0495628_0631496 | 3300046516 | Bacteria | 762 |
| 582 | Ga0495630_0174358 | 3300046517 | Bacteria | 1639 |
| 583 | Ga0495630_0229405 | 3300046517 | Bacteria | 1418 |
| 584 | Ga0495630_0258406 | 3300046517 | Bacteria | 1330 |
| 585 | Ga0495630_0327948 | 3300046517 | Bacteria | 1170 |
| 586 | Ga0495631_0024767 | 3300046518 | Bacteria | 2768 |
| 587 | Ga0495631_0028378 | 3300046518 | Bacteria | 2552 |
| 588 | Ga0495631_0075427 | 3300046518 | Bacteria | 1455 |
| 589 | Ga0495631_0193070 | 3300046518 | Bacteria | 871 |
| 590 | Ga0495631_0216938 | 3300046518 | Bacteria | 817 |
| 591 | Ga0495632_0013932 | 3300046519 | Bacteria | 4567 |
| 592 | Ga0495632_0014004 | 3300046519 | Bacteria | 4551 |
| 593 | Ga0495632_0023282 | 3300046519 | Bacteria | 3309 |
| 594 | Ga0495632_0023741 | 3300046519 | Bacteria | 3269 |
| 595 | Ga0495632_0024060 | 3300046519 | Bacteria | 3241 |
| 596 | Ga0495632_0070374 | 3300046519 | Bacteria | 1682 |
| 597 | Ga0495632_0086214 | 3300046519 | Bacteria | 1493 |
| 598 | Ga0495632_0100246 | 3300046519 | Bacteria | 1365 |
| 599 | Ga0495632_0111912 | 3300046519 | Bacteria | 1281 |
| 600 | Ga0495632_0123626 | 3300046519 | Bacteria | 1207 |
| 601 | Ga0495637_0008936 | 3300046520 | Bacteria | 4902 |
| 602 | Ga0495637_0010470 | 3300046520 | Bacteria | 4481 |
| 603 | Ga0495637_0020186 | 3300046520 | Bacteria | 3068 |
| 604 | Ga0495637_0022473 | 3300046520 | Bacteria | 2875 |
| 605 | Ga0495637_0023706 | 3300046520 | Bacteria | 2783 |
| 606 | Ga0495637_0024744 | 3300046520 | Bacteria | 2715 |
| 607 | Ga0495637_0027699 | 3300046520 | Bacteria | 2532 |
| 608 | Ga0495637_0038292 | 3300046520 | Bacteria | 2077 |
| 609 | Ga0495637_0045988 | 3300046520 | Bacteria | 1848 |
| 610 | Ga0495637_0063971 | 3300046520 | Bacteria | 1502 |
| 611 | Ga0495637_0067793 | 3300046520 | Bacteria | 1447 |
| 612 | Ga0495637_0083859 | 3300046520 | Bacteria | 1266 |
| 613 | Ga0495637_0108101 | 3300046520 | Bacteria | 1080 |
| 614 | Ga0495637_0127830 | 3300046520 | Bacteria | 972 |
| 615 | Ga0495637_0156317 | 3300046520 | Bacteria | 857 |
| 616 | Ga0495643_0014888 | 3300046522 | Bacteria | 4615 |
| 617 | Ga0495643_0061172 | 3300046522 | Bacteria | 1997 |
| 618 | Ga0495643_0156723 | 3300046522 | Bacteria | 1123 |
| 619 | Ga0495643_0186418 | 3300046522 | Bacteria | 1004 |
| 620 | Ga0495643_0192652 | 3300046522 | Bacteria | 983 |
| 621 | Ga0495643_0193949 | 3300046522 | Bacteria | 979 |
| 622 | Ga0495643_0200999 | 3300046522 | Bacteria | 956 |
| 623 | Ga0495644_0015202 | 3300046523 | Bacteria | 2947 |
| 624 | Ga0495644_0018793 | 3300046523 | Bacteria | 2637 |
| 625 | Ga0495644_0070766 | 3300046523 | Bacteria | 1310 |
| 626 | Ga0495644_0104334 | 3300046523 | Bacteria | 1073 |
| 627 | Ga0495644_0104779 | 3300046523 | Bacteria | 1071 |
| 628 | Ga0495648_0001114 | 3300046524 | Bacteria | 27241 |
| 629 | Ga0495648_0036903 | 3300046524 | Bacteria | 3145 |
| 630 | Ga0495648_0055595 | 3300046524 | Bacteria | 2385 |
| 631 | Ga0495648_0060392 | 3300046524 | Bacteria | 2256 |
| 632 | Ga0495648_0076997 | 3300046524 | Bacteria | 1913 |
| 633 | Ga0495648_0084673 | 3300046524 | Bacteria | 1793 |
| 634 | Ga0495648_0087316 | 3300046524 | Bacteria | 1756 |
| 635 | Ga0495648_0104184 | 3300046524 | Bacteria | 1558 |
| 636 | Ga0495648_0105047 | 3300046524 | Bacteria | 1549 |
| 637 | Ga0495648_0132189 | 3300046524 | Bacteria | 1325 |
| 638 | Ga0495648_0158314 | 3300046524 | Bacteria | 1173 |
| 639 | Ga0495648_0247455 | 3300046524 | Bacteria | 862 |
| 640 | Ga0495648_0261322 | 3300046524 | Bacteria | 830 |
| 641 | Ga0495666_0070391 | 3300046526 | Bacteria | 1663 |
| 642 | Ga0495666_0114496 | 3300046526 | Bacteria | 1265 |
| 643 | Ga0495666_0123529 | 3300046526 | Bacteria | 1211 |
| 644 | Ga0495642_0000110 | 3300046528 | Bacteria | 46480 |
| 645 | Ga0495642_0006287 | 3300046528 | Bacteria | 4557 |
| 646 | Ga0495642_0049334 | 3300046528 | Bacteria | 1728 |
| 647 | Ga0495654_0014060 | 3300046530 | Bacteria | 4268 |
| 648 | Ga0495654_0014774 | 3300046530 | Bacteria | 4151 |
| 649 | Ga0495654_0018332 | 3300046530 | Bacteria | 3669 |
| 650 | Ga0495654_0031102 | 3300046530 | Bacteria | 2710 |
| 651 | Ga0495654_0036127 | 3300046530 | Bacteria | 2484 |
| 652 | Ga0495654_0049835 | 3300046530 | Bacteria | 2049 |
| 653 | Ga0495654_0072661 | 3300046530 | Bacteria | 1627 |
| 654 | Ga0495654_0078129 | 3300046530 | Bacteria | 1556 |
| 655 | Ga0495654_0078280 | 3300046530 | Bacteria | 1554 |
| 656 | Ga0495654_0078960 | 3300046530 | Bacteria | 1546 |
| 657 | Ga0495654_0101763 | 3300046530 | Bacteria | 1321 |
| 658 | Ga0495654_0106361 | 3300046530 | Bacteria | 1285 |
| 659 | Ga0495654_0107868 | 3300046530 | Bacteria | 1273 |
| 660 | Ga0495654_0111250 | 3300046530 | Bacteria | 1249 |
| 661 | Ga0495654_0122982 | 3300046530 | Bacteria | 1172 |
| 662 | Ga0495654_0126930 | 3300046530 | Bacteria | 1148 |
| 663 | Ga0495654_0185151 | 3300046530 | Bacteria | 899 |
| 664 | Ga0495586_0120674 | 3300046535 | Bacteria | 1464 |
| 665 | Ga0495587_0014630 | 3300046536 | Bacteria | 4915 |
| 666 | Ga0495587_0022102 | 3300046536 | Bacteria | 3918 |
| 667 | Ga0495587_0219805 | 3300046536 | Bacteria | 1071 |
| 668 | Ga0495609_0031877 | 3300046538 | Bacteria | 2395 |
| 669 | Ga0495609_0093251 | 3300046538 | Bacteria | 1308 |
| 670 | Ga0495609_0098217 | 3300046538 | Bacteria | 1269 |
| 671 | Ga0495609_0141275 | 3300046538 | Bacteria | 1027 |
| 672 | Ga0495609_0209493 | 3300046538 | Bacteria | 812 |
| 673 | Ga0495609_0215535 | 3300046538 | Bacteria | 798 |
| 674 | Ga0495609_0221038 | 3300046538 | Bacteria | 786 |
| 675 | Ga0495597_0000082 | 3300046542 | Bacteria | 83872 |
| 676 | Ga0495597_0018993 | 3300046542 | Bacteria | 3220 |
| 677 | Ga0495597_0024723 | 3300046542 | Bacteria | 2770 |
| 678 | Ga0495597_0025191 | 3300046542 | Bacteria | 2739 |
| 679 | Ga0495597_0027366 | 3300046542 | Bacteria | 2614 |
| 680 | Ga0495597_0059078 | 3300046542 | Bacteria | 1674 |
| 681 | Ga0495597_0143968 | 3300046542 | Bacteria | 981 |
| 682 | Ga0495597_0173716 | 3300046542 | Bacteria | 873 |
| 683 | Ga0495597_0219874 | 3300046542 | Bacteria | 754 |
| 684 | Ga0495622_0008425 | 3300046557 | Bacteria | 4773 |
| 685 | Ga0495622_0009246 | 3300046557 | Bacteria | 4560 |
| 686 | Ga0495622_0032113 | 3300046557 | Bacteria | 2451 |
| 687 | Ga0495622_0035430 | 3300046557 | Bacteria | 2327 |
| 688 | Ga0495622_0055572 | 3300046557 | Bacteria | 1836 |
| 689 | Ga0495622_0128162 | 3300046557 | Bacteria | 1156 |
| 690 | Ga0495633_0044077 | 3300046558 | Bacteria | 2114 |
| 691 | Ga0495633_0050640 | 3300046558 | Bacteria | 1957 |
| 692 | Ga0495633_0136527 | 3300046558 | Bacteria | 1134 |
| 693 | Ga0495633_0165651 | 3300046558 | Bacteria | 1019 |
| 694 | Ga0495633_0292380 | 3300046558 | Bacteria | 740 |
| 695 | Ga0495668_0046904 | 3300046616 | Bacteria | 2399 |
| 696 | Ga0495668_0049165 | 3300046616 | Bacteria | 2338 |
| 697 | Ga0495668_0080891 | 3300046616 | Bacteria | 1783 |
| 698 | Ga0495668_0193267 | 3300046616 | Bacteria | 1114 |
| 699 | Ga0495634_0130371 | 3300046642 | Bacteria | 1603 |
| 700 | Ga0495611_0014174 | 3300046648 | Bacteria | 3401 |
| 701 | Ga0495611_0105819 | 3300046648 | Bacteria | 1308 |
| 702 | Ga0495625_0053091 | 3300046660 | Bacteria | 2900 |
| 703 | Ga0495625_0076233 | 3300046660 | Bacteria | 2344 |
| 704 | Ga0495625_0076583 | 3300046660 | Bacteria | 2338 |
| 705 | Ga0495625_0113992 | 3300046660 | Bacteria | 1845 |
| 706 | Ga0495625_0117781 | 3300046660 | Bacteria | 1810 |
| 707 | Ga0495625_0156886 | 3300046660 | Bacteria | 1527 |
| 708 | Ga0495625_0167040 | 3300046660 | Bacteria | 1470 |
| 709 | Ga0495635_0030111 | 3300046663 | Bacteria | 3773 |
| 710 | Ga0495635_0289847 | 3300046663 | Bacteria | 1098 |
| 711 | Ga0495659_0002018 | 3300046664 | Bacteria | 6663 |
| 712 | Ga0495659_0005249 | 3300046664 | Bacteria | 4074 |
| 713 | Ga0495661_0000075 | 3300046665 | Bacteria | 119777 |
| 714 | Ga0495661_0000564 | 3300046665 | Bacteria | 38403 |
| 715 | Ga0495661_0018254 | 3300046665 | Bacteria | 4617 |
| 716 | Ga0495661_0021922 | 3300046665 | Bacteria | 4157 |
| 717 | Ga0495661_0071206 | 3300046665 | Bacteria | 2032 |
| 718 | Ga0495661_0125397 | 3300046665 | Bacteria | 1413 |
| 719 | Ga0495661_0141694 | 3300046665 | Bacteria | 1307 |
| 720 | Ga0495661_0235292 | 3300046665 | Bacteria | 942 |
| 721 | Ga0495588_0107537 | 3300046674 | Bacteria | 1468 |
| 722 | Ga0495588_0264405 | 3300046674 | Bacteria | 906 |
| 723 | Ga0495623_0057783 | 3300046679 | Bacteria | 2440 |
| 724 | Ga0495623_0132826 | 3300046679 | Bacteria | 1488 |
| 725 | Ga0495646_0053685 | 3300046680 | Bacteria | 2428 |
| 726 | Ga0495646_0187903 | 3300046680 | Bacteria | 1130 |
| 727 | Ga0495646_0188494 | 3300046680 | Bacteria | 1128 |
| 728 | Ga0495646_0205605 | 3300046680 | Bacteria | 1070 |
| 729 | Ga0495669_0009692 | 3300046684 | Bacteria | 4064 |
| 730 | Ga0495669_0113538 | 3300046684 | Bacteria | 1266 |
| 731 | Ga0495613_0146097 | 3300046689 | Bacteria | 1687 |
| 732 | Ga0495613_0148197 | 3300046689 | Bacteria | 1674 |
| 733 | Ga0495624_0046684 | 3300046690 | Bacteria | 2753 |
| 734 | Ga0495670_0040133 | 3300046691 | Bacteria | 2334 |
| 735 | Ga0495670_0044338 | 3300046691 | Bacteria | 2220 |
| 736 | Ga0495670_0047105 | 3300046691 | Bacteria | 2154 |
| 737 | Ga0495670_0090619 | 3300046691 | Bacteria | 1564 |
| 738 | Ga0495670_0110276 | 3300046691 | Bacteria | 1423 |
| 739 | Ga0495670_0188469 | 3300046691 | Bacteria | 1090 |
| 740 | Ga0495671_0012058 | 3300046692 | Bacteria | 4726 |
| 741 | Ga0495671_0014192 | 3300046692 | Bacteria | 4293 |
| 742 | Ga0495671_0041230 | 3300046692 | Bacteria | 2325 |
| 743 | Ga0495671_0043988 | 3300046692 | Bacteria | 2240 |
| 744 | Ga0495671_0050800 | 3300046692 | Bacteria | 2063 |
| 745 | Ga0495671_0051956 | 3300046692 | Bacteria | 2037 |
| 746 | Ga0495671_0169513 | 3300046692 | Bacteria | 1061 |
| 747 | Ga0495671_0272817 | 3300046692 | Bacteria | 815 |
| 748 | Ga0495649_0012910 | 3300046694 | Bacteria | 4838 |
| 749 | Ga0495649_0049667 | 3300046694 | Bacteria | 2278 |
| 750 | Ga0495649_0057913 | 3300046694 | Bacteria | 2088 |
| 751 | Ga0495649_0113679 | 3300046694 | Bacteria | 1434 |
| 752 | Ga0495649_0115034 | 3300046694 | Bacteria | 1424 |
| 753 | Ga0495649_0118128 | 3300046694 | Bacteria | 1403 |
| 754 | Ga0495649_0119433 | 3300046694 | Bacteria | 1394 |
| 755 | Ga0495649_0149208 | 3300046694 | Bacteria | 1228 |
| 756 | Ga0495649_0149731 | 3300046694 | Bacteria | 1226 |
| 757 | Ga0495649_0219908 | 3300046694 | Bacteria | 982 |
| 758 | Ga0495649_0225404 | 3300046694 | Bacteria | 968 |
| 759 | Ga0495649_0246075 | 3300046694 | Bacteria | 919 |
| 760 | Ga0495589_0011594 | 3300046794 | Bacteria | 4575 |
| 761 | Ga0495589_0036746 | 3300046794 | Bacteria | 2454 |
| 762 | Ga0495589_0039001 | 3300046794 | Bacteria | 2375 |
| 763 | Ga0495589_0040310 | 3300046794 | Bacteria | 2332 |
| 764 | Ga0495589_0090895 | 3300046794 | Bacteria | 1482 |
| 765 | Ga0495589_0094280 | 3300046794 | Bacteria | 1453 |
| 766 | Ga0495589_0106372 | 3300046794 | Bacteria | 1355 |
| 767 | Ga0495589_0128165 | 3300046794 | Bacteria | 1219 |
| 768 | Ga0495589_0175034 | 3300046794 | Bacteria | 1019 |
| 769 | Ga0495600_0014165 | 3300046809 | Bacteria | 5023 |
| 770 | Ga0495600_0212736 | 3300046809 | Bacteria | 1238 |
| 771 | Ga0495660_0001289 | 3300046810 | Bacteria | 17358 |
| 772 | Ga0495660_0017078 | 3300046810 | Bacteria | 4179 |
| 773 | Ga0495660_0018821 | 3300046810 | Bacteria | 3965 |
| 774 | Ga0495660_0054484 | 3300046810 | Bacteria | 2166 |
| 775 | Ga0495660_0079161 | 3300046810 | Bacteria | 1726 |
| 776 | Ga0495660_0080778 | 3300046810 | Bacteria | 1705 |
| 777 | Ga0495660_0134252 | 3300046810 | Bacteria | 1238 |
| 778 | Ga0495660_0136778 | 3300046810 | Bacteria | 1223 |
| 779 | Ga0495660_0141745 | 3300046810 | Bacteria | 1195 |
| 780 | Ga0495660_0143345 | 3300046810 | Bacteria | 1186 |
| 781 | Ga0495660_0199409 | 3300046810 | Bacteria | 956 |
| 782 | Ga0495660_0216411 | 3300046810 | Bacteria | 905 |
| 783 | Ga0495660_0219715 | 3300046810 | Bacteria | 896 |
| 784 | Ga0495660_0221808 | 3300046810 | Bacteria | 891 |
| 785 | Ga0495660_0247510 | 3300046810 | Bacteria | 828 |
| 786 | Ga0495581_0149199 | 3300047315 | Bacteria | 1365 |
| 787 | Ga0495581_0169025 | 3300047315 | Bacteria | 1278 |
| 788 | Ga0495604_0028554 | 3300047317 | Bacteria | 4438 |
| 789 | Ga0495604_0029305 | 3300047317 | Bacteria | 4378 |
| 790 | Ga0495604_0114564 | 3300047317 | Bacteria | 1960 |
| 791 | Ga0495604_0202653 | 3300047317 | Bacteria | 1375 |
| 792 | Ga0495636_0006069 | 3300047318 | Bacteria | 4743 |
| 793 | Ga0495636_0183329 | 3300047318 | Bacteria | 951 |
| 794 | Ga0495636_0188769 | 3300047318 | Bacteria | 937 |
| 795 | Ga0495672_0018737 | 3300047320 | Bacteria | 4584 |
| 796 | Ga0495672_0020647 | 3300047320 | Bacteria | 4310 |
| 797 | Ga0495672_0022090 | 3300047320 | Bacteria | 4141 |
| 798 | Ga0495672_0045116 | 3300047320 | Bacteria | 2640 |
| 799 | Ga0495672_0064470 | 3300047320 | Bacteria | 2098 |
| 800 | Ga0495672_0071401 | 3300047320 | Bacteria | 1964 |
| 801 | Ga0495672_0130272 | 3300047320 | Bacteria | 1324 |
| 802 | Ga0495672_0141979 | 3300047320 | Bacteria | 1253 |
| 803 | Ga0495672_0144096 | 3300047320 | Bacteria | 1241 |
| 804 | Ga0495672_0146815 | 3300047320 | Bacteria | 1226 |
| 805 | Ga0495672_0175652 | 3300047320 | Bacteria | 1088 |
| 806 | Ga0495672_0187137 | 3300047320 | Bacteria | 1044 |
| 807 | Ga0495672_0236677 | 3300047320 | Bacteria | 893 |
| 808 | Ga0495672_0243995 | 3300047320 | Bacteria | 875 |
| 809 | Ga0495672_0327702 | 3300047320 | Bacteria | 717 |
| 810 | Ga0495676_0061550 | 3300047321 | Bacteria | 2936 |
| 811 | Ga0495676_0252806 | 3300047321 | Bacteria | 1201 |
| 812 | Ga0495680_0002007 | 3300047322 | Bacteria | 21362 |
| 813 | Ga0495680_0032347 | 3300047322 | Bacteria | 4246 |
| 814 | Ga0495680_0209323 | 3300047322 | Bacteria | 1396 |
| 815 | Ga0495683_0018874 | 3300047323 | Bacteria | 3560 |
| 816 | Ga0495683_0031471 | 3300047323 | Bacteria | 2704 |
| 817 | Ga0495683_0042657 | 3300047323 | Bacteria | 2286 |
| 818 | Ga0495683_0052252 | 3300047323 | Bacteria | 2040 |
| 819 | Ga0495683_0082056 | 3300047323 | Bacteria | 1571 |
| 820 | Ga0495683_0091476 | 3300047323 | Bacteria | 1473 |
| 821 | Ga0495683_0137668 | 3300047323 | Bacteria | 1146 |
| 822 | Ga0495683_0160079 | 3300047323 | Bacteria | 1041 |
| 823 | Ga0495683_0198864 | 3300047323 | Bacteria | 905 |
| 824 | Ga0495683_0205181 | 3300047323 | Bacteria | 886 |
| 825 | Ga0495687_021709 | 3300047443 | Bacteria | 3098 |
| 826 | Ga0495687_028341 | 3300047443 | Bacteria | 2606 |
| 827 | Ga0495687_037693 | 3300047443 | Bacteria | 2151 |
| 828 | Ga0495687_048721 | 3300047443 | Bacteria | 1815 |
| 829 | Ga0495675_0118847 | 3300047444 | Bacteria | 1646 |
| 830 | Ga0495675_0336937 | 3300047444 | Bacteria | 889 |
| 831 | Ga0495677_0013830 | 3300047445 | Bacteria | 2938 |
| 832 | Ga0495679_014131 | 3300047446 | Bacteria | 2970 |
| 833 | Ga0495679_030999 | 3300047446 | Bacteria | 1729 |
| 834 | Ga0495679_037750 | 3300047446 | Bacteria | 1517 |
| 835 | Ga0495679_049123 | 3300047446 | Bacteria | 1273 |
| 836 | Ga0495679_051094 | 3300047446 | Bacteria | 1241 |
| 837 | Ga0495679_053124 | 3300047446 | Bacteria | 1210 |
| 838 | Ga0495679_059344 | 3300047446 | Bacteria | 1125 |
| 839 | Ga0495685_056915 | 3300047447 | Bacteria | 1321 |
| 840 | Ga0495673_0012189 | 3300047469 | Bacteria | 4575 |
| 841 | Ga0495673_0021627 | 3300047469 | Bacteria | 3172 |
| 842 | Ga0495673_0026961 | 3300047469 | Bacteria | 2738 |
| 843 | Ga0495673_0050442 | 3300047469 | Bacteria | 1826 |
| 844 | Ga0495673_0050595 | 3300047469 | Bacteria | 1822 |
| 845 | Ga0495673_0087591 | 3300047469 | Bacteria | 1277 |
| 846 | Ga0495673_0088006 | 3300047469 | Bacteria | 1273 |
| 847 | Ga0495673_0088108 | 3300047469 | Bacteria | 1272 |
| 848 | Ga0495673_0104608 | 3300047469 | Bacteria | 1139 |
| 849 | Ga0495673_0131676 | 3300047469 | Bacteria | 982 |
| 850 | Ga0495681_0013651 | 3300047470 | Bacteria | 4701 |
| 851 | Ga0495681_0027965 | 3300047470 | Bacteria | 2909 |
| 852 | Ga0495681_0036119 | 3300047470 | Bacteria | 2446 |
| 853 | Ga0495681_0037591 | 3300047470 | Bacteria | 2382 |
| 854 | Ga0495681_0040242 | 3300047470 | Bacteria | 2277 |
| 855 | Ga0495681_0046591 | 3300047470 | Bacteria | 2066 |
| 856 | Ga0495681_0049511 | 3300047470 | Bacteria | 1985 |
| 857 | Ga0495681_0063552 | 3300047470 | Bacteria | 1693 |
| 858 | Ga0495681_0075081 | 3300047470 | Bacteria | 1522 |
| 859 | Ga0495681_0105879 | 3300047470 | Bacteria | 1223 |
| 860 | Ga0495681_0116617 | 3300047470 | Bacteria | 1150 |
| 861 | Ga0495681_0120629 | 3300047470 | Bacteria | 1125 |
| 862 | Ga0495681_0128372 | 3300047470 | Bacteria | 1081 |
| 863 | Ga0495681_0136917 | 3300047470 | Bacteria | 1037 |
| 864 | Ga0495681_0144424 | 3300047470 | Bacteria | 1002 |
| 865 | Ga0495681_0175332 | 3300047470 | Bacteria | 884 |
| 866 | Ga0495684_0188396 | 3300047471 | Bacteria | 1526 |
| 867 | Ga0495684_0293488 | 3300047471 | Bacteria | 1169 |
| 868 | Ga0495686_0029084 | 3300047472 | Bacteria | 3596 |
| 869 | Ga0495686_0067394 | 3300047472 | Bacteria | 2209 |
| 870 | Ga0495686_0073803 | 3300047472 | Bacteria | 2094 |
| 871 | Ga0495686_0119904 | 3300047472 | Bacteria | 1569 |
| 872 | Ga0495686_0259869 | 3300047472 | Bacteria | 972 |
| 873 | Ga0495686_0293068 | 3300047472 | Bacteria | 900 |
| 874 | Ga0495686_0307979 | 3300047472 | Bacteria | 872 |
| 875 | Ga0495686_0326056 | 3300047472 | Bacteria | 840 |
| 876 | Ga0495593_0036988 | 3300047673 | Bacteria | 2643 |
| 877 | Ga0495593_0051410 | 3300047673 | Bacteria | 2181 |
| 878 | Ga0495593_0134771 | 3300047673 | Bacteria | 1252 |
| 879 | Ga0495593_0202135 | 3300047673 | Bacteria | 998 |
| 880 | Ga0495602_0098322 | 3300048088 | Bacteria | 2408 |
| 881 | Ga0495626_0002161 | 3300048091 | Bacteria | 14156 |
| 882 | Ga0495626_0013153 | 3300048091 | Bacteria | 4311 |
| 883 | Ga0495626_0014420 | 3300048091 | Bacteria | 4075 |
| 884 | Ga0495626_0016159 | 3300048091 | Bacteria | 3799 |
| 885 | Ga0495626_0016605 | 3300048091 | Bacteria | 3735 |
| 886 | Ga0495626_0018368 | 3300048091 | Bacteria | 3512 |
| 887 | Ga0495626_0025813 | 3300048091 | Bacteria | 2869 |
| 888 | Ga0495626_0049289 | 3300048091 | Bacteria | 1950 |
| 889 | Ga0495626_0123517 | 3300048091 | Bacteria | 1110 |
| 890 | Ga0495626_0156828 | 3300048091 | Bacteria | 956 |
| 891 | Ga0496102_0056266 | 3300048905 | Bacteria | 3588 |
| 892 | Ga0496102_0568763 | 3300048905 | Bacteria | 1056 |
| 893 | Ga0496103_0224310 | 3300048906 | Bacteria | 1208 |
| 894 | Ga0496105_0470842 | 3300048908 | Bacteria | 990 |
| 895 | Ga0496110_0163280 | 3300048913 | Bacteria | 2019 |
| 896 | Ga0496110_0193041 | 3300048913 | Bacteria | 1849 |
| 897 | Ga0496110_0912967 | 3300048913 | Bacteria | 784 |
| 898 | Ga0496112_0434220 | 3300048915 | Bacteria | 1251 |
| 899 | Ga0496115_0275725 | 3300048918 | Bacteria | 1381 |
| 900 | Ga0496116_0021084 | 3300048919 | Bacteria | 4924 |
| 901 | Ga0496116_0021098 | 3300048919 | Bacteria | 4921 |
| 902 | Ga0496116_0026531 | 3300048919 | Bacteria | 4235 |
| 903 | Ga0496116_0134536 | 3300048919 | Bacteria | 1402 |
| 904 | Ga0496116_0137674 | 3300048919 | Bacteria | 1379 |
| 905 | Ga0496116_0191107 | 3300048919 | Bacteria | 1084 |
| 906 | Ga0496117_0024709 | 3300048920 | Bacteria | 4741 |
| 907 | Ga0496117_0027437 | 3300048920 | Bacteria | 4437 |
| 908 | Ga0496117_0081265 | 3300048920 | Bacteria | 2127 |
| 909 | Ga0496117_0115282 | 3300048920 | Bacteria | 1663 |
| 910 | Ga0496117_0136122 | 3300048920 | Bacteria | 1479 |
| 911 | Ga0496117_0146559 | 3300048920 | Bacteria | 1404 |
| 912 | Ga0496117_0166008 | 3300048920 | Bacteria | 1287 |
| 913 | Ga0496117_0263133 | 3300048920 | Bacteria | 933 |
| 914 | Ga0496118_0031052 | 3300048921 | Bacteria | 4441 |
| 915 | Ga0496118_0071244 | 3300048921 | Bacteria | 2503 |
| 916 | Ga0496118_0123193 | 3300048921 | Bacteria | 1684 |
| 917 | Ga0496118_0139781 | 3300048921 | Bacteria | 1537 |
| 918 | Ga0496118_0147379 | 3300048921 | Bacteria | 1479 |
| 919 | Ga0496118_0156567 | 3300048921 | Bacteria | 1416 |
| 920 | Ga0496118_0163430 | 3300048921 | Bacteria | 1372 |
| 921 | Ga0496118_0225179 | 3300048921 | Bacteria | 1087 |
| 922 | Ga0496118_0239345 | 3300048921 | Bacteria | 1040 |
| 923 | Ga0496118_0274390 | 3300048921 | Bacteria | 942 |
| 924 | Ga0496119_0075002 | 3300048922 | Bacteria | 1967 |
| 925 | Ga0496119_0125557 | 3300048922 | Bacteria | 1404 |
| 926 | Ga0496120_0063909 | 3300048923 | Bacteria | 2045 |
| 927 | Ga0496120_0094903 | 3300048923 | Bacteria | 1586 |
| 928 | Ga0496121_0030950 | 3300048924 | Bacteria | 4903 |
| 929 | Ga0496121_0073656 | 3300048924 | Bacteria | 2736 |
| 930 | Ga0496121_0120503 | 3300048924 | Bacteria | 1982 |
| 931 | Ga0496121_0150325 | 3300048924 | Bacteria | 1714 |
| 932 | Ga0496121_0184042 | 3300048924 | Bacteria | 1504 |
| 933 | Ga0496121_0197366 | 3300048924 | Bacteria | 1437 |
| 934 | Ga0496121_0319175 | 3300048924 | Bacteria | 1047 |
| 935 | Ga0496121_0385703 | 3300048924 | Bacteria | 922 |
| 936 | Ga0496122_0056694 | 3300048925 | Bacteria | 2918 |
| 937 | Ga0496122_0114201 | 3300048925 | Bacteria | 1762 |
| 938 | Ga0496122_0127159 | 3300048925 | Bacteria | 1628 |
| 939 | Ga0496122_0194822 | 3300048925 | Bacteria | 1191 |
| 940 | Ga0496122_0260631 | 3300048925 | Bacteria | 962 |
| 941 | Ga0496122_0274290 | 3300048925 | Bacteria | 926 |
| 942 | Ga0496123_0046289 | 3300048926 | Bacteria | 2952 |
| 943 | Ga0496123_0126745 | 3300048926 | Bacteria | 1423 |
| 944 | Ga0496123_0160641 | 3300048926 | Bacteria | 1198 |
| 945 | Ga0496123_0217693 | 3300048926 | Bacteria | 965 |
| 946 | Ga0496124_0065322 | 3300048927 | Bacteria | 3034 |
| 947 | Ga0496124_0089529 | 3300048927 | Bacteria | 2512 |
| 948 | Ga0496124_0110464 | 3300048927 | Bacteria | 2213 |
| 949 | Ga0496124_0143087 | 3300048927 | Bacteria | 1884 |
| 950 | Ga0496124_0194122 | 3300048927 | Bacteria | 1550 |
| 951 | Ga0496124_0363715 | 3300048927 | Bacteria | 1018 |
| 952 | Ga0496125_0031967 | 3300048928 | Bacteria | 4680 |
| 953 | Ga0496125_0098266 | 3300048928 | Bacteria | 2166 |
| 954 | Ga0496125_0120817 | 3300048928 | Bacteria | 1869 |
| 955 | Ga0496125_0146193 | 3300048928 | Bacteria | 1633 |
| 956 | Ga0496125_0147079 | 3300048928 | Bacteria | 1626 |
| 957 | Ga0496125_0148730 | 3300048928 | Bacteria | 1613 |
| 958 | Ga0496125_0155153 | 3300048928 | Bacteria | 1565 |
| 959 | Ga0496125_0268240 | 3300048928 | Bacteria | 1065 |
| 960 | Ga0496125_0290828 | 3300048928 | Bacteria | 1006 |
| 961 | Ga0496126_0200763 | 3300048929 | Bacteria | 1684 |
| 962 | Ga0496126_0237957 | 3300048929 | Bacteria | 1522 |
| 963 | Ga0496126_0244781 | 3300048929 | Bacteria | 1496 |
| 964 | Ga0495678_006781 | 3300049459 | Bacteria | 6029 |
| 965 | Ga0495678_011835 | 3300049459 | Bacteria | 4160 |
| 966 | Ga0495678_027646 | 3300049459 | Bacteria | 2404 |
| 967 | Ga0495678_029517 | 3300049459 | Bacteria | 2301 |
| 968 | Ga0495678_033534 | 3300049459 | Bacteria | 2118 |
| 969 | Ga0495678_034451 | 3300049459 | Bacteria | 2083 |
| 970 | Ga0495678_046068 | 3300049459 | Bacteria | 1716 |
| 971 | Ga0495678_075408 | 3300049459 | Bacteria | 1224 |
| 972 | Ga0495678_086433 | 3300049459 | Bacteria | 1114 |
| 973 | Ga0495678_093221 | 3300049459 | Bacteria | 1056 |
| 974 | Ga0495678_097288 | 3300049459 | Bacteria | 1025 |
| 975 | Ga0495678_104086 | 3300049459 | Bacteria | 979 |
| 976 | Ga0495678_104513 | 3300049459 | Bacteria | 976 |
| 977 | Ga0495682_0000639 | 3300049460 | Bacteria | 23381 |
| 978 | Ga0495682_0017893 | 3300049460 | Bacteria | 2670 |
| 979 | Ga0495682_0020540 | 3300049460 | Bacteria | 2478 |
| 980 | Ga0495682_0035732 | 3300049460 | Bacteria | 1829 |
| 981 | Ga0495682_0036478 | 3300049460 | Bacteria | 1810 |
| 982 | Ga0495682_0107078 | 3300049460 | Bacteria | 1002 |
| 983 | Ga0495682_0120601 | 3300049460 | Bacteria | 939 |
| 984 | Ga0495682_0129815 | 3300049460 | Bacteria | 901 |
| 985 | Ga0495682_0149724 | 3300049460 | Bacteria | 832 |
| 986 | Ga0495682_0165777 | 3300049460 | Bacteria | 786 |
| 987 | Ga0501241_006783 | 3300049758 | Bacteria | 2104 |
| 988 | nmdc:mga03683_140185_c1 | 3300050489 | Bacteria | 1087 |
| 989 | nmdc:mga00v17_184679_c1 | 3300050491 | Bacteria | 1346 |
| 990 | nmdc:mga00v17_289892_c1 | 3300050491 | Bacteria | 1063 |
| 991 | nmdc:mga08x19_381003_c1 | 3300050514 | Bacteria | 988 |
| 992 | nmdc:mga08x19_434662_c1 | 3300050514 | Bacteria | 923 |
| 993 | Ga0500634_0016683 | 3300053161 | Bacteria | 3921 |
| 994 | 2511255844 | 2511231004 | Bacteria | 6669789 |
| 995 | 2511264962 | 2511231006 | Bacteria | 6794709 |
| 996 | 2511271930 | 2511231007 | Bacteria | 6306603 |
| 997 | 2511274971 | 2511231008 | Bacteria | 6624100 |
| 998 | 2511292723 | 2511231010 | Bacteria | 6373152 |
| 999 | 2511295330 | 2511231011 | Bacteria | 6149768 |
| 1000 | 2511299394 | 2511231012 | Bacteria | 6738011 |
| 1001 | 2511315809 | 2511231014 | Bacteria | 6462302 |
| 1002 | 2511319280 | 2511231015 | Bacteria | 6598026 |
| 1003 | 2511325737 | 2511231016 | Bacteria | 6704427 |
| 1004 | 2511334976 | 2511231017 | Bacteria | 6503007 |
| 1005 | 2511338269 | 2511231018 | Bacteria | 6436256 |
| 1006 | 2511343056 | 2511231019 | Bacteria | 6520662 |
| 1007 | 2511351702 | 2511231020 | Bacteria | 6115223 |
| 1008 | 2511356062 | 2511231021 | Bacteria | 7302637 |
| 1009 | 2511361187 | 2511231022 | Bacteria | 6719296 |
| 1010 | 2511367280 | 2511231023 | Bacteria | 6808468 |
| 1011 | 2511411498 | 2511231031 | Bacteria | 6558529 |
| 1012 | 2511827019 | 2511231156 | Bacteria | 6845832 |
| 1013 | 2512324629 | 2512047018 | Bacteria | 6663241 |
| 1014 | 2555672223 | 2554235341 | Bacteria | 6867980 |
| 1015 | 2583794811 | 2582580891 | Bacteria | 6800976 |
| 1016 | 2597860301 | 2597489887 | Bacteria | 6666321 |
| 1017 | 2597862030 | 2597489888 | Bacteria | 6179543 |
| 1018 | 2597867758 | 2597489889 | Bacteria | 6297495 |
| 1019 | 2599358342 | 2599185160 | Bacteria | 6844013 |
| 1020 | 2599364691 | 2599185161 | Bacteria | 6960462 |
| 1021 | 2599370773 | 2599185162 | Bacteria | 6957254 |
| 1022 | 2599376795 | 2599185163 | Bacteria | 6995158 |
| 1023 | 2599383507 | 2599185164 | Bacteria | 6841688 |
| 1024 | 2599389954 | 2599185165 | Bacteria | 6843250 |
| 1025 | 2599396237 | 2599185166 | Bacteria | 6959206 |
| 1026 | 2599397362 | 2599185167 | Bacteria | 6353609 |
| 1027 | 2599408077 | 2599185168 | Bacteria | 6997636 |
| 1028 | 2599449358 | 2599185179 | Bacteria | 6611171 |
| 1029 | 2599465157 | 2599185181 | Bacteria | 6844519 |
| 1030 | 2599471466 | 2599185182 | Bacteria | 6883168 |
| 1031 | 2599486858 | 2599185185 | Bacteria | 6652270 |
| 1032 | 2599493928 | 2599185186 | Bacteria | 6831633 |
| 1033 | 2599505216 | 2599185188 | Bacteria | 6164180 |
| 1034 | 2599507951 | 2599185189 | Bacteria | 5862825 |
| 1035 | 2599510902 | 2599185190 | Bacteria | 6285678 |
| 1036 | 2599519607 | 2599185191 | Bacteria | 6297582 |
| 1037 | 2599615264 | 2599185212 | Bacteria | 6765997 |
| 1038 | 2599773256 | 2599185248 | Bacteria | 6696816 |
| 1039 | 2599807019 | 2599185257 | Bacteria | 6492581 |
| 1040 | 2599882745 | 2599185288 | Bacteria | 6666191 |
| 1041 | 2599889787 | 2599185289 | Bacteria | 6778765 |
| 1042 | 2599890276 | 2599185290 | Bacteria | 6289611 |
| 1043 | 2599901421 | 2599185291 | Bacteria | 6775623 |
| 1044 | 2599934867 | 2599185300 | Bacteria | 6062622 |
| 1045 | 2599945821 | 2599185302 | Bacteria | 5954930 |
| 1046 | 2599950225 | 2599185303 | Bacteria | 6512725 |
| 1047 | 2599956825 | 2599185304 | Bacteria | 5951361 |
| 1048 | 2599963251 | 2599185305 | Bacteria | 6748700 |
| 1049 | 2599967563 | 2599185306 | Bacteria | 6637356 |
| 1050 | 2599981532 | 2599185308 | Bacteria | 6621546 |
| 1051 | 2599986813 | 2599185309 | Bacteria | 5969593 |
| 1052 | 2599991708 | 2599185310 | Bacteria | 6014457 |
| 1053 | 2599998019 | 2599185311 | Bacteria | 6354990 |
| 1054 | 2600002740 | 2599185312 | Bacteria | 5912071 |
| 1055 | 2600008008 | 2599185313 | Bacteria | 6658188 |
| 1056 | 2600015356 | 2599185314 | Bacteria | 6621749 |
| 1057 | 2600021142 | 2599185315 | Bacteria | 6771107 |
| 1058 | 2600027289 | 2599185316 | Bacteria | 6320029 |
| 1059 | 2600032743 | 2599185317 | Bacteria | 6435722 |
| 1060 | 2600037896 | 2599185318 | Bacteria | 6961590 |
| 1061 | 2600043542 | 2599185319 | Bacteria | 6637840 |
| 1062 | 2600050265 | 2599185320 | Bacteria | 5963263 |
| 1063 | 2600056761 | 2599185321 | Bacteria | 6764560 |
| 1064 | 2600061800 | 2599185322 | Bacteria | 6763055 |
| 1065 | 2600067043 | 2599185323 | Bacteria | 6688755 |
| 1066 | 2600074844 | 2599185324 | Bacteria | 6590677 |
| 1067 | 2600080307 | 2599185325 | Bacteria | 6324919 |
| 1068 | 2600217891 | 2599185356 | Bacteria | 6843884 |
| 1069 | 2600361176 | 2600254930 | Bacteria | 6431253 |
| 1070 | 2600367185 | 2600254931 | Bacteria | 6734225 |
| 1071 | 2601690636 | 2600255296 | Bacteria | 5784754 |
| 1072 | 2601778058 | 2600255313 | Bacteria | 6842543 |
| 1073 | 2601800400 | 2600255318 | Bacteria | 6383414 |
| 1074 | 2606078792 | 2603880185 | Bacteria | 6379190 |
| 1075 | 2606125547 | 2603880199 | Bacteria | 6377649 |
| 1076 | 2621301817 | 2619619299 | Bacteria | 6649820 |
| 1077 | 2624482815 | 2623620443 | Bacteria | 6427864 |
| 1078 | 2624494356 | 2623620446 | Bacteria | 6500345 |
| 1079 | 2643844734 | 2643221565 | Bacteria | 6216018 |
| 1080 | 2643869180 | 2643221571 | Bacteria | 6228673 |
| 1081 | 2643957501 | 2643221589 | Bacteria | 6250934 |
| 1082 | 2644025615 | 2643221602 | Bacteria | 6249926 |
| 1083 | 2644187727 | 2643221633 | Bacteria | 6733554 |
| 1084 | 2644284565 | 2643221650 | Bacteria | 7029547 |
| 1085 | 2644621381 | 2643221713 | Bacteria | 6554480 |
| 1086 | 2652546469 | 2651869719 | Bacteria | 6047974 |
| 1087 | 2671094103 | 2667528170 | Bacteria | 6786960 |
| 1088 | 2671100863 | 2667528171 | Bacteria | 6900659 |
| 1089 | 2671130063 | 2667528176 | Bacteria | 6724917 |
| 1090 | 2671773423 | 2671180172 | Bacteria | 6495783 |
| 1091 | 2677898592 | 2675903420 | Bacteria | 6247433 |
| 1092 | 2678265387 | 2675903515 | Bacteria | 6580491 |
| 1093 | 2715752249 | 2713897148 | Bacteria | 5883533 |
| 1094 | 2715758990 | 2713897149 | Bacteria | 6506249 |
| 1095 | 2718636027 | 2718217725 | Bacteria | 5758958 |
| 1096 | 2723246922 | 2721755607 | Bacteria | 5841722 |
| 1097 | 2738672535 | 2738541265 | Bacteria | 6594665 |
| 1098 | 2738750928 | 2738541282 | Bacteria | 6593925 |
| 1099 | 2738808830 | 2738541294 | Bacteria | 6925949 |
| 1100 | 2738859969 | 2738541303 | Bacteria | 6591772 |
| 1101 | 2738896190 | 2738541309 | Bacteria | 6926455 |
| 1102 | 2739198246 | 2738543004 | Bacteria | 6381073 |
| 1103 | 2739261009 | 2738543015 | Bacteria | 6750701 |
| 1104 | 2739316368 | 2738543025 | Bacteria | 6600348 |
| 1105 | 2743739843 | 2740892503 | Bacteria | 6855563 |
| 1106 | 2745005841 | 2744054620 | Bacteria | 6551379 |
| 1107 | 2774121727 | 2773857670 | Bacteria | 6407454 |
| 1108 | 2774136965 | 2773857673 | Bacteria | 6513460 |
| 1109 | 2784262407 | 2784132063 | Bacteria | 6262788 |
| 1110 | 2784316987 | 2784132072 | Bacteria | 6596533 |
| 1111 | 2794598377 | 2791355520 | Bacteria | 5948615 |
| 1112 | 2808858029 | 2808606361 | Bacteria | 6136259 |
| 1113 | 2808926562 | 2808606376 | Bacteria | 6248667 |
| 1114 | 2808930781 | 2808606377 | Bacteria | 6646337 |
| 1115 | 2808937523 | 2808606378 | Bacteria | 6177535 |
| 1116 | 2808948723 | 2808606380 | Bacteria | 6248705 |
| 1117 | 2808952903 | 2808606381 | Bacteria | 6646461 |
| 1118 | 2808959228 | 2808606382 | Bacteria | 6841132 |
| 1119 | 2808966514 | 2808606383 | Bacteria | 6138645 |
| 1120 | 2808974964 | 2808606385 | Bacteria | 6711065 |
| 1121 | 2808991397 | 2808606388 | Bacteria | 6706662 |
| 1122 | 2809001317 | 2808606389 | Bacteria | 6138126 |
| 1123 | 2809219364 | 2808606445 | Bacteria | 6057339 |
| 1124 | 2817488811 | 2816332298 | Bacteria | 6852809 |
| 1125 | 2819659104 | 2818991456 | Bacteria | 6123676 |
| 1126 | 2819706531 | 2818991464 | Bacteria | 6907494 |
| 1127 | 2823425050 | 2823421272 | Bacteria | 5372474 |
| 1128 | 2825655719 | 2825651385 | Bacteria | 6715909 |
| 1129 | 2834028727 | 2834028612 | Bacteria | 6354979 |
| 1130 | 2842830801 | 2842826826 | Bacteria | 5974129 |
| 1131 | 2842837053 | 2842832357 | Bacteria | 5959113 |
| 1132 | 2842838837 | 2842837860 | Bacteria | 6066181 |
| 1133 | 2842847792 | 2842843487 | Bacteria | 6004777 |
| 1134 | 2842859539 | 2842854478 | Bacteria | 6143501 |
| 1135 | 2844666395 | 2844665904 | Bacteria | 6817974 |
| 1136 | 2852615894 | 2852612431 | Bacteria | 6885235 |
| 1137 | 2852663139 | 2852657418 | Bacteria | 6472974 |
| 1138 | 2852670862 | 2852667396 | Bacteria | 6885555 |
| 1139 | 2860343799 | 2860339153 | Bacteria | 6846989 |
| 1140 | 2860868762 | 2860867994 | Bacteria | 5645326 |
| 1141 | 2878034747 | 2878029506 | Bacteria | 6418441 |
| 1142 | 2880235396 | 2880230671 | Bacteria | 6140320 |
| 1143 | 2904523042 | 2904518522 | Bacteria | 6068986 |
| 1144 | 2904555168 | 2904550169 | Bacteria | 6221258 |
| 1145 | 2908447404 | 2908446538 | Bacteria | 6829095 |
| 1146 | 2913041935 | 2913036834 | Bacteria | 6704877 |
| 1147 | 2917076103 | 2917070673 | Bacteria | 6868303 |
| 1148 | 2919067872 | 2919063839 | Bacteria | 6302690 |
| 1149 | 2919390759 | 2919385768 | Bacteria | 5897293 |
| 1150 | 2919461830 | 2919456309 | Bacteria | 6586567 |
| 1151 | 2919487572 | 2919481497 | Bacteria | 6907839 |
| 1152 | 2919491039 | 2919487758 | Bacteria | 5929766 |
| 1153 | 2919501766 | 2919501602 | Bacteria | 5286340 |
| 1154 | 2919701543 | 2919697872 | Bacteria | 6553725 |
| 1155 | 2923158933 | 2923153595 | Bacteria | 6870622 |
| 1156 | 2923592086 | 2923586266 | Bacteria | 6565975 |
| 1157 | 2926063439 | 2926063275 | Bacteria | 5285848 |
| 1158 | 2929149316 | 2929144301 | Bacteria | 6622272 |
| 1159 | 2929190641 | 2929189879 | Bacteria | 5930554 |
| 1160 | 2931373269 | 2931369376 | Bacteria | 6847892 |
| 1161 | 2931391740 | 2931390751 | Bacteria | 6273349 |
| 1162 | 2931397469 | 2931396565 | Bacteria | 7251677 |
| 1163 | 2935359527 | 2935353572 | Unclassified | 6955622 |
| 1164 | 2939641739 | 2939636861 | Bacteria | 6297853 |
| 1165 | 2939652779 | 2939651529 | Bacteria | 5895393 |
| 1166 | 2945929831 | 2945928738 | Bacteria | 6053221 |
| 1167 | 2945966199 | 2945961074 | Bacteria | 7342064 |
| 1168 | 2946012121 | 2946006987 | Bacteria | 6705746 |
| 1169 | 2946028991 | 2946027586 | Bacteria | 6049274 |
| 1170 | 2947235542 | 2947233263 | Bacteria | 6439278 |
| 1171 | 2969309565 | 2969304461 | Bacteria | 6601805 |
| 1172 | 2974294703 | 2974289157 | Bacteria | 6080362 |
| 1173 | 2984287235 | 2984286254 | Bacteria | 6702062 |
| 1174 | 2988730863 | 2988728565 | Bacteria | 6124362 |
| 1175 | 2998144815 | 2998139840 | Bacteria | 6073514 |
| 1176 | 3007398557 | 3007395558 | Bacteria | 6755444 |
| 1177 | 3007420446 | 3007419365 | Bacteria | 7026924 |
| 1178 | 3007516606 | 3007511990 | Bacteria | 6481491 |
| 1179 | 3007617130 | 3007614139 | Bacteria | 6053559 |
| 1180 | 3007621483 | 3007619802 | Bacteria | 6411688 |
| 1181 | 3007722204 | 3007718800 | Bacteria | 5971527 |
| 1182 | 3007860024 | 3007855910 | Bacteria | 5637581 |
| 1183 | 3007866273 | 3007861166 | Bacteria | 6045338 |
| 1184 | 3007871026 | 3007866637 | Bacteria | 5899198 |
| 1185 | 3007875334 | 3007872151 | Bacteria | 5268868 |
| 1186 | 637322640 | 637000220 | Bacteria | 7074893 |
| 1187 | 8015693019 | 8015687852 | Bacteria | 6613826 |
| 1188 | 8019771445 | 8019769354 | Bacteria | 6924660 |
| 1189 | 8019781444 | 8019775933 | Bacteria | 6858656 |
| 1190 | 8029996080 | 8029995093 | Bacteria | 5990776 |
| 1191 | 8054286319 | 8054285046 | Bacteria | 6919322 |
| 1192 | 8054349168 | 8054347763 | Bacteria | 5901107 |
| 1193 | 8054504336 | 8054503363 | Bacteria | 6101651 |
| 1194 | 8055776266 | 8055770955 | Bacteria | 6827675 |
| 1195 | 8055818766 | 8055817908 | Bacteria | 6609162 |
| 1196 | 8056131030 | 8056125926 | Bacteria | 6228218 |
| 1197 | 8056132663 | 8056131705 | Bacteria | 6107031 |
| 1198 | 8056138260 | 8056137416 | Bacteria | 6147080 |
| 1199 | 8056148150 | 8056143049 | Bacteria | 6307666 |
| 1200 | 8056150925 | 8056148874 | Bacteria | 6479865 |
| 1201 | 8056157161 | 8056155041 | Bacteria | 6486948 |
| 1202 | 8056161484 | 8056161164 | Bacteria | 6106669 |
| 1203 | 8056171753 | 8056166840 | Bacteria | 5820959 |
| 1204 | 8056172432 | 8056172158 | Bacteria | 6133900 |
| 1205 | 8056179090 | 8056177738 | Bacteria | 6748268 |
| 1206 | 8056571843 | 8056569372 | Bacteria | 5997322 |
| 1207 | 8057805105 | 8057798959 | Bacteria | 6713499 |
| 1208 | Ga0182005_1026909 | |||
| 1209 | MRS2a_Contig_814 | |||
| 1210 | SwRhRL2b_contig_2472292 | |||
| 1211 | JGI25162J39368_1003240 | |||
| 1212 | JGI25162J39368_1003322 | |||
| 1213 | JGI25163J39215_1001321 | |||
| 1214 | JGI25163J39215_1001357 | |||
| 1215 | JGI25164J39214_1000406 | |||
| 1216 | JGI25164J39214_1000427 | |||
| 1217 | JGI25165J46597_1000762 | |||
| 1218 | JGI25165J46597_1000820 | |||
| 1219 | rootH1_10160472 | |||
| 1220 | Ga0055538_1000223 | |||
| 1221 | Ga0055539_1000265 | |||
| 1222 | Ga0055533_1000254 | |||
| 1223 | Ga0055532_1000285 | |||
| 1224 | Ga0055525_1001060 | |||
| 1225 | Ga0055536_1007308 | |||
| 1226 | Ga0055536_1007658 | |||
| 1227 | Ga0055536_1007989 | |||
| 1228 | Ga0055530_10006505 | |||
| 1229 | Ga0055530_10006839 | |||
| 1230 | Ga0055530_10006991 | |||
| 1231 | Ga0055540_1005967 | |||
| 1232 | Ga0055540_1006149 | |||
| 1233 | Ga0055540_1006222 | |||
| 1234 | Ga0055531_10000213 | |||
| 1235 | Ga0055541_1000164 | |||
| 1236 | Ga0065714_10000103 | |||
| 1237 | Ga0065714_10012417 | |||
| 1238 | Ga0065714_10017391 | |||
| 1239 | Ga0065714_10067949 | |||
| 1240 | Ga0065714_10068269 | |||
| 1241 | Ga0065714_10068900 | |||
| 1242 | Ga0065714_10150266 | |||
| 1243 | Ga0065714_10154347 | |||
| 1244 | Ga0065704_10090316 | |||
| 1245 | Ga0065712_10001951 | |||
| 1246 | Ga0065712_10008723 | |||
| 1247 | Ga0070670_100028218 | |||
| 1248 | Ga0070670_100095318 | |||
| 1249 | Ga0070661_100001983 | |||
| 1250 | Ga0070669_100015352 | |||
| 1251 | Ga0070669_100016472 | |||
| 1252 | Ga0070662_100003527 | |||
| 1253 | Ga0070662_100115383 | |||
| 1254 | Ga0068853_100001084 | |||
| 1255 | Ga0070665_100185284 | |||
| 1256 | Ga0070664_100000106 | |||
| 1257 | Ga0070664_100606906 | |||
| 1258 | Ga0068854_100000750 | |||
| 1259 | Ga0068851_10000021 | |||
| 1260 | Ga0075363_100192117 | |||
| 1261 | Ga0075364_10063238 | |||
| 1262 | Ga0075364_10168018 | |||
| 1263 | Ga0075364_10310670 | |||
| 1264 | Ga0075364_10390230 | |||
| 1265 | Ga0075432_10015738 | |||
| 1266 | Ga0075432_10055181 | |||
| 1267 | Ga0075432_10064680 | |||
| 1268 | Ga0075432_10078882 | |||
| 1269 | Ga0075432_10103838 | |||
| 1270 | Ga0075432_10138956 | |||
| 1271 | Ga0075432_10141451 | |||
| 1272 | Ga0075432_10164831 | |||
| 1273 | Ga0075362_10080443 | |||
| 1274 | Ga0075362_10164539 | |||
| 1275 | Ga0075369_10178972 | |||
| 1276 | Ga0075436_100120231 | |||
| 1277 | Ga0075436_100144479 | |||
| 1278 | Ga0075436_100255668 | |||
| 1279 | Ga0075436_100283691 | |||
| 1280 | Ga0079104_1005220 | |||
| 1281 | Ga0079104_1005531 | |||
| 1282 | Ga0099826_10016061 | |||
| 1283 | Ga0105251_10011738 | |||
| 1284 | Ga0105251_10012724 | |||
| 1285 | Ga0105251_10032404 | |||
| 1286 | Ga0105251_10050442 | |||
| 1287 | Ga0105251_10058242 | |||
| 1288 | Ga0105251_10066103 | |||
| 1289 | Ga0105244_10013003 | |||
| 1290 | Ga0105244_10016058 | |||
| 1291 | Ga0105244_10034208 | |||
| 1292 | Ga0105244_10057315 | |||
| 1293 | Ga0105244_10061866 | |||
| 1294 | Ga0105244_10087953 | |||
| 1295 | Ga0105244_10128703 | |||
| 1296 | Ga0105244_10185455 | |||
| 1297 | Ga0105244_10220554 | |||
| 1298 | Ga0105250_10007661 | |||
| 1299 | Ga0105250_10010336 | |||
| 1300 | Ga0105250_10011259 | |||
| 1301 | Ga0105250_10034652 | |||
| 1302 | Ga0105250_10047376 | |||
| 1303 | Ga0105250_10049356 | |||
| 1304 | Ga0105250_10126881 | |||
| 1305 | Ga0105250_10141501 | |||
| 1306 | Ga0105243_10020387 | |||
| 1307 | Ga0105243_10021271 | |||
| 1308 | Ga0105243_10022859 | |||
| 1309 | Ga0105243_10291160 | |||
| 1310 | Ga0105242_10020863 | |||
| 1311 | Ga0105248_10168229 | |||
| 1312 | Ga0105237_10000530 | |||
| 1313 | Ga0105249_10172560 | |||
| 1314 | Ga0105246_10014019 | |||
| 1315 | Ga0105246_10015769 | |||
| 1316 | Ga0105246_10047680 | |||
| 1317 | Ga0105246_10052207 | |||
| 1318 | Ga0157336_1000601 | |||
| 1319 | Ga0157345_1000381 | |||
| 1320 | Ga0157373_10020160 | |||
| 1321 | Ga0157373_10024702 | |||
| 1322 | Ga0157373_10054542 | |||
| 1323 | Ga0157373_10057971 | |||
| 1324 | Ga0157373_10073065 | |||
| 1325 | Ga0157373_10157540 | |||
| 1326 | Ga0157373_10189864 | |||
| 1327 | Ga0157373_10203547 | |||
| 1328 | Ga0157373_10366724 | |||
| 1329 | Ga0157371_10020778 | |||
| 1330 | Ga0157371_10021537 | |||
| 1331 | Ga0157371_10411648 | |||
| 1332 | Ga0157371_10520308 | |||
| 1333 | Ga0157370_10006809 | |||
| 1334 | Ga0157370_10102642 | |||
| 1335 | Ga0157370_10112510 | |||
| 1336 | Ga0157370_10214357 | |||
| 1337 | Ga0157370_10256827 | |||
| 1338 | Ga0157369_10000272 | |||
| 1339 | Ga0157369_10059566 | |||
| 1340 | Ga0157369_10108950 | |||
| 1341 | Ga0157369_10139953 | |||
| 1342 | Ga0157369_10244770 | |||
| 1343 | Ga0157369_10558178 | |||
| 1344 | Ga0163162_10277473 | |||
| 1345 | Ga0163162_11068295 | |||
| 1346 | Ga0163162_11068965 | |||
| 1347 | Ga0157372_10259372 | |||
| 1348 | Ga0157375_10034966 | |||
| 1349 | Ga0157375_10107201 | |||
| 1350 | Ga0157375_10363421 | |||
| 1351 | Ga0157375_10404859 | |||
| 1352 | Ga0157375_10692154 | |||
| 1353 | Ga0157375_10793409 | |||
| 1354 | Ga0182008_10011148 | |||
| 1355 | Ga0182008_10034090 | |||
| 1356 | Ga0182008_10034107 | |||
| 1357 | Ga0182008_10048551 | |||
| 1358 | Ga0182008_10066089 | |||
| 1359 | Ga0182008_10082457 | |||
| 1360 | Ga0182008_10083374 | |||
| 1361 | Ga0182008_10084456 | |||
| 1362 | Ga0182008_10085441 | |||
| 1363 | Ga0182008_10090144 | |||
| 1364 | Ga0182006_1007442 | |||
| 1365 | Ga0182006_1008668 | |||
| 1366 | Ga0182006_1009743 | |||
| 1367 | Ga0182006_1009869 | |||
| 1368 | Ga0182006_1019639 | |||
| 1369 | Ga0182006_1031024 | |||
| 1370 | Ga0182006_1048778 | |||
| 1371 | Ga0182006_1055507 | |||
| 1372 | Ga0182007_10008289 | |||
| 1373 | Ga0182007_10040240 | |||
| 1374 | Ga0182005_1007441 | |||
| 1375 | Ga0182005_1020064 | |||
| 1376 | Ga0182005_1038404 | |||
| 1377 | Ga0182005_1044673 | |||
| 1378 | Ga0163161_10023328 | |||
| 1379 | Ga0163161_10088088 | |||
| 1380 | Ga0163161_10199345 | |||
| 1381 | Ga0163161_10211561 | |||
| 1382 | Ga0163161_10229484 | |||
| 1383 | Ga0163161_10265326 | |||
| 1384 | Ga0163161_10293915 | |||
| 1385 | Ga0163161_10538544 | |||
| 1386 | Ga0209760_100009 | |||
| 1387 | Ga0209760_100240 | |||
| 1388 | Ga0209784_100093 | |||
| 1389 | Ga0209566_100109 | |||
| 1390 | Ga0209674_100133 | |||
| 1391 | Ga0209147_100140 | |||
| 1392 | Ga0209563_100124 | |||
| 1393 | Ga0207427_100016 | |||
| 1394 | Ga0207427_100092 | |||
| 1395 | Ga0209437_100011 | |||
| 1396 | Ga0209437_100065 | |||
| 1397 | Ga0209437_118972 | |||
| 1398 | Ga0209646_1000356 | |||
| 1399 | Ga0209677_100084 | |||
| 1400 | Ga0209759_1009823 | |||
| 1401 | Ga0209759_1013117 | |||
| 1402 | Ga0209233_1000019 | |||
| 1403 | Ga0209233_1000085 | |||
| 1404 | Ga0209676_1000076 | |||
| 1405 | Ga0209676_1000423 | |||
| 1406 | Ga0209676_1000544 | |||
| 1407 | Ga0209676_1012009 | |||
| 1408 | Ga0209050_1000063 | |||
| 1409 | Ga0209050_1001614 | |||
| 1410 | Ga0209050_1003951 | |||
| 1411 | Ga0209050_1009695 | |||
| 1412 | Ga0209051_1000045 | |||
| 1413 | Ga0209051_1001217 | |||
| 1414 | Ga0209051_1003407 | |||
| 1415 | Ga0209051_1004537 | |||
| 1416 | Ga0209257_1001395 | |||
| 1417 | Ga0209257_1016658 | |||
| 1418 | Ga0207656_10000020 | |||
| 1419 | Ga0207696_1000047 | |||
| 1420 | Ga0207696_1000052 | |||
| 1421 | Ga0207696_1002215 | |||
| 1422 | Ga0207696_1002929 | |||
| 1423 | Ga0207696_1006081 | |||
| 1424 | Ga0207696_1044506 | |||
| 1425 | Ga0207696_1082890 | |||
| 1426 | Ga0207655_1000005 | |||
| 1427 | Ga0207655_1000015 | |||
| 1428 | Ga0207655_1002404 | |||
| 1429 | Ga0207655_1015242 | |||
| 1430 | Ga0207655_1015503 | |||
| 1431 | Ga0207655_1027070 | |||
| 1432 | Ga0207655_1028284 | |||
| 1433 | Ga0207655_1033530 | |||
| 1434 | Ga0207655_1039869 | |||
| 1435 | Ga0207655_1041720 | |||
| 1436 | Ga0207655_1050728 | |||
| 1437 | Ga0207655_1051763 | |||
| 1438 | Ga0207655_1058255 | |||
| 1439 | Ga0207655_1078597 | |||
| 1440 | Ga0207655_1089501 | |||
| 1441 | Ga0207713_1001126 | |||
| 1442 | Ga0207713_1001381 | |||
| 1443 | Ga0207713_1001558 | |||
| 1444 | Ga0207713_1006595 | |||
| 1445 | Ga0207713_1012862 | |||
| 1446 | Ga0207713_1012974 | |||
| 1447 | Ga0207713_1015521 | |||
| 1448 | Ga0207713_1027738 | |||
| 1449 | Ga0207713_1048964 | |||
| 1450 | Ga0207671_10000091 | |||
| 1451 | Ga0207649_10000020 | |||
| 1452 | Ga0207681_10001200 | |||
| 1453 | Ga0207681_10011442 | |||
| 1454 | Ga0207650_10001806 | |||
| 1455 | Ga0207650_10010215 | |||
| 1456 | Ga0207706_10028814 | |||
| 1457 | Ga0207706_10029073 | |||
| 1458 | Ga0207686_10002435 | |||
| 1459 | Ga0207709_10000030 | |||
| 1460 | Ga0207709_10015459 | |||
| 1461 | Ga0207679_10000023 | |||
| 1462 | Ga0207640_10006652 | |||
| 1463 | Ga0207639_10004305 | |||
| 1464 | Ga0207674_10545440 | |||
| 1465 | Ga0209281_1000070 | |||
| 1466 | Ga0209281_1000249 | |||
| 1467 | Ga0209281_1027647 | |||
| 1468 | Ga0207428_10075011 | |||
| 1469 | Ga0207428_10100559 | |||
| 1470 | Ga0207428_10107541 | |||
| 1471 | Ga0207428_10131711 | |||
| 1472 | Ga0207428_10134771 | |||
| 1473 | Ga0207428_10195628 | |||
| 1474 | Ga0268266_10048925 | |||
| 1475 | Ga0268266_10089030 | |||
| 1476 | Ga0268266_10777985 | |||
| 1477 | Ga0307517_10132904 | |||
| 1478 | Ga0307517_10206681 | |||
| 1479 | Ga0307511_10046472 | |||
| 1480 | Ga0307511_10103557 | |||
| 1481 | Ga0316179_1115579 | |||
| 1482 | Ga0316178_1132417 | |||
| 1483 | Ga0316183_1020816 | |||
| 1484 | Ga0316183_1095850 | |||
| 1485 | Ga0316181_1062350 | |||
| 1486 | Ga0316181_1233680 | |||
| 1487 | Ga0307408_100000020 | |||
| 1488 | Ga0307408_100031181 | |||
| 1489 | Ga0307408_100053636 | |||
| 1490 | Ga0307408_100650265 | |||
| 1491 | Ga0307408_100808173 | |||
| 1492 | Ga0307516_10230646 | |||
| 1493 | Ga0307516_10281767 | |||
| 1494 | Ga0307516_10375978 | |||
| 1495 | Ga0307516_10462449 | |||
| 1496 | Ga0307405_10025612 | |||
| 1497 | Ga0307405_10027415 | |||
| 1498 | Ga0307405_10114434 | |||
| 1499 | Ga0307405_10391934 | |||
| 1500 | Ga0307405_10737253 | |||
| 1501 | Ga0307413_10043742 | |||
| 1502 | Ga0307407_10043019 | |||
| 1503 | Ga0307407_10192519 | |||
| 1504 | Ga0307412_10013603 | |||
| 1505 | Ga0307412_10163328 | |||
| 1506 | Ga0307412_10222894 | |||
| 1507 | Ga0307412_10736746 | |||
| 1508 | Ga0307409_100033599 | |||
| 1509 | Ga0307416_100070637 | |||
| 1510 | Ga0307416_100171920 | |||
| 1511 | Ga0307414_10134089 | |||
| 1512 | Ga0307414_10386549 | |||
| 1513 | Ga0307414_10840056 | |||
| 1514 | Ga0307411_10048187 | |||
| 1515 | Ga0307411_10427803 | |||
| 1516 | Ga0307411_10605561 | |||
| 1517 | Ga0307510_10050664 | |||
| 1518 | Ga0237819_01017 | |||
| 1519 | Ga0439438_000794 | |||
| 1520 | Ga0439438_009197 | |||
| 1521 | Ga0439438_015215 | |||
| 1522 | Ga0439438_019275 | |||
| 1523 | Ga0439438_027297 | |||
| 1524 | Ga0439438_035766 | |||
| 1525 | Ga0439438_044117 | |||
| 1526 | Ga0439438_047536 | |||
| 1527 | Ga0439438_050218 | |||
| 1528 | Ga0439438_051328 | |||
| 1529 | Ga0439447_004461 | |||
| 1530 | Ga0439447_008817 | |||
| 1531 | Ga0439447_015318 | |||
| 1532 | Ga0439447_025149 | |||
| 1533 | Ga0439447_026643 | |||
| 1534 | Ga0439447_029791 | |||
| 1535 | Ga0439447_033780 | |||
| 1536 | Ga0439447_038686 | |||
| 1537 | Ga0439447_048718 | |||
| 1538 | Ga0439466_0005253 | |||
| 1539 | Ga0439466_0005392 | |||
| 1540 | Ga0439466_0008024 | |||
| 1541 | Ga0439466_0022334 | |||
| 1542 | Ga0439466_0059908 | |||
| 1543 | Ga0439466_0066243 | |||
| 1544 | Ga0439466_0079446 | |||
| 1545 | Ga0439465_0016857 | |||
| 1546 | Ga0439445_0068154 | |||
| 1547 | Ga0439432_002066 | |||
| 1548 | Ga0439432_023828 | |||
| 1549 | Ga0439432_031988 | |||
| 1550 | Ga0439432_037697 | |||
| 1551 | Ga0439432_051204 | |||
| 1552 | Ga0439432_062006 | |||
| 1553 | Ga0439432_088632 | |||
| 1554 | Ga0439432_092855 | |||
| 1555 | Ga0439451_007953 | |||
| 1556 | Ga0439451_010329 | |||
| 1557 | Ga0439451_019023 | |||
| 1558 | Ga0439451_024617 | |||
| 1559 | Ga0439451_026942 | |||
| 1560 | Ga0439452_000338 | |||
| 1561 | Ga0439452_000434 | |||
| 1562 | Ga0439452_008622 | |||
| 1563 | Ga0439452_009155 | |||
| 1564 | Ga0439452_036748 | |||
| 1565 | Ga0439452_053676 | |||
| 1566 | Ga0439456_004346 | |||
| 1567 | Ga0439456_017000 | |||
| 1568 | Ga0439456_029346 | |||
| 1569 | Ga0439456_048983 | |||
| 1570 | Ga0439456_054726 | |||
| 1571 | Ga0439456_066704 | |||
| 1572 | Ga0439463_011837 | |||
| 1573 | Ga0439463_035831 | |||
| 1574 | Ga0439463_045203 | |||
| 1575 | Ga0439463_076228 | |||
| 1576 | Ga0439463_091199 | |||
| 1577 | Ga0450911_001932 | |||
| 1578 | Ga0450911_003246 | |||
| 1579 | Ga0450911_006715 | |||
| 1580 | Ga0450919_003093 | |||
| 1581 | Ga0450919_005982 | |||
| 1582 | Ga0450920_007877 | |||
| 1583 | Ga0450922_000844 | |||
| 1584 | Ga0450922_003191 | |||
| 1585 | Ga0450923_024473 | |||
| 1586 | Ga0450890_003483 | |||
| 1587 | Ga0450892_004510 | |||
| 1588 | Ga0450900_012091 | |||
| 1589 | Ga0450902_025410 | |||
| 1590 | Ga0450902_028473 | |||
| 1591 | Ga0450902_029401 | |||
| 1592 | Ga0450903_011248 | |||
| 1593 | Ga0450905_013147 | |||
| 1594 | Ga0450906_001529 | |||
| 1595 | Ga0450907_001646 | |||
| 1596 | Ga0450907_004561 | |||
| 1597 | Ga0450907_006646 | |||
| 1598 | Ga0450910_018891 | |||
| 1599 | Ga0439446_0003265 | |||
| 1600 | Ga0439446_0010828 | |||
| 1601 | Ga0439446_0030074 | |||
| 1602 | Ga0450908_008011 | |||
| 1603 | Ga0450909_001202 | |||
| 1604 | Ga0450909_005639 | |||
| 1605 | Ga0439434_0020729 | |||
| 1606 | Ga0439434_0048062 | |||
| 1607 | Ga0439464_0026657 | |||
| 1608 | Ga0439464_0048947 | |||
| 1609 | Ga0439460_0002707 | |||
| 1610 | Ga0439460_0028347 | |||
| 1611 | Ga0450918_006703 | |||
| 1612 | Ga0439440_0004459 | |||
| 1613 | Ga0439440_0013367 | |||
| 1614 | Ga0439440_0020002 | |||
| 1615 | Ga0495617_004733 | |||
| 1616 | Ga0495617_025554 | |||
| 1617 | Ga0495617_026081 | |||
| 1618 | Ga0495617_032538 | |||
| 1619 | Ga0495617_036832 | |||
| 1620 | Ga0495617_057652 | |||
| 1621 | Ga0495617_083797 | |||
| 1622 | Ga0495617_103975 | |||
| 1623 | Ga0495617_155187 | |||
| 1624 | Ga0495627_000719 | |||
| 1625 | Ga0495627_005599 | |||
| 1626 | Ga0495627_006451 | |||
| 1627 | Ga0495627_027250 | |||
| 1628 | Ga0495627_045567 | |||
| 1629 | Ga0495627_057756 | |||
| 1630 | Ga0495627_066307 | |||
| 1631 | Ga0495603_0074423 | |||
| 1632 | Ga0495603_0134300 | |||
| 1633 | Ga0495590_0006964 | |||
| 1634 | Ga0495590_0013917 | |||
| 1635 | Ga0495590_0037730 | |||
| 1636 | Ga0495590_0055797 | |||
| 1637 | Ga0495590_0087235 | |||
| 1638 | Ga0495590_0088629 | |||
| 1639 | Ga0495591_000140 | |||
| 1640 | Ga0495591_006963 | |||
| 1641 | Ga0495591_008623 | |||
| 1642 | Ga0495591_019828 | |||
| 1643 | Ga0495591_021317 | |||
| 1644 | Ga0495591_027752 | |||
| 1645 | Ga0495591_028650 | |||
| 1646 | Ga0495591_040751 | |||
| 1647 | Ga0495591_042828 | |||
| 1648 | Ga0495591_053702 | |||
| 1649 | Ga0495591_059514 | |||
| 1650 | Ga0495591_059612 | |||
| 1651 | Ga0495591_063676 | |||
| 1652 | Ga0495591_084019 | |||
| 1653 | Ga0495629_0176973 | |||
| 1654 | Ga0495638_0033793 | |||
| 1655 | Ga0495638_0044049 | |||
| 1656 | Ga0495638_0046459 | |||
| 1657 | Ga0495638_0058113 | |||
| 1658 | Ga0495638_0083120 | |||
| 1659 | Ga0495638_0120957 | |||
| 1660 | Ga0495638_0130801 | |||
| 1661 | Ga0495638_0139176 | |||
| 1662 | Ga0495638_0142440 | |||
| 1663 | Ga0495638_0160281 | |||
| 1664 | Ga0495638_0163666 | |||
| 1665 | Ga0495638_0181095 | |||
| 1666 | Ga0495638_0205365 | |||
| 1667 | Ga0495638_0240007 | |||
| 1668 | Ga0495638_0256850 | |||
| 1669 | Ga0495638_0323854 | |||
| 1670 | Ga0495653_0039027 | |||
| 1671 | Ga0495653_0044648 | |||
| 1672 | Ga0495653_0081925 | |||
| 1673 | Ga0495653_0129352 | |||
| 1674 | Ga0495653_0144839 | |||
| 1675 | Ga0495653_0214118 | |||
| 1676 | Ga0495653_0318605 | |||
| 1677 | Ga0495650_0005915 | |||
| 1678 | Ga0495650_0027723 | |||
| 1679 | Ga0495650_0030241 | |||
| 1680 | Ga0495650_0033426 | |||
| 1681 | Ga0495650_0036416 | |||
| 1682 | Ga0495650_0047162 | |||
| 1683 | Ga0495650_0072009 | |||
| 1684 | Ga0495650_0110844 | |||
| 1685 | Ga0495605_0000156 | |||
| 1686 | Ga0495605_0013132 | |||
| 1687 | Ga0495605_0026616 | |||
| 1688 | Ga0495605_0030282 | |||
| 1689 | Ga0495605_0046391 | |||
| 1690 | Ga0495605_0063086 | |||
| 1691 | Ga0495605_0069226 | |||
| 1692 | Ga0495605_0092012 | |||
| 1693 | Ga0495605_0118436 | |||
| 1694 | Ga0495605_0153936 | |||
| 1695 | Ga0495605_0154578 | |||
| 1696 | Ga0495605_0173192 | |||
| 1697 | Ga0495605_0196598 | |||
| 1698 | Ga0495639_0000104 | |||
| 1699 | Ga0495639_0070744 | |||
| 1700 | Ga0495584_0013055 | |||
| 1701 | Ga0495584_0013120 | |||
| 1702 | Ga0495584_0013293 | |||
| 1703 | Ga0495584_0046296 | |||
| 1704 | Ga0495584_0078377 | |||
| 1705 | Ga0495584_0129687 | |||
| 1706 | Ga0495584_0141504 | |||
| 1707 | Ga0495584_0141524 | |||
| 1708 | Ga0495584_0155631 | |||
| 1709 | Ga0495584_0184009 | |||
| 1710 | Ga0495585_0013772 | |||
| 1711 | Ga0495585_0053958 | |||
| 1712 | Ga0495585_0059436 | |||
| 1713 | Ga0495585_0064657 | |||
| 1714 | Ga0495585_0132526 | |||
| 1715 | Ga0495585_0164272 | |||
| 1716 | Ga0495585_0167870 | |||
| 1717 | Ga0495585_0175689 | |||
| 1718 | Ga0495585_0219235 | |||
| 1719 | Ga0495585_0228401 | |||
| 1720 | Ga0495594_0145169 | |||
| 1721 | Ga0495594_0163817 | |||
| 1722 | Ga0495596_0015726 | |||
| 1723 | Ga0495596_0031651 | |||
| 1724 | Ga0495596_0111487 | |||
| 1725 | Ga0495607_0001212 | |||
| 1726 | Ga0495607_0001241 | |||
| 1727 | Ga0495607_0001421 | |||
| 1728 | Ga0495607_0001487 | |||
| 1729 | Ga0495607_0043092 | |||
| 1730 | Ga0495607_0057709 | |||
| 1731 | Ga0495607_0070084 | |||
| 1732 | Ga0495607_0074631 | |||
| 1733 | Ga0495607_0079003 | |||
| 1734 | Ga0495607_0096769 | |||
| 1735 | Ga0495607_0118112 | |||
| 1736 | Ga0495607_0132317 | |||
| 1737 | Ga0495607_0149549 | |||
| 1738 | Ga0495607_0162263 | |||
| 1739 | Ga0495607_0180605 | |||
| 1740 | Ga0495607_0188291 | |||
| 1741 | Ga0495607_0203745 | |||
| 1742 | Ga0495607_0216716 | |||
| 1743 | Ga0495583_0000579 | |||
| 1744 | Ga0495583_0012034 | |||
| 1745 | Ga0495583_0013591 | |||
| 1746 | Ga0495583_0042558 | |||
| 1747 | Ga0495583_0055166 | |||
| 1748 | Ga0495583_0064221 | |||
| 1749 | Ga0495583_0066898 | |||
| 1750 | Ga0495583_0134568 | |||
| 1751 | Ga0495606_0020111 | |||
| 1752 | Ga0495606_0027789 | |||
| 1753 | Ga0495606_0031646 | |||
| 1754 | Ga0495606_0038681 | |||
| 1755 | Ga0495606_0048785 | |||
| 1756 | Ga0495606_0058399 | |||
| 1757 | Ga0495606_0084289 | |||
| 1758 | Ga0495606_0104821 | |||
| 1759 | Ga0495606_0186646 | |||
| 1760 | Ga0495606_0255231 | |||
| 1761 | Ga0495610_0016725 | |||
| 1762 | Ga0495610_0027691 | |||
| 1763 | Ga0495610_0074993 | |||
| 1764 | Ga0495610_0075069 | |||
| 1765 | Ga0495610_0077848 | |||
| 1766 | Ga0495610_0083618 | |||
| 1767 | Ga0495610_0090932 | |||
| 1768 | Ga0495610_0092694 | |||
| 1769 | Ga0495610_0118653 | |||
| 1770 | Ga0495610_0171760 | |||
| 1771 | Ga0495610_0185467 | |||
| 1772 | Ga0495610_0205173 | |||
| 1773 | Ga0495616_0012636 | |||
| 1774 | Ga0495616_0037541 | |||
| 1775 | Ga0495616_0046119 | |||
| 1776 | Ga0495616_0053652 | |||
| 1777 | Ga0495616_0063961 | |||
| 1778 | Ga0495616_0133517 | |||
| 1779 | Ga0495616_0188878 | |||
| 1780 | Ga0495620_0017098 | |||
| 1781 | Ga0495620_0026897 | |||
| 1782 | Ga0495620_0038801 | |||
| 1783 | Ga0495620_0068858 | |||
| 1784 | Ga0495620_0092068 | |||
| 1785 | Ga0495620_0093068 | |||
| 1786 | Ga0495620_0103453 | |||
| 1787 | Ga0495628_0313408 | |||
| 1788 | Ga0495628_0631496 | |||
| 1789 | Ga0495630_0174358 | |||
| 1790 | Ga0495630_0229405 | |||
| 1791 | Ga0495630_0258406 | |||
| 1792 | Ga0495630_0327948 | |||
| 1793 | Ga0495631_0024767 | |||
| 1794 | Ga0495631_0028378 | |||
| 1795 | Ga0495631_0075427 | |||
| 1796 | Ga0495631_0193070 | |||
| 1797 | Ga0495631_0216938 | |||
| 1798 | Ga0495632_0013932 | |||
| 1799 | Ga0495632_0014004 | |||
| 1800 | Ga0495632_0023282 | |||
| 1801 | Ga0495632_0023741 | |||
| 1802 | Ga0495632_0024060 | |||
| 1803 | Ga0495632_0070374 | |||
| 1804 | Ga0495632_0086214 | |||
| 1805 | Ga0495632_0100246 | |||
| 1806 | Ga0495632_0111912 | |||
| 1807 | Ga0495632_0123626 | |||
| 1808 | Ga0495637_0008936 | |||
| 1809 | Ga0495637_0010470 | |||
| 1810 | Ga0495637_0020186 | |||
| 1811 | Ga0495637_0022473 | |||
| 1812 | Ga0495637_0023706 | |||
| 1813 | Ga0495637_0024744 | |||
| 1814 | Ga0495637_0027699 | |||
| 1815 | Ga0495637_0038292 | |||
| 1816 | Ga0495637_0045988 | |||
| 1817 | Ga0495637_0063971 | |||
| 1818 | Ga0495637_0067793 | |||
| 1819 | Ga0495637_0083859 | |||
| 1820 | Ga0495637_0108101 | |||
| 1821 | Ga0495637_0127830 | |||
| 1822 | Ga0495637_0156317 | |||
| 1823 | Ga0495643_0014888 | |||
| 1824 | Ga0495643_0061172 | |||
| 1825 | Ga0495643_0156723 | |||
| 1826 | Ga0495643_0186418 | |||
| 1827 | Ga0495643_0192652 | |||
| 1828 | Ga0495643_0193949 | |||
| 1829 | Ga0495643_0200999 | |||
| 1830 | Ga0495644_0015202 | |||
| 1831 | Ga0495644_0018793 | |||
| 1832 | Ga0495644_0070766 | |||
| 1833 | Ga0495644_0104334 | |||
| 1834 | Ga0495644_0104779 | |||
| 1835 | Ga0495648_0001114 | |||
| 1836 | Ga0495648_0036903 | |||
| 1837 | Ga0495648_0055595 | |||
| 1838 | Ga0495648_0060392 | |||
| 1839 | Ga0495648_0076997 | |||
| 1840 | Ga0495648_0084673 | |||
| 1841 | Ga0495648_0087316 | |||
| 1842 | Ga0495648_0104184 | |||
| 1843 | Ga0495648_0105047 | |||
| 1844 | Ga0495648_0132189 | |||
| 1845 | Ga0495648_0158314 | |||
| 1846 | Ga0495648_0247455 | |||
| 1847 | Ga0495648_0261322 | |||
| 1848 | Ga0495666_0070391 | |||
| 1849 | Ga0495666_0114496 | |||
| 1850 | Ga0495666_0123529 | |||
| 1851 | Ga0495642_0000110 | |||
| 1852 | Ga0495642_0006287 | |||
| 1853 | Ga0495642_0049334 | |||
| 1854 | Ga0495654_0014060 | |||
| 1855 | Ga0495654_0014774 | |||
| 1856 | Ga0495654_0018332 | |||
| 1857 | Ga0495654_0031102 | |||
| 1858 | Ga0495654_0036127 | |||
| 1859 | Ga0495654_0049835 | |||
| 1860 | Ga0495654_0072661 | |||
| 1861 | Ga0495654_0078129 | |||
| 1862 | Ga0495654_0078280 | |||
| 1863 | Ga0495654_0078960 | |||
| 1864 | Ga0495654_0101763 | |||
| 1865 | Ga0495654_0106361 | |||
| 1866 | Ga0495654_0107868 | |||
| 1867 | Ga0495654_0111250 | |||
| 1868 | Ga0495654_0122982 | |||
| 1869 | Ga0495654_0126930 | |||
| 1870 | Ga0495654_0185151 | |||
| 1871 | Ga0495586_0120674 | |||
| 1872 | Ga0495587_0014630 | |||
| 1873 | Ga0495587_0022102 | |||
| 1874 | Ga0495587_0219805 | |||
| 1875 | Ga0495609_0031877 | |||
| 1876 | Ga0495609_0093251 | |||
| 1877 | Ga0495609_0098217 | |||
| 1878 | Ga0495609_0141275 | |||
| 1879 | Ga0495609_0209493 | |||
| 1880 | Ga0495609_0215535 | |||
| 1881 | Ga0495609_0221038 | |||
| 1882 | Ga0495597_0000082 | |||
| 1883 | Ga0495597_0018993 | |||
| 1884 | Ga0495597_0024723 | |||
| 1885 | Ga0495597_0025191 | |||
| 1886 | Ga0495597_0027366 | |||
| 1887 | Ga0495597_0059078 | |||
| 1888 | Ga0495597_0143968 | |||
| 1889 | Ga0495597_0173716 | |||
| 1890 | Ga0495597_0219874 | |||
| 1891 | Ga0495622_0008425 | |||
| 1892 | Ga0495622_0009246 | |||
| 1893 | Ga0495622_0032113 | |||
| 1894 | Ga0495622_0035430 | |||
| 1895 | Ga0495622_0055572 | |||
| 1896 | Ga0495622_0128162 | |||
| 1897 | Ga0495633_0044077 | |||
| 1898 | Ga0495633_0050640 | |||
| 1899 | Ga0495633_0136527 | |||
| 1900 | Ga0495633_0165651 | |||
| 1901 | Ga0495633_0292380 | |||
| 1902 | Ga0495668_0046904 | |||
| 1903 | Ga0495668_0049165 | |||
| 1904 | Ga0495668_0080891 | |||
| 1905 | Ga0495668_0193267 | |||
| 1906 | Ga0495634_0130371 | |||
| 1907 | Ga0495611_0014174 | |||
| 1908 | Ga0495611_0105819 | |||
| 1909 | Ga0495625_0053091 | |||
| 1910 | Ga0495625_0076233 | |||
| 1911 | Ga0495625_0076583 | |||
| 1912 | Ga0495625_0113992 | |||
| 1913 | Ga0495625_0117781 | |||
| 1914 | Ga0495625_0156886 | |||
| 1915 | Ga0495625_0167040 | |||
| 1916 | Ga0495635_0030111 | |||
| 1917 | Ga0495635_0289847 | |||
| 1918 | Ga0495659_0002018 | |||
| 1919 | Ga0495659_0005249 | |||
| 1920 | Ga0495661_0000075 | |||
| 1921 | Ga0495661_0000564 | |||
| 1922 | Ga0495661_0018254 | |||
| 1923 | Ga0495661_0021922 | |||
| 1924 | Ga0495661_0071206 | |||
| 1925 | Ga0495661_0125397 | |||
| 1926 | Ga0495661_0141694 | |||
| 1927 | Ga0495661_0235292 | |||
| 1928 | Ga0495588_0107537 | |||
| 1929 | Ga0495588_0264405 | |||
| 1930 | Ga0495623_0057783 | |||
| 1931 | Ga0495623_0132826 | |||
| 1932 | Ga0495646_0053685 | |||
| 1933 | Ga0495646_0187903 | |||
| 1934 | Ga0495646_0188494 | |||
| 1935 | Ga0495646_0205605 | |||
| 1936 | Ga0495669_0009692 | |||
| 1937 | Ga0495669_0113538 | |||
| 1938 | Ga0495613_0146097 | |||
| 1939 | Ga0495613_0148197 | |||
| 1940 | Ga0495624_0046684 | |||
| 1941 | Ga0495670_0040133 | |||
| 1942 | Ga0495670_0044338 | |||
| 1943 | Ga0495670_0047105 | |||
| 1944 | Ga0495670_0090619 | |||
| 1945 | Ga0495670_0110276 | |||
| 1946 | Ga0495670_0188469 | |||
| 1947 | Ga0495671_0012058 | |||
| 1948 | Ga0495671_0014192 | |||
| 1949 | Ga0495671_0041230 | |||
| 1950 | Ga0495671_0043988 | |||
| 1951 | Ga0495671_0050800 | |||
| 1952 | Ga0495671_0051956 | |||
| 1953 | Ga0495671_0169513 | |||
| 1954 | Ga0495671_0272817 | |||
| 1955 | Ga0495649_0012910 | |||
| 1956 | Ga0495649_0049667 | |||
| 1957 | Ga0495649_0057913 | |||
| 1958 | Ga0495649_0113679 | |||
| 1959 | Ga0495649_0115034 | |||
| 1960 | Ga0495649_0118128 | |||
| 1961 | Ga0495649_0119433 | |||
| 1962 | Ga0495649_0149208 | |||
| 1963 | Ga0495649_0149731 | |||
| 1964 | Ga0495649_0219908 | |||
| 1965 | Ga0495649_0225404 | |||
| 1966 | Ga0495649_0246075 | |||
| 1967 | Ga0495589_0011594 | |||
| 1968 | Ga0495589_0036746 | |||
| 1969 | Ga0495589_0039001 | |||
| 1970 | Ga0495589_0040310 | |||
| 1971 | Ga0495589_0090895 | |||
| 1972 | Ga0495589_0094280 | |||
| 1973 | Ga0495589_0106372 | |||
| 1974 | Ga0495589_0128165 | |||
| 1975 | Ga0495589_0175034 | |||
| 1976 | Ga0495600_0014165 | |||
| 1977 | Ga0495600_0212736 | |||
| 1978 | Ga0495660_0001289 | |||
| 1979 | Ga0495660_0017078 | |||
| 1980 | Ga0495660_0018821 | |||
| 1981 | Ga0495660_0054484 | |||
| 1982 | Ga0495660_0079161 | |||
| 1983 | Ga0495660_0080778 | |||
| 1984 | Ga0495660_0134252 | |||
| 1985 | Ga0495660_0136778 | |||
| 1986 | Ga0495660_0141745 | |||
| 1987 | Ga0495660_0143345 | |||
| 1988 | Ga0495660_0199409 | |||
| 1989 | Ga0495660_0216411 | |||
| 1990 | Ga0495660_0219715 | |||
| 1991 | Ga0495660_0221808 | |||
| 1992 | Ga0495660_0247510 | |||
| 1993 | Ga0495581_0149199 | |||
| 1994 | Ga0495581_0169025 | |||
| 1995 | Ga0495604_0028554 | |||
| 1996 | Ga0495604_0029305 | |||
| 1997 | Ga0495604_0114564 | |||
| 1998 | Ga0495604_0202653 | |||
| 1999 | Ga0495636_0006069 | |||
| 2000 | Ga0495636_0183329 | |||
| 2001 | Ga0495636_0188769 | |||
| 2002 | Ga0495672_0018737 | |||
| 2003 | Ga0495672_0020647 | |||
| 2004 | Ga0495672_0022090 | |||
| 2005 | Ga0495672_0045116 | |||
| 2006 | Ga0495672_0064470 | |||
| 2007 | Ga0495672_0071401 | |||
| 2008 | Ga0495672_0130272 | |||
| 2009 | Ga0495672_0141979 | |||
| 2010 | Ga0495672_0144096 | |||
| 2011 | Ga0495672_0146815 | |||
| 2012 | Ga0495672_0175652 | |||
| 2013 | Ga0495672_0187137 | |||
| 2014 | Ga0495672_0236677 | |||
| 2015 | Ga0495672_0243995 | |||
| 2016 | Ga0495672_0327702 | |||
| 2017 | Ga0495676_0061550 | |||
| 2018 | Ga0495676_0252806 | |||
| 2019 | Ga0495680_0002007 | |||
| 2020 | Ga0495680_0032347 | |||
| 2021 | Ga0495680_0209323 | |||
| 2022 | Ga0495683_0018874 | |||
| 2023 | Ga0495683_0031471 | |||
| 2024 | Ga0495683_0042657 | |||
| 2025 | Ga0495683_0052252 | |||
| 2026 | Ga0495683_0082056 | |||
| 2027 | Ga0495683_0091476 | |||
| 2028 | Ga0495683_0137668 | |||
| 2029 | Ga0495683_0160079 | |||
| 2030 | Ga0495683_0198864 | |||
| 2031 | Ga0495683_0205181 | |||
| 2032 | Ga0495687_021709 | |||
| 2033 | Ga0495687_028341 | |||
| 2034 | Ga0495687_037693 | |||
| 2035 | Ga0495687_048721 | |||
| 2036 | Ga0495675_0118847 | |||
| 2037 | Ga0495675_0336937 | |||
| 2038 | Ga0495677_0013830 | |||
| 2039 | Ga0495679_014131 | |||
| 2040 | Ga0495679_030999 | |||
| 2041 | Ga0495679_037750 | |||
| 2042 | Ga0495679_049123 | |||
| 2043 | Ga0495679_051094 | |||
| 2044 | Ga0495679_053124 | |||
| 2045 | Ga0495679_059344 | |||
| 2046 | Ga0495685_056915 | |||
| 2047 | Ga0495673_0012189 | |||
| 2048 | Ga0495673_0021627 | |||
| 2049 | Ga0495673_0026961 | |||
| 2050 | Ga0495673_0050442 | |||
| 2051 | Ga0495673_0050595 | |||
| 2052 | Ga0495673_0087591 | |||
| 2053 | Ga0495673_0088006 | |||
| 2054 | Ga0495673_0088108 | |||
| 2055 | Ga0495673_0104608 | |||
| 2056 | Ga0495673_0131676 | |||
| 2057 | Ga0495681_0013651 | |||
| 2058 | Ga0495681_0027965 | |||
| 2059 | Ga0495681_0036119 | |||
| 2060 | Ga0495681_0037591 | |||
| 2061 | Ga0495681_0040242 | |||
| 2062 | Ga0495681_0046591 | |||
| 2063 | Ga0495681_0049511 | |||
| 2064 | Ga0495681_0063552 | |||
| 2065 | Ga0495681_0075081 | |||
| 2066 | Ga0495681_0105879 | |||
| 2067 | Ga0495681_0116617 | |||
| 2068 | Ga0495681_0120629 | |||
| 2069 | Ga0495681_0128372 | |||
| 2070 | Ga0495681_0136917 | |||
| 2071 | Ga0495681_0144424 | |||
| 2072 | Ga0495681_0175332 | |||
| 2073 | Ga0495684_0188396 | |||
| 2074 | Ga0495684_0293488 | |||
| 2075 | Ga0495686_0029084 | |||
| 2076 | Ga0495686_0067394 | |||
| 2077 | Ga0495686_0073803 | |||
| 2078 | Ga0495686_0119904 | |||
| 2079 | Ga0495686_0259869 | |||
| 2080 | Ga0495686_0293068 | |||
| 2081 | Ga0495686_0307979 | |||
| 2082 | Ga0495686_0326056 | |||
| 2083 | Ga0495593_0036988 | |||
| 2084 | Ga0495593_0051410 | |||
| 2085 | Ga0495593_0134771 | |||
| 2086 | Ga0495593_0202135 | |||
| 2087 | Ga0495602_0098322 | |||
| 2088 | Ga0495626_0002161 | |||
| 2089 | Ga0495626_0013153 | |||
| 2090 | Ga0495626_0014420 | |||
| 2091 | Ga0495626_0016159 | |||
| 2092 | Ga0495626_0016605 | |||
| 2093 | Ga0495626_0018368 | |||
| 2094 | Ga0495626_0025813 | |||
| 2095 | Ga0495626_0049289 | |||
| 2096 | Ga0495626_0123517 | |||
| 2097 | Ga0495626_0156828 | |||
| 2098 | Ga0496102_0056266 | |||
| 2099 | Ga0496102_0568763 | |||
| 2100 | Ga0496103_0224310 | |||
| 2101 | Ga0496105_0470842 | |||
| 2102 | Ga0496110_0163280 | |||
| 2103 | Ga0496110_0193041 | |||
| 2104 | Ga0496110_0912967 | |||
| 2105 | Ga0496112_0434220 | |||
| 2106 | Ga0496115_0275725 | |||
| 2107 | Ga0496116_0021084 | |||
| 2108 | Ga0496116_0021098 | |||
| 2109 | Ga0496116_0026531 | |||
| 2110 | Ga0496116_0134536 | |||
| 2111 | Ga0496116_0137674 | |||
| 2112 | Ga0496116_0191107 | |||
| 2113 | Ga0496117_0024709 | |||
| 2114 | Ga0496117_0027437 | |||
| 2115 | Ga0496117_0081265 | |||
| 2116 | Ga0496117_0115282 | |||
| 2117 | Ga0496117_0136122 | |||
| 2118 | Ga0496117_0146559 | |||
| 2119 | Ga0496117_0166008 | |||
| 2120 | Ga0496117_0263133 | |||
| 2121 | Ga0496118_0031052 | |||
| 2122 | Ga0496118_0071244 | |||
| 2123 | Ga0496118_0123193 | |||
| 2124 | Ga0496118_0139781 | |||
| 2125 | Ga0496118_0147379 | |||
| 2126 | Ga0496118_0156567 | |||
| 2127 | Ga0496118_0163430 | |||
| 2128 | Ga0496118_0225179 | |||
| 2129 | Ga0496118_0239345 | |||
| 2130 | Ga0496118_0274390 | |||
| 2131 | Ga0496119_0075002 | |||
| 2132 | Ga0496119_0125557 | |||
| 2133 | Ga0496120_0063909 | |||
| 2134 | Ga0496120_0094903 | |||
| 2135 | Ga0496121_0030950 | |||
| 2136 | Ga0496121_0073656 | |||
| 2137 | Ga0496121_0120503 | |||
| 2138 | Ga0496121_0150325 | |||
| 2139 | Ga0496121_0184042 | |||
| 2140 | Ga0496121_0197366 | |||
| 2141 | Ga0496121_0319175 | |||
| 2142 | Ga0496121_0385703 | |||
| 2143 | Ga0496122_0056694 | |||
| 2144 | Ga0496122_0114201 | |||
| 2145 | Ga0496122_0127159 | |||
| 2146 | Ga0496122_0194822 | |||
| 2147 | Ga0496122_0260631 | |||
| 2148 | Ga0496122_0274290 | |||
| 2149 | Ga0496123_0046289 | |||
| 2150 | Ga0496123_0126745 | |||
| 2151 | Ga0496123_0160641 | |||
| 2152 | Ga0496123_0217693 | |||
| 2153 | Ga0496124_0065322 | |||
| 2154 | Ga0496124_0089529 | |||
| 2155 | Ga0496124_0110464 | |||
| 2156 | Ga0496124_0143087 | |||
| 2157 | Ga0496124_0194122 | |||
| 2158 | Ga0496124_0363715 | |||
| 2159 | Ga0496125_0031967 | |||
| 2160 | Ga0496125_0098266 | |||
| 2161 | Ga0496125_0120817 | |||
| 2162 | Ga0496125_0146193 | |||
| 2163 | Ga0496125_0147079 | |||
| 2164 | Ga0496125_0148730 | |||
| 2165 | Ga0496125_0155153 | |||
| 2166 | Ga0496125_0268240 | |||
| 2167 | Ga0496125_0290828 | |||
| 2168 | Ga0496126_0200763 | |||
| 2169 | Ga0496126_0237957 | |||
| 2170 | Ga0496126_0244781 | |||
| 2171 | Ga0495678_006781 | |||
| 2172 | Ga0495678_011835 | |||
| 2173 | Ga0495678_027646 | |||
| 2174 | Ga0495678_029517 | |||
| 2175 | Ga0495678_033534 | |||
| 2176 | Ga0495678_034451 | |||
| 2177 | Ga0495678_046068 | |||
| 2178 | Ga0495678_075408 | |||
| 2179 | Ga0495678_086433 | |||
| 2180 | Ga0495678_093221 | |||
| 2181 | Ga0495678_097288 | |||
| 2182 | Ga0495678_104086 | |||
| 2183 | Ga0495678_104513 | |||
| 2184 | Ga0495682_0000639 | |||
| 2185 | Ga0495682_0017893 | |||
| 2186 | Ga0495682_0020540 | |||
| 2187 | Ga0495682_0035732 | |||
| 2188 | Ga0495682_0036478 | |||
| 2189 | Ga0495682_0107078 | |||
| 2190 | Ga0495682_0120601 | |||
| 2191 | Ga0495682_0129815 | |||
| 2192 | Ga0495682_0149724 | |||
| 2193 | Ga0495682_0165777 | |||
| 2194 | Ga0501241_006783 | |||
| 2195 | nmdc:mga03683_140185_c1 | |||
| 2196 | nmdc:mga00v17_184679_c1 | |||
| 2197 | nmdc:mga00v17_289892_c1 | |||
| 2198 | nmdc:mga08x19_381003_c1 | |||
| 2199 | nmdc:mga08x19_434662_c1 | |||
| 2200 | Ga0500634_0016683 | |||
| 2201 | 2511255844 | |||
| 2202 | 2511264962 | |||
| 2203 | 2511271930 | |||
| 2204 | 2511274971 | |||
| 2205 | 2511292723 | |||
| 2206 | 2511295330 | |||
| 2207 | 2511299394 | |||
| 2208 | 2511315809 | |||
| 2209 | 2511319280 | |||
| 2210 | 2511325737 | |||
| 2211 | 2511334976 | |||
| 2212 | 2511338269 | |||
| 2213 | 2511343056 | |||
| 2214 | 2511351702 | |||
| 2215 | 2511356062 | |||
| 2216 | 2511361187 | |||
| 2217 | 2511367280 | |||
| 2218 | 2511411498 | |||
| 2219 | 2511827019 | |||
| 2220 | 2512324629 | |||
| 2221 | 2555672223 | |||
| 2222 | 2583794811 | |||
| 2223 | 2597860301 | |||
| 2224 | 2597862030 | |||
| 2225 | 2597867758 | |||
| 2226 | 2599358342 | |||
| 2227 | 2599364691 | |||
| 2228 | 2599370773 | |||
| 2229 | 2599376795 | |||
| 2230 | 2599383507 | |||
| 2231 | 2599389954 | |||
| 2232 | 2599396237 | |||
| 2233 | 2599397362 | |||
| 2234 | 2599408077 | |||
| 2235 | 2599449358 | |||
| 2236 | 2599465157 | |||
| 2237 | 2599471466 | |||
| 2238 | 2599486858 | |||
| 2239 | 2599493928 | |||
| 2240 | 2599505216 | |||
| 2241 | 2599507951 | |||
| 2242 | 2599510902 | |||
| 2243 | 2599519607 | |||
| 2244 | 2599615264 | |||
| 2245 | 2599773256 | |||
| 2246 | 2599807019 | |||
| 2247 | 2599882745 | |||
| 2248 | 2599889787 | |||
| 2249 | 2599890276 | |||
| 2250 | 2599901421 | |||
| 2251 | 2599934867 | |||
| 2252 | 2599945821 | |||
| 2253 | 2599950225 | |||
| 2254 | 2599956825 | |||
| 2255 | 2599963251 | |||
| 2256 | 2599967563 | |||
| 2257 | 2599981532 | |||
| 2258 | 2599986813 | |||
| 2259 | 2599991708 | |||
| 2260 | 2599998019 | |||
| 2261 | 2600002740 | |||
| 2262 | 2600008008 | |||
| 2263 | 2600015356 | |||
| 2264 | 2600021142 | |||
| 2265 | 2600027289 | |||
| 2266 | 2600032743 | |||
| 2267 | 2600037896 | |||
| 2268 | 2600043542 | |||
| 2269 | 2600050265 | |||
| 2270 | 2600056761 | |||
| 2271 | 2600061800 | |||
| 2272 | 2600067043 | |||
| 2273 | 2600074844 | |||
| 2274 | 2600080307 | |||
| 2275 | 2600217891 | |||
| 2276 | 2600361176 | |||
| 2277 | 2600367185 | |||
| 2278 | 2601690636 | |||
| 2279 | 2601778058 | |||
| 2280 | 2601800400 | |||
| 2281 | 2606078792 | |||
| 2282 | 2606125547 | |||
| 2283 | 2621301817 | |||
| 2284 | 2624482815 | |||
| 2285 | 2624494356 | |||
| 2286 | 2643844734 | |||
| 2287 | 2643869180 | |||
| 2288 | 2643957501 | |||
| 2289 | 2644025615 | |||
| 2290 | 2644187727 | |||
| 2291 | 2644284565 | |||
| 2292 | 2644621381 | |||
| 2293 | 2652546469 | |||
| 2294 | 2671094103 | |||
| 2295 | 2671100863 | |||
| 2296 | 2671130063 | |||
| 2297 | 2671773423 | |||
| 2298 | 2677898592 | |||
| 2299 | 2678265387 | |||
| 2300 | 2715752249 | |||
| 2301 | 2715758990 | |||
| 2302 | 2718636027 | |||
| 2303 | 2723246922 | |||
| 2304 | 2738672535 | |||
| 2305 | 2738750928 | |||
| 2306 | 2738808830 | |||
| 2307 | 2738859969 | |||
| 2308 | 2738896190 | |||
| 2309 | 2739198246 | |||
| 2310 | 2739261009 | |||
| 2311 | 2739316368 | |||
| 2312 | 2743739843 | |||
| 2313 | 2745005841 | |||
| 2314 | 2774121727 | |||
| 2315 | 2774136965 | |||
| 2316 | 2784262407 | |||
| 2317 | 2784316987 | |||
| 2318 | 2794598377 | |||
| 2319 | 2808858029 | |||
| 2320 | 2808926562 | |||
| 2321 | 2808930781 | |||
| 2322 | 2808937523 | |||
| 2323 | 2808948723 | |||
| 2324 | 2808952903 | |||
| 2325 | 2808959228 | |||
| 2326 | 2808966514 | |||
| 2327 | 2808974964 | |||
| 2328 | 2808991397 | |||
| 2329 | 2809001317 | |||
| 2330 | 2809219364 | |||
| 2331 | 2817488811 | |||
| 2332 | 2819659104 | |||
| 2333 | 2819706531 | |||
| 2334 | 2823425050 | |||
| 2335 | 2825655719 | |||
| 2336 | 2834028727 | |||
| 2337 | 2842830801 | |||
| 2338 | 2842837053 | |||
| 2339 | 2842838837 | |||
| 2340 | 2842847792 | |||
| 2341 | 2842859539 | |||
| 2342 | 2844666395 | |||
| 2343 | 2852615894 | |||
| 2344 | 2852663139 | |||
| 2345 | 2852670862 | |||
| 2346 | 2860343799 | |||
| 2347 | 2860868762 | |||
| 2348 | 2878034747 | |||
| 2349 | 2880235396 | |||
| 2350 | 2904523042 | |||
| 2351 | 2904555168 | |||
| 2352 | 2908447404 | |||
| 2353 | 2913041935 | |||
| 2354 | 2917076103 | |||
| 2355 | 2919067872 | |||
| 2356 | 2919390759 | |||
| 2357 | 2919461830 | |||
| 2358 | 2919487572 | |||
| 2359 | 2919491039 | |||
| 2360 | 2919501766 | |||
| 2361 | 2919701543 | |||
| 2362 | 2923158933 | |||
| 2363 | 2923592086 | |||
| 2364 | 2926063439 | |||
| 2365 | 2929149316 | |||
| 2366 | 2929190641 | |||
| 2367 | 2931373269 | |||
| 2368 | 2931391740 | |||
| 2369 | 2931397469 | |||
| 2370 | 2935359527 | |||
| 2371 | 2939641739 | |||
| 2372 | 2939652779 | |||
| 2373 | 2945929831 | |||
| 2374 | 2945966199 | |||
| 2375 | 2946012121 | |||
| 2376 | 2946028991 | |||
| 2377 | 2947235542 | |||
| 2378 | 2969309565 | |||
| 2379 | 2974294703 | |||
| 2380 | 2984287235 | |||
| 2381 | 2988730863 | |||
| 2382 | 2998144815 | |||
| 2383 | 3007398557 | |||
| 2384 | 3007420446 | |||
| 2385 | 3007516606 | |||
| 2386 | 3007617130 | |||
| 2387 | 3007621483 | |||
| 2388 | 3007722204 | |||
| 2389 | 3007860024 | |||
| 2390 | 3007866273 | |||
| 2391 | 3007871026 | |||
| 2392 | 3007875334 | |||
| 2393 | 637322640 | |||
| 2394 | 8015693019 | |||
| 2395 | 8019771445 | |||
| 2396 | 8019781444 | |||
| 2397 | 8029996080 | |||
| 2398 | 8054286319 | |||
| 2399 | 8054349168 | |||
| 2400 | 8054504336 | |||
| 2401 | 8055776266 | |||
| 2402 | 8055818766 | |||
| 2403 | 8056131030 | |||
| 2404 | 8056132663 | |||
| 2405 | 8056138260 | |||
| 2406 | 8056148150 | |||
| 2407 | 8056150925 | |||
| 2408 | 8056157161 | |||
| 2409 | 8056161484 | |||
| 2410 | 8056171753 | |||
| 2411 | 8056172432 | |||
| 2412 | 8056179090 | |||
| 2413 | 8056571843 | |||
| 2414 | 8057805105 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rv9-assembly1.cif.gz_A | crystal structure of neisseria meningitidis protein nmb0706, pfam duf152 | 0.7631 | 1 | 216 |
| 1rv9-assembly1.cif.gz_A | crystal structure of neisseria meningitidis protein nmb0706, pfam duf152 | 0.76 | 1 | 216 |
| 7f3v-assembly3.cif.gz_C | crystal structure of yfih with c107a mutation in complex with endogenous udp-murnac | 0.7543 | 4 | 215 |
| 1z9t-assembly1.cif.gz_A | crystal structure of a putative laccase (yfih) from escherichia coli at 1.54 a resolution | 0.7543 | 4 | 215 |
| 1xaf-assembly1.cif.gz_B | crystal structure of protein of unknown function yfih from shigella flexneri 2a str. 2457t | 0.75 | 4 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZ88_1_221_3.60.140.10 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.7914 | 36 | 215 | 3.60.140.10 |
| 1rv9A00 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.7631 | 1 | 216 | 3.60.140.10 |
| 1rv9A00 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.76 | 1 | 216 | 3.60.140.10 |
| 1xafA00 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.7361 | 4 | 215 | 3.60.140.10 |
| 1xafA00 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.7208 | 4 | 215 | 3.60.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J6CJN7-F1-model_v4 | deleted | 0.9042 | 76 | 186 |
|
| AF-A0A7G2JZ14-F1-model_v4 | Purine nucleoside phosphorylase | 0.8886 | 76 | 168 |
GO:0004000
GO:0005507 GO:0017061 GO:0046936 |
| AF-A0A3M3HJ45-F1-model_v4 | deleted | 0.8666 | 89 | 215 |
|
| AF-A0A658K3C0-F1-model_v4 | Multicopper polyphenol oxidase | 0.8548 | 96 | 216 |
GO:0004000
GO:0005507 GO:0017061 GO:0046936 |
| AF-A0A534B2K8-F1-model_v4 | Purine nucleoside phosphorylase | 0.8545 | 84 | 215 |
GO:0004000
GO:0005507 GO:0017061 GO:0046936 |