F491613
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1203 | 447 | 2406 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10077157|Ga0070709_100771572 |
| Length | 277 |
| Sequence | MALPVQRELRAGAEGLSRGPAHTGGMTTEAQGAQLARAGQAPPVQRVDGSPIRVLVVDDEPSLAELLASVLRYEGWEIRTAGDGVTAVRTAREFRPDAVVLDIMLPDFDGLEVLRRIRQDSPQVCVLFLTARDSVDDRVAGITAGGDDYVTKPFSLEEVLARLRGLLRRAGLARARGETQLAVGDLTMDEDAREVRRGDDLIDLTATEFELLRFLMRNPRRVLSKAQILDRVWNYDFGGQAHVVELYISYLRKKIDAGREPLIHTVRGVGYVLKPAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 108 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 127 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 134 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 136 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 200 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 203 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 204 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 205 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 206 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 207 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 208 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 218 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 219 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 220 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 221 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 223 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 224 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 234 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 239 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 247 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 253 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 255 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 261 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 264 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 265 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 266 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 267 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 268 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 270 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 271 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 272 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 273 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 274 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 275 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 276 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 277 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 278 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 279 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 280 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 281 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 338 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 339 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 340 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 341 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 342 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 343 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 346 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 347 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 348 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 349 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 350 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 351 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 352 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 353 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 354 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 383 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 384 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 400 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 401 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 402 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 403 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 404 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 405 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 406 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 407 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 410 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 411 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 412 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 413 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 414 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 415 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 416 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 417 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 418 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 419 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 420 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 421 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 422 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 423 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 424 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 425 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 426 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 427 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 428 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 429 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 430 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 431 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 432 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 433 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 434 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 435 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 436 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 437 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 438 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 439 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 440 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 441 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 442 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 443 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 444 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 445 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 446 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 447 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.85 |
| Metatranscriptomes | 2 |
| Isolates | 3.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 1.91 |
| Nodule | 0.17 |
| Rhizoplane | 8.06 |
| Rhizosphere | 84.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070709_10077157 | 3300005434 | Bacteria | 2165 |
| 2 | JGI24739J22299_10074272 | 3300001989 | Bacteria | 1053 |
| 3 | JGI24743J22301_10009419 | 3300001991 | Bacteria | 1730 |
| 4 | JGI24738J21930_10005489 | 3300002075 | Bacteria | 3035 |
| 5 | JGI25404J52841_10010555 | 3300003659 | Bacteria | 1985 |
| 6 | Ga0070658_10049656 | 3300005327 | Bacteria | 3399 |
| 7 | Ga0070658_10164455 | 3300005327 | Bacteria | 1863 |
| 8 | Ga0070683_100145261 | 3300005329 | Bacteria | 2247 |
| 9 | Ga0070690_100158485 | 3300005330 | Bacteria | 1549 |
| 10 | Ga0070690_100280803 | 3300005330 | Bacteria | 1188 |
| 11 | Ga0070670_100027661 | 3300005331 | Bacteria | 4878 |
| 12 | Ga0068869_100009064 | 3300005334 | Bacteria | 6448 |
| 13 | Ga0068869_100013540 | 3300005334 | Bacteria | 5428 |
| 14 | Ga0068869_100091214 | 3300005334 | Bacteria | 2292 |
| 15 | Ga0068869_100150784 | 3300005334 | Bacteria | 1803 |
| 16 | Ga0070666_10043691 | 3300005335 | Bacteria | 3001 |
| 17 | Ga0070666_10107835 | 3300005335 | Bacteria | 1925 |
| 18 | Ga0070680_100025795 | 3300005336 | Bacteria | 4699 |
| 19 | Ga0070680_100039708 | 3300005336 | Bacteria | 3807 |
| 20 | Ga0070682_100011309 | 3300005337 | Bacteria | 5097 |
| 21 | Ga0070682_100158280 | 3300005337 | Bacteria | 1562 |
| 22 | Ga0070682_100219967 | 3300005337 | Bacteria | 1351 |
| 23 | Ga0070682_100308236 | 3300005337 | Bacteria | 1164 |
| 24 | Ga0068868_100001738 | 3300005338 | Bacteria | 14922 |
| 25 | Ga0068868_100116560 | 3300005338 | Bacteria | 2175 |
| 26 | Ga0070660_100017931 | 3300005339 | Bacteria | 5165 |
| 27 | Ga0070660_100103162 | 3300005339 | Bacteria | 2261 |
| 28 | Ga0070689_100061491 | 3300005340 | Bacteria | 2921 |
| 29 | Ga0070691_10003832 | 3300005341 | Bacteria | 6793 |
| 30 | Ga0070687_100012858 | 3300005343 | Bacteria | 3711 |
| 31 | Ga0070687_100017559 | 3300005343 | Bacteria | 3293 |
| 32 | Ga0070661_100004959 | 3300005344 | Bacteria | 9166 |
| 33 | Ga0070661_100039922 | 3300005344 | Bacteria | 3421 |
| 34 | Ga0070692_10004181 | 3300005345 | Bacteria | 5984 |
| 35 | Ga0070692_10046146 | 3300005345 | Bacteria | 2251 |
| 36 | Ga0070692_10062498 | 3300005345 | Bacteria | 1965 |
| 37 | Ga0070692_10168752 | 3300005345 | Bacteria | 1260 |
| 38 | Ga0070668_100127331 | 3300005347 | Bacteria | 2041 |
| 39 | Ga0070675_100006254 | 3300005354 | Bacteria | 9137 |
| 40 | Ga0070675_100012160 | 3300005354 | Bacteria | 6747 |
| 41 | Ga0070671_100012625 | 3300005355 | Bacteria | 6808 |
| 42 | Ga0070671_100224350 | 3300005355 | Bacteria | 1594 |
| 43 | Ga0070673_100197398 | 3300005364 | Bacteria | 1731 |
| 44 | Ga0070688_100208277 | 3300005365 | Bacteria | 1372 |
| 45 | Ga0070659_100045613 | 3300005366 | Bacteria | 3434 |
| 46 | Ga0070659_100049396 | 3300005366 | Bacteria | 3308 |
| 47 | Ga0070659_100117742 | 3300005366 | Bacteria | 2148 |
| 48 | Ga0070659_100191879 | 3300005366 | Bacteria | 1679 |
| 49 | Ga0070709_10001827 | 3300005434 | Bacteria | 11546 |
| 50 | Ga0070709_10017307 | 3300005434 | Bacteria | 4132 |
| 51 | Ga0070714_100000076 | 3300005435 | Bacteria | 84569 |
| 52 | Ga0070714_100000630 | 3300005435 | Bacteria | 25127 |
| 53 | Ga0070714_100016313 | 3300005435 | Bacteria | 5993 |
| 54 | Ga0070714_100022645 | 3300005435 | Bacteria | 5152 |
| 55 | Ga0070714_100026551 | 3300005435 | Bacteria | 4787 |
| 56 | Ga0070714_100032567 | 3300005435 | Bacteria | 4352 |
| 57 | Ga0070714_100071758 | 3300005435 | Bacteria | 2995 |
| 58 | Ga0070714_100287565 | 3300005435 | Bacteria | 1529 |
| 59 | Ga0070714_100290885 | 3300005435 | Bacteria | 1520 |
| 60 | Ga0070713_100009273 | 3300005436 | Bacteria | 7033 |
| 61 | Ga0070713_100052282 | 3300005436 | Bacteria | 3382 |
| 62 | Ga0070713_100137108 | 3300005436 | Bacteria | 2163 |
| 63 | Ga0070713_100191388 | 3300005436 | Bacteria | 1843 |
| 64 | Ga0070713_100199361 | 3300005436 | Bacteria | 1807 |
| 65 | Ga0070713_100212874 | 3300005436 | Bacteria | 1750 |
| 66 | Ga0070713_100469101 | 3300005436 | Bacteria | 1185 |
| 67 | Ga0070713_100664113 | 3300005436 | Bacteria | 993 |
| 68 | Ga0070710_10000145 | 3300005437 | Bacteria | 32792 |
| 69 | Ga0070710_10003172 | 3300005437 | Bacteria | 7792 |
| 70 | Ga0070710_10078199 | 3300005437 | Bacteria | 1924 |
| 71 | Ga0070710_10090224 | 3300005437 | Bacteria | 1806 |
| 72 | Ga0070701_10012256 | 3300005438 | Bacteria | 3860 |
| 73 | Ga0070711_100235448 | 3300005439 | Bacteria | 1429 |
| 74 | Ga0070711_100300878 | 3300005439 | Bacteria | 1275 |
| 75 | Ga0070711_100389726 | 3300005439 | Bacteria | 1128 |
| 76 | Ga0070705_100376474 | 3300005440 | Bacteria | 1043 |
| 77 | Ga0070700_100031520 | 3300005441 | Bacteria | 3178 |
| 78 | Ga0070700_100342360 | 3300005441 | Bacteria | 1106 |
| 79 | Ga0070708_100036965 | 3300005445 | Bacteria | 4258 |
| 80 | Ga0070708_100055285 | 3300005445 | Bacteria | 3529 |
| 81 | Ga0070708_100298384 | 3300005445 | Bacteria | 1517 |
| 82 | Ga0070663_100001480 | 3300005455 | Bacteria | 12905 |
| 83 | Ga0070663_100005175 | 3300005455 | Bacteria | 7724 |
| 84 | Ga0070663_100056286 | 3300005455 | Bacteria | 2817 |
| 85 | Ga0070663_100062969 | 3300005455 | Bacteria | 2676 |
| 86 | Ga0070678_100002453 | 3300005456 | Bacteria | 10161 |
| 87 | Ga0070678_100131008 | 3300005456 | Bacteria | 1992 |
| 88 | Ga0070678_100229817 | 3300005456 | Bacteria | 1546 |
| 89 | Ga0070662_100005331 | 3300005457 | Bacteria | 8216 |
| 90 | Ga0070681_10007532 | 3300005458 | Bacteria | 10639 |
| 91 | Ga0070681_10119510 | 3300005458 | Bacteria | 2571 |
| 92 | Ga0068867_100178930 | 3300005459 | Bacteria | 1685 |
| 93 | Ga0070685_10011347 | 3300005466 | Bacteria | 4666 |
| 94 | Ga0070685_10231373 | 3300005466 | Bacteria | 1216 |
| 95 | Ga0070706_100000349 | 3300005467 | Bacteria | 55601 |
| 96 | Ga0070706_100000813 | 3300005467 | Bacteria | 34620 |
| 97 | Ga0070706_100002736 | 3300005467 | Bacteria | 17624 |
| 98 | Ga0070706_100006549 | 3300005467 | Bacteria | 10988 |
| 99 | Ga0070706_100037946 | 3300005467 | Bacteria | 4448 |
| 100 | Ga0070706_100077404 | 3300005467 | Bacteria | 3078 |
| 101 | Ga0070706_100087281 | 3300005467 | Bacteria | 2891 |
| 102 | Ga0070707_100000381 | 3300005468 | Bacteria | 43789 |
| 103 | Ga0070707_100000524 | 3300005468 | Bacteria | 38316 |
| 104 | Ga0070707_100009405 | 3300005468 | Bacteria | 9071 |
| 105 | Ga0070707_100040335 | 3300005468 | Bacteria | 4467 |
| 106 | Ga0070707_100078480 | 3300005468 | Bacteria | 3185 |
| 107 | Ga0070707_100129806 | 3300005468 | Bacteria | 2450 |
| 108 | Ga0070707_100130763 | 3300005468 | Bacteria | 2441 |
| 109 | Ga0070707_100212185 | 3300005468 | Bacteria | 1887 |
| 110 | Ga0070698_100000951 | 3300005471 | Bacteria | 31690 |
| 111 | Ga0070698_100001154 | 3300005471 | Bacteria | 29241 |
| 112 | Ga0070698_100001699 | 3300005471 | Bacteria | 24551 |
| 113 | Ga0070698_100003087 | 3300005471 | Bacteria | 18358 |
| 114 | Ga0070698_100022634 | 3300005471 | Bacteria | 6572 |
| 115 | Ga0070698_100031767 | 3300005471 | Bacteria | 5472 |
| 116 | Ga0070698_100208451 | 3300005471 | Bacteria | 1890 |
| 117 | Ga0070698_100239085 | 3300005471 | Bacteria | 1749 |
| 118 | Ga0070698_100317030 | 3300005471 | Bacteria | 1490 |
| 119 | Ga0070699_100006729 | 3300005518 | Bacteria | 9996 |
| 120 | Ga0070679_100011412 | 3300005530 | Bacteria | 8465 |
| 121 | Ga0070679_100092058 | 3300005530 | Bacteria | 3020 |
| 122 | Ga0070679_100152529 | 3300005530 | Bacteria | 2287 |
| 123 | Ga0070684_100059161 | 3300005535 | Bacteria | 3350 |
| 124 | Ga0070684_100131961 | 3300005535 | Bacteria | 2254 |
| 125 | Ga0070697_100000447 | 3300005536 | Bacteria | 31726 |
| 126 | Ga0070697_100012490 | 3300005536 | Bacteria | 6655 |
| 127 | Ga0070697_100043185 | 3300005536 | Bacteria | 3649 |
| 128 | Ga0068853_100209106 | 3300005539 | Bacteria | 1778 |
| 129 | Ga0070672_100060681 | 3300005543 | Bacteria | 2978 |
| 130 | Ga0070672_100427122 | 3300005543 | Bacteria | 1139 |
| 131 | Ga0070672_100448610 | 3300005543 | Bacteria | 1111 |
| 132 | Ga0070686_100011554 | 3300005544 | Bacteria | 5010 |
| 133 | Ga0070686_100202084 | 3300005544 | Bacteria | 1425 |
| 134 | Ga0070695_100041487 | 3300005545 | Bacteria | 2917 |
| 135 | Ga0070696_100026054 | 3300005546 | Bacteria | 3978 |
| 136 | Ga0070693_100025368 | 3300005547 | Bacteria | 3190 |
| 137 | Ga0070693_100091402 | 3300005547 | Bacteria | 1835 |
| 138 | Ga0070665_100120949 | 3300005548 | Bacteria | 2620 |
| 139 | Ga0070665_100291786 | 3300005548 | Bacteria | 1633 |
| 140 | Ga0070704_100060378 | 3300005549 | Bacteria | 2709 |
| 141 | Ga0070704_100119718 | 3300005549 | Bacteria | 2020 |
| 142 | Ga0068855_100162206 | 3300005563 | Bacteria | 2536 |
| 143 | Ga0068855_100223669 | 3300005563 | Bacteria | 2110 |
| 144 | Ga0070664_100043727 | 3300005564 | Bacteria | 3780 |
| 145 | Ga0070664_100087969 | 3300005564 | Bacteria | 2686 |
| 146 | Ga0070664_100194287 | 3300005564 | Bacteria | 1809 |
| 147 | Ga0068857_100008010 | 3300005577 | Bacteria | 9113 |
| 148 | Ga0068857_100011670 | 3300005577 | Bacteria | 7641 |
| 149 | Ga0068857_100193668 | 3300005577 | Bacteria | 1852 |
| 150 | Ga0068857_100258507 | 3300005577 | Bacteria | 1598 |
| 151 | Ga0068854_100026349 | 3300005578 | Bacteria | 3995 |
| 152 | Ga0068854_100034654 | 3300005578 | Bacteria | 3528 |
| 153 | Ga0068856_100011106 | 3300005614 | Bacteria | 8745 |
| 154 | Ga0068856_100135540 | 3300005614 | Bacteria | 2467 |
| 155 | Ga0068856_100256307 | 3300005614 | Bacteria | 1764 |
| 156 | Ga0068856_100427453 | 3300005614 | Bacteria | 1345 |
| 157 | Ga0070702_100003036 | 3300005615 | Bacteria | 7428 |
| 158 | Ga0068852_100066276 | 3300005616 | Bacteria | 3153 |
| 159 | Ga0068852_100183518 | 3300005616 | Bacteria | 1969 |
| 160 | Ga0068859_100034967 | 3300005617 | Bacteria | 5040 |
| 161 | Ga0068859_100167028 | 3300005617 | Bacteria | 2280 |
| 162 | Ga0068864_100003373 | 3300005618 | Bacteria | 13208 |
| 163 | Ga0068864_100044849 | 3300005618 | Bacteria | 3792 |
| 164 | Ga0068864_100276717 | 3300005618 | Bacteria | 1566 |
| 165 | Ga0068861_100062872 | 3300005719 | Bacteria | 2852 |
| 166 | Ga0068851_10014136 | 3300005834 | Bacteria | 3786 |
| 167 | Ga0068870_10002608 | 3300005840 | Bacteria | 7541 |
| 168 | Ga0068870_10015521 | 3300005840 | Bacteria | 3615 |
| 169 | Ga0068863_100017352 | 3300005841 | Bacteria | 6902 |
| 170 | Ga0068863_100115786 | 3300005841 | Bacteria | 2554 |
| 171 | Ga0068863_100267039 | 3300005841 | Bacteria | 1655 |
| 172 | Ga0068863_100360693 | 3300005841 | Bacteria | 1417 |
| 173 | Ga0068858_100021460 | 3300005842 | Bacteria | 6035 |
| 174 | Ga0068858_100071310 | 3300005842 | Bacteria | 3222 |
| 175 | Ga0068858_100123031 | 3300005842 | Bacteria | 2428 |
| 176 | Ga0068860_100396126 | 3300005843 | Bacteria | 1365 |
| 177 | Ga0068862_100052069 | 3300005844 | Bacteria | 3502 |
| 178 | Ga0068862_100154589 | 3300005844 | Bacteria | 2044 |
| 179 | Ga0081455_10002124 | 3300005937 | Bacteria | 23620 |
| 180 | Ga0081455_10094227 | 3300005937 | Bacteria | 2419 |
| 181 | Ga0081540_1000582 | 3300005983 | Bacteria | 35204 |
| 182 | Ga0081540_1000756 | 3300005983 | Bacteria | 29755 |
| 183 | Ga0081539_10000127 | 3300005985 | Bacteria | 179934 |
| 184 | Ga0081539_10005011 | 3300005985 | Bacteria | 13975 |
| 185 | Ga0081539_10027065 | 3300005985 | Bacteria | 3640 |
| 186 | Ga0070717_10003556 | 3300006028 | Bacteria | 11169 |
| 187 | Ga0070717_10029458 | 3300006028 | Bacteria | 4404 |
| 188 | Ga0070717_10032114 | 3300006028 | Bacteria | 4228 |
| 189 | Ga0070717_10033576 | 3300006028 | Bacteria | 4140 |
| 190 | Ga0070717_10038774 | 3300006028 | Bacteria | 3874 |
| 191 | Ga0070717_10043560 | 3300006028 | Bacteria | 3664 |
| 192 | Ga0070717_10067857 | 3300006028 | Bacteria | 2968 |
| 193 | Ga0070717_10119033 | 3300006028 | Bacteria | 2260 |
| 194 | Ga0070717_10127904 | 3300006028 | Bacteria | 2182 |
| 195 | Ga0070717_10186750 | 3300006028 | Bacteria | 1809 |
| 196 | Ga0075363_100107153 | 3300006048 | Bacteria | 1551 |
| 197 | Ga0075364_10044399 | 3300006051 | Bacteria | 2891 |
| 198 | Ga0075364_10114395 | 3300006051 | Bacteria | 1803 |
| 199 | Ga0075364_10253218 | 3300006051 | Bacteria | 1197 |
| 200 | Ga0075432_10102543 | 3300006058 | Bacteria | 1059 |
| 201 | Ga0070715_10004309 | 3300006163 | Bacteria | 4645 |
| 202 | Ga0070715_10040652 | 3300006163 | Bacteria | 1944 |
| 203 | Ga0070715_10128455 | 3300006163 | Bacteria | 1217 |
| 204 | Ga0070716_100000508 | 3300006173 | Bacteria | 16215 |
| 205 | Ga0070716_100007882 | 3300006173 | Bacteria | 5271 |
| 206 | Ga0070716_100015589 | 3300006173 | Bacteria | 3907 |
| 207 | Ga0070716_100044320 | 3300006173 | Bacteria | 2491 |
| 208 | Ga0070716_100080295 | 3300006173 | Bacteria | 1944 |
| 209 | Ga0070712_100005372 | 3300006175 | Bacteria | 7934 |
| 210 | Ga0070712_100009334 | 3300006175 | Bacteria | 6183 |
| 211 | Ga0070712_100029059 | 3300006175 | Bacteria | 3704 |
| 212 | Ga0070712_100045417 | 3300006175 | Bacteria | 3033 |
| 213 | Ga0070712_100056408 | 3300006175 | Bacteria | 2755 |
| 214 | Ga0075369_10036161 | 3300006186 | Bacteria | 2101 |
| 215 | Ga0097621_100079576 | 3300006237 | Bacteria | 2725 |
| 216 | Ga0097621_100276555 | 3300006237 | Bacteria | 1477 |
| 217 | Ga0068871_100027412 | 3300006358 | Bacteria | 4455 |
| 218 | Ga0068871_100056948 | 3300006358 | Bacteria | 3179 |
| 219 | Ga0075428_100177928 | 3300006844 | Bacteria | 2303 |
| 220 | Ga0075428_100601023 | 3300006844 | Bacteria | 1175 |
| 221 | Ga0075430_100280130 | 3300006846 | Bacteria | 1380 |
| 222 | Ga0075431_100407153 | 3300006847 | Bacteria | 1361 |
| 223 | Ga0075433_10051187 | 3300006852 | Bacteria | 3596 |
| 224 | Ga0075433_10336727 | 3300006852 | Bacteria | 1334 |
| 225 | Ga0075433_10361918 | 3300006852 | Bacteria | 1281 |
| 226 | Ga0075433_10409791 | 3300006852 | Bacteria | 1196 |
| 227 | Ga0075434_100032233 | 3300006871 | Bacteria | 5167 |
| 228 | Ga0075434_100033506 | 3300006871 | Bacteria | 5069 |
| 229 | Ga0075434_100039315 | 3300006871 | Bacteria | 4687 |
| 230 | Ga0068865_100039011 | 3300006881 | Bacteria | 3219 |
| 231 | Ga0068865_100041107 | 3300006881 | Bacteria | 3145 |
| 232 | Ga0075436_100064740 | 3300006914 | Bacteria | 2527 |
| 233 | Ga0075436_100066572 | 3300006914 | Bacteria | 2490 |
| 234 | Ga0075436_100169009 | 3300006914 | Bacteria | 1544 |
| 235 | Ga0097620_100034967 | 3300006931 | Bacteria | 5040 |
| 236 | Ga0097620_100167031 | 3300006931 | Bacteria | 2280 |
| 237 | Ga0075435_100008746 | 3300007076 | Bacteria | 7285 |
| 238 | Ga0075435_100037863 | 3300007076 | Bacteria | 3843 |
| 239 | Ga0075435_100061836 | 3300007076 | Bacteria | 3038 |
| 240 | Ga0105240_10190377 | 3300009093 | Bacteria | 2413 |
| 241 | Ga0111539_10002633 | 3300009094 | Bacteria | 23770 |
| 242 | Ga0111539_10034507 | 3300009094 | Bacteria | 6133 |
| 243 | Ga0111539_10124766 | 3300009094 | Bacteria | 3017 |
| 244 | Ga0105245_10025589 | 3300009098 | Bacteria | 5190 |
| 245 | Ga0105245_10075578 | 3300009098 | Bacteria | 3068 |
| 246 | Ga0114129_10210261 | 3300009147 | Bacteria | 2630 |
| 247 | Ga0114129_10537231 | 3300009147 | Bacteria | 1522 |
| 248 | Ga0114129_11016986 | 3300009147 | Bacteria | 1043 |
| 249 | Ga0105243_10012670 | 3300009148 | Bacteria | 6371 |
| 250 | Ga0105243_10090047 | 3300009148 | Bacteria | 2524 |
| 251 | Ga0105243_10538320 | 3300009148 | Bacteria | 1113 |
| 252 | Ga0105241_10027438 | 3300009174 | Bacteria | 4241 |
| 253 | Ga0105241_10079336 | 3300009174 | Bacteria | 2566 |
| 254 | Ga0105241_10260942 | 3300009174 | Bacteria | 1472 |
| 255 | Ga0105241_10433309 | 3300009174 | Bacteria | 1160 |
| 256 | Ga0105242_10043614 | 3300009176 | Bacteria | 3628 |
| 257 | Ga0105242_10162088 | 3300009176 | Bacteria | 1958 |
| 258 | Ga0105242_10500030 | 3300009176 | Bacteria | 1156 |
| 259 | Ga0105248_10064723 | 3300009177 | Bacteria | 4105 |
| 260 | Ga0105248_10068285 | 3300009177 | Bacteria | 3991 |
| 261 | Ga0105237_10225066 | 3300009545 | Bacteria | 1876 |
| 262 | Ga0105238_10108005 | 3300009551 | Bacteria | 2764 |
| 263 | Ga0105238_11106273 | 3300009551 | Bacteria | 815 |
| 264 | Ga0105249_10057141 | 3300009553 | Bacteria | 3573 |
| 265 | Ga0105249_10128313 | 3300009553 | Bacteria | 2418 |
| 266 | Ga0105239_10083549 | 3300010375 | Bacteria | 3517 |
| 267 | Ga0105239_10222503 | 3300010375 | Bacteria | 2117 |
| 268 | Ga0105246_10001046 | 3300011119 | Bacteria | 15970 |
| 269 | Ga0105246_10074624 | 3300011119 | Bacteria | 2398 |
| 270 | Ga0157335_1001533 | 3300012492 | Bacteria | 1281 |
| 271 | Ga0157342_1000629 | 3300012507 | Bacteria | 2259 |
| 272 | Ga0157373_10058350 | 3300013100 | Bacteria | 2737 |
| 273 | Ga0157373_10090051 | 3300013100 | Bacteria | 2161 |
| 274 | Ga0157371_10048553 | 3300013102 | Bacteria | 3017 |
| 275 | Ga0157370_10040361 | 3300013104 | Bacteria | 4506 |
| 276 | Ga0157370_10567634 | 3300013104 | Bacteria | 1040 |
| 277 | Ga0157369_10030215 | 3300013105 | Bacteria | 5977 |
| 278 | Ga0157369_10202544 | 3300013105 | Bacteria | 2083 |
| 279 | Ga0157369_10350611 | 3300013105 | Bacteria | 1533 |
| 280 | Ga0157369_10405716 | 3300013105 | Bacteria | 1414 |
| 281 | Ga0157369_10774703 | 3300013105 | Bacteria | 986 |
| 282 | Ga0157374_10499685 | 3300013296 | Bacteria | 1221 |
| 283 | Ga0157378_10143331 | 3300013297 | Bacteria | 2220 |
| 284 | Ga0163162_10528450 | 3300013306 | Bacteria | 1309 |
| 285 | Ga0157372_10024291 | 3300013307 | Bacteria | 6581 |
| 286 | Ga0157372_10121581 | 3300013307 | Bacteria | 3000 |
| 287 | Ga0157372_11017817 | 3300013307 | Bacteria | 959 |
| 288 | Ga0157375_10029871 | 3300013308 | Bacteria | 5131 |
| 289 | Ga0157375_10188851 | 3300013308 | Bacteria | 2215 |
| 290 | Ga0157375_10442072 | 3300013308 | Bacteria | 1466 |
| 291 | Ga0157375_11211775 | 3300013308 | Bacteria | 886 |
| 292 | Ga0163163_10074068 | 3300014325 | Bacteria | 3396 |
| 293 | Ga0163163_10094916 | 3300014325 | Bacteria | 3001 |
| 294 | Ga0163163_10602639 | 3300014325 | Bacteria | 1162 |
| 295 | Ga0157380_10015485 | 3300014326 | Bacteria | 5607 |
| 296 | Ga0157377_10006040 | 3300014745 | Bacteria | 5744 |
| 297 | Ga0157379_10149162 | 3300014968 | Bacteria | 2109 |
| 298 | Ga0157379_10254059 | 3300014968 | Bacteria | 1596 |
| 299 | Ga0157376_10374968 | 3300014969 | Bacteria | 1369 |
| 300 | Ga0163161_10085542 | 3300017792 | Bacteria | 2326 |
| 301 | Ga0163161_10134516 | 3300017792 | Bacteria | 1868 |
| 302 | Ga0163161_10135521 | 3300017792 | Bacteria | 1861 |
| 303 | Ga0163161_10148532 | 3300017792 | Bacteria | 1780 |
| 304 | Ga0197907_10318288 | 3300020069 | Bacteria | 1503 |
| 305 | Ga0197907_10356126 | 3300020069 | Bacteria | 1595 |
| 306 | Ga0197907_10384303 | 3300020069 | Bacteria | 1555 |
| 307 | Ga0197907_10894406 | 3300020069 | Bacteria | 1821 |
| 308 | Ga0206356_10117693 | 3300020070 | Bacteria | 1323 |
| 309 | Ga0206356_10553711 | 3300020070 | Bacteria | 2658 |
| 310 | Ga0206356_10775408 | 3300020070 | Bacteria | 4715 |
| 311 | Ga0206356_11454669 | 3300020070 | Bacteria | 2496 |
| 312 | Ga0206356_11642507 | 3300020070 | Bacteria | 2051 |
| 313 | Ga0206356_11751201 | 3300020070 | Bacteria | 2942 |
| 314 | Ga0206355_1415136 | 3300020076 | Bacteria | 1378 |
| 315 | Ga0206351_10402913 | 3300020077 | Bacteria | 1747 |
| 316 | Ga0206352_10662284 | 3300020078 | Bacteria | 1672 |
| 317 | Ga0206350_10015471 | 3300020080 | Bacteria | 811 |
| 318 | Ga0206350_10483273 | 3300020080 | Bacteria | 1216 |
| 319 | Ga0206354_11233094 | 3300020081 | Bacteria | 1616 |
| 320 | Ga0206353_10337382 | 3300020082 | Bacteria | 20355 |
| 321 | Ga0206353_10983463 | 3300020082 | Bacteria | 1559 |
| 322 | Ga0206353_11024964 | 3300020082 | Bacteria | 2583 |
| 323 | Ga0213876_10023166 | 3300021384 | Bacteria | 3281 |
| 324 | Ga0213875_10000656 | 3300021388 | Bacteria | 27417 |
| 325 | Ga0213875_10002258 | 3300021388 | Bacteria | 11685 |
| 326 | Ga0213875_10004419 | 3300021388 | Bacteria | 7720 |
| 327 | Ga0213875_10012191 | 3300021388 | Bacteria | 4251 |
| 328 | Ga0213875_10013455 | 3300021388 | Bacteria | 4016 |
| 329 | Ga0224712_10010732 | 3300022467 | Bacteria | 2813 |
| 330 | Ga0224712_10025009 | 3300022467 | Bacteria | 2094 |
| 331 | Ga0224712_10056531 | 3300022467 | Bacteria | 1547 |
| 332 | Ga0224712_10063647 | 3300022467 | Bacteria | 1477 |
| 333 | Ga0224572_1000926 | 3300024225 | Bacteria | 3997 |
| 334 | Ga0224572_1004645 | 3300024225 | Bacteria | 2405 |
| 335 | Ga0207426_1013882 | 3300025302 | Bacteria | 2969 |
| 336 | Ga0207692_10014656 | 3300025898 | Bacteria | 3429 |
| 337 | Ga0207692_10023748 | 3300025898 | Bacteria | 2840 |
| 338 | Ga0207692_10030089 | 3300025898 | Bacteria | 2586 |
| 339 | Ga0207692_10074661 | 3300025898 | Bacteria | 1797 |
| 340 | Ga0207692_10076608 | 3300025898 | Bacteria | 1777 |
| 341 | Ga0207692_10095492 | 3300025898 | Bacteria | 1621 |
| 342 | Ga0207692_10298567 | 3300025898 | Bacteria | 980 |
| 343 | Ga0207642_10029802 | 3300025899 | Bacteria | 2265 |
| 344 | Ga0207642_10035497 | 3300025899 | Bacteria | 2130 |
| 345 | Ga0207688_10005687 | 3300025901 | Bacteria | 6778 |
| 346 | Ga0207688_10006105 | 3300025901 | Bacteria | 6553 |
| 347 | Ga0207688_10022025 | 3300025901 | Bacteria | 3485 |
| 348 | Ga0207688_10057212 | 3300025901 | Bacteria | 2191 |
| 349 | Ga0207647_10068591 | 3300025904 | Bacteria | 2147 |
| 350 | Ga0207647_10149445 | 3300025904 | Bacteria | 1366 |
| 351 | Ga0207685_10001217 | 3300025905 | Bacteria | 5220 |
| 352 | Ga0207685_10020818 | 3300025905 | Bacteria | 2188 |
| 353 | Ga0207699_10001589 | 3300025906 | Bacteria | 10782 |
| 354 | Ga0207699_10012585 | 3300025906 | Bacteria | 4307 |
| 355 | Ga0207699_10015976 | 3300025906 | Bacteria | 3914 |
| 356 | Ga0207699_10036378 | 3300025906 | Bacteria | 2806 |
| 357 | Ga0207699_10082702 | 3300025906 | Bacteria | 1995 |
| 358 | Ga0207643_10000215 | 3300025908 | Bacteria | 40461 |
| 359 | Ga0207705_10007059 | 3300025909 | Bacteria | 8285 |
| 360 | Ga0207705_10193033 | 3300025909 | Bacteria | 1541 |
| 361 | Ga0207684_10001715 | 3300025910 | Bacteria | 23242 |
| 362 | Ga0207684_10002461 | 3300025910 | Bacteria | 18657 |
| 363 | Ga0207684_10005381 | 3300025910 | Bacteria | 11826 |
| 364 | Ga0207684_10014889 | 3300025910 | Bacteria | 6692 |
| 365 | Ga0207684_10016382 | 3300025910 | Bacteria | 6364 |
| 366 | Ga0207684_10029210 | 3300025910 | Bacteria | 4697 |
| 367 | Ga0207684_10063319 | 3300025910 | Bacteria | 3140 |
| 368 | Ga0207684_10134284 | 3300025910 | Bacteria | 2124 |
| 369 | Ga0207684_10604994 | 3300025910 | Bacteria | 936 |
| 370 | Ga0207654_10033839 | 3300025911 | Bacteria | 2835 |
| 371 | Ga0207707_10004913 | 3300025912 | Bacteria | 11753 |
| 372 | Ga0207707_10044829 | 3300025912 | Bacteria | 3855 |
| 373 | Ga0207707_10072011 | 3300025912 | Bacteria | 3012 |
| 374 | Ga0207671_10072231 | 3300025914 | Bacteria | 2575 |
| 375 | Ga0207693_10009380 | 3300025915 | Bacteria | 7982 |
| 376 | Ga0207693_10012263 | 3300025915 | Bacteria | 6928 |
| 377 | Ga0207693_10039473 | 3300025915 | Bacteria | 3718 |
| 378 | Ga0207663_10003579 | 3300025916 | Bacteria | 7627 |
| 379 | Ga0207663_10018255 | 3300025916 | Bacteria | 3927 |
| 380 | Ga0207663_10054027 | 3300025916 | Bacteria | 2513 |
| 381 | Ga0207663_10058432 | 3300025916 | Bacteria | 2434 |
| 382 | Ga0207663_10144519 | 3300025916 | Bacteria | 1661 |
| 383 | Ga0207663_10156392 | 3300025916 | Bacteria | 1604 |
| 384 | Ga0207663_10522975 | 3300025916 | Bacteria | 924 |
| 385 | Ga0207660_10002966 | 3300025917 | Bacteria | 11097 |
| 386 | Ga0207660_10007062 | 3300025917 | Bacteria | 7276 |
| 387 | Ga0207660_10638051 | 3300025917 | Bacteria | 868 |
| 388 | Ga0207662_10003307 | 3300025918 | Bacteria | 8273 |
| 389 | Ga0207657_10002090 | 3300025919 | Bacteria | 21602 |
| 390 | Ga0207657_10059138 | 3300025919 | Bacteria | 3295 |
| 391 | Ga0207657_10126874 | 3300025919 | Bacteria | 2095 |
| 392 | Ga0207649_10009551 | 3300025920 | Bacteria | 5311 |
| 393 | Ga0207649_10034467 | 3300025920 | Bacteria | 3033 |
| 394 | Ga0207649_10139205 | 3300025920 | Bacteria | 1658 |
| 395 | Ga0207652_10000592 | 3300025921 | Bacteria | 36290 |
| 396 | Ga0207652_10009921 | 3300025921 | Bacteria | 7664 |
| 397 | Ga0207652_10082676 | 3300025921 | Bacteria | 2810 |
| 398 | Ga0207646_10000065 | 3300025922 | Bacteria | 149387 |
| 399 | Ga0207646_10001312 | 3300025922 | Bacteria | 30880 |
| 400 | Ga0207646_10017053 | 3300025922 | Bacteria | 6806 |
| 401 | Ga0207646_10032398 | 3300025922 | Bacteria | 4730 |
| 402 | Ga0207646_10090348 | 3300025922 | Bacteria | 2742 |
| 403 | Ga0207646_10158032 | 3300025922 | Bacteria | 2045 |
| 404 | Ga0207681_10418708 | 3300025923 | Bacteria | 1085 |
| 405 | Ga0207694_10252193 | 3300025924 | Bacteria | 1444 |
| 406 | Ga0207650_10002455 | 3300025925 | Bacteria | 12898 |
| 407 | Ga0207650_10217403 | 3300025925 | Bacteria | 1537 |
| 408 | Ga0207659_10004667 | 3300025926 | Bacteria | 8299 |
| 409 | Ga0207687_10003055 | 3300025927 | Bacteria | 11350 |
| 410 | Ga0207687_10063389 | 3300025927 | Bacteria | 2617 |
| 411 | Ga0207687_10091074 | 3300025927 | Bacteria | 2223 |
| 412 | Ga0207687_10132506 | 3300025927 | Bacteria | 1881 |
| 413 | Ga0207687_10466323 | 3300025927 | Bacteria | 1049 |
| 414 | Ga0207700_10000218 | 3300025928 | Bacteria | 34263 |
| 415 | Ga0207700_10000229 | 3300025928 | Bacteria | 33559 |
| 416 | Ga0207700_10031067 | 3300025928 | Bacteria | 3790 |
| 417 | Ga0207700_10039433 | 3300025928 | Bacteria | 3439 |
| 418 | Ga0207700_10116457 | 3300025928 | Bacteria | 2159 |
| 419 | Ga0207700_10119665 | 3300025928 | Bacteria | 2133 |
| 420 | Ga0207700_10167917 | 3300025928 | Bacteria | 1828 |
| 421 | Ga0207700_10265128 | 3300025928 | Bacteria | 1472 |
| 422 | Ga0207664_10000588 | 3300025929 | Bacteria | 25365 |
| 423 | Ga0207664_10011479 | 3300025929 | Bacteria | 6301 |
| 424 | Ga0207664_10019149 | 3300025929 | Bacteria | 5054 |
| 425 | Ga0207664_10024584 | 3300025929 | Bacteria | 4528 |
| 426 | Ga0207664_10029877 | 3300025929 | Bacteria | 4156 |
| 427 | Ga0207664_10101334 | 3300025929 | Bacteria | 2379 |
| 428 | Ga0207664_10104036 | 3300025929 | Bacteria | 2350 |
| 429 | Ga0207664_10169210 | 3300025929 | Bacteria | 1869 |
| 430 | Ga0207664_10171012 | 3300025929 | Bacteria | 1860 |
| 431 | Ga0207664_10213200 | 3300025929 | Bacteria | 1672 |
| 432 | Ga0207664_10473025 | 3300025929 | Bacteria | 1120 |
| 433 | Ga0207644_10024769 | 3300025931 | Bacteria | 4122 |
| 434 | Ga0207690_10033467 | 3300025932 | Bacteria | 3305 |
| 435 | Ga0207706_10013237 | 3300025933 | Bacteria | 7504 |
| 436 | Ga0207706_10140752 | 3300025933 | Bacteria | 2122 |
| 437 | Ga0207706_10283673 | 3300025933 | Bacteria | 1444 |
| 438 | Ga0207686_10246526 | 3300025934 | Bacteria | 1303 |
| 439 | Ga0207709_10009672 | 3300025935 | Bacteria | 5311 |
| 440 | Ga0207709_10076383 | 3300025935 | Bacteria | 2144 |
| 441 | Ga0207709_10079764 | 3300025935 | Bacteria | 2106 |
| 442 | Ga0207670_10146039 | 3300025936 | Bacteria | 1749 |
| 443 | Ga0207670_10177881 | 3300025936 | Bacteria | 1600 |
| 444 | Ga0207665_10000193 | 3300025939 | Bacteria | 41109 |
| 445 | Ga0207665_10000369 | 3300025939 | Bacteria | 31246 |
| 446 | Ga0207665_10006989 | 3300025939 | Bacteria | 7468 |
| 447 | Ga0207665_10024374 | 3300025939 | Bacteria | 3989 |
| 448 | Ga0207665_10062983 | 3300025939 | Bacteria | 2518 |
| 449 | Ga0207691_10004250 | 3300025940 | Bacteria | 13903 |
| 450 | Ga0207691_10224727 | 3300025940 | Bacteria | 1627 |
| 451 | Ga0207691_10535967 | 3300025940 | Bacteria | 993 |
| 452 | Ga0207711_10061229 | 3300025941 | Bacteria | 3245 |
| 453 | Ga0207711_10076178 | 3300025941 | Bacteria | 2921 |
| 454 | Ga0207711_10104209 | 3300025941 | Bacteria | 2513 |
| 455 | Ga0207689_10001149 | 3300025942 | Bacteria | 25481 |
| 456 | Ga0207689_10005138 | 3300025942 | Bacteria | 11767 |
| 457 | Ga0207689_10018067 | 3300025942 | Bacteria | 5955 |
| 458 | Ga0207661_10012466 | 3300025944 | Bacteria | 6176 |
| 459 | Ga0207661_10042117 | 3300025944 | Bacteria | 3599 |
| 460 | Ga0207661_10105958 | 3300025944 | Bacteria | 2369 |
| 461 | Ga0207679_10019362 | 3300025945 | Bacteria | 4570 |
| 462 | Ga0207679_10053069 | 3300025945 | Bacteria | 2976 |
| 463 | Ga0207679_10261105 | 3300025945 | Bacteria | 1477 |
| 464 | Ga0207667_10167467 | 3300025949 | Bacteria | 2259 |
| 465 | Ga0207667_10269652 | 3300025949 | Bacteria | 1740 |
| 466 | Ga0207712_10306895 | 3300025961 | Bacteria | 1304 |
| 467 | Ga0207668_10074135 | 3300025972 | Bacteria | 2442 |
| 468 | Ga0207640_10008388 | 3300025981 | Bacteria | 5744 |
| 469 | Ga0207640_10095164 | 3300025981 | Bacteria | 2073 |
| 470 | Ga0207658_10053817 | 3300025986 | Bacteria | 2976 |
| 471 | Ga0207677_10002476 | 3300026023 | Bacteria | 9694 |
| 472 | Ga0207677_10026127 | 3300026023 | Bacteria | 3657 |
| 473 | Ga0207677_10052799 | 3300026023 | Bacteria | 2763 |
| 474 | Ga0207703_10486739 | 3300026035 | Bacteria | 1156 |
| 475 | Ga0207639_10027269 | 3300026041 | Bacteria | 4159 |
| 476 | Ga0207639_10074960 | 3300026041 | Bacteria | 2659 |
| 477 | Ga0207678_10000552 | 3300026067 | Bacteria | 34170 |
| 478 | Ga0207678_10001019 | 3300026067 | Bacteria | 25566 |
| 479 | Ga0207678_10001856 | 3300026067 | Bacteria | 19305 |
| 480 | Ga0207678_10008054 | 3300026067 | Bacteria | 9294 |
| 481 | Ga0207678_10015961 | 3300026067 | Bacteria | 6597 |
| 482 | Ga0207708_10000933 | 3300026075 | Bacteria | 21920 |
| 483 | Ga0207708_10019775 | 3300026075 | Bacteria | 5077 |
| 484 | Ga0207708_10039703 | 3300026075 | Bacteria | 3587 |
| 485 | Ga0207702_10002139 | 3300026078 | Bacteria | 18993 |
| 486 | Ga0207702_10062383 | 3300026078 | Bacteria | 3183 |
| 487 | Ga0207702_10181168 | 3300026078 | Bacteria | 1940 |
| 488 | Ga0207641_10004861 | 3300026088 | Bacteria | 11565 |
| 489 | Ga0207641_10118081 | 3300026088 | Bacteria | 2362 |
| 490 | Ga0207641_10417272 | 3300026088 | Bacteria | 1291 |
| 491 | Ga0207648_10092525 | 3300026089 | Bacteria | 2644 |
| 492 | Ga0207648_10173093 | 3300026089 | Bacteria | 1909 |
| 493 | Ga0207676_10003268 | 3300026095 | Bacteria | 11535 |
| 494 | Ga0207674_10008373 | 3300026116 | Bacteria | 11962 |
| 495 | Ga0207674_10028803 | 3300026116 | Bacteria | 5855 |
| 496 | Ga0207674_10158695 | 3300026116 | Bacteria | 2217 |
| 497 | Ga0207675_100014732 | 3300026118 | Bacteria | 7293 |
| 498 | Ga0207675_100019992 | 3300026118 | Bacteria | 6248 |
| 499 | Ga0207675_100084010 | 3300026118 | Bacteria | 2987 |
| 500 | Ga0207683_10001755 | 3300026121 | Bacteria | 19188 |
| 501 | Ga0207683_10010244 | 3300026121 | Bacteria | 7992 |
| 502 | Ga0207698_10011353 | 3300026142 | Bacteria | 5771 |
| 503 | Ga0207698_10016262 | 3300026142 | Bacteria | 5010 |
| 504 | Ga0207428_10009874 | 3300027907 | Bacteria | 8550 |
| 505 | Ga0207428_10079370 | 3300027907 | Bacteria | 2566 |
| 506 | Ga0207428_10321299 | 3300027907 | Bacteria | 1143 |
| 507 | Ga0268266_10055062 | 3300028379 | Bacteria | 3419 |
| 508 | Ga0268265_10056558 | 3300028380 | Bacteria | 2985 |
| 509 | Ga0268264_10112285 | 3300028381 | Bacteria | 2389 |
| 510 | Ga0265337_1055019 | 3300028556 | Bacteria | 1112 |
| 511 | Ga0307517_10002916 | 3300028786 | Bacteria | 27096 |
| 512 | Ga0307515_10000845 | 3300028794 | Bacteria | 70367 |
| 513 | Ga0265338_10004550 | 3300028800 | Bacteria | 18669 |
| 514 | Ga0307511_10011641 | 3300030521 | Bacteria | 8659 |
| 515 | Ga0307512_10030128 | 3300030522 | Bacteria | 4727 |
| 516 | Ga0307509_10019979 | 3300031507 | Bacteria | 7616 |
| 517 | Ga0307509_10037358 | 3300031507 | Bacteria | 5310 |
| 518 | Ga0316575_10016337 | 3300031665 | Bacteria | 2807 |
| 519 | Ga0316579_10155949 | 3300031691 | Bacteria | 1102 |
| 520 | Ga0316576_10011912 | 3300031727 | Bacteria | 5721 |
| 521 | Ga0316576_10066587 | 3300031727 | Bacteria | 2649 |
| 522 | Ga0316576_10561176 | 3300031727 | Bacteria | 836 |
| 523 | Ga0316578_10006497 | 3300031728 | Bacteria | 5778 |
| 524 | Ga0307516_10070070 | 3300031730 | Bacteria | 3371 |
| 525 | Ga0316577_10035835 | 3300031733 | Bacteria | 2773 |
| 526 | Ga0307413_10071265 | 3300031824 | Bacteria | 2189 |
| 527 | Ga0307406_10057429 | 3300031901 | Bacteria | 2496 |
| 528 | Ga0307409_100230441 | 3300031995 | Bacteria | 1679 |
| 529 | Ga0307409_100367610 | 3300031995 | Bacteria | 1363 |
| 530 | Ga0307409_100536642 | 3300031995 | Bacteria | 1146 |
| 531 | Ga0307416_100074745 | 3300032002 | Bacteria | 2833 |
| 532 | Ga0307411_10018902 | 3300032005 | Bacteria | 3966 |
| 533 | Ga0307415_100105409 | 3300032126 | Bacteria | 2079 |
| 534 | Ga0307415_100421941 | 3300032126 | Bacteria | 1145 |
| 535 | Ga0307507_10039437 | 3300033179 | Bacteria | 4766 |
| 536 | Ga0307507_10070361 | 3300033179 | Bacteria | 3174 |
| 537 | Ga0307510_10019969 | 3300033180 | Bacteria | 7846 |
| 538 | Ga0307510_10097383 | 3300033180 | Bacteria | 2752 |
| 539 | Ga0316214_1008262 | 3300033545 | Bacteria | 1399 |
| 540 | Ga0373930_0012825 | 3300034816 | Bacteria | 1535 |
| 541 | Ga0373948_0018076 | 3300034817 | Bacteria | 1321 |
| 542 | Ga0373926_0007030 | 3300035083 | Bacteria | 3741 |
| 543 | Ga0373926_0021076 | 3300035083 | Bacteria | 2254 |
| 544 | Ga0373929_0007087 | 3300035085 | Bacteria | 2040 |
| 545 | Ga0373934_0000101 | 3300035086 | Bacteria | 29995 |
| 546 | Ga0373934_0011618 | 3300035086 | Bacteria | 3313 |
| 547 | Ga0373934_0032649 | 3300035086 | Bacteria | 2043 |
| 548 | Ga0373934_0057862 | 3300035086 | Bacteria | 1542 |
| 549 | Ga0373940_0058157 | 3300035088 | Bacteria | 1100 |
| 550 | Ga0373944_0087609 | 3300035089 | Bacteria | 1036 |
| 551 | Ga0373949_0050395 | 3300035090 | Bacteria | 1047 |
| 552 | Ga0373951_0031707 | 3300035091 | Bacteria | 1247 |
| 553 | Ga0373952_0002235 | 3300035092 | Bacteria | 3490 |
| 554 | Ga0373923_0000264 | 3300035111 | Bacteria | 11443 |
| 555 | Ga0373923_0004102 | 3300035111 | Bacteria | 4792 |
| 556 | Ga0373923_0012992 | 3300035111 | Bacteria | 3093 |
| 557 | Ga0373923_0040994 | 3300035111 | Bacteria | 1907 |
| 558 | Ga0373923_0107447 | 3300035111 | Bacteria | 1236 |
| 559 | Ga0373932_0028776 | 3300035112 | Bacteria | 1529 |
| 560 | Ga0373936_0000263 | 3300035113 | Bacteria | 17271 |
| 561 | Ga0373936_0000384 | 3300035113 | Bacteria | 15010 |
| 562 | Ga0373936_0002894 | 3300035113 | Bacteria | 6410 |
| 563 | Ga0373936_0010005 | 3300035113 | Bacteria | 3579 |
| 564 | Ga0373936_0096227 | 3300035113 | Bacteria | 1245 |
| 565 | Ga0373936_0149842 | 3300035113 | Bacteria | 1011 |
| 566 | Ga0373939_0003193 | 3300035114 | Bacteria | 3843 |
| 567 | Ga0373945_0015076 | 3300035116 | Bacteria | 2597 |
| 568 | Ga0373945_0042604 | 3300035116 | Bacteria | 1645 |
| 569 | Ga0373953_0010608 | 3300035117 | Bacteria | 3213 |
| 570 | Ga0373953_0011778 | 3300035117 | Bacteria | 3080 |
| 571 | Ga0373953_0044095 | 3300035117 | Bacteria | 1782 |
| 572 | Ga0373954_0004360 | 3300035118 | Bacteria | 6083 |
| 573 | Ga0373954_0008629 | 3300035118 | Bacteria | 4481 |
| 574 | Ga0373956_0000095 | 3300035119 | Bacteria | 29811 |
| 575 | Ga0373956_0018884 | 3300035119 | Bacteria | 2921 |
| 576 | Ga0373956_0020931 | 3300035119 | Bacteria | 2788 |
| 577 | Ga0373956_0043741 | 3300035119 | Bacteria | 1994 |
| 578 | Ga0373956_0057897 | 3300035119 | Bacteria | 1752 |
| 579 | Ga0373956_0088024 | 3300035119 | Bacteria | 1430 |
| 580 | Ga0373957_0000385 | 3300035120 | Bacteria | 11170 |
| 581 | Ga0373957_0004550 | 3300035120 | Bacteria | 4226 |
| 582 | Ga0373957_0010447 | 3300035120 | Bacteria | 3069 |
| 583 | Ga0373957_0017172 | 3300035120 | Bacteria | 2516 |
| 584 | Ga0373957_0022949 | 3300035120 | Bacteria | 2227 |
| 585 | Ga0373957_0035148 | 3300035120 | Bacteria | 1860 |
| 586 | Ga0373957_0045166 | 3300035120 | Bacteria | 1668 |
| 587 | Ga0373957_0047249 | 3300035120 | Bacteria | 1636 |
| 588 | Ga0373957_0061095 | 3300035120 | Bacteria | 1459 |
| 589 | Ga0373957_0146542 | 3300035120 | Bacteria | 967 |
| 590 | Ga0373960_0017543 | 3300035121 | Bacteria | 1856 |
| 591 | Ga0373943_0012651 | 3300035170 | Bacteria | 3803 |
| 592 | Ga0373943_0036928 | 3300035170 | Bacteria | 2342 |
| 593 | Ga0373943_0053670 | 3300035170 | Bacteria | 1991 |
| 594 | Ga0373946_0020376 | 3300035171 | Bacteria | 2562 |
| 595 | Ga0373955_0000002 | 3300035172 | Bacteria | 125763 |
| 596 | Ga0373955_0023875 | 3300035172 | Bacteria | 3120 |
| 597 | Ga0373955_0044502 | 3300035172 | Bacteria | 2391 |
| 598 | Ga0373955_0131947 | 3300035172 | Bacteria | 1459 |
| 599 | Ga0373942_0046116 | 3300035207 | Bacteria | 1206 |
| 600 | Ga0373961_0064848 | 3300035241 | Bacteria | 1117 |
| 601 | Ga0373962_0052983 | 3300035242 | Bacteria | 1173 |
| 602 | Ga0316574_0016125 | 3300035398 | Bacteria | 4347 |
| 603 | Ga0316574_0094095 | 3300035398 | Bacteria | 1913 |
| 604 | Ga0373924_0000306 | 3300035410 | Bacteria | 15139 |
| 605 | Ga0373924_0038851 | 3300035410 | Bacteria | 1942 |
| 606 | Ga0373924_0058257 | 3300035410 | Bacteria | 1612 |
| 607 | Ga0373924_0105579 | 3300035410 | Bacteria | 1214 |
| 608 | Ga0373931_0123617 | 3300035691 | Bacteria | 1482 |
| 609 | Ga0373931_0175364 | 3300035691 | Bacteria | 1266 |
| 610 | Ga0373935_0017898 | 3300035692 | Bacteria | 4304 |
| 611 | Ga0373935_0018974 | 3300035692 | Bacteria | 4192 |
| 612 | Ga0373935_0031984 | 3300035692 | Bacteria | 3268 |
| 613 | Ga0373935_0040003 | 3300035692 | Bacteria | 2940 |
| 614 | Ga0373935_0286166 | 3300035692 | Bacteria | 1161 |
| 615 | Ga0373927_0007355 | 3300035695 | Bacteria | 7454 |
| 616 | Ga0373927_0331696 | 3300035695 | Bacteria | 1002 |
| 617 | Ga0373933_0000029 | 3300035724 | Bacteria | 86829 |
| 618 | Ga0373933_0001380 | 3300035724 | Bacteria | 14259 |
| 619 | Ga0373933_0007481 | 3300035724 | Bacteria | 5963 |
| 620 | Ga0373933_0069586 | 3300035724 | Bacteria | 2139 |
| 621 | Ga0373933_0072990 | 3300035724 | Bacteria | 2090 |
| 622 | Ga0373947_0002205 | 3300035725 | Bacteria | 11797 |
| 623 | Ga0373947_0002535 | 3300035725 | Bacteria | 10986 |
| 624 | Ga0373947_0084273 | 3300035725 | Bacteria | 1972 |
| 625 | Ga0373947_0257306 | 3300035725 | Bacteria | 1156 |
| 626 | Ga0373947_0304046 | 3300035725 | Bacteria | 1064 |
| 627 | Ga0373937_0000362 | 3300036401 | Bacteria | 42228 |
| 628 | Ga0373937_0005208 | 3300036401 | Bacteria | 11101 |
| 629 | Ga0373937_0047429 | 3300036401 | Bacteria | 3930 |
| 630 | Ga0373937_0078610 | 3300036401 | Bacteria | 3048 |
| 631 | Ga0373937_0149356 | 3300036401 | Bacteria | 2188 |
| 632 | Ga0373937_0225208 | 3300036401 | Bacteria | 1765 |
| 633 | Ga0373937_0240902 | 3300036401 | Bacteria | 1704 |
| 634 | Ga0373937_0252516 | 3300036401 | Bacteria | 1662 |
| 635 | Ga0372808_020110 | 3300036459 | Bacteria | 959 |
| 636 | Ga0316584_0082537 | 3300036712 | Bacteria | 2407 |
| 637 | Ga0373925_0000665 | 3300037068 | Bacteria | 32298 |
| 638 | Ga0373925_0001448 | 3300037068 | Bacteria | 20502 |
| 639 | Ga0373925_0002171 | 3300037068 | Bacteria | 15985 |
| 640 | Ga0373925_0031217 | 3300037068 | Bacteria | 3914 |
| 641 | Ga0373925_0160648 | 3300037068 | Bacteria | 1769 |
| 642 | Ga0373925_0392959 | 3300037068 | Bacteria | 1130 |
| 643 | Ga0373925_0466080 | 3300037068 | Bacteria | 1035 |
| 644 | Ga0395900_0242541 | 3300037418 | Bacteria | 1807 |
| 645 | Ga0395898_0079991 | 3300037466 | Bacteria | 3152 |
| 646 | Ga0395898_0581592 | 3300037466 | Bacteria | 1062 |
| 647 | Ga0395905_0228580 | 3300037471 | Bacteria | 1740 |
| 648 | Ga0395905_0447910 | 3300037471 | Bacteria | 1189 |
| 649 | Ga0316581_0137974 | 3300037588 | Bacteria | 752 |
| 650 | Ga0436364_0239700 | 3300037853 | Bacteria | 1631 |
| 651 | Ga0436364_0455895 | 3300037853 | Bacteria | 3407 |
| 652 | Ga0436364_0490334 | 3300037853 | Bacteria | 3197 |
| 653 | Ga0436364_0954826 | 3300037853 | Bacteria | 5178 |
| 654 | Ga0436364_0991115 | 3300037853 | Bacteria | 10432 |
| 655 | Ga0436364_1135490 | 3300037853 | Bacteria | 8171 |
| 656 | Ga0436364_1474170 | 3300037853 | Bacteria | 4287 |
| 657 | Ga0436364_1492889 | 3300037853 | Bacteria | 100509 |
| 658 | Ga0436364_1502084 | 3300037853 | Bacteria | 4831 |
| 659 | Ga0436364_1513813 | 3300037853 | Bacteria | 12335 |
| 660 | Ga0395901_0070186 | 3300038443 | Bacteria | 3650 |
| 661 | Ga0395901_0295380 | 3300038443 | Bacteria | 1680 |
| 662 | Ga0436365_0258162 | 3300039437 | Bacteria | 1999 |
| 663 | Ga0436365_1661196 | 3300039437 | Bacteria | 2072 |
| 664 | Ga0436365_1740178 | 3300039437 | Bacteria | 4052 |
| 665 | Ga0436360_0834923 | 3300039438 | Bacteria | 934 |
| 666 | Ga0436363_0595625 | 3300039450 | Bacteria | 833 |
| 667 | Ga0436362_0237089 | 3300039453 | Bacteria | 1399 |
| 668 | Ga0436362_0906744 | 3300039453 | Bacteria | 804 |
| 669 | Ga0439436_0074006 | 3300041404 | Bacteria | 949 |
| 670 | Ga0451798_0680473 | 3300041458 | Bacteria | 941 |
| 671 | Ga0451833_1164257 | 3300041491 | Bacteria | 794 |
| 672 | Ga0451837_0007545 | 3300041494 | Bacteria | 3239 |
| 673 | Ga0451837_1389347 | 3300041494 | Bacteria | 1982 |
| 674 | Ga0439449_0011013 | 3300042007 | Bacteria | 3412 |
| 675 | Ga0466972_0008486 | 3300044658 | Bacteria | 5153 |
| 676 | Ga0466972_0034884 | 3300044658 | Bacteria | 2463 |
| 677 | Ga0466966_0113849 | 3300044684 | Bacteria | 1666 |
| 678 | Ga0466966_0229156 | 3300044684 | Bacteria | 1121 |
| 679 | Ga0466961_0044052 | 3300044693 | Bacteria | 2856 |
| 680 | Ga0466961_0063845 | 3300044693 | Bacteria | 2340 |
| 681 | Ga0466961_0346158 | 3300044693 | Bacteria | 905 |
| 682 | Ga0466963_0013348 | 3300044694 | Bacteria | 5044 |
| 683 | Ga0466963_0040371 | 3300044694 | Bacteria | 3059 |
| 684 | Ga0466963_0075628 | 3300044694 | Bacteria | 2273 |
| 685 | Ga0466963_0229704 | 3300044694 | Bacteria | 1300 |
| 686 | Ga0466964_0047312 | 3300044706 | Bacteria | 1755 |
| 687 | Ga0466964_0254458 | 3300044706 | Bacteria | 867 |
| 688 | Ga0466971_0061573 | 3300044719 | Bacteria | 1697 |
| 689 | Ga0466970_0006118 | 3300044765 | Bacteria | 5996 |
| 690 | Ga0466970_0023818 | 3300044765 | Bacteria | 3201 |
| 691 | Ga0466957_0002812 | 3300044842 | Bacteria | 9413 |
| 692 | Ga0466957_0013330 | 3300044842 | Bacteria | 4769 |
| 693 | Ga0466957_0251442 | 3300044842 | Bacteria | 1175 |
| 694 | Ga0466959_0147079 | 3300045049 | Bacteria | 1662 |
| 695 | Ga0466959_0223344 | 3300045049 | Bacteria | 1306 |
| 696 | Ga0466958_0033367 | 3300045836 | Bacteria | 3067 |
| 697 | Ga0466967_0021746 | 3300045976 | Bacteria | 5219 |
| 698 | Ga0466967_0047375 | 3300045976 | Bacteria | 3747 |
| 699 | Ga0466967_0211850 | 3300045976 | Bacteria | 1838 |
| 700 | Ga0466967_0426560 | 3300045976 | Bacteria | 1293 |
| 701 | Ga0495592_0000043 | 3300046454 | Bacteria | 122354 |
| 702 | Ga0495592_0058605 | 3300046454 | Bacteria | 2839 |
| 703 | Ga0495592_0097635 | 3300046454 | Bacteria | 2097 |
| 704 | Ga0495592_0099233 | 3300046454 | Bacteria | 2077 |
| 705 | Ga0495603_0000448 | 3300046455 | Bacteria | 22622 |
| 706 | Ga0495629_0000931 | 3300046459 | Bacteria | 23551 |
| 707 | Ga0495629_0004500 | 3300046459 | Bacteria | 10431 |
| 708 | Ga0495629_0004652 | 3300046459 | Bacteria | 10273 |
| 709 | Ga0495629_0012207 | 3300046459 | Bacteria | 6222 |
| 710 | Ga0495629_0044660 | 3300046459 | Bacteria | 3109 |
| 711 | Ga0495629_0081521 | 3300046459 | Bacteria | 2258 |
| 712 | Ga0495629_0096002 | 3300046459 | Bacteria | 2068 |
| 713 | Ga0495638_0012389 | 3300046460 | Bacteria | 5846 |
| 714 | Ga0495641_0002833 | 3300046461 | Bacteria | 13414 |
| 715 | Ga0495641_0004385 | 3300046461 | Bacteria | 9997 |
| 716 | Ga0495641_0008639 | 3300046461 | Bacteria | 6168 |
| 717 | Ga0495641_0036412 | 3300046461 | Bacteria | 2312 |
| 718 | Ga0495651_0000135 | 3300046462 | Bacteria | 54990 |
| 719 | Ga0495651_0000966 | 3300046462 | Bacteria | 22257 |
| 720 | Ga0495651_0002221 | 3300046462 | Bacteria | 14991 |
| 721 | Ga0495651_0008526 | 3300046462 | Bacteria | 7854 |
| 722 | Ga0495651_0062476 | 3300046462 | Bacteria | 2849 |
| 723 | Ga0495651_0074089 | 3300046462 | Bacteria | 2583 |
| 724 | Ga0495653_0004969 | 3300046463 | Bacteria | 10794 |
| 725 | Ga0495653_0016838 | 3300046463 | Bacteria | 5948 |
| 726 | Ga0495653_0018600 | 3300046463 | Bacteria | 5639 |
| 727 | Ga0495653_0033692 | 3300046463 | Bacteria | 4055 |
| 728 | Ga0495653_0040287 | 3300046463 | Bacteria | 3651 |
| 729 | Ga0495653_0162540 | 3300046463 | Bacteria | 1549 |
| 730 | Ga0495653_0203840 | 3300046463 | Bacteria | 1340 |
| 731 | Ga0495653_0279244 | 3300046463 | Bacteria | 1097 |
| 732 | Ga0495653_0435284 | 3300046463 | Bacteria | 827 |
| 733 | Ga0495580_0009782 | 3300046472 | Bacteria | 7521 |
| 734 | Ga0495580_0061619 | 3300046472 | Bacteria | 2633 |
| 735 | Ga0495582_0002660 | 3300046473 | Bacteria | 9970 |
| 736 | Ga0495582_0005191 | 3300046473 | Bacteria | 7284 |
| 737 | Ga0495582_0037012 | 3300046473 | Bacteria | 2684 |
| 738 | Ga0495582_0104284 | 3300046473 | Bacteria | 1589 |
| 739 | Ga0495639_0000703 | 3300046475 | Bacteria | 15322 |
| 740 | Ga0495662_0004713 | 3300046476 | Bacteria | 6829 |
| 741 | Ga0495662_0005311 | 3300046476 | Bacteria | 6458 |
| 742 | Ga0495662_0013949 | 3300046476 | Bacteria | 3911 |
| 743 | Ga0495662_0019432 | 3300046476 | Bacteria | 3286 |
| 744 | Ga0495664_0003738 | 3300046477 | Bacteria | 8301 |
| 745 | Ga0495664_0031476 | 3300046477 | Bacteria | 3110 |
| 746 | Ga0495664_0081001 | 3300046477 | Bacteria | 1946 |
| 747 | Ga0495594_0079930 | 3300046499 | Bacteria | 1825 |
| 748 | Ga0495608_0000016 | 3300046511 | Bacteria | 196738 |
| 749 | Ga0495608_0004214 | 3300046511 | Bacteria | 10308 |
| 750 | Ga0495608_0007788 | 3300046511 | Bacteria | 7539 |
| 751 | Ga0495608_0012724 | 3300046511 | Bacteria | 5839 |
| 752 | Ga0495608_0023485 | 3300046511 | Bacteria | 4226 |
| 753 | Ga0495608_0033389 | 3300046511 | Bacteria | 3478 |
| 754 | Ga0495608_0070195 | 3300046511 | Bacteria | 2286 |
| 755 | Ga0495608_0101783 | 3300046511 | Bacteria | 1852 |
| 756 | Ga0495618_0004534 | 3300046514 | Bacteria | 8535 |
| 757 | Ga0495618_0049436 | 3300046514 | Bacteria | 2655 |
| 758 | Ga0495618_0086487 | 3300046514 | Bacteria | 2004 |
| 759 | Ga0495628_0000034 | 3300046516 | Bacteria | 115264 |
| 760 | Ga0495628_0068789 | 3300046516 | Bacteria | 2761 |
| 761 | Ga0495628_0101714 | 3300046516 | Bacteria | 2218 |
| 762 | Ga0495628_0108285 | 3300046516 | Bacteria | 2139 |
| 763 | Ga0495628_0169026 | 3300046516 | Bacteria | 1658 |
| 764 | Ga0495630_0004529 | 3300046517 | Bacteria | 9737 |
| 765 | Ga0495630_0056328 | 3300046517 | Bacteria | 2946 |
| 766 | Ga0495630_0075412 | 3300046517 | Bacteria | 2541 |
| 767 | Ga0495630_0222639 | 3300046517 | Bacteria | 1440 |
| 768 | Ga0495630_0273858 | 3300046517 | Bacteria | 1289 |
| 769 | Ga0495630_0474923 | 3300046517 | Bacteria | 958 |
| 770 | Ga0495652_0000174 | 3300046529 | Bacteria | 73044 |
| 771 | Ga0495652_0004293 | 3300046529 | Bacteria | 13670 |
| 772 | Ga0495652_0066976 | 3300046529 | Bacteria | 3011 |
| 773 | Ga0495652_0081786 | 3300046529 | Bacteria | 2663 |
| 774 | Ga0495652_0087805 | 3300046529 | Bacteria | 2550 |
| 775 | Ga0495652_0131273 | 3300046529 | Bacteria | 1983 |
| 776 | Ga0495652_0139783 | 3300046529 | Bacteria | 1905 |
| 777 | Ga0495652_0145591 | 3300046529 | Bacteria | 1857 |
| 778 | Ga0495665_0003719 | 3300046531 | Bacteria | 8272 |
| 779 | Ga0495665_0004882 | 3300046531 | Bacteria | 7228 |
| 780 | Ga0495665_0086288 | 3300046531 | Bacteria | 1649 |
| 781 | Ga0495640_0007019 | 3300046533 | Bacteria | 8865 |
| 782 | Ga0495640_0084868 | 3300046533 | Bacteria | 2099 |
| 783 | Ga0495640_0112416 | 3300046533 | Bacteria | 1778 |
| 784 | Ga0495640_0155559 | 3300046533 | Bacteria | 1467 |
| 785 | Ga0495640_0194386 | 3300046533 | Bacteria | 1288 |
| 786 | Ga0495640_0212207 | 3300046533 | Bacteria | 1223 |
| 787 | Ga0495640_0303809 | 3300046533 | Bacteria | 991 |
| 788 | Ga0495586_0003326 | 3300046535 | Bacteria | 8626 |
| 789 | Ga0495586_0012499 | 3300046535 | Bacteria | 4504 |
| 790 | Ga0495586_0184986 | 3300046535 | Bacteria | 1179 |
| 791 | Ga0495587_0000044 | 3300046536 | Bacteria | 108443 |
| 792 | Ga0495587_0005394 | 3300046536 | Bacteria | 8355 |
| 793 | Ga0495587_0016948 | 3300046536 | Bacteria | 4530 |
| 794 | Ga0495587_0027227 | 3300046536 | Bacteria | 3481 |
| 795 | Ga0495587_0199888 | 3300046536 | Bacteria | 1130 |
| 796 | Ga0495645_0022548 | 3300046543 | Bacteria | 4556 |
| 797 | Ga0495645_0030241 | 3300046543 | Bacteria | 3943 |
| 798 | Ga0495645_0034926 | 3300046543 | Bacteria | 3665 |
| 799 | Ga0495645_0037566 | 3300046543 | Bacteria | 3531 |
| 800 | Ga0495645_0051963 | 3300046543 | Bacteria | 2982 |
| 801 | Ga0495645_0375636 | 3300046543 | Bacteria | 910 |
| 802 | Ga0495622_0094570 | 3300046557 | Bacteria | 1372 |
| 803 | Ga0495667_0000052 | 3300046559 | Bacteria | 108432 |
| 804 | Ga0495667_0001554 | 3300046559 | Bacteria | 15235 |
| 805 | Ga0495667_0003726 | 3300046559 | Bacteria | 10254 |
| 806 | Ga0495667_0007717 | 3300046559 | Bacteria | 7292 |
| 807 | Ga0495667_0015859 | 3300046559 | Bacteria | 5094 |
| 808 | Ga0495667_0017126 | 3300046559 | Bacteria | 4894 |
| 809 | Ga0495667_0027228 | 3300046559 | Bacteria | 3853 |
| 810 | Ga0495667_0066992 | 3300046559 | Bacteria | 2346 |
| 811 | Ga0495667_0112369 | 3300046559 | Bacteria | 1760 |
| 812 | Ga0495667_0259858 | 3300046559 | Bacteria | 1104 |
| 813 | Ga0495634_0002898 | 3300046642 | Bacteria | 14076 |
| 814 | Ga0495634_0018001 | 3300046642 | Bacteria | 5034 |
| 815 | Ga0495634_0056891 | 3300046642 | Bacteria | 2612 |
| 816 | Ga0495634_0141921 | 3300046642 | Bacteria | 1524 |
| 817 | Ga0495625_0026086 | 3300046660 | Bacteria | 4419 |
| 818 | Ga0495635_0000862 | 3300046663 | Bacteria | 19903 |
| 819 | Ga0495635_0011411 | 3300046663 | Bacteria | 6232 |
| 820 | Ga0495635_0030524 | 3300046663 | Bacteria | 3745 |
| 821 | Ga0495635_0039128 | 3300046663 | Bacteria | 3282 |
| 822 | Ga0495635_0072092 | 3300046663 | Bacteria | 2367 |
| 823 | Ga0495635_0088831 | 3300046663 | Bacteria | 2114 |
| 824 | Ga0495635_0136665 | 3300046663 | Bacteria | 1670 |
| 825 | Ga0495635_0203960 | 3300046663 | Bacteria | 1340 |
| 826 | Ga0495635_0257941 | 3300046663 | Bacteria | 1174 |
| 827 | Ga0495635_0294465 | 3300046663 | Bacteria | 1089 |
| 828 | Ga0495588_0001192 | 3300046674 | Bacteria | 11221 |
| 829 | Ga0495588_0043863 | 3300046674 | Bacteria | 2289 |
| 830 | Ga0495588_0191399 | 3300046674 | Bacteria | 1080 |
| 831 | Ga0495657_0000015 | 3300046675 | Bacteria | 187657 |
| 832 | Ga0495657_0003936 | 3300046675 | Bacteria | 11921 |
| 833 | Ga0495657_0009695 | 3300046675 | Bacteria | 7281 |
| 834 | Ga0495657_0011699 | 3300046675 | Bacteria | 6546 |
| 835 | Ga0495657_0013105 | 3300046675 | Bacteria | 6128 |
| 836 | Ga0495657_0015891 | 3300046675 | Bacteria | 5494 |
| 837 | Ga0495657_0015957 | 3300046675 | Bacteria | 5480 |
| 838 | Ga0495657_0045712 | 3300046675 | Bacteria | 2969 |
| 839 | Ga0495657_0048506 | 3300046675 | Bacteria | 2864 |
| 840 | Ga0495657_0178971 | 3300046675 | Bacteria | 1302 |
| 841 | Ga0495599_0000035 | 3300046678 | Bacteria | 103981 |
| 842 | Ga0495599_0009512 | 3300046678 | Bacteria | 5943 |
| 843 | Ga0495599_0121628 | 3300046678 | Bacteria | 1622 |
| 844 | Ga0495599_0180222 | 3300046678 | Bacteria | 1302 |
| 845 | Ga0495599_0205821 | 3300046678 | Bacteria | 1208 |
| 846 | Ga0495623_0000767 | 3300046679 | Bacteria | 21507 |
| 847 | Ga0495623_0043441 | 3300046679 | Bacteria | 2860 |
| 848 | Ga0495623_0065142 | 3300046679 | Bacteria | 2279 |
| 849 | Ga0495623_0084647 | 3300046679 | Bacteria | 1956 |
| 850 | Ga0495623_0204589 | 3300046679 | Bacteria | 1133 |
| 851 | Ga0495623_0274394 | 3300046679 | Bacteria | 940 |
| 852 | Ga0495646_0002176 | 3300046680 | Bacteria | 11936 |
| 853 | Ga0495646_0022208 | 3300046680 | Bacteria | 4003 |
| 854 | Ga0495646_0053352 | 3300046680 | Bacteria | 2438 |
| 855 | Ga0495646_0062723 | 3300046680 | Bacteria | 2209 |
| 856 | Ga0495646_0122185 | 3300046680 | Bacteria | 1472 |
| 857 | Ga0495646_0142203 | 3300046680 | Bacteria | 1340 |
| 858 | Ga0495658_0004230 | 3300046683 | Bacteria | 7062 |
| 859 | Ga0495658_0014284 | 3300046683 | Bacteria | 4055 |
| 860 | Ga0495658_0209385 | 3300046683 | Bacteria | 1218 |
| 861 | Ga0495613_0040458 | 3300046689 | Bacteria | 3453 |
| 862 | Ga0495613_0063510 | 3300046689 | Bacteria | 2702 |
| 863 | Ga0495613_0082889 | 3300046689 | Bacteria | 2328 |
| 864 | Ga0495613_0166203 | 3300046689 | Bacteria | 1567 |
| 865 | Ga0495613_0315677 | 3300046689 | Bacteria | 1079 |
| 866 | Ga0495624_0012749 | 3300046690 | Bacteria | 5739 |
| 867 | Ga0495624_0021323 | 3300046690 | Bacteria | 4297 |
| 868 | Ga0495624_0093165 | 3300046690 | Bacteria | 1857 |
| 869 | Ga0495670_0077873 | 3300046691 | Bacteria | 1686 |
| 870 | Ga0495671_0006448 | 3300046692 | Bacteria | 6775 |
| 871 | Ga0495589_0005208 | 3300046794 | Bacteria | 6878 |
| 872 | Ga0495600_0004974 | 3300046809 | Bacteria | 7982 |
| 873 | Ga0495600_0007374 | 3300046809 | Bacteria | 6726 |
| 874 | Ga0495600_0048924 | 3300046809 | Bacteria | 2758 |
| 875 | Ga0495600_0072957 | 3300046809 | Bacteria | 2241 |
| 876 | Ga0495600_0111800 | 3300046809 | Bacteria | 1778 |
| 877 | Ga0495600_0128487 | 3300046809 | Bacteria | 1647 |
| 878 | Ga0495600_0163282 | 3300046809 | Bacteria | 1439 |
| 879 | Ga0495581_0003852 | 3300047315 | Bacteria | 8631 |
| 880 | Ga0495581_0035248 | 3300047315 | Bacteria | 2895 |
| 881 | Ga0495581_0099794 | 3300047315 | Bacteria | 1686 |
| 882 | Ga0495604_0000048 | 3300047317 | Bacteria | 108810 |
| 883 | Ga0495604_0024556 | 3300047317 | Bacteria | 4808 |
| 884 | Ga0495604_0030884 | 3300047317 | Bacteria | 4251 |
| 885 | Ga0495604_0085167 | 3300047317 | Bacteria | 2359 |
| 886 | Ga0495604_0098263 | 3300047317 | Bacteria | 2157 |
| 887 | Ga0495604_0133042 | 3300047317 | Bacteria | 1785 |
| 888 | Ga0495604_0260255 | 3300047317 | Bacteria | 1179 |
| 889 | Ga0495674_0005311 | 3300047319 | Bacteria | 12358 |
| 890 | Ga0495674_0013115 | 3300047319 | Bacteria | 7794 |
| 891 | Ga0495674_0033330 | 3300047319 | Bacteria | 4667 |
| 892 | Ga0495674_0072542 | 3300047319 | Bacteria | 2969 |
| 893 | Ga0495674_0119404 | 3300047319 | Bacteria | 2228 |
| 894 | Ga0495674_0162109 | 3300047319 | Bacteria | 1870 |
| 895 | Ga0495674_0193690 | 3300047319 | Bacteria | 1688 |
| 896 | Ga0495674_0248746 | 3300047319 | Bacteria | 1463 |
| 897 | Ga0495676_0003200 | 3300047321 | Bacteria | 14801 |
| 898 | Ga0495676_0030991 | 3300047321 | Bacteria | 4529 |
| 899 | Ga0495676_0065365 | 3300047321 | Bacteria | 2823 |
| 900 | Ga0495676_0075176 | 3300047321 | Bacteria | 2584 |
| 901 | Ga0495676_0079253 | 3300047321 | Bacteria | 2498 |
| 902 | Ga0495676_0127266 | 3300047321 | Bacteria | 1844 |
| 903 | Ga0495676_0455862 | 3300047321 | Bacteria | 843 |
| 904 | Ga0495680_0000069 | 3300047322 | Bacteria | 88766 |
| 905 | Ga0495680_0004112 | 3300047322 | Bacteria | 13995 |
| 906 | Ga0495680_0010588 | 3300047322 | Bacteria | 8225 |
| 907 | Ga0495680_0011817 | 3300047322 | Bacteria | 7711 |
| 908 | Ga0495680_0022401 | 3300047322 | Bacteria | 5264 |
| 909 | Ga0495680_0027484 | 3300047322 | Bacteria | 4673 |
| 910 | Ga0495680_0028813 | 3300047322 | Bacteria | 4551 |
| 911 | Ga0495680_0067563 | 3300047322 | Bacteria | 2732 |
| 912 | Ga0495680_0109944 | 3300047322 | Bacteria | 2043 |
| 913 | Ga0495680_0116408 | 3300047322 | Bacteria | 1976 |
| 914 | Ga0495680_0172113 | 3300047322 | Bacteria | 1567 |
| 915 | Ga0495680_0224195 | 3300047322 | Bacteria | 1340 |
| 916 | Ga0495687_004640 | 3300047443 | Bacteria | 9169 |
| 917 | Ga0495675_0000685 | 3300047444 | Bacteria | 21288 |
| 918 | Ga0495675_0004478 | 3300047444 | Bacteria | 8464 |
| 919 | Ga0495675_0016613 | 3300047444 | Bacteria | 4655 |
| 920 | Ga0495675_0037710 | 3300047444 | Bacteria | 3078 |
| 921 | Ga0495675_0143150 | 3300047444 | Bacteria | 1481 |
| 922 | Ga0495675_0251588 | 3300047444 | Bacteria | 1061 |
| 923 | Ga0495675_0275965 | 3300047444 | Bacteria | 1003 |
| 924 | Ga0495681_0035320 | 3300047470 | Bacteria | 2482 |
| 925 | Ga0495684_0003133 | 3300047471 | Bacteria | 12974 |
| 926 | Ga0495684_0004619 | 3300047471 | Bacteria | 10752 |
| 927 | Ga0495684_0007538 | 3300047471 | Bacteria | 8421 |
| 928 | Ga0495684_0023007 | 3300047471 | Bacteria | 4792 |
| 929 | Ga0495684_0025322 | 3300047471 | Bacteria | 4562 |
| 930 | Ga0495684_0064696 | 3300047471 | Bacteria | 2779 |
| 931 | Ga0495684_0084760 | 3300047471 | Bacteria | 2403 |
| 932 | Ga0495593_0024245 | 3300047673 | Bacteria | 3363 |
| 933 | Ga0495602_0001615 | 3300048088 | Bacteria | 22410 |
| 934 | Ga0495602_0018075 | 3300048088 | Bacteria | 7052 |
| 935 | Ga0495602_0026606 | 3300048088 | Bacteria | 5577 |
| 936 | Ga0495602_0037844 | 3300048088 | Bacteria | 4469 |
| 937 | Ga0495602_0038337 | 3300048088 | Bacteria | 4432 |
| 938 | Ga0495602_0041369 | 3300048088 | Bacteria | 4210 |
| 939 | Ga0495602_0072982 | 3300048088 | Bacteria | 2923 |
| 940 | Ga0495602_0082140 | 3300048088 | Bacteria | 2705 |
| 941 | Ga0495602_0147407 | 3300048088 | Bacteria | 1854 |
| 942 | Ga0495602_0182705 | 3300048088 | Bacteria | 1616 |
| 943 | Ga0495602_0350017 | 3300048088 | Bacteria | 1066 |
| 944 | Ga0495614_0023127 | 3300048089 | Bacteria | 2680 |
| 945 | Ga0496100_0008298 | 3300048903 | Bacteria | 5790 |
| 946 | Ga0496100_0022571 | 3300048903 | Bacteria | 3809 |
| 947 | Ga0496100_0039952 | 3300048903 | Bacteria | 2982 |
| 948 | Ga0496100_0078985 | 3300048903 | Bacteria | 2216 |
| 949 | Ga0496100_0140956 | 3300048903 | Bacteria | 1709 |
| 950 | Ga0496100_0213672 | 3300048903 | Bacteria | 1412 |
| 951 | Ga0496101_0020981 | 3300048904 | Bacteria | 4483 |
| 952 | Ga0496101_0067646 | 3300048904 | Bacteria | 2609 |
| 953 | Ga0496101_0124435 | 3300048904 | Bacteria | 1953 |
| 954 | Ga0496101_0128848 | 3300048904 | Bacteria | 1920 |
| 955 | Ga0496101_0129321 | 3300048904 | Bacteria | 1916 |
| 956 | Ga0496101_0214425 | 3300048904 | Bacteria | 1492 |
| 957 | Ga0496101_0228922 | 3300048904 | Bacteria | 1444 |
| 958 | Ga0496102_0000929 | 3300048905 | Bacteria | 27594 |
| 959 | Ga0496102_0058675 | 3300048905 | Bacteria | 3517 |
| 960 | Ga0496102_0076872 | 3300048905 | Bacteria | 3072 |
| 961 | Ga0496102_0091753 | 3300048905 | Bacteria | 2812 |
| 962 | Ga0496102_0153131 | 3300048905 | Bacteria | 2167 |
| 963 | Ga0496103_0034521 | 3300048906 | Bacteria | 3093 |
| 964 | Ga0496104_0000263 | 3300048907 | Bacteria | 46252 |
| 965 | Ga0496104_0002013 | 3300048907 | Bacteria | 17642 |
| 966 | Ga0496104_0005064 | 3300048907 | Bacteria | 11495 |
| 967 | Ga0496104_0046865 | 3300048907 | Bacteria | 4073 |
| 968 | Ga0496104_0070149 | 3300048907 | Bacteria | 3331 |
| 969 | Ga0496104_0147530 | 3300048907 | Bacteria | 2259 |
| 970 | Ga0496104_0152648 | 3300048907 | Bacteria | 2216 |
| 971 | Ga0496104_0238384 | 3300048907 | Bacteria | 1731 |
| 972 | Ga0496104_0273903 | 3300048907 | Bacteria | 1600 |
| 973 | Ga0496105_0001788 | 3300048908 | Bacteria | 15363 |
| 974 | Ga0496105_0025988 | 3300048908 | Bacteria | 4771 |
| 975 | Ga0496105_0035101 | 3300048908 | Bacteria | 4126 |
| 976 | Ga0496105_0039054 | 3300048908 | Bacteria | 3911 |
| 977 | Ga0496105_0047571 | 3300048908 | Bacteria | 3540 |
| 978 | Ga0496105_0067920 | 3300048908 | Bacteria | 2944 |
| 979 | Ga0496105_0084410 | 3300048908 | Bacteria | 2623 |
| 980 | Ga0496106_0004569 | 3300048909 | Bacteria | 10264 |
| 981 | Ga0496106_0052854 | 3300048909 | Bacteria | 3066 |
| 982 | Ga0496106_0174016 | 3300048909 | Bacteria | 1707 |
| 983 | Ga0496106_0333026 | 3300048909 | Bacteria | 1219 |
| 984 | Ga0496106_0573512 | 3300048909 | Bacteria | 905 |
| 985 | Ga0496107_0021454 | 3300048910 | Bacteria | 4564 |
| 986 | Ga0496107_0045441 | 3300048910 | Bacteria | 3159 |
| 987 | Ga0496107_0063357 | 3300048910 | Bacteria | 2679 |
| 988 | Ga0496107_0095309 | 3300048910 | Bacteria | 2177 |
| 989 | Ga0496107_0202453 | 3300048910 | Bacteria | 1475 |
| 990 | Ga0496107_0260182 | 3300048910 | Bacteria | 1291 |
| 991 | Ga0496108_0007549 | 3300048911 | Bacteria | 8813 |
| 992 | Ga0496108_0020982 | 3300048911 | Bacteria | 5370 |
| 993 | Ga0496108_0074176 | 3300048911 | Bacteria | 2872 |
| 994 | Ga0496108_0125293 | 3300048911 | Bacteria | 2205 |
| 995 | Ga0496108_0238441 | 3300048911 | Bacteria | 1582 |
| 996 | Ga0496108_0369867 | 3300048911 | Bacteria | 1251 |
| 997 | Ga0496109_0007402 | 3300048912 | Bacteria | 9291 |
| 998 | Ga0496109_0023097 | 3300048912 | Bacteria | 5517 |
| 999 | Ga0496109_0029729 | 3300048912 | Bacteria | 4895 |
| 1000 | Ga0496109_0032848 | 3300048912 | Bacteria | 4668 |
| 1001 | Ga0496109_0039821 | 3300048912 | Bacteria | 4255 |
| 1002 | Ga0496109_0050283 | 3300048912 | Bacteria | 3796 |
| 1003 | Ga0496109_0220544 | 3300048912 | Bacteria | 1783 |
| 1004 | Ga0496109_0312651 | 3300048912 | Bacteria | 1482 |
| 1005 | Ga0496109_0407063 | 3300048912 | Bacteria | 1285 |
| 1006 | Ga0496109_0538493 | 3300048912 | Bacteria | 1102 |
| 1007 | Ga0496110_0002708 | 3300048913 | Bacteria | 13397 |
| 1008 | Ga0496110_0022446 | 3300048913 | Bacteria | 5359 |
| 1009 | Ga0496110_0033389 | 3300048913 | Bacteria | 4451 |
| 1010 | Ga0496110_0173402 | 3300048913 | Bacteria | 1957 |
| 1011 | Ga0496110_0445362 | 3300048913 | Bacteria | 1180 |
| 1012 | Ga0496111_0002537 | 3300048914 | Bacteria | 11024 |
| 1013 | Ga0496111_0080832 | 3300048914 | Bacteria | 2372 |
| 1014 | Ga0496111_0084454 | 3300048914 | Bacteria | 2321 |
| 1015 | Ga0496111_0191585 | 3300048914 | Bacteria | 1520 |
| 1016 | Ga0496111_0274372 | 3300048914 | Bacteria | 1251 |
| 1017 | Ga0496112_0000159 | 3300048915 | Bacteria | 42547 |
| 1018 | Ga0496112_0014254 | 3300048915 | Bacteria | 7366 |
| 1019 | Ga0496112_0024687 | 3300048915 | Bacteria | 5762 |
| 1020 | Ga0496112_0106498 | 3300048915 | Bacteria | 2773 |
| 1021 | Ga0496112_0177747 | 3300048915 | Bacteria | 2093 |
| 1022 | Ga0496113_0006554 | 3300048916 | Bacteria | 7391 |
| 1023 | Ga0496113_0027455 | 3300048916 | Bacteria | 4081 |
| 1024 | Ga0496113_0073559 | 3300048916 | Bacteria | 2604 |
| 1025 | Ga0496113_0188925 | 3300048916 | Bacteria | 1635 |
| 1026 | Ga0496113_0287282 | 3300048916 | Bacteria | 1315 |
| 1027 | Ga0496114_0012899 | 3300048917 | Bacteria | 6694 |
| 1028 | Ga0496114_0028233 | 3300048917 | Bacteria | 4603 |
| 1029 | Ga0496114_0048829 | 3300048917 | Bacteria | 3521 |
| 1030 | Ga0496114_0056772 | 3300048917 | Bacteria | 3267 |
| 1031 | Ga0496114_0062390 | 3300048917 | Bacteria | 3119 |
| 1032 | Ga0496114_0079216 | 3300048917 | Bacteria | 2773 |
| 1033 | Ga0496114_0092814 | 3300048917 | Bacteria | 2565 |
| 1034 | Ga0496114_0670978 | 3300048917 | Bacteria | 910 |
| 1035 | Ga0496115_0021236 | 3300048918 | Bacteria | 5013 |
| 1036 | Ga0496115_0031981 | 3300048918 | Bacteria | 4149 |
| 1037 | Ga0496115_0062701 | 3300048918 | Bacteria | 2999 |
| 1038 | Ga0496115_0168843 | 3300048918 | Bacteria | 1809 |
| 1039 | Ga0496115_0389467 | 3300048918 | Bacteria | 1132 |
| 1040 | Ga0496122_0196991 | 3300048925 | Bacteria | 1182 |
| 1041 | Ga0496125_0310490 | 3300048928 | Bacteria | 961 |
| 1042 | Ga0496126_0027315 | 3300048929 | Bacteria | 5453 |
| 1043 | Ga0496126_0031554 | 3300048929 | Bacteria | 5003 |
| 1044 | Ga0496126_0037923 | 3300048929 | Bacteria | 4488 |
| 1045 | Ga0496126_0211493 | 3300048929 | Bacteria | 1633 |
| 1046 | Ga0501031_0003149 | 3300049568 | Bacteria | 10581 |
| 1047 | Ga0501031_0008650 | 3300049568 | Bacteria | 6620 |
| 1048 | Ga0501031_0043366 | 3300049568 | Bacteria | 2936 |
| 1049 | Ga0501032_0029432 | 3300049569 | Bacteria | 3768 |
| 1050 | Ga0501032_0033532 | 3300049569 | Bacteria | 3517 |
| 1051 | Ga0501032_0151016 | 3300049569 | Bacteria | 1527 |
| 1052 | Ga0501033_0006830 | 3300049570 | Bacteria | 8906 |
| 1053 | Ga0501033_0007168 | 3300049570 | Bacteria | 8699 |
| 1054 | Ga0501033_0041059 | 3300049570 | Bacteria | 3453 |
| 1055 | Ga0501033_0083715 | 3300049570 | Bacteria | 2338 |
| 1056 | Ga0501034_0035028 | 3300049571 | Bacteria | 5091 |
| 1057 | Ga0501034_0067171 | 3300049571 | Bacteria | 3599 |
| 1058 | Ga0501034_0103409 | 3300049571 | Bacteria | 2842 |
| 1059 | Ga0501034_0145978 | 3300049571 | Bacteria | 2343 |
| 1060 | Ga0501036_0007634 | 3300049572 | Bacteria | 8828 |
| 1061 | Ga0501036_0090011 | 3300049572 | Bacteria | 2592 |
| 1062 | Ga0501036_0181637 | 3300049572 | Bacteria | 1771 |
| 1063 | Ga0501036_0237947 | 3300049572 | Bacteria | 1527 |
| 1064 | Ga0501037_0094556 | 3300049573 | Bacteria | 2161 |
| 1065 | Ga0501037_0335809 | 3300049573 | Bacteria | 1044 |
| 1066 | Ga0501038_0005688 | 3300049574 | Bacteria | 11565 |
| 1067 | Ga0501038_0105460 | 3300049574 | Bacteria | 2341 |
| 1068 | Ga0501039_0001008 | 3300049575 | Bacteria | 20519 |
| 1069 | Ga0501039_0004674 | 3300049575 | Bacteria | 10360 |
| 1070 | Ga0501039_0171264 | 3300049575 | Bacteria | 1707 |
| 1071 | Ga0501039_0618121 | 3300049575 | Bacteria | 849 |
| 1072 | Ga0501040_0016271 | 3300049576 | Bacteria | 4920 |
| 1073 | Ga0501040_0230685 | 3300049576 | Bacteria | 1318 |
| 1074 | Ga0501041_0018351 | 3300049577 | Bacteria | 4168 |
| 1075 | Ga0501041_0121766 | 3300049577 | Bacteria | 1622 |
| 1076 | Ga0501042_0103845 | 3300049578 | Bacteria | 2045 |
| 1077 | Ga0501043_0087121 | 3300049579 | Bacteria | 2454 |
| 1078 | Ga0501043_0114972 | 3300049579 | Bacteria | 2112 |
| 1079 | Ga0501043_0173761 | 3300049579 | Bacteria | 1680 |
| 1080 | Ga0501043_0498774 | 3300049579 | Bacteria | 910 |
| 1081 | Ga0501046_0013645 | 3300049580 | Bacteria | 6872 |
| 1082 | Ga0501047_0006153 | 3300049581 | Bacteria | 11284 |
| 1083 | Ga0501047_0011211 | 3300049581 | Bacteria | 8481 |
| 1084 | Ga0501047_0394547 | 3300049581 | Bacteria | 1217 |
| 1085 | Ga0501047_0676130 | 3300049581 | Bacteria | 850 |
| 1086 | Ga0501048_0001302 | 3300049582 | Bacteria | 18920 |
| 1087 | Ga0501048_0002817 | 3300049582 | Bacteria | 13277 |
| 1088 | Ga0501048_0124358 | 3300049582 | Bacteria | 1824 |
| 1089 | Ga0501067_0137914 | 3300049583 | Bacteria | 1358 |
| 1090 | Ga0501068_0304002 | 3300049584 | Bacteria | 1021 |
| 1091 | Ga0501070_0028990 | 3300049586 | Bacteria | 4642 |
| 1092 | Ga0501070_0145471 | 3300049586 | Bacteria | 1956 |
| 1093 | Ga0501070_0289775 | 3300049586 | Bacteria | 1334 |
| 1094 | Ga0501071_0024723 | 3300049587 | Bacteria | 4201 |
| 1095 | Ga0501072_0027284 | 3300049588 | Bacteria | 4455 |
| 1096 | Ga0501072_0375380 | 3300049588 | Bacteria | 1128 |
| 1097 | Ga0501074_0353461 | 3300049590 | Bacteria | 1043 |
| 1098 | Ga0501075_0006844 | 3300049591 | Bacteria | 7870 |
| 1099 | Ga0501076_0007635 | 3300049592 | Bacteria | 7875 |
| 1100 | Ga0501077_0032713 | 3300049593 | Bacteria | 3311 |
| 1101 | Ga0501079_0168435 | 3300049741 | Bacteria | 1708 |
| 1102 | Ga0501035_0011100 | 3300049822 | Bacteria | 8341 |
| 1103 | Ga0501035_0011350 | 3300049822 | Bacteria | 8258 |
| 1104 | Ga0501035_0710947 | 3300049822 | Bacteria | 809 |
| 1105 | Ga0501044_0007546 | 3300049823 | Bacteria | 11959 |
| 1106 | Ga0501044_0015982 | 3300049823 | Bacteria | 8075 |
| 1107 | Ga0501044_0227522 | 3300049823 | Bacteria | 1814 |
| 1108 | Ga0501044_0270899 | 3300049823 | Bacteria | 1633 |
| 1109 | Ga0501045_0000128 | 3300049824 | Bacteria | 39951 |
| 1110 | Ga0501045_0035949 | 3300049824 | Bacteria | 3597 |
| 1111 | Ga0501045_0197373 | 3300049824 | Bacteria | 1499 |
| 1112 | nmdc:mga03n38_30676_c1 | 3300050490 | Bacteria | 2262 |
| 1113 | nmdc:mga00v17_231881_c1 | 3300050491 | Bacteria | 1196 |
| 1114 | nmdc:mga00v17_29413_c1 | 3300050491 | Bacteria | 3224 |
| 1115 | nmdc:mga00v17_68711_c1 | 3300050491 | Bacteria | 2190 |
| 1116 | nmdc:mga0yw44_5475_c1 | 3300050492 | Bacteria | 6005 |
| 1117 | nmdc:mga0yw44_67171_c1 | 3300050492 | Bacteria | 2215 |
| 1118 | nmdc:mga06z11_302671_c1 | 3300050494 | Bacteria | 951 |
| 1119 | nmdc:mga05p37_43634_c1 | 3300050507 | Bacteria | 5517 |
| 1120 | nmdc:mga09592_357055_c1 | 3300050508 | Bacteria | 1265 |
| 1121 | nmdc:mga08y16_43759_c1 | 3300050511 | Bacteria | 4693 |
| 1122 | nmdc:mga08y16_71631_c1 | 3300050511 | Bacteria | 3612 |
| 1123 | nmdc:mga08y16_95906_c1 | 3300050511 | Bacteria | 3089 |
| 1124 | nmdc:mga0n895_201902_c1 | 3300050512 | Bacteria | 2019 |
| 1125 | nmdc:mga0n895_23448_c1 | 3300050512 | Bacteria | 5800 |
| 1126 | nmdc:mga0n895_6914_c1 | 3300050512 | Bacteria | 9693 |
| 1127 | nmdc:mga0rr50_3006_c1 | 3300050513 | Bacteria | 9643 |
| 1128 | nmdc:mga0rr50_523891_c1 | 3300050513 | Bacteria | 1008 |
| 1129 | nmdc:mga0rr50_73089_c1 | 3300050513 | Bacteria | 2621 |
| 1130 | nmdc:mga08x19_11321_c1 | 3300050514 | Bacteria | 5369 |
| 1131 | nmdc:mga08x19_1282_c1 | 3300050514 | Bacteria | 15600 |
| 1132 | nmdc:mga08x19_87055_c1 | 3300050514 | Bacteria | 2057 |
| 1133 | nmdc:mga0sz30_49429_c1 | 3300050516 | Bacteria | 1263 |
| 1134 | Ga0495601_0002951 | 3300053077 | Bacteria | 9667 |
| 1135 | Ga0495601_0017372 | 3300053077 | Bacteria | 4366 |
| 1136 | Ga0495601_0018474 | 3300053077 | Bacteria | 4245 |
| 1137 | Ga0495601_0022322 | 3300053077 | Bacteria | 3884 |
| 1138 | Ga0495601_0032112 | 3300053077 | Bacteria | 3266 |
| 1139 | Ga0495601_0042317 | 3300053077 | Bacteria | 2857 |
| 1140 | Ga0495601_0094479 | 3300053077 | Bacteria | 1927 |
| 1141 | Ga0495601_0139427 | 3300053077 | Bacteria | 1581 |
| 1142 | Ga0495612_0011079 | 3300053078 | Bacteria | 3639 |
| 1143 | Ga0495612_0011425 | 3300053078 | Bacteria | 3580 |
| 1144 | Ga0495612_0094971 | 3300053078 | Bacteria | 1266 |
| 1145 | Ga0495655_0010282 | 3300053083 | Bacteria | 1842 |
| 1146 | Ga0495595_0000162 | 3300053084 | Bacteria | 26749 |
| 1147 | Ga0495595_0005098 | 3300053084 | Bacteria | 5308 |
| 1148 | Ga0495595_0012128 | 3300053084 | Bacteria | 3617 |
| 1149 | Ga0495595_0053589 | 3300053084 | Bacteria | 1874 |
| 1150 | Ga0495619_0009943 | 3300053085 | Bacteria | 5990 |
| 1151 | Ga0495619_0013593 | 3300053085 | Bacteria | 5128 |
| 1152 | Ga0495619_0014724 | 3300053085 | Bacteria | 4940 |
| 1153 | Ga0500644_0038556 | 3300053088 | Bacteria | 1569 |
| 1154 | Ga0500583_0147065 | 3300053092 | Bacteria | 1172 |
| 1155 | Ga0500641_0005009 | 3300053096 | Bacteria | 4699 |
| 1156 | Ga0500556_0000086 | 3300053104 | Bacteria | 87063 |
| 1157 | Ga0500560_002305 | 3300053107 | Bacteria | 3610 |
| 1158 | Ga0500562_001846 | 3300053108 | Bacteria | 5313 |
| 1159 | Ga0500593_000565 | 3300053117 | Bacteria | 14324 |
| 1160 | Ga0500655_000708 | 3300053133 | Bacteria | 6617 |
| 1161 | Ga0500577_0012772 | 3300053142 | Bacteria | 2548 |
| 1162 | Ga0501084_0006106 | 3300054114 | Bacteria | 9905 |
| 1163 | Ga0501084_0710250 | 3300054114 | Bacteria | 848 |
| 1164 | Ga0501082_0019284 | 3300060353 | Bacteria | 5879 |
| 1165 | Ga0530510_0004113 | 3300061734 | Bacteria | 10043 |
| 1166 | 2643946882 | 2643221587 | Bacteria | 7586415 |
| 1167 | 2644034294 | 2643221604 | Bacteria | 5014917 |
| 1168 | 2644098690 | 2643221617 | Bacteria | 5139111 |
| 1169 | 2644116051 | 2643221620 | Bacteria | 5134593 |
| 1170 | 2644228749 | 2643221641 | Bacteria | 4490190 |
| 1171 | 2644435063 | 2643221677 | Bacteria | 7584031 |
| 1172 | 2644457903 | 2643221681 | Bacteria | 3707866 |
| 1173 | 2645722761 | 2643221961 | Bacteria | 3919167 |
| 1174 | 2645725733 | 2643221962 | Bacteria | 3874254 |
| 1175 | 2676484398 | 2675903059 | Bacteria | 8644972 |
| 1176 | 2738871536 | 2738541305 | Bacteria | 4910150 |
| 1177 | 2740166171 | 2739367898 | Bacteria | 4367674 |
| 1178 | 2774393490 | 2773857762 | Bacteria | 5971770 |
| 1179 | 2793977387 | 2791355406 | Bacteria | 11364898 |
| 1180 | 2808872498 | 2808606365 | Bacteria | 4301966 |
| 1181 | 2809195622 | 2808606439 | Bacteria | 5952208 |
| 1182 | 2812333542 | 2811994874 | Bacteria | 5367947 |
| 1183 | 2812350522 | 2811994878 | Bacteria | 5992952 |
| 1184 | 2819740200 | 2818991472 | Bacteria | 10089953 |
| 1185 | 2856744110 | 2856741275 | Bacteria | 8096094 |
| 1186 | 2862180851 | 2862178590 | Bacteria | 8583590 |
| 1187 | 2862575526 | 2862574272 | Bacteria | 10567477 |
| 1188 | 2891403566 | 2891395885 | Bacteria | 9251614 |
| 1189 | 2891564343 | 2891562705 | Bacteria | 8039471 |
| 1190 | 2891971876 | 2891968417 | Bacteria | 5821697 |
| 1191 | 2912762398 | 2912757875 | Bacteria | 7940295 |
| 1192 | 2984579090 | 2984576629 | Bacteria | 4248407 |
| 1193 | 2990260016 | 2990256926 | Bacteria | 4252839 |
| 1194 | 2995464865 | 2995463766 | Bacteria | 8577691 |
| 1195 | 8003315206 | 8003314358 | Bacteria | 10575343 |
| 1196 | 8025536874 | 8025530807 | Bacteria | 8495698 |
| 1197 | 8047716709 | 8047710418 | Bacteria | 11023148 |
| 1198 | 8047903554 | 8047893842 | Bacteria | 11723082 |
| 1199 | 8048356813 | 8048356638 | Bacteria | 11044339 |
| 1200 | 8048379008 | 8048369669 | Bacteria | 11666822 |
| 1201 | 8048388113 | 8048379754 | Bacteria | 11877923 |
| 1202 | 8054610045 | 8054609563 | Bacteria | 5170090 |
| 1203 | 8055174723 | 8055172936 | Bacteria | 9305943 |
| 1204 | Ga0070709_10077157 | |||
| 1205 | JGI24739J22299_10074272 | |||
| 1206 | JGI24743J22301_10009419 | |||
| 1207 | JGI24738J21930_10005489 | |||
| 1208 | JGI25404J52841_10010555 | |||
| 1209 | Ga0070658_10049656 | |||
| 1210 | Ga0070658_10164455 | |||
| 1211 | Ga0070683_100145261 | |||
| 1212 | Ga0070690_100158485 | |||
| 1213 | Ga0070690_100280803 | |||
| 1214 | Ga0070670_100027661 | |||
| 1215 | Ga0068869_100009064 | |||
| 1216 | Ga0068869_100013540 | |||
| 1217 | Ga0068869_100091214 | |||
| 1218 | Ga0068869_100150784 | |||
| 1219 | Ga0070666_10043691 | |||
| 1220 | Ga0070666_10107835 | |||
| 1221 | Ga0070680_100025795 | |||
| 1222 | Ga0070680_100039708 | |||
| 1223 | Ga0070682_100011309 | |||
| 1224 | Ga0070682_100158280 | |||
| 1225 | Ga0070682_100219967 | |||
| 1226 | Ga0070682_100308236 | |||
| 1227 | Ga0068868_100001738 | |||
| 1228 | Ga0068868_100116560 | |||
| 1229 | Ga0070660_100017931 | |||
| 1230 | Ga0070660_100103162 | |||
| 1231 | Ga0070689_100061491 | |||
| 1232 | Ga0070691_10003832 | |||
| 1233 | Ga0070687_100012858 | |||
| 1234 | Ga0070687_100017559 | |||
| 1235 | Ga0070661_100004959 | |||
| 1236 | Ga0070661_100039922 | |||
| 1237 | Ga0070692_10004181 | |||
| 1238 | Ga0070692_10046146 | |||
| 1239 | Ga0070692_10062498 | |||
| 1240 | Ga0070692_10168752 | |||
| 1241 | Ga0070668_100127331 | |||
| 1242 | Ga0070675_100006254 | |||
| 1243 | Ga0070675_100012160 | |||
| 1244 | Ga0070671_100012625 | |||
| 1245 | Ga0070671_100224350 | |||
| 1246 | Ga0070673_100197398 | |||
| 1247 | Ga0070688_100208277 | |||
| 1248 | Ga0070659_100045613 | |||
| 1249 | Ga0070659_100049396 | |||
| 1250 | Ga0070659_100117742 | |||
| 1251 | Ga0070659_100191879 | |||
| 1252 | Ga0070709_10001827 | |||
| 1253 | Ga0070709_10017307 | |||
| 1254 | Ga0070714_100000076 | |||
| 1255 | Ga0070714_100000630 | |||
| 1256 | Ga0070714_100016313 | |||
| 1257 | Ga0070714_100022645 | |||
| 1258 | Ga0070714_100026551 | |||
| 1259 | Ga0070714_100032567 | |||
| 1260 | Ga0070714_100071758 | |||
| 1261 | Ga0070714_100287565 | |||
| 1262 | Ga0070714_100290885 | |||
| 1263 | Ga0070713_100009273 | |||
| 1264 | Ga0070713_100052282 | |||
| 1265 | Ga0070713_100137108 | |||
| 1266 | Ga0070713_100191388 | |||
| 1267 | Ga0070713_100199361 | |||
| 1268 | Ga0070713_100212874 | |||
| 1269 | Ga0070713_100469101 | |||
| 1270 | Ga0070713_100664113 | |||
| 1271 | Ga0070710_10000145 | |||
| 1272 | Ga0070710_10003172 | |||
| 1273 | Ga0070710_10078199 | |||
| 1274 | Ga0070710_10090224 | |||
| 1275 | Ga0070701_10012256 | |||
| 1276 | Ga0070711_100235448 | |||
| 1277 | Ga0070711_100300878 | |||
| 1278 | Ga0070711_100389726 | |||
| 1279 | Ga0070705_100376474 | |||
| 1280 | Ga0070700_100031520 | |||
| 1281 | Ga0070700_100342360 | |||
| 1282 | Ga0070708_100036965 | |||
| 1283 | Ga0070708_100055285 | |||
| 1284 | Ga0070708_100298384 | |||
| 1285 | Ga0070663_100001480 | |||
| 1286 | Ga0070663_100005175 | |||
| 1287 | Ga0070663_100056286 | |||
| 1288 | Ga0070663_100062969 | |||
| 1289 | Ga0070678_100002453 | |||
| 1290 | Ga0070678_100131008 | |||
| 1291 | Ga0070678_100229817 | |||
| 1292 | Ga0070662_100005331 | |||
| 1293 | Ga0070681_10007532 | |||
| 1294 | Ga0070681_10119510 | |||
| 1295 | Ga0068867_100178930 | |||
| 1296 | Ga0070685_10011347 | |||
| 1297 | Ga0070685_10231373 | |||
| 1298 | Ga0070706_100000349 | |||
| 1299 | Ga0070706_100000813 | |||
| 1300 | Ga0070706_100002736 | |||
| 1301 | Ga0070706_100006549 | |||
| 1302 | Ga0070706_100037946 | |||
| 1303 | Ga0070706_100077404 | |||
| 1304 | Ga0070706_100087281 | |||
| 1305 | Ga0070707_100000381 | |||
| 1306 | Ga0070707_100000524 | |||
| 1307 | Ga0070707_100009405 | |||
| 1308 | Ga0070707_100040335 | |||
| 1309 | Ga0070707_100078480 | |||
| 1310 | Ga0070707_100129806 | |||
| 1311 | Ga0070707_100130763 | |||
| 1312 | Ga0070707_100212185 | |||
| 1313 | Ga0070698_100000951 | |||
| 1314 | Ga0070698_100001154 | |||
| 1315 | Ga0070698_100001699 | |||
| 1316 | Ga0070698_100003087 | |||
| 1317 | Ga0070698_100022634 | |||
| 1318 | Ga0070698_100031767 | |||
| 1319 | Ga0070698_100208451 | |||
| 1320 | Ga0070698_100239085 | |||
| 1321 | Ga0070698_100317030 | |||
| 1322 | Ga0070699_100006729 | |||
| 1323 | Ga0070679_100011412 | |||
| 1324 | Ga0070679_100092058 | |||
| 1325 | Ga0070679_100152529 | |||
| 1326 | Ga0070684_100059161 | |||
| 1327 | Ga0070684_100131961 | |||
| 1328 | Ga0070697_100000447 | |||
| 1329 | Ga0070697_100012490 | |||
| 1330 | Ga0070697_100043185 | |||
| 1331 | Ga0068853_100209106 | |||
| 1332 | Ga0070672_100060681 | |||
| 1333 | Ga0070672_100427122 | |||
| 1334 | Ga0070672_100448610 | |||
| 1335 | Ga0070686_100011554 | |||
| 1336 | Ga0070686_100202084 | |||
| 1337 | Ga0070695_100041487 | |||
| 1338 | Ga0070696_100026054 | |||
| 1339 | Ga0070693_100025368 | |||
| 1340 | Ga0070693_100091402 | |||
| 1341 | Ga0070665_100120949 | |||
| 1342 | Ga0070665_100291786 | |||
| 1343 | Ga0070704_100060378 | |||
| 1344 | Ga0070704_100119718 | |||
| 1345 | Ga0068855_100162206 | |||
| 1346 | Ga0068855_100223669 | |||
| 1347 | Ga0070664_100043727 | |||
| 1348 | Ga0070664_100087969 | |||
| 1349 | Ga0070664_100194287 | |||
| 1350 | Ga0068857_100008010 | |||
| 1351 | Ga0068857_100011670 | |||
| 1352 | Ga0068857_100193668 | |||
| 1353 | Ga0068857_100258507 | |||
| 1354 | Ga0068854_100026349 | |||
| 1355 | Ga0068854_100034654 | |||
| 1356 | Ga0068856_100011106 | |||
| 1357 | Ga0068856_100135540 | |||
| 1358 | Ga0068856_100256307 | |||
| 1359 | Ga0068856_100427453 | |||
| 1360 | Ga0070702_100003036 | |||
| 1361 | Ga0068852_100066276 | |||
| 1362 | Ga0068852_100183518 | |||
| 1363 | Ga0068859_100034967 | |||
| 1364 | Ga0068859_100167028 | |||
| 1365 | Ga0068864_100003373 | |||
| 1366 | Ga0068864_100044849 | |||
| 1367 | Ga0068864_100276717 | |||
| 1368 | Ga0068861_100062872 | |||
| 1369 | Ga0068851_10014136 | |||
| 1370 | Ga0068870_10002608 | |||
| 1371 | Ga0068870_10015521 | |||
| 1372 | Ga0068863_100017352 | |||
| 1373 | Ga0068863_100115786 | |||
| 1374 | Ga0068863_100267039 | |||
| 1375 | Ga0068863_100360693 | |||
| 1376 | Ga0068858_100021460 | |||
| 1377 | Ga0068858_100071310 | |||
| 1378 | Ga0068858_100123031 | |||
| 1379 | Ga0068860_100396126 | |||
| 1380 | Ga0068862_100052069 | |||
| 1381 | Ga0068862_100154589 | |||
| 1382 | Ga0081455_10002124 | |||
| 1383 | Ga0081455_10094227 | |||
| 1384 | Ga0081540_1000582 | |||
| 1385 | Ga0081540_1000756 | |||
| 1386 | Ga0081539_10000127 | |||
| 1387 | Ga0081539_10005011 | |||
| 1388 | Ga0081539_10027065 | |||
| 1389 | Ga0070717_10003556 | |||
| 1390 | Ga0070717_10029458 | |||
| 1391 | Ga0070717_10032114 | |||
| 1392 | Ga0070717_10033576 | |||
| 1393 | Ga0070717_10038774 | |||
| 1394 | Ga0070717_10043560 | |||
| 1395 | Ga0070717_10067857 | |||
| 1396 | Ga0070717_10119033 | |||
| 1397 | Ga0070717_10127904 | |||
| 1398 | Ga0070717_10186750 | |||
| 1399 | Ga0075363_100107153 | |||
| 1400 | Ga0075364_10044399 | |||
| 1401 | Ga0075364_10114395 | |||
| 1402 | Ga0075364_10253218 | |||
| 1403 | Ga0075432_10102543 | |||
| 1404 | Ga0070715_10004309 | |||
| 1405 | Ga0070715_10040652 | |||
| 1406 | Ga0070715_10128455 | |||
| 1407 | Ga0070716_100000508 | |||
| 1408 | Ga0070716_100007882 | |||
| 1409 | Ga0070716_100015589 | |||
| 1410 | Ga0070716_100044320 | |||
| 1411 | Ga0070716_100080295 | |||
| 1412 | Ga0070712_100005372 | |||
| 1413 | Ga0070712_100009334 | |||
| 1414 | Ga0070712_100029059 | |||
| 1415 | Ga0070712_100045417 | |||
| 1416 | Ga0070712_100056408 | |||
| 1417 | Ga0075369_10036161 | |||
| 1418 | Ga0097621_100079576 | |||
| 1419 | Ga0097621_100276555 | |||
| 1420 | Ga0068871_100027412 | |||
| 1421 | Ga0068871_100056948 | |||
| 1422 | Ga0075428_100177928 | |||
| 1423 | Ga0075428_100601023 | |||
| 1424 | Ga0075430_100280130 | |||
| 1425 | Ga0075431_100407153 | |||
| 1426 | Ga0075433_10051187 | |||
| 1427 | Ga0075433_10336727 | |||
| 1428 | Ga0075433_10361918 | |||
| 1429 | Ga0075433_10409791 | |||
| 1430 | Ga0075434_100032233 | |||
| 1431 | Ga0075434_100033506 | |||
| 1432 | Ga0075434_100039315 | |||
| 1433 | Ga0068865_100039011 | |||
| 1434 | Ga0068865_100041107 | |||
| 1435 | Ga0075436_100064740 | |||
| 1436 | Ga0075436_100066572 | |||
| 1437 | Ga0075436_100169009 | |||
| 1438 | Ga0097620_100034967 | |||
| 1439 | Ga0097620_100167031 | |||
| 1440 | Ga0075435_100008746 | |||
| 1441 | Ga0075435_100037863 | |||
| 1442 | Ga0075435_100061836 | |||
| 1443 | Ga0105240_10190377 | |||
| 1444 | Ga0111539_10002633 | |||
| 1445 | Ga0111539_10034507 | |||
| 1446 | Ga0111539_10124766 | |||
| 1447 | Ga0105245_10025589 | |||
| 1448 | Ga0105245_10075578 | |||
| 1449 | Ga0114129_10210261 | |||
| 1450 | Ga0114129_10537231 | |||
| 1451 | Ga0114129_11016986 | |||
| 1452 | Ga0105243_10012670 | |||
| 1453 | Ga0105243_10090047 | |||
| 1454 | Ga0105243_10538320 | |||
| 1455 | Ga0105241_10027438 | |||
| 1456 | Ga0105241_10079336 | |||
| 1457 | Ga0105241_10260942 | |||
| 1458 | Ga0105241_10433309 | |||
| 1459 | Ga0105242_10043614 | |||
| 1460 | Ga0105242_10162088 | |||
| 1461 | Ga0105242_10500030 | |||
| 1462 | Ga0105248_10064723 | |||
| 1463 | Ga0105248_10068285 | |||
| 1464 | Ga0105237_10225066 | |||
| 1465 | Ga0105238_10108005 | |||
| 1466 | Ga0105238_11106273 | |||
| 1467 | Ga0105249_10057141 | |||
| 1468 | Ga0105249_10128313 | |||
| 1469 | Ga0105239_10083549 | |||
| 1470 | Ga0105239_10222503 | |||
| 1471 | Ga0105246_10001046 | |||
| 1472 | Ga0105246_10074624 | |||
| 1473 | Ga0157335_1001533 | |||
| 1474 | Ga0157342_1000629 | |||
| 1475 | Ga0157373_10058350 | |||
| 1476 | Ga0157373_10090051 | |||
| 1477 | Ga0157371_10048553 | |||
| 1478 | Ga0157370_10040361 | |||
| 1479 | Ga0157370_10567634 | |||
| 1480 | Ga0157369_10030215 | |||
| 1481 | Ga0157369_10202544 | |||
| 1482 | Ga0157369_10350611 | |||
| 1483 | Ga0157369_10405716 | |||
| 1484 | Ga0157369_10774703 | |||
| 1485 | Ga0157374_10499685 | |||
| 1486 | Ga0157378_10143331 | |||
| 1487 | Ga0163162_10528450 | |||
| 1488 | Ga0157372_10024291 | |||
| 1489 | Ga0157372_10121581 | |||
| 1490 | Ga0157372_11017817 | |||
| 1491 | Ga0157375_10029871 | |||
| 1492 | Ga0157375_10188851 | |||
| 1493 | Ga0157375_10442072 | |||
| 1494 | Ga0157375_11211775 | |||
| 1495 | Ga0163163_10074068 | |||
| 1496 | Ga0163163_10094916 | |||
| 1497 | Ga0163163_10602639 | |||
| 1498 | Ga0157380_10015485 | |||
| 1499 | Ga0157377_10006040 | |||
| 1500 | Ga0157379_10149162 | |||
| 1501 | Ga0157379_10254059 | |||
| 1502 | Ga0157376_10374968 | |||
| 1503 | Ga0163161_10085542 | |||
| 1504 | Ga0163161_10134516 | |||
| 1505 | Ga0163161_10135521 | |||
| 1506 | Ga0163161_10148532 | |||
| 1507 | Ga0197907_10318288 | |||
| 1508 | Ga0197907_10356126 | |||
| 1509 | Ga0197907_10384303 | |||
| 1510 | Ga0197907_10894406 | |||
| 1511 | Ga0206356_10117693 | |||
| 1512 | Ga0206356_10553711 | |||
| 1513 | Ga0206356_10775408 | |||
| 1514 | Ga0206356_11454669 | |||
| 1515 | Ga0206356_11642507 | |||
| 1516 | Ga0206356_11751201 | |||
| 1517 | Ga0206355_1415136 | |||
| 1518 | Ga0206351_10402913 | |||
| 1519 | Ga0206352_10662284 | |||
| 1520 | Ga0206350_10015471 | |||
| 1521 | Ga0206350_10483273 | |||
| 1522 | Ga0206354_11233094 | |||
| 1523 | Ga0206353_10337382 | |||
| 1524 | Ga0206353_10983463 | |||
| 1525 | Ga0206353_11024964 | |||
| 1526 | Ga0213876_10023166 | |||
| 1527 | Ga0213875_10000656 | |||
| 1528 | Ga0213875_10002258 | |||
| 1529 | Ga0213875_10004419 | |||
| 1530 | Ga0213875_10012191 | |||
| 1531 | Ga0213875_10013455 | |||
| 1532 | Ga0224712_10010732 | |||
| 1533 | Ga0224712_10025009 | |||
| 1534 | Ga0224712_10056531 | |||
| 1535 | Ga0224712_10063647 | |||
| 1536 | Ga0224572_1000926 | |||
| 1537 | Ga0224572_1004645 | |||
| 1538 | Ga0207426_1013882 | |||
| 1539 | Ga0207692_10014656 | |||
| 1540 | Ga0207692_10023748 | |||
| 1541 | Ga0207692_10030089 | |||
| 1542 | Ga0207692_10074661 | |||
| 1543 | Ga0207692_10076608 | |||
| 1544 | Ga0207692_10095492 | |||
| 1545 | Ga0207692_10298567 | |||
| 1546 | Ga0207642_10029802 | |||
| 1547 | Ga0207642_10035497 | |||
| 1548 | Ga0207688_10005687 | |||
| 1549 | Ga0207688_10006105 | |||
| 1550 | Ga0207688_10022025 | |||
| 1551 | Ga0207688_10057212 | |||
| 1552 | Ga0207647_10068591 | |||
| 1553 | Ga0207647_10149445 | |||
| 1554 | Ga0207685_10001217 | |||
| 1555 | Ga0207685_10020818 | |||
| 1556 | Ga0207699_10001589 | |||
| 1557 | Ga0207699_10012585 | |||
| 1558 | Ga0207699_10015976 | |||
| 1559 | Ga0207699_10036378 | |||
| 1560 | Ga0207699_10082702 | |||
| 1561 | Ga0207643_10000215 | |||
| 1562 | Ga0207705_10007059 | |||
| 1563 | Ga0207705_10193033 | |||
| 1564 | Ga0207684_10001715 | |||
| 1565 | Ga0207684_10002461 | |||
| 1566 | Ga0207684_10005381 | |||
| 1567 | Ga0207684_10014889 | |||
| 1568 | Ga0207684_10016382 | |||
| 1569 | Ga0207684_10029210 | |||
| 1570 | Ga0207684_10063319 | |||
| 1571 | Ga0207684_10134284 | |||
| 1572 | Ga0207684_10604994 | |||
| 1573 | Ga0207654_10033839 | |||
| 1574 | Ga0207707_10004913 | |||
| 1575 | Ga0207707_10044829 | |||
| 1576 | Ga0207707_10072011 | |||
| 1577 | Ga0207671_10072231 | |||
| 1578 | Ga0207693_10009380 | |||
| 1579 | Ga0207693_10012263 | |||
| 1580 | Ga0207693_10039473 | |||
| 1581 | Ga0207663_10003579 | |||
| 1582 | Ga0207663_10018255 | |||
| 1583 | Ga0207663_10054027 | |||
| 1584 | Ga0207663_10058432 | |||
| 1585 | Ga0207663_10144519 | |||
| 1586 | Ga0207663_10156392 | |||
| 1587 | Ga0207663_10522975 | |||
| 1588 | Ga0207660_10002966 | |||
| 1589 | Ga0207660_10007062 | |||
| 1590 | Ga0207660_10638051 | |||
| 1591 | Ga0207662_10003307 | |||
| 1592 | Ga0207657_10002090 | |||
| 1593 | Ga0207657_10059138 | |||
| 1594 | Ga0207657_10126874 | |||
| 1595 | Ga0207649_10009551 | |||
| 1596 | Ga0207649_10034467 | |||
| 1597 | Ga0207649_10139205 | |||
| 1598 | Ga0207652_10000592 | |||
| 1599 | Ga0207652_10009921 | |||
| 1600 | Ga0207652_10082676 | |||
| 1601 | Ga0207646_10000065 | |||
| 1602 | Ga0207646_10001312 | |||
| 1603 | Ga0207646_10017053 | |||
| 1604 | Ga0207646_10032398 | |||
| 1605 | Ga0207646_10090348 | |||
| 1606 | Ga0207646_10158032 | |||
| 1607 | Ga0207681_10418708 | |||
| 1608 | Ga0207694_10252193 | |||
| 1609 | Ga0207650_10002455 | |||
| 1610 | Ga0207650_10217403 | |||
| 1611 | Ga0207659_10004667 | |||
| 1612 | Ga0207687_10003055 | |||
| 1613 | Ga0207687_10063389 | |||
| 1614 | Ga0207687_10091074 | |||
| 1615 | Ga0207687_10132506 | |||
| 1616 | Ga0207687_10466323 | |||
| 1617 | Ga0207700_10000218 | |||
| 1618 | Ga0207700_10000229 | |||
| 1619 | Ga0207700_10031067 | |||
| 1620 | Ga0207700_10039433 | |||
| 1621 | Ga0207700_10116457 | |||
| 1622 | Ga0207700_10119665 | |||
| 1623 | Ga0207700_10167917 | |||
| 1624 | Ga0207700_10265128 | |||
| 1625 | Ga0207664_10000588 | |||
| 1626 | Ga0207664_10011479 | |||
| 1627 | Ga0207664_10019149 | |||
| 1628 | Ga0207664_10024584 | |||
| 1629 | Ga0207664_10029877 | |||
| 1630 | Ga0207664_10101334 | |||
| 1631 | Ga0207664_10104036 | |||
| 1632 | Ga0207664_10169210 | |||
| 1633 | Ga0207664_10171012 | |||
| 1634 | Ga0207664_10213200 | |||
| 1635 | Ga0207664_10473025 | |||
| 1636 | Ga0207644_10024769 | |||
| 1637 | Ga0207690_10033467 | |||
| 1638 | Ga0207706_10013237 | |||
| 1639 | Ga0207706_10140752 | |||
| 1640 | Ga0207706_10283673 | |||
| 1641 | Ga0207686_10246526 | |||
| 1642 | Ga0207709_10009672 | |||
| 1643 | Ga0207709_10076383 | |||
| 1644 | Ga0207709_10079764 | |||
| 1645 | Ga0207670_10146039 | |||
| 1646 | Ga0207670_10177881 | |||
| 1647 | Ga0207665_10000193 | |||
| 1648 | Ga0207665_10000369 | |||
| 1649 | Ga0207665_10006989 | |||
| 1650 | Ga0207665_10024374 | |||
| 1651 | Ga0207665_10062983 | |||
| 1652 | Ga0207691_10004250 | |||
| 1653 | Ga0207691_10224727 | |||
| 1654 | Ga0207691_10535967 | |||
| 1655 | Ga0207711_10061229 | |||
| 1656 | Ga0207711_10076178 | |||
| 1657 | Ga0207711_10104209 | |||
| 1658 | Ga0207689_10001149 | |||
| 1659 | Ga0207689_10005138 | |||
| 1660 | Ga0207689_10018067 | |||
| 1661 | Ga0207661_10012466 | |||
| 1662 | Ga0207661_10042117 | |||
| 1663 | Ga0207661_10105958 | |||
| 1664 | Ga0207679_10019362 | |||
| 1665 | Ga0207679_10053069 | |||
| 1666 | Ga0207679_10261105 | |||
| 1667 | Ga0207667_10167467 | |||
| 1668 | Ga0207667_10269652 | |||
| 1669 | Ga0207712_10306895 | |||
| 1670 | Ga0207668_10074135 | |||
| 1671 | Ga0207640_10008388 | |||
| 1672 | Ga0207640_10095164 | |||
| 1673 | Ga0207658_10053817 | |||
| 1674 | Ga0207677_10002476 | |||
| 1675 | Ga0207677_10026127 | |||
| 1676 | Ga0207677_10052799 | |||
| 1677 | Ga0207703_10486739 | |||
| 1678 | Ga0207639_10027269 | |||
| 1679 | Ga0207639_10074960 | |||
| 1680 | Ga0207678_10000552 | |||
| 1681 | Ga0207678_10001019 | |||
| 1682 | Ga0207678_10001856 | |||
| 1683 | Ga0207678_10008054 | |||
| 1684 | Ga0207678_10015961 | |||
| 1685 | Ga0207708_10000933 | |||
| 1686 | Ga0207708_10019775 | |||
| 1687 | Ga0207708_10039703 | |||
| 1688 | Ga0207702_10002139 | |||
| 1689 | Ga0207702_10062383 | |||
| 1690 | Ga0207702_10181168 | |||
| 1691 | Ga0207641_10004861 | |||
| 1692 | Ga0207641_10118081 | |||
| 1693 | Ga0207641_10417272 | |||
| 1694 | Ga0207648_10092525 | |||
| 1695 | Ga0207648_10173093 | |||
| 1696 | Ga0207676_10003268 | |||
| 1697 | Ga0207674_10008373 | |||
| 1698 | Ga0207674_10028803 | |||
| 1699 | Ga0207674_10158695 | |||
| 1700 | Ga0207675_100014732 | |||
| 1701 | Ga0207675_100019992 | |||
| 1702 | Ga0207675_100084010 | |||
| 1703 | Ga0207683_10001755 | |||
| 1704 | Ga0207683_10010244 | |||
| 1705 | Ga0207698_10011353 | |||
| 1706 | Ga0207698_10016262 | |||
| 1707 | Ga0207428_10009874 | |||
| 1708 | Ga0207428_10079370 | |||
| 1709 | Ga0207428_10321299 | |||
| 1710 | Ga0268266_10055062 | |||
| 1711 | Ga0268265_10056558 | |||
| 1712 | Ga0268264_10112285 | |||
| 1713 | Ga0265337_1055019 | |||
| 1714 | Ga0307517_10002916 | |||
| 1715 | Ga0307515_10000845 | |||
| 1716 | Ga0265338_10004550 | |||
| 1717 | Ga0307511_10011641 | |||
| 1718 | Ga0307512_10030128 | |||
| 1719 | Ga0307509_10019979 | |||
| 1720 | Ga0307509_10037358 | |||
| 1721 | Ga0316575_10016337 | |||
| 1722 | Ga0316579_10155949 | |||
| 1723 | Ga0316576_10011912 | |||
| 1724 | Ga0316576_10066587 | |||
| 1725 | Ga0316576_10561176 | |||
| 1726 | Ga0316578_10006497 | |||
| 1727 | Ga0307516_10070070 | |||
| 1728 | Ga0316577_10035835 | |||
| 1729 | Ga0307413_10071265 | |||
| 1730 | Ga0307406_10057429 | |||
| 1731 | Ga0307409_100230441 | |||
| 1732 | Ga0307409_100367610 | |||
| 1733 | Ga0307409_100536642 | |||
| 1734 | Ga0307416_100074745 | |||
| 1735 | Ga0307411_10018902 | |||
| 1736 | Ga0307415_100105409 | |||
| 1737 | Ga0307415_100421941 | |||
| 1738 | Ga0307507_10039437 | |||
| 1739 | Ga0307507_10070361 | |||
| 1740 | Ga0307510_10019969 | |||
| 1741 | Ga0307510_10097383 | |||
| 1742 | Ga0316214_1008262 | |||
| 1743 | Ga0373930_0012825 | |||
| 1744 | Ga0373948_0018076 | |||
| 1745 | Ga0373926_0007030 | |||
| 1746 | Ga0373926_0021076 | |||
| 1747 | Ga0373929_0007087 | |||
| 1748 | Ga0373934_0000101 | |||
| 1749 | Ga0373934_0011618 | |||
| 1750 | Ga0373934_0032649 | |||
| 1751 | Ga0373934_0057862 | |||
| 1752 | Ga0373940_0058157 | |||
| 1753 | Ga0373944_0087609 | |||
| 1754 | Ga0373949_0050395 | |||
| 1755 | Ga0373951_0031707 | |||
| 1756 | Ga0373952_0002235 | |||
| 1757 | Ga0373923_0000264 | |||
| 1758 | Ga0373923_0004102 | |||
| 1759 | Ga0373923_0012992 | |||
| 1760 | Ga0373923_0040994 | |||
| 1761 | Ga0373923_0107447 | |||
| 1762 | Ga0373932_0028776 | |||
| 1763 | Ga0373936_0000263 | |||
| 1764 | Ga0373936_0000384 | |||
| 1765 | Ga0373936_0002894 | |||
| 1766 | Ga0373936_0010005 | |||
| 1767 | Ga0373936_0096227 | |||
| 1768 | Ga0373936_0149842 | |||
| 1769 | Ga0373939_0003193 | |||
| 1770 | Ga0373945_0015076 | |||
| 1771 | Ga0373945_0042604 | |||
| 1772 | Ga0373953_0010608 | |||
| 1773 | Ga0373953_0011778 | |||
| 1774 | Ga0373953_0044095 | |||
| 1775 | Ga0373954_0004360 | |||
| 1776 | Ga0373954_0008629 | |||
| 1777 | Ga0373956_0000095 | |||
| 1778 | Ga0373956_0018884 | |||
| 1779 | Ga0373956_0020931 | |||
| 1780 | Ga0373956_0043741 | |||
| 1781 | Ga0373956_0057897 | |||
| 1782 | Ga0373956_0088024 | |||
| 1783 | Ga0373957_0000385 | |||
| 1784 | Ga0373957_0004550 | |||
| 1785 | Ga0373957_0010447 | |||
| 1786 | Ga0373957_0017172 | |||
| 1787 | Ga0373957_0022949 | |||
| 1788 | Ga0373957_0035148 | |||
| 1789 | Ga0373957_0045166 | |||
| 1790 | Ga0373957_0047249 | |||
| 1791 | Ga0373957_0061095 | |||
| 1792 | Ga0373957_0146542 | |||
| 1793 | Ga0373960_0017543 | |||
| 1794 | Ga0373943_0012651 | |||
| 1795 | Ga0373943_0036928 | |||
| 1796 | Ga0373943_0053670 | |||
| 1797 | Ga0373946_0020376 | |||
| 1798 | Ga0373955_0000002 | |||
| 1799 | Ga0373955_0023875 | |||
| 1800 | Ga0373955_0044502 | |||
| 1801 | Ga0373955_0131947 | |||
| 1802 | Ga0373942_0046116 | |||
| 1803 | Ga0373961_0064848 | |||
| 1804 | Ga0373962_0052983 | |||
| 1805 | Ga0316574_0016125 | |||
| 1806 | Ga0316574_0094095 | |||
| 1807 | Ga0373924_0000306 | |||
| 1808 | Ga0373924_0038851 | |||
| 1809 | Ga0373924_0058257 | |||
| 1810 | Ga0373924_0105579 | |||
| 1811 | Ga0373931_0123617 | |||
| 1812 | Ga0373931_0175364 | |||
| 1813 | Ga0373935_0017898 | |||
| 1814 | Ga0373935_0018974 | |||
| 1815 | Ga0373935_0031984 | |||
| 1816 | Ga0373935_0040003 | |||
| 1817 | Ga0373935_0286166 | |||
| 1818 | Ga0373927_0007355 | |||
| 1819 | Ga0373927_0331696 | |||
| 1820 | Ga0373933_0000029 | |||
| 1821 | Ga0373933_0001380 | |||
| 1822 | Ga0373933_0007481 | |||
| 1823 | Ga0373933_0069586 | |||
| 1824 | Ga0373933_0072990 | |||
| 1825 | Ga0373947_0002205 | |||
| 1826 | Ga0373947_0002535 | |||
| 1827 | Ga0373947_0084273 | |||
| 1828 | Ga0373947_0257306 | |||
| 1829 | Ga0373947_0304046 | |||
| 1830 | Ga0373937_0000362 | |||
| 1831 | Ga0373937_0005208 | |||
| 1832 | Ga0373937_0047429 | |||
| 1833 | Ga0373937_0078610 | |||
| 1834 | Ga0373937_0149356 | |||
| 1835 | Ga0373937_0225208 | |||
| 1836 | Ga0373937_0240902 | |||
| 1837 | Ga0373937_0252516 | |||
| 1838 | Ga0372808_020110 | |||
| 1839 | Ga0316584_0082537 | |||
| 1840 | Ga0373925_0000665 | |||
| 1841 | Ga0373925_0001448 | |||
| 1842 | Ga0373925_0002171 | |||
| 1843 | Ga0373925_0031217 | |||
| 1844 | Ga0373925_0160648 | |||
| 1845 | Ga0373925_0392959 | |||
| 1846 | Ga0373925_0466080 | |||
| 1847 | Ga0395900_0242541 | |||
| 1848 | Ga0395898_0079991 | |||
| 1849 | Ga0395898_0581592 | |||
| 1850 | Ga0395905_0228580 | |||
| 1851 | Ga0395905_0447910 | |||
| 1852 | Ga0316581_0137974 | |||
| 1853 | Ga0436364_0239700 | |||
| 1854 | Ga0436364_0455895 | |||
| 1855 | Ga0436364_0490334 | |||
| 1856 | Ga0436364_0954826 | |||
| 1857 | Ga0436364_0991115 | |||
| 1858 | Ga0436364_1135490 | |||
| 1859 | Ga0436364_1474170 | |||
| 1860 | Ga0436364_1492889 | |||
| 1861 | Ga0436364_1502084 | |||
| 1862 | Ga0436364_1513813 | |||
| 1863 | Ga0395901_0070186 | |||
| 1864 | Ga0395901_0295380 | |||
| 1865 | Ga0436365_0258162 | |||
| 1866 | Ga0436365_1661196 | |||
| 1867 | Ga0436365_1740178 | |||
| 1868 | Ga0436360_0834923 | |||
| 1869 | Ga0436363_0595625 | |||
| 1870 | Ga0436362_0237089 | |||
| 1871 | Ga0436362_0906744 | |||
| 1872 | Ga0439436_0074006 | |||
| 1873 | Ga0451798_0680473 | |||
| 1874 | Ga0451833_1164257 | |||
| 1875 | Ga0451837_0007545 | |||
| 1876 | Ga0451837_1389347 | |||
| 1877 | Ga0439449_0011013 | |||
| 1878 | Ga0466972_0008486 | |||
| 1879 | Ga0466972_0034884 | |||
| 1880 | Ga0466966_0113849 | |||
| 1881 | Ga0466966_0229156 | |||
| 1882 | Ga0466961_0044052 | |||
| 1883 | Ga0466961_0063845 | |||
| 1884 | Ga0466961_0346158 | |||
| 1885 | Ga0466963_0013348 | |||
| 1886 | Ga0466963_0040371 | |||
| 1887 | Ga0466963_0075628 | |||
| 1888 | Ga0466963_0229704 | |||
| 1889 | Ga0466964_0047312 | |||
| 1890 | Ga0466964_0254458 | |||
| 1891 | Ga0466971_0061573 | |||
| 1892 | Ga0466970_0006118 | |||
| 1893 | Ga0466970_0023818 | |||
| 1894 | Ga0466957_0002812 | |||
| 1895 | Ga0466957_0013330 | |||
| 1896 | Ga0466957_0251442 | |||
| 1897 | Ga0466959_0147079 | |||
| 1898 | Ga0466959_0223344 | |||
| 1899 | Ga0466958_0033367 | |||
| 1900 | Ga0466967_0021746 | |||
| 1901 | Ga0466967_0047375 | |||
| 1902 | Ga0466967_0211850 | |||
| 1903 | Ga0466967_0426560 | |||
| 1904 | Ga0495592_0000043 | |||
| 1905 | Ga0495592_0058605 | |||
| 1906 | Ga0495592_0097635 | |||
| 1907 | Ga0495592_0099233 | |||
| 1908 | Ga0495603_0000448 | |||
| 1909 | Ga0495629_0000931 | |||
| 1910 | Ga0495629_0004500 | |||
| 1911 | Ga0495629_0004652 | |||
| 1912 | Ga0495629_0012207 | |||
| 1913 | Ga0495629_0044660 | |||
| 1914 | Ga0495629_0081521 | |||
| 1915 | Ga0495629_0096002 | |||
| 1916 | Ga0495638_0012389 | |||
| 1917 | Ga0495641_0002833 | |||
| 1918 | Ga0495641_0004385 | |||
| 1919 | Ga0495641_0008639 | |||
| 1920 | Ga0495641_0036412 | |||
| 1921 | Ga0495651_0000135 | |||
| 1922 | Ga0495651_0000966 | |||
| 1923 | Ga0495651_0002221 | |||
| 1924 | Ga0495651_0008526 | |||
| 1925 | Ga0495651_0062476 | |||
| 1926 | Ga0495651_0074089 | |||
| 1927 | Ga0495653_0004969 | |||
| 1928 | Ga0495653_0016838 | |||
| 1929 | Ga0495653_0018600 | |||
| 1930 | Ga0495653_0033692 | |||
| 1931 | Ga0495653_0040287 | |||
| 1932 | Ga0495653_0162540 | |||
| 1933 | Ga0495653_0203840 | |||
| 1934 | Ga0495653_0279244 | |||
| 1935 | Ga0495653_0435284 | |||
| 1936 | Ga0495580_0009782 | |||
| 1937 | Ga0495580_0061619 | |||
| 1938 | Ga0495582_0002660 | |||
| 1939 | Ga0495582_0005191 | |||
| 1940 | Ga0495582_0037012 | |||
| 1941 | Ga0495582_0104284 | |||
| 1942 | Ga0495639_0000703 | |||
| 1943 | Ga0495662_0004713 | |||
| 1944 | Ga0495662_0005311 | |||
| 1945 | Ga0495662_0013949 | |||
| 1946 | Ga0495662_0019432 | |||
| 1947 | Ga0495664_0003738 | |||
| 1948 | Ga0495664_0031476 | |||
| 1949 | Ga0495664_0081001 | |||
| 1950 | Ga0495594_0079930 | |||
| 1951 | Ga0495608_0000016 | |||
| 1952 | Ga0495608_0004214 | |||
| 1953 | Ga0495608_0007788 | |||
| 1954 | Ga0495608_0012724 | |||
| 1955 | Ga0495608_0023485 | |||
| 1956 | Ga0495608_0033389 | |||
| 1957 | Ga0495608_0070195 | |||
| 1958 | Ga0495608_0101783 | |||
| 1959 | Ga0495618_0004534 | |||
| 1960 | Ga0495618_0049436 | |||
| 1961 | Ga0495618_0086487 | |||
| 1962 | Ga0495628_0000034 | |||
| 1963 | Ga0495628_0068789 | |||
| 1964 | Ga0495628_0101714 | |||
| 1965 | Ga0495628_0108285 | |||
| 1966 | Ga0495628_0169026 | |||
| 1967 | Ga0495630_0004529 | |||
| 1968 | Ga0495630_0056328 | |||
| 1969 | Ga0495630_0075412 | |||
| 1970 | Ga0495630_0222639 | |||
| 1971 | Ga0495630_0273858 | |||
| 1972 | Ga0495630_0474923 | |||
| 1973 | Ga0495652_0000174 | |||
| 1974 | Ga0495652_0004293 | |||
| 1975 | Ga0495652_0066976 | |||
| 1976 | Ga0495652_0081786 | |||
| 1977 | Ga0495652_0087805 | |||
| 1978 | Ga0495652_0131273 | |||
| 1979 | Ga0495652_0139783 | |||
| 1980 | Ga0495652_0145591 | |||
| 1981 | Ga0495665_0003719 | |||
| 1982 | Ga0495665_0004882 | |||
| 1983 | Ga0495665_0086288 | |||
| 1984 | Ga0495640_0007019 | |||
| 1985 | Ga0495640_0084868 | |||
| 1986 | Ga0495640_0112416 | |||
| 1987 | Ga0495640_0155559 | |||
| 1988 | Ga0495640_0194386 | |||
| 1989 | Ga0495640_0212207 | |||
| 1990 | Ga0495640_0303809 | |||
| 1991 | Ga0495586_0003326 | |||
| 1992 | Ga0495586_0012499 | |||
| 1993 | Ga0495586_0184986 | |||
| 1994 | Ga0495587_0000044 | |||
| 1995 | Ga0495587_0005394 | |||
| 1996 | Ga0495587_0016948 | |||
| 1997 | Ga0495587_0027227 | |||
| 1998 | Ga0495587_0199888 | |||
| 1999 | Ga0495645_0022548 | |||
| 2000 | Ga0495645_0030241 | |||
| 2001 | Ga0495645_0034926 | |||
| 2002 | Ga0495645_0037566 | |||
| 2003 | Ga0495645_0051963 | |||
| 2004 | Ga0495645_0375636 | |||
| 2005 | Ga0495622_0094570 | |||
| 2006 | Ga0495667_0000052 | |||
| 2007 | Ga0495667_0001554 | |||
| 2008 | Ga0495667_0003726 | |||
| 2009 | Ga0495667_0007717 | |||
| 2010 | Ga0495667_0015859 | |||
| 2011 | Ga0495667_0017126 | |||
| 2012 | Ga0495667_0027228 | |||
| 2013 | Ga0495667_0066992 | |||
| 2014 | Ga0495667_0112369 | |||
| 2015 | Ga0495667_0259858 | |||
| 2016 | Ga0495634_0002898 | |||
| 2017 | Ga0495634_0018001 | |||
| 2018 | Ga0495634_0056891 | |||
| 2019 | Ga0495634_0141921 | |||
| 2020 | Ga0495625_0026086 | |||
| 2021 | Ga0495635_0000862 | |||
| 2022 | Ga0495635_0011411 | |||
| 2023 | Ga0495635_0030524 | |||
| 2024 | Ga0495635_0039128 | |||
| 2025 | Ga0495635_0072092 | |||
| 2026 | Ga0495635_0088831 | |||
| 2027 | Ga0495635_0136665 | |||
| 2028 | Ga0495635_0203960 | |||
| 2029 | Ga0495635_0257941 | |||
| 2030 | Ga0495635_0294465 | |||
| 2031 | Ga0495588_0001192 | |||
| 2032 | Ga0495588_0043863 | |||
| 2033 | Ga0495588_0191399 | |||
| 2034 | Ga0495657_0000015 | |||
| 2035 | Ga0495657_0003936 | |||
| 2036 | Ga0495657_0009695 | |||
| 2037 | Ga0495657_0011699 | |||
| 2038 | Ga0495657_0013105 | |||
| 2039 | Ga0495657_0015891 | |||
| 2040 | Ga0495657_0015957 | |||
| 2041 | Ga0495657_0045712 | |||
| 2042 | Ga0495657_0048506 | |||
| 2043 | Ga0495657_0178971 | |||
| 2044 | Ga0495599_0000035 | |||
| 2045 | Ga0495599_0009512 | |||
| 2046 | Ga0495599_0121628 | |||
| 2047 | Ga0495599_0180222 | |||
| 2048 | Ga0495599_0205821 | |||
| 2049 | Ga0495623_0000767 | |||
| 2050 | Ga0495623_0043441 | |||
| 2051 | Ga0495623_0065142 | |||
| 2052 | Ga0495623_0084647 | |||
| 2053 | Ga0495623_0204589 | |||
| 2054 | Ga0495623_0274394 | |||
| 2055 | Ga0495646_0002176 | |||
| 2056 | Ga0495646_0022208 | |||
| 2057 | Ga0495646_0053352 | |||
| 2058 | Ga0495646_0062723 | |||
| 2059 | Ga0495646_0122185 | |||
| 2060 | Ga0495646_0142203 | |||
| 2061 | Ga0495658_0004230 | |||
| 2062 | Ga0495658_0014284 | |||
| 2063 | Ga0495658_0209385 | |||
| 2064 | Ga0495613_0040458 | |||
| 2065 | Ga0495613_0063510 | |||
| 2066 | Ga0495613_0082889 | |||
| 2067 | Ga0495613_0166203 | |||
| 2068 | Ga0495613_0315677 | |||
| 2069 | Ga0495624_0012749 | |||
| 2070 | Ga0495624_0021323 | |||
| 2071 | Ga0495624_0093165 | |||
| 2072 | Ga0495670_0077873 | |||
| 2073 | Ga0495671_0006448 | |||
| 2074 | Ga0495589_0005208 | |||
| 2075 | Ga0495600_0004974 | |||
| 2076 | Ga0495600_0007374 | |||
| 2077 | Ga0495600_0048924 | |||
| 2078 | Ga0495600_0072957 | |||
| 2079 | Ga0495600_0111800 | |||
| 2080 | Ga0495600_0128487 | |||
| 2081 | Ga0495600_0163282 | |||
| 2082 | Ga0495581_0003852 | |||
| 2083 | Ga0495581_0035248 | |||
| 2084 | Ga0495581_0099794 | |||
| 2085 | Ga0495604_0000048 | |||
| 2086 | Ga0495604_0024556 | |||
| 2087 | Ga0495604_0030884 | |||
| 2088 | Ga0495604_0085167 | |||
| 2089 | Ga0495604_0098263 | |||
| 2090 | Ga0495604_0133042 | |||
| 2091 | Ga0495604_0260255 | |||
| 2092 | Ga0495674_0005311 | |||
| 2093 | Ga0495674_0013115 | |||
| 2094 | Ga0495674_0033330 | |||
| 2095 | Ga0495674_0072542 | |||
| 2096 | Ga0495674_0119404 | |||
| 2097 | Ga0495674_0162109 | |||
| 2098 | Ga0495674_0193690 | |||
| 2099 | Ga0495674_0248746 | |||
| 2100 | Ga0495676_0003200 | |||
| 2101 | Ga0495676_0030991 | |||
| 2102 | Ga0495676_0065365 | |||
| 2103 | Ga0495676_0075176 | |||
| 2104 | Ga0495676_0079253 | |||
| 2105 | Ga0495676_0127266 | |||
| 2106 | Ga0495676_0455862 | |||
| 2107 | Ga0495680_0000069 | |||
| 2108 | Ga0495680_0004112 | |||
| 2109 | Ga0495680_0010588 | |||
| 2110 | Ga0495680_0011817 | |||
| 2111 | Ga0495680_0022401 | |||
| 2112 | Ga0495680_0027484 | |||
| 2113 | Ga0495680_0028813 | |||
| 2114 | Ga0495680_0067563 | |||
| 2115 | Ga0495680_0109944 | |||
| 2116 | Ga0495680_0116408 | |||
| 2117 | Ga0495680_0172113 | |||
| 2118 | Ga0495680_0224195 | |||
| 2119 | Ga0495687_004640 | |||
| 2120 | Ga0495675_0000685 | |||
| 2121 | Ga0495675_0004478 | |||
| 2122 | Ga0495675_0016613 | |||
| 2123 | Ga0495675_0037710 | |||
| 2124 | Ga0495675_0143150 | |||
| 2125 | Ga0495675_0251588 | |||
| 2126 | Ga0495675_0275965 | |||
| 2127 | Ga0495681_0035320 | |||
| 2128 | Ga0495684_0003133 | |||
| 2129 | Ga0495684_0004619 | |||
| 2130 | Ga0495684_0007538 | |||
| 2131 | Ga0495684_0023007 | |||
| 2132 | Ga0495684_0025322 | |||
| 2133 | Ga0495684_0064696 | |||
| 2134 | Ga0495684_0084760 | |||
| 2135 | Ga0495593_0024245 | |||
| 2136 | Ga0495602_0001615 | |||
| 2137 | Ga0495602_0018075 | |||
| 2138 | Ga0495602_0026606 | |||
| 2139 | Ga0495602_0037844 | |||
| 2140 | Ga0495602_0038337 | |||
| 2141 | Ga0495602_0041369 | |||
| 2142 | Ga0495602_0072982 | |||
| 2143 | Ga0495602_0082140 | |||
| 2144 | Ga0495602_0147407 | |||
| 2145 | Ga0495602_0182705 | |||
| 2146 | Ga0495602_0350017 | |||
| 2147 | Ga0495614_0023127 | |||
| 2148 | Ga0496100_0008298 | |||
| 2149 | Ga0496100_0022571 | |||
| 2150 | Ga0496100_0039952 | |||
| 2151 | Ga0496100_0078985 | |||
| 2152 | Ga0496100_0140956 | |||
| 2153 | Ga0496100_0213672 | |||
| 2154 | Ga0496101_0020981 | |||
| 2155 | Ga0496101_0067646 | |||
| 2156 | Ga0496101_0124435 | |||
| 2157 | Ga0496101_0128848 | |||
| 2158 | Ga0496101_0129321 | |||
| 2159 | Ga0496101_0214425 | |||
| 2160 | Ga0496101_0228922 | |||
| 2161 | Ga0496102_0000929 | |||
| 2162 | Ga0496102_0058675 | |||
| 2163 | Ga0496102_0076872 | |||
| 2164 | Ga0496102_0091753 | |||
| 2165 | Ga0496102_0153131 | |||
| 2166 | Ga0496103_0034521 | |||
| 2167 | Ga0496104_0000263 | |||
| 2168 | Ga0496104_0002013 | |||
| 2169 | Ga0496104_0005064 | |||
| 2170 | Ga0496104_0046865 | |||
| 2171 | Ga0496104_0070149 | |||
| 2172 | Ga0496104_0147530 | |||
| 2173 | Ga0496104_0152648 | |||
| 2174 | Ga0496104_0238384 | |||
| 2175 | Ga0496104_0273903 | |||
| 2176 | Ga0496105_0001788 | |||
| 2177 | Ga0496105_0025988 | |||
| 2178 | Ga0496105_0035101 | |||
| 2179 | Ga0496105_0039054 | |||
| 2180 | Ga0496105_0047571 | |||
| 2181 | Ga0496105_0067920 | |||
| 2182 | Ga0496105_0084410 | |||
| 2183 | Ga0496106_0004569 | |||
| 2184 | Ga0496106_0052854 | |||
| 2185 | Ga0496106_0174016 | |||
| 2186 | Ga0496106_0333026 | |||
| 2187 | Ga0496106_0573512 | |||
| 2188 | Ga0496107_0021454 | |||
| 2189 | Ga0496107_0045441 | |||
| 2190 | Ga0496107_0063357 | |||
| 2191 | Ga0496107_0095309 | |||
| 2192 | Ga0496107_0202453 | |||
| 2193 | Ga0496107_0260182 | |||
| 2194 | Ga0496108_0007549 | |||
| 2195 | Ga0496108_0020982 | |||
| 2196 | Ga0496108_0074176 | |||
| 2197 | Ga0496108_0125293 | |||
| 2198 | Ga0496108_0238441 | |||
| 2199 | Ga0496108_0369867 | |||
| 2200 | Ga0496109_0007402 | |||
| 2201 | Ga0496109_0023097 | |||
| 2202 | Ga0496109_0029729 | |||
| 2203 | Ga0496109_0032848 | |||
| 2204 | Ga0496109_0039821 | |||
| 2205 | Ga0496109_0050283 | |||
| 2206 | Ga0496109_0220544 | |||
| 2207 | Ga0496109_0312651 | |||
| 2208 | Ga0496109_0407063 | |||
| 2209 | Ga0496109_0538493 | |||
| 2210 | Ga0496110_0002708 | |||
| 2211 | Ga0496110_0022446 | |||
| 2212 | Ga0496110_0033389 | |||
| 2213 | Ga0496110_0173402 | |||
| 2214 | Ga0496110_0445362 | |||
| 2215 | Ga0496111_0002537 | |||
| 2216 | Ga0496111_0080832 | |||
| 2217 | Ga0496111_0084454 | |||
| 2218 | Ga0496111_0191585 | |||
| 2219 | Ga0496111_0274372 | |||
| 2220 | Ga0496112_0000159 | |||
| 2221 | Ga0496112_0014254 | |||
| 2222 | Ga0496112_0024687 | |||
| 2223 | Ga0496112_0106498 | |||
| 2224 | Ga0496112_0177747 | |||
| 2225 | Ga0496113_0006554 | |||
| 2226 | Ga0496113_0027455 | |||
| 2227 | Ga0496113_0073559 | |||
| 2228 | Ga0496113_0188925 | |||
| 2229 | Ga0496113_0287282 | |||
| 2230 | Ga0496114_0012899 | |||
| 2231 | Ga0496114_0028233 | |||
| 2232 | Ga0496114_0048829 | |||
| 2233 | Ga0496114_0056772 | |||
| 2234 | Ga0496114_0062390 | |||
| 2235 | Ga0496114_0079216 | |||
| 2236 | Ga0496114_0092814 | |||
| 2237 | Ga0496114_0670978 | |||
| 2238 | Ga0496115_0021236 | |||
| 2239 | Ga0496115_0031981 | |||
| 2240 | Ga0496115_0062701 | |||
| 2241 | Ga0496115_0168843 | |||
| 2242 | Ga0496115_0389467 | |||
| 2243 | Ga0496122_0196991 | |||
| 2244 | Ga0496125_0310490 | |||
| 2245 | Ga0496126_0027315 | |||
| 2246 | Ga0496126_0031554 | |||
| 2247 | Ga0496126_0037923 | |||
| 2248 | Ga0496126_0211493 | |||
| 2249 | Ga0501031_0003149 | |||
| 2250 | Ga0501031_0008650 | |||
| 2251 | Ga0501031_0043366 | |||
| 2252 | Ga0501032_0029432 | |||
| 2253 | Ga0501032_0033532 | |||
| 2254 | Ga0501032_0151016 | |||
| 2255 | Ga0501033_0006830 | |||
| 2256 | Ga0501033_0007168 | |||
| 2257 | Ga0501033_0041059 | |||
| 2258 | Ga0501033_0083715 | |||
| 2259 | Ga0501034_0035028 | |||
| 2260 | Ga0501034_0067171 | |||
| 2261 | Ga0501034_0103409 | |||
| 2262 | Ga0501034_0145978 | |||
| 2263 | Ga0501036_0007634 | |||
| 2264 | Ga0501036_0090011 | |||
| 2265 | Ga0501036_0181637 | |||
| 2266 | Ga0501036_0237947 | |||
| 2267 | Ga0501037_0094556 | |||
| 2268 | Ga0501037_0335809 | |||
| 2269 | Ga0501038_0005688 | |||
| 2270 | Ga0501038_0105460 | |||
| 2271 | Ga0501039_0001008 | |||
| 2272 | Ga0501039_0004674 | |||
| 2273 | Ga0501039_0171264 | |||
| 2274 | Ga0501039_0618121 | |||
| 2275 | Ga0501040_0016271 | |||
| 2276 | Ga0501040_0230685 | |||
| 2277 | Ga0501041_0018351 | |||
| 2278 | Ga0501041_0121766 | |||
| 2279 | Ga0501042_0103845 | |||
| 2280 | Ga0501043_0087121 | |||
| 2281 | Ga0501043_0114972 | |||
| 2282 | Ga0501043_0173761 | |||
| 2283 | Ga0501043_0498774 | |||
| 2284 | Ga0501046_0013645 | |||
| 2285 | Ga0501047_0006153 | |||
| 2286 | Ga0501047_0011211 | |||
| 2287 | Ga0501047_0394547 | |||
| 2288 | Ga0501047_0676130 | |||
| 2289 | Ga0501048_0001302 | |||
| 2290 | Ga0501048_0002817 | |||
| 2291 | Ga0501048_0124358 | |||
| 2292 | Ga0501067_0137914 | |||
| 2293 | Ga0501068_0304002 | |||
| 2294 | Ga0501070_0028990 | |||
| 2295 | Ga0501070_0145471 | |||
| 2296 | Ga0501070_0289775 | |||
| 2297 | Ga0501071_0024723 | |||
| 2298 | Ga0501072_0027284 | |||
| 2299 | Ga0501072_0375380 | |||
| 2300 | Ga0501074_0353461 | |||
| 2301 | Ga0501075_0006844 | |||
| 2302 | Ga0501076_0007635 | |||
| 2303 | Ga0501077_0032713 | |||
| 2304 | Ga0501079_0168435 | |||
| 2305 | Ga0501035_0011100 | |||
| 2306 | Ga0501035_0011350 | |||
| 2307 | Ga0501035_0710947 | |||
| 2308 | Ga0501044_0007546 | |||
| 2309 | Ga0501044_0015982 | |||
| 2310 | Ga0501044_0227522 | |||
| 2311 | Ga0501044_0270899 | |||
| 2312 | Ga0501045_0000128 | |||
| 2313 | Ga0501045_0035949 | |||
| 2314 | Ga0501045_0197373 | |||
| 2315 | nmdc:mga03n38_30676_c1 | |||
| 2316 | nmdc:mga00v17_231881_c1 | |||
| 2317 | nmdc:mga00v17_29413_c1 | |||
| 2318 | nmdc:mga00v17_68711_c1 | |||
| 2319 | nmdc:mga0yw44_5475_c1 | |||
| 2320 | nmdc:mga0yw44_67171_c1 | |||
| 2321 | nmdc:mga06z11_302671_c1 | |||
| 2322 | nmdc:mga05p37_43634_c1 | |||
| 2323 | nmdc:mga09592_357055_c1 | |||
| 2324 | nmdc:mga08y16_43759_c1 | |||
| 2325 | nmdc:mga08y16_71631_c1 | |||
| 2326 | nmdc:mga08y16_95906_c1 | |||
| 2327 | nmdc:mga0n895_201902_c1 | |||
| 2328 | nmdc:mga0n895_23448_c1 | |||
| 2329 | nmdc:mga0n895_6914_c1 | |||
| 2330 | nmdc:mga0rr50_3006_c1 | |||
| 2331 | nmdc:mga0rr50_523891_c1 | |||
| 2332 | nmdc:mga0rr50_73089_c1 | |||
| 2333 | nmdc:mga08x19_11321_c1 | |||
| 2334 | nmdc:mga08x19_1282_c1 | |||
| 2335 | nmdc:mga08x19_87055_c1 | |||
| 2336 | nmdc:mga0sz30_49429_c1 | |||
| 2337 | Ga0495601_0002951 | |||
| 2338 | Ga0495601_0017372 | |||
| 2339 | Ga0495601_0018474 | |||
| 2340 | Ga0495601_0022322 | |||
| 2341 | Ga0495601_0032112 | |||
| 2342 | Ga0495601_0042317 | |||
| 2343 | Ga0495601_0094479 | |||
| 2344 | Ga0495601_0139427 | |||
| 2345 | Ga0495612_0011079 | |||
| 2346 | Ga0495612_0011425 | |||
| 2347 | Ga0495612_0094971 | |||
| 2348 | Ga0495655_0010282 | |||
| 2349 | Ga0495595_0000162 | |||
| 2350 | Ga0495595_0005098 | |||
| 2351 | Ga0495595_0012128 | |||
| 2352 | Ga0495595_0053589 | |||
| 2353 | Ga0495619_0009943 | |||
| 2354 | Ga0495619_0013593 | |||
| 2355 | Ga0495619_0014724 | |||
| 2356 | Ga0500644_0038556 | |||
| 2357 | Ga0500583_0147065 | |||
| 2358 | Ga0500641_0005009 | |||
| 2359 | Ga0500556_0000086 | |||
| 2360 | Ga0500560_002305 | |||
| 2361 | Ga0500562_001846 | |||
| 2362 | Ga0500593_000565 | |||
| 2363 | Ga0500655_000708 | |||
| 2364 | Ga0500577_0012772 | |||
| 2365 | Ga0501084_0006106 | |||
| 2366 | Ga0501084_0710250 | |||
| 2367 | Ga0501082_0019284 | |||
| 2368 | Ga0530510_0004113 | |||
| 2369 | 2643946882 | |||
| 2370 | 2644034294 | |||
| 2371 | 2644098690 | |||
| 2372 | 2644116051 | |||
| 2373 | 2644228749 | |||
| 2374 | 2644435063 | |||
| 2375 | 2644457903 | |||
| 2376 | 2645722761 | |||
| 2377 | 2645725733 | |||
| 2378 | 2676484398 | |||
| 2379 | 2738871536 | |||
| 2380 | 2740166171 | |||
| 2381 | 2774393490 | |||
| 2382 | 2793977387 | |||
| 2383 | 2808872498 | |||
| 2384 | 2809195622 | |||
| 2385 | 2812333542 | |||
| 2386 | 2812350522 | |||
| 2387 | 2819740200 | |||
| 2388 | 2856744110 | |||
| 2389 | 2862180851 | |||
| 2390 | 2862575526 | |||
| 2391 | 2891403566 | |||
| 2392 | 2891564343 | |||
| 2393 | 2891971876 | |||
| 2394 | 2912762398 | |||
| 2395 | 2984579090 | |||
| 2396 | 2990260016 | |||
| 2397 | 2995464865 | |||
| 2398 | 8003315206 | |||
| 2399 | 8025536874 | |||
| 2400 | 8047716709 | |||
| 2401 | 8047903554 | |||
| 2402 | 8048356813 | |||
| 2403 | 8048379008 | |||
| 2404 | 8048388113 | |||
| 2405 | 8054610045 | |||
| 2406 | 8055174723 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pmu-assembly1.cif.gz_C | crystal structure of the dna-binding domain of phop | 0.9738 | 146 | 240 |
| 2pmu-assembly1.cif.gz_F | crystal structure of the dna-binding domain of phop | 0.9605 | 144 | 240 |
| 2pmu-assembly1.cif.gz_D | crystal structure of the dna-binding domain of phop | 0.9584 | 146 | 240 |
| 3q15-assembly2.cif.gz_D-3 | crystal structure of raph complexed with spo0f | 0.9373 | 19 | 131 |
| 2pmu-assembly1.cif.gz_A | crystal structure of the dna-binding domain of phop | 0.9352 | 146 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 1.001 | 17 | 97 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9889 | 17 | 97 | 3.40.50.2300 |
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9792 | 19 | 97 | 3.40.50.2300 |
| af_P71814_19_100_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9712 | 19 | 97 | 3.40.50.2300 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9618 | 18 | 97 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S9FFS7-F1-model_v4 | DNA-binding response regulator | 0.8334 | 1 | 169 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A435B0I5-F1-model_v4 | Response regulator transcription factor | 0.8184 | 17 | 198 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7W9CRF2-F1-model_v4 | Two-component system OmpR family response regulator | 0.8111 | 3 | 243 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7W9CRF2-F1-model_v4 | Two-component system OmpR family response regulator | 0.7993 | 3 | 243 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A435B0I5-F1-model_v4 | Response regulator transcription factor | 0.7919 | 17 | 198 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |