F491613

General Info

Members Datasets Scaffolds Average Seq Length
1203 447 2406 248

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10077157|Ga0070709_100771572
Length 277
Sequence MALPVQRELRAGAEGLSRGPAHTGGMTTEAQGAQLARAGQAPPVQRVDGSPIRVLVVDDEPSLAELLASVLRYEGWEIRTAGDGVTAVRTAREFRPDAVVLDIMLPDFDGLEVLRRIRQDSPQVCVLFLTARDSVDDRVAGITAGGDDYVTKPFSLEEVLARLRGLLRRAGLARARGETQLAVGDLTMDEDAREVRRGDDLIDLTATEFELLRFLMRNPRRVLSKAQILDRVWNYDFGGQAHVVELYISYLRKKIDAGREPLIHTVRGVGYVLKPAS

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
108 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
127 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
199 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
203 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
204 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
205 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
206 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
207 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
208 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
220 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
221 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
226 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
229 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
234 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
235 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
236 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
237 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
238 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
239 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
244 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
245 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
246 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
247 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
255 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
261 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
267 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
268 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
269 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
270 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
271 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
272 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
273 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
274 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
275 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
276 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
277 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
278 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
281 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
287 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
288 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
289 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
294 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
314 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
315 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
318 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
319 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
320 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
321 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
329 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
330 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
331 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
352 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
353 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
354 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
370 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
382 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
383 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
384 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
385 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
386 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
387 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
388 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
389 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
390 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
391 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
392 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
399 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
400 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
401 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
402 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
403 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
404 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
405 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
406 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
407 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
408 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
409 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
410 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
411 2643221604 Nocardioides sp. Root190 Isolate Unclassified
412 2643221617 Nocardioides sp. Root79 Isolate Unclassified
413 2643221620 Nocardioides sp. Root240 Isolate Unclassified
414 2643221641 Nocardioides sp. Root122 Isolate Unclassified
415 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
416 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
417 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
418 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
419 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
420 2738541305 Nocardioides sp. CF167 Isolate Unclassified
421 2739367898 Nocardioides sp. CF479 Isolate Unclassified
422 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
423 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
424 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
425 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
426 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
427 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
428 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
429 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
430 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
431 2862574272 Streptomyces sp. AcE210 Isolate Nodule
432 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
433 2891562705 Microbispora tritici MT50 Isolate Unclassified
434 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
435 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
436 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
437 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
438 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
439 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
440 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
441 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
442 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
443 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
444 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
445 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
446 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
447 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.85
Metatranscriptomes 2
Isolates 3.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 1.91
Nodule 0.17
Rhizoplane 8.06
Rhizosphere 84.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10077157 3300005434 Bacteria 2165
2 JGI24739J22299_10074272 3300001989 Bacteria 1053
3 JGI24743J22301_10009419 3300001991 Bacteria 1730
4 JGI24738J21930_10005489 3300002075 Bacteria 3035
5 JGI25404J52841_10010555 3300003659 Bacteria 1985
6 Ga0070658_10049656 3300005327 Bacteria 3399
7 Ga0070658_10164455 3300005327 Bacteria 1863
8 Ga0070683_100145261 3300005329 Bacteria 2247
9 Ga0070690_100158485 3300005330 Bacteria 1549
10 Ga0070690_100280803 3300005330 Bacteria 1188
11 Ga0070670_100027661 3300005331 Bacteria 4878
12 Ga0068869_100009064 3300005334 Bacteria 6448
13 Ga0068869_100013540 3300005334 Bacteria 5428
14 Ga0068869_100091214 3300005334 Bacteria 2292
15 Ga0068869_100150784 3300005334 Bacteria 1803
16 Ga0070666_10043691 3300005335 Bacteria 3001
17 Ga0070666_10107835 3300005335 Bacteria 1925
18 Ga0070680_100025795 3300005336 Bacteria 4699
19 Ga0070680_100039708 3300005336 Bacteria 3807
20 Ga0070682_100011309 3300005337 Bacteria 5097
21 Ga0070682_100158280 3300005337 Bacteria 1562
22 Ga0070682_100219967 3300005337 Bacteria 1351
23 Ga0070682_100308236 3300005337 Bacteria 1164
24 Ga0068868_100001738 3300005338 Bacteria 14922
25 Ga0068868_100116560 3300005338 Bacteria 2175
26 Ga0070660_100017931 3300005339 Bacteria 5165
27 Ga0070660_100103162 3300005339 Bacteria 2261
28 Ga0070689_100061491 3300005340 Bacteria 2921
29 Ga0070691_10003832 3300005341 Bacteria 6793
30 Ga0070687_100012858 3300005343 Bacteria 3711
31 Ga0070687_100017559 3300005343 Bacteria 3293
32 Ga0070661_100004959 3300005344 Bacteria 9166
33 Ga0070661_100039922 3300005344 Bacteria 3421
34 Ga0070692_10004181 3300005345 Bacteria 5984
35 Ga0070692_10046146 3300005345 Bacteria 2251
36 Ga0070692_10062498 3300005345 Bacteria 1965
37 Ga0070692_10168752 3300005345 Bacteria 1260
38 Ga0070668_100127331 3300005347 Bacteria 2041
39 Ga0070675_100006254 3300005354 Bacteria 9137
40 Ga0070675_100012160 3300005354 Bacteria 6747
41 Ga0070671_100012625 3300005355 Bacteria 6808
42 Ga0070671_100224350 3300005355 Bacteria 1594
43 Ga0070673_100197398 3300005364 Bacteria 1731
44 Ga0070688_100208277 3300005365 Bacteria 1372
45 Ga0070659_100045613 3300005366 Bacteria 3434
46 Ga0070659_100049396 3300005366 Bacteria 3308
47 Ga0070659_100117742 3300005366 Bacteria 2148
48 Ga0070659_100191879 3300005366 Bacteria 1679
49 Ga0070709_10001827 3300005434 Bacteria 11546
50 Ga0070709_10017307 3300005434 Bacteria 4132
51 Ga0070714_100000076 3300005435 Bacteria 84569
52 Ga0070714_100000630 3300005435 Bacteria 25127
53 Ga0070714_100016313 3300005435 Bacteria 5993
54 Ga0070714_100022645 3300005435 Bacteria 5152
55 Ga0070714_100026551 3300005435 Bacteria 4787
56 Ga0070714_100032567 3300005435 Bacteria 4352
57 Ga0070714_100071758 3300005435 Bacteria 2995
58 Ga0070714_100287565 3300005435 Bacteria 1529
59 Ga0070714_100290885 3300005435 Bacteria 1520
60 Ga0070713_100009273 3300005436 Bacteria 7033
61 Ga0070713_100052282 3300005436 Bacteria 3382
62 Ga0070713_100137108 3300005436 Bacteria 2163
63 Ga0070713_100191388 3300005436 Bacteria 1843
64 Ga0070713_100199361 3300005436 Bacteria 1807
65 Ga0070713_100212874 3300005436 Bacteria 1750
66 Ga0070713_100469101 3300005436 Bacteria 1185
67 Ga0070713_100664113 3300005436 Bacteria 993
68 Ga0070710_10000145 3300005437 Bacteria 32792
69 Ga0070710_10003172 3300005437 Bacteria 7792
70 Ga0070710_10078199 3300005437 Bacteria 1924
71 Ga0070710_10090224 3300005437 Bacteria 1806
72 Ga0070701_10012256 3300005438 Bacteria 3860
73 Ga0070711_100235448 3300005439 Bacteria 1429
74 Ga0070711_100300878 3300005439 Bacteria 1275
75 Ga0070711_100389726 3300005439 Bacteria 1128
76 Ga0070705_100376474 3300005440 Bacteria 1043
77 Ga0070700_100031520 3300005441 Bacteria 3178
78 Ga0070700_100342360 3300005441 Bacteria 1106
79 Ga0070708_100036965 3300005445 Bacteria 4258
80 Ga0070708_100055285 3300005445 Bacteria 3529
81 Ga0070708_100298384 3300005445 Bacteria 1517
82 Ga0070663_100001480 3300005455 Bacteria 12905
83 Ga0070663_100005175 3300005455 Bacteria 7724
84 Ga0070663_100056286 3300005455 Bacteria 2817
85 Ga0070663_100062969 3300005455 Bacteria 2676
86 Ga0070678_100002453 3300005456 Bacteria 10161
87 Ga0070678_100131008 3300005456 Bacteria 1992
88 Ga0070678_100229817 3300005456 Bacteria 1546
89 Ga0070662_100005331 3300005457 Bacteria 8216
90 Ga0070681_10007532 3300005458 Bacteria 10639
91 Ga0070681_10119510 3300005458 Bacteria 2571
92 Ga0068867_100178930 3300005459 Bacteria 1685
93 Ga0070685_10011347 3300005466 Bacteria 4666
94 Ga0070685_10231373 3300005466 Bacteria 1216
95 Ga0070706_100000349 3300005467 Bacteria 55601
96 Ga0070706_100000813 3300005467 Bacteria 34620
97 Ga0070706_100002736 3300005467 Bacteria 17624
98 Ga0070706_100006549 3300005467 Bacteria 10988
99 Ga0070706_100037946 3300005467 Bacteria 4448
100 Ga0070706_100077404 3300005467 Bacteria 3078
101 Ga0070706_100087281 3300005467 Bacteria 2891
102 Ga0070707_100000381 3300005468 Bacteria 43789
103 Ga0070707_100000524 3300005468 Bacteria 38316
104 Ga0070707_100009405 3300005468 Bacteria 9071
105 Ga0070707_100040335 3300005468 Bacteria 4467
106 Ga0070707_100078480 3300005468 Bacteria 3185
107 Ga0070707_100129806 3300005468 Bacteria 2450
108 Ga0070707_100130763 3300005468 Bacteria 2441
109 Ga0070707_100212185 3300005468 Bacteria 1887
110 Ga0070698_100000951 3300005471 Bacteria 31690
111 Ga0070698_100001154 3300005471 Bacteria 29241
112 Ga0070698_100001699 3300005471 Bacteria 24551
113 Ga0070698_100003087 3300005471 Bacteria 18358
114 Ga0070698_100022634 3300005471 Bacteria 6572
115 Ga0070698_100031767 3300005471 Bacteria 5472
116 Ga0070698_100208451 3300005471 Bacteria 1890
117 Ga0070698_100239085 3300005471 Bacteria 1749
118 Ga0070698_100317030 3300005471 Bacteria 1490
119 Ga0070699_100006729 3300005518 Bacteria 9996
120 Ga0070679_100011412 3300005530 Bacteria 8465
121 Ga0070679_100092058 3300005530 Bacteria 3020
122 Ga0070679_100152529 3300005530 Bacteria 2287
123 Ga0070684_100059161 3300005535 Bacteria 3350
124 Ga0070684_100131961 3300005535 Bacteria 2254
125 Ga0070697_100000447 3300005536 Bacteria 31726
126 Ga0070697_100012490 3300005536 Bacteria 6655
127 Ga0070697_100043185 3300005536 Bacteria 3649
128 Ga0068853_100209106 3300005539 Bacteria 1778
129 Ga0070672_100060681 3300005543 Bacteria 2978
130 Ga0070672_100427122 3300005543 Bacteria 1139
131 Ga0070672_100448610 3300005543 Bacteria 1111
132 Ga0070686_100011554 3300005544 Bacteria 5010
133 Ga0070686_100202084 3300005544 Bacteria 1425
134 Ga0070695_100041487 3300005545 Bacteria 2917
135 Ga0070696_100026054 3300005546 Bacteria 3978
136 Ga0070693_100025368 3300005547 Bacteria 3190
137 Ga0070693_100091402 3300005547 Bacteria 1835
138 Ga0070665_100120949 3300005548 Bacteria 2620
139 Ga0070665_100291786 3300005548 Bacteria 1633
140 Ga0070704_100060378 3300005549 Bacteria 2709
141 Ga0070704_100119718 3300005549 Bacteria 2020
142 Ga0068855_100162206 3300005563 Bacteria 2536
143 Ga0068855_100223669 3300005563 Bacteria 2110
144 Ga0070664_100043727 3300005564 Bacteria 3780
145 Ga0070664_100087969 3300005564 Bacteria 2686
146 Ga0070664_100194287 3300005564 Bacteria 1809
147 Ga0068857_100008010 3300005577 Bacteria 9113
148 Ga0068857_100011670 3300005577 Bacteria 7641
149 Ga0068857_100193668 3300005577 Bacteria 1852
150 Ga0068857_100258507 3300005577 Bacteria 1598
151 Ga0068854_100026349 3300005578 Bacteria 3995
152 Ga0068854_100034654 3300005578 Bacteria 3528
153 Ga0068856_100011106 3300005614 Bacteria 8745
154 Ga0068856_100135540 3300005614 Bacteria 2467
155 Ga0068856_100256307 3300005614 Bacteria 1764
156 Ga0068856_100427453 3300005614 Bacteria 1345
157 Ga0070702_100003036 3300005615 Bacteria 7428
158 Ga0068852_100066276 3300005616 Bacteria 3153
159 Ga0068852_100183518 3300005616 Bacteria 1969
160 Ga0068859_100034967 3300005617 Bacteria 5040
161 Ga0068859_100167028 3300005617 Bacteria 2280
162 Ga0068864_100003373 3300005618 Bacteria 13208
163 Ga0068864_100044849 3300005618 Bacteria 3792
164 Ga0068864_100276717 3300005618 Bacteria 1566
165 Ga0068861_100062872 3300005719 Bacteria 2852
166 Ga0068851_10014136 3300005834 Bacteria 3786
167 Ga0068870_10002608 3300005840 Bacteria 7541
168 Ga0068870_10015521 3300005840 Bacteria 3615
169 Ga0068863_100017352 3300005841 Bacteria 6902
170 Ga0068863_100115786 3300005841 Bacteria 2554
171 Ga0068863_100267039 3300005841 Bacteria 1655
172 Ga0068863_100360693 3300005841 Bacteria 1417
173 Ga0068858_100021460 3300005842 Bacteria 6035
174 Ga0068858_100071310 3300005842 Bacteria 3222
175 Ga0068858_100123031 3300005842 Bacteria 2428
176 Ga0068860_100396126 3300005843 Bacteria 1365
177 Ga0068862_100052069 3300005844 Bacteria 3502
178 Ga0068862_100154589 3300005844 Bacteria 2044
179 Ga0081455_10002124 3300005937 Bacteria 23620
180 Ga0081455_10094227 3300005937 Bacteria 2419
181 Ga0081540_1000582 3300005983 Bacteria 35204
182 Ga0081540_1000756 3300005983 Bacteria 29755
183 Ga0081539_10000127 3300005985 Bacteria 179934
184 Ga0081539_10005011 3300005985 Bacteria 13975
185 Ga0081539_10027065 3300005985 Bacteria 3640
186 Ga0070717_10003556 3300006028 Bacteria 11169
187 Ga0070717_10029458 3300006028 Bacteria 4404
188 Ga0070717_10032114 3300006028 Bacteria 4228
189 Ga0070717_10033576 3300006028 Bacteria 4140
190 Ga0070717_10038774 3300006028 Bacteria 3874
191 Ga0070717_10043560 3300006028 Bacteria 3664
192 Ga0070717_10067857 3300006028 Bacteria 2968
193 Ga0070717_10119033 3300006028 Bacteria 2260
194 Ga0070717_10127904 3300006028 Bacteria 2182
195 Ga0070717_10186750 3300006028 Bacteria 1809
196 Ga0075363_100107153 3300006048 Bacteria 1551
197 Ga0075364_10044399 3300006051 Bacteria 2891
198 Ga0075364_10114395 3300006051 Bacteria 1803
199 Ga0075364_10253218 3300006051 Bacteria 1197
200 Ga0075432_10102543 3300006058 Bacteria 1059
201 Ga0070715_10004309 3300006163 Bacteria 4645
202 Ga0070715_10040652 3300006163 Bacteria 1944
203 Ga0070715_10128455 3300006163 Bacteria 1217
204 Ga0070716_100000508 3300006173 Bacteria 16215
205 Ga0070716_100007882 3300006173 Bacteria 5271
206 Ga0070716_100015589 3300006173 Bacteria 3907
207 Ga0070716_100044320 3300006173 Bacteria 2491
208 Ga0070716_100080295 3300006173 Bacteria 1944
209 Ga0070712_100005372 3300006175 Bacteria 7934
210 Ga0070712_100009334 3300006175 Bacteria 6183
211 Ga0070712_100029059 3300006175 Bacteria 3704
212 Ga0070712_100045417 3300006175 Bacteria 3033
213 Ga0070712_100056408 3300006175 Bacteria 2755
214 Ga0075369_10036161 3300006186 Bacteria 2101
215 Ga0097621_100079576 3300006237 Bacteria 2725
216 Ga0097621_100276555 3300006237 Bacteria 1477
217 Ga0068871_100027412 3300006358 Bacteria 4455
218 Ga0068871_100056948 3300006358 Bacteria 3179
219 Ga0075428_100177928 3300006844 Bacteria 2303
220 Ga0075428_100601023 3300006844 Bacteria 1175
221 Ga0075430_100280130 3300006846 Bacteria 1380
222 Ga0075431_100407153 3300006847 Bacteria 1361
223 Ga0075433_10051187 3300006852 Bacteria 3596
224 Ga0075433_10336727 3300006852 Bacteria 1334
225 Ga0075433_10361918 3300006852 Bacteria 1281
226 Ga0075433_10409791 3300006852 Bacteria 1196
227 Ga0075434_100032233 3300006871 Bacteria 5167
228 Ga0075434_100033506 3300006871 Bacteria 5069
229 Ga0075434_100039315 3300006871 Bacteria 4687
230 Ga0068865_100039011 3300006881 Bacteria 3219
231 Ga0068865_100041107 3300006881 Bacteria 3145
232 Ga0075436_100064740 3300006914 Bacteria 2527
233 Ga0075436_100066572 3300006914 Bacteria 2490
234 Ga0075436_100169009 3300006914 Bacteria 1544
235 Ga0097620_100034967 3300006931 Bacteria 5040
236 Ga0097620_100167031 3300006931 Bacteria 2280
237 Ga0075435_100008746 3300007076 Bacteria 7285
238 Ga0075435_100037863 3300007076 Bacteria 3843
239 Ga0075435_100061836 3300007076 Bacteria 3038
240 Ga0105240_10190377 3300009093 Bacteria 2413
241 Ga0111539_10002633 3300009094 Bacteria 23770
242 Ga0111539_10034507 3300009094 Bacteria 6133
243 Ga0111539_10124766 3300009094 Bacteria 3017
244 Ga0105245_10025589 3300009098 Bacteria 5190
245 Ga0105245_10075578 3300009098 Bacteria 3068
246 Ga0114129_10210261 3300009147 Bacteria 2630
247 Ga0114129_10537231 3300009147 Bacteria 1522
248 Ga0114129_11016986 3300009147 Bacteria 1043
249 Ga0105243_10012670 3300009148 Bacteria 6371
250 Ga0105243_10090047 3300009148 Bacteria 2524
251 Ga0105243_10538320 3300009148 Bacteria 1113
252 Ga0105241_10027438 3300009174 Bacteria 4241
253 Ga0105241_10079336 3300009174 Bacteria 2566
254 Ga0105241_10260942 3300009174 Bacteria 1472
255 Ga0105241_10433309 3300009174 Bacteria 1160
256 Ga0105242_10043614 3300009176 Bacteria 3628
257 Ga0105242_10162088 3300009176 Bacteria 1958
258 Ga0105242_10500030 3300009176 Bacteria 1156
259 Ga0105248_10064723 3300009177 Bacteria 4105
260 Ga0105248_10068285 3300009177 Bacteria 3991
261 Ga0105237_10225066 3300009545 Bacteria 1876
262 Ga0105238_10108005 3300009551 Bacteria 2764
263 Ga0105238_11106273 3300009551 Bacteria 815
264 Ga0105249_10057141 3300009553 Bacteria 3573
265 Ga0105249_10128313 3300009553 Bacteria 2418
266 Ga0105239_10083549 3300010375 Bacteria 3517
267 Ga0105239_10222503 3300010375 Bacteria 2117
268 Ga0105246_10001046 3300011119 Bacteria 15970
269 Ga0105246_10074624 3300011119 Bacteria 2398
270 Ga0157335_1001533 3300012492 Bacteria 1281
271 Ga0157342_1000629 3300012507 Bacteria 2259
272 Ga0157373_10058350 3300013100 Bacteria 2737
273 Ga0157373_10090051 3300013100 Bacteria 2161
274 Ga0157371_10048553 3300013102 Bacteria 3017
275 Ga0157370_10040361 3300013104 Bacteria 4506
276 Ga0157370_10567634 3300013104 Bacteria 1040
277 Ga0157369_10030215 3300013105 Bacteria 5977
278 Ga0157369_10202544 3300013105 Bacteria 2083
279 Ga0157369_10350611 3300013105 Bacteria 1533
280 Ga0157369_10405716 3300013105 Bacteria 1414
281 Ga0157369_10774703 3300013105 Bacteria 986
282 Ga0157374_10499685 3300013296 Bacteria 1221
283 Ga0157378_10143331 3300013297 Bacteria 2220
284 Ga0163162_10528450 3300013306 Bacteria 1309
285 Ga0157372_10024291 3300013307 Bacteria 6581
286 Ga0157372_10121581 3300013307 Bacteria 3000
287 Ga0157372_11017817 3300013307 Bacteria 959
288 Ga0157375_10029871 3300013308 Bacteria 5131
289 Ga0157375_10188851 3300013308 Bacteria 2215
290 Ga0157375_10442072 3300013308 Bacteria 1466
291 Ga0157375_11211775 3300013308 Bacteria 886
292 Ga0163163_10074068 3300014325 Bacteria 3396
293 Ga0163163_10094916 3300014325 Bacteria 3001
294 Ga0163163_10602639 3300014325 Bacteria 1162
295 Ga0157380_10015485 3300014326 Bacteria 5607
296 Ga0157377_10006040 3300014745 Bacteria 5744
297 Ga0157379_10149162 3300014968 Bacteria 2109
298 Ga0157379_10254059 3300014968 Bacteria 1596
299 Ga0157376_10374968 3300014969 Bacteria 1369
300 Ga0163161_10085542 3300017792 Bacteria 2326
301 Ga0163161_10134516 3300017792 Bacteria 1868
302 Ga0163161_10135521 3300017792 Bacteria 1861
303 Ga0163161_10148532 3300017792 Bacteria 1780
304 Ga0197907_10318288 3300020069 Bacteria 1503
305 Ga0197907_10356126 3300020069 Bacteria 1595
306 Ga0197907_10384303 3300020069 Bacteria 1555
307 Ga0197907_10894406 3300020069 Bacteria 1821
308 Ga0206356_10117693 3300020070 Bacteria 1323
309 Ga0206356_10553711 3300020070 Bacteria 2658
310 Ga0206356_10775408 3300020070 Bacteria 4715
311 Ga0206356_11454669 3300020070 Bacteria 2496
312 Ga0206356_11642507 3300020070 Bacteria 2051
313 Ga0206356_11751201 3300020070 Bacteria 2942
314 Ga0206355_1415136 3300020076 Bacteria 1378
315 Ga0206351_10402913 3300020077 Bacteria 1747
316 Ga0206352_10662284 3300020078 Bacteria 1672
317 Ga0206350_10015471 3300020080 Bacteria 811
318 Ga0206350_10483273 3300020080 Bacteria 1216
319 Ga0206354_11233094 3300020081 Bacteria 1616
320 Ga0206353_10337382 3300020082 Bacteria 20355
321 Ga0206353_10983463 3300020082 Bacteria 1559
322 Ga0206353_11024964 3300020082 Bacteria 2583
323 Ga0213876_10023166 3300021384 Bacteria 3281
324 Ga0213875_10000656 3300021388 Bacteria 27417
325 Ga0213875_10002258 3300021388 Bacteria 11685
326 Ga0213875_10004419 3300021388 Bacteria 7720
327 Ga0213875_10012191 3300021388 Bacteria 4251
328 Ga0213875_10013455 3300021388 Bacteria 4016
329 Ga0224712_10010732 3300022467 Bacteria 2813
330 Ga0224712_10025009 3300022467 Bacteria 2094
331 Ga0224712_10056531 3300022467 Bacteria 1547
332 Ga0224712_10063647 3300022467 Bacteria 1477
333 Ga0224572_1000926 3300024225 Bacteria 3997
334 Ga0224572_1004645 3300024225 Bacteria 2405
335 Ga0207426_1013882 3300025302 Bacteria 2969
336 Ga0207692_10014656 3300025898 Bacteria 3429
337 Ga0207692_10023748 3300025898 Bacteria 2840
338 Ga0207692_10030089 3300025898 Bacteria 2586
339 Ga0207692_10074661 3300025898 Bacteria 1797
340 Ga0207692_10076608 3300025898 Bacteria 1777
341 Ga0207692_10095492 3300025898 Bacteria 1621
342 Ga0207692_10298567 3300025898 Bacteria 980
343 Ga0207642_10029802 3300025899 Bacteria 2265
344 Ga0207642_10035497 3300025899 Bacteria 2130
345 Ga0207688_10005687 3300025901 Bacteria 6778
346 Ga0207688_10006105 3300025901 Bacteria 6553
347 Ga0207688_10022025 3300025901 Bacteria 3485
348 Ga0207688_10057212 3300025901 Bacteria 2191
349 Ga0207647_10068591 3300025904 Bacteria 2147
350 Ga0207647_10149445 3300025904 Bacteria 1366
351 Ga0207685_10001217 3300025905 Bacteria 5220
352 Ga0207685_10020818 3300025905 Bacteria 2188
353 Ga0207699_10001589 3300025906 Bacteria 10782
354 Ga0207699_10012585 3300025906 Bacteria 4307
355 Ga0207699_10015976 3300025906 Bacteria 3914
356 Ga0207699_10036378 3300025906 Bacteria 2806
357 Ga0207699_10082702 3300025906 Bacteria 1995
358 Ga0207643_10000215 3300025908 Bacteria 40461
359 Ga0207705_10007059 3300025909 Bacteria 8285
360 Ga0207705_10193033 3300025909 Bacteria 1541
361 Ga0207684_10001715 3300025910 Bacteria 23242
362 Ga0207684_10002461 3300025910 Bacteria 18657
363 Ga0207684_10005381 3300025910 Bacteria 11826
364 Ga0207684_10014889 3300025910 Bacteria 6692
365 Ga0207684_10016382 3300025910 Bacteria 6364
366 Ga0207684_10029210 3300025910 Bacteria 4697
367 Ga0207684_10063319 3300025910 Bacteria 3140
368 Ga0207684_10134284 3300025910 Bacteria 2124
369 Ga0207684_10604994 3300025910 Bacteria 936
370 Ga0207654_10033839 3300025911 Bacteria 2835
371 Ga0207707_10004913 3300025912 Bacteria 11753
372 Ga0207707_10044829 3300025912 Bacteria 3855
373 Ga0207707_10072011 3300025912 Bacteria 3012
374 Ga0207671_10072231 3300025914 Bacteria 2575
375 Ga0207693_10009380 3300025915 Bacteria 7982
376 Ga0207693_10012263 3300025915 Bacteria 6928
377 Ga0207693_10039473 3300025915 Bacteria 3718
378 Ga0207663_10003579 3300025916 Bacteria 7627
379 Ga0207663_10018255 3300025916 Bacteria 3927
380 Ga0207663_10054027 3300025916 Bacteria 2513
381 Ga0207663_10058432 3300025916 Bacteria 2434
382 Ga0207663_10144519 3300025916 Bacteria 1661
383 Ga0207663_10156392 3300025916 Bacteria 1604
384 Ga0207663_10522975 3300025916 Bacteria 924
385 Ga0207660_10002966 3300025917 Bacteria 11097
386 Ga0207660_10007062 3300025917 Bacteria 7276
387 Ga0207660_10638051 3300025917 Bacteria 868
388 Ga0207662_10003307 3300025918 Bacteria 8273
389 Ga0207657_10002090 3300025919 Bacteria 21602
390 Ga0207657_10059138 3300025919 Bacteria 3295
391 Ga0207657_10126874 3300025919 Bacteria 2095
392 Ga0207649_10009551 3300025920 Bacteria 5311
393 Ga0207649_10034467 3300025920 Bacteria 3033
394 Ga0207649_10139205 3300025920 Bacteria 1658
395 Ga0207652_10000592 3300025921 Bacteria 36290
396 Ga0207652_10009921 3300025921 Bacteria 7664
397 Ga0207652_10082676 3300025921 Bacteria 2810
398 Ga0207646_10000065 3300025922 Bacteria 149387
399 Ga0207646_10001312 3300025922 Bacteria 30880
400 Ga0207646_10017053 3300025922 Bacteria 6806
401 Ga0207646_10032398 3300025922 Bacteria 4730
402 Ga0207646_10090348 3300025922 Bacteria 2742
403 Ga0207646_10158032 3300025922 Bacteria 2045
404 Ga0207681_10418708 3300025923 Bacteria 1085
405 Ga0207694_10252193 3300025924 Bacteria 1444
406 Ga0207650_10002455 3300025925 Bacteria 12898
407 Ga0207650_10217403 3300025925 Bacteria 1537
408 Ga0207659_10004667 3300025926 Bacteria 8299
409 Ga0207687_10003055 3300025927 Bacteria 11350
410 Ga0207687_10063389 3300025927 Bacteria 2617
411 Ga0207687_10091074 3300025927 Bacteria 2223
412 Ga0207687_10132506 3300025927 Bacteria 1881
413 Ga0207687_10466323 3300025927 Bacteria 1049
414 Ga0207700_10000218 3300025928 Bacteria 34263
415 Ga0207700_10000229 3300025928 Bacteria 33559
416 Ga0207700_10031067 3300025928 Bacteria 3790
417 Ga0207700_10039433 3300025928 Bacteria 3439
418 Ga0207700_10116457 3300025928 Bacteria 2159
419 Ga0207700_10119665 3300025928 Bacteria 2133
420 Ga0207700_10167917 3300025928 Bacteria 1828
421 Ga0207700_10265128 3300025928 Bacteria 1472
422 Ga0207664_10000588 3300025929 Bacteria 25365
423 Ga0207664_10011479 3300025929 Bacteria 6301
424 Ga0207664_10019149 3300025929 Bacteria 5054
425 Ga0207664_10024584 3300025929 Bacteria 4528
426 Ga0207664_10029877 3300025929 Bacteria 4156
427 Ga0207664_10101334 3300025929 Bacteria 2379
428 Ga0207664_10104036 3300025929 Bacteria 2350
429 Ga0207664_10169210 3300025929 Bacteria 1869
430 Ga0207664_10171012 3300025929 Bacteria 1860
431 Ga0207664_10213200 3300025929 Bacteria 1672
432 Ga0207664_10473025 3300025929 Bacteria 1120
433 Ga0207644_10024769 3300025931 Bacteria 4122
434 Ga0207690_10033467 3300025932 Bacteria 3305
435 Ga0207706_10013237 3300025933 Bacteria 7504
436 Ga0207706_10140752 3300025933 Bacteria 2122
437 Ga0207706_10283673 3300025933 Bacteria 1444
438 Ga0207686_10246526 3300025934 Bacteria 1303
439 Ga0207709_10009672 3300025935 Bacteria 5311
440 Ga0207709_10076383 3300025935 Bacteria 2144
441 Ga0207709_10079764 3300025935 Bacteria 2106
442 Ga0207670_10146039 3300025936 Bacteria 1749
443 Ga0207670_10177881 3300025936 Bacteria 1600
444 Ga0207665_10000193 3300025939 Bacteria 41109
445 Ga0207665_10000369 3300025939 Bacteria 31246
446 Ga0207665_10006989 3300025939 Bacteria 7468
447 Ga0207665_10024374 3300025939 Bacteria 3989
448 Ga0207665_10062983 3300025939 Bacteria 2518
449 Ga0207691_10004250 3300025940 Bacteria 13903
450 Ga0207691_10224727 3300025940 Bacteria 1627
451 Ga0207691_10535967 3300025940 Bacteria 993
452 Ga0207711_10061229 3300025941 Bacteria 3245
453 Ga0207711_10076178 3300025941 Bacteria 2921
454 Ga0207711_10104209 3300025941 Bacteria 2513
455 Ga0207689_10001149 3300025942 Bacteria 25481
456 Ga0207689_10005138 3300025942 Bacteria 11767
457 Ga0207689_10018067 3300025942 Bacteria 5955
458 Ga0207661_10012466 3300025944 Bacteria 6176
459 Ga0207661_10042117 3300025944 Bacteria 3599
460 Ga0207661_10105958 3300025944 Bacteria 2369
461 Ga0207679_10019362 3300025945 Bacteria 4570
462 Ga0207679_10053069 3300025945 Bacteria 2976
463 Ga0207679_10261105 3300025945 Bacteria 1477
464 Ga0207667_10167467 3300025949 Bacteria 2259
465 Ga0207667_10269652 3300025949 Bacteria 1740
466 Ga0207712_10306895 3300025961 Bacteria 1304
467 Ga0207668_10074135 3300025972 Bacteria 2442
468 Ga0207640_10008388 3300025981 Bacteria 5744
469 Ga0207640_10095164 3300025981 Bacteria 2073
470 Ga0207658_10053817 3300025986 Bacteria 2976
471 Ga0207677_10002476 3300026023 Bacteria 9694
472 Ga0207677_10026127 3300026023 Bacteria 3657
473 Ga0207677_10052799 3300026023 Bacteria 2763
474 Ga0207703_10486739 3300026035 Bacteria 1156
475 Ga0207639_10027269 3300026041 Bacteria 4159
476 Ga0207639_10074960 3300026041 Bacteria 2659
477 Ga0207678_10000552 3300026067 Bacteria 34170
478 Ga0207678_10001019 3300026067 Bacteria 25566
479 Ga0207678_10001856 3300026067 Bacteria 19305
480 Ga0207678_10008054 3300026067 Bacteria 9294
481 Ga0207678_10015961 3300026067 Bacteria 6597
482 Ga0207708_10000933 3300026075 Bacteria 21920
483 Ga0207708_10019775 3300026075 Bacteria 5077
484 Ga0207708_10039703 3300026075 Bacteria 3587
485 Ga0207702_10002139 3300026078 Bacteria 18993
486 Ga0207702_10062383 3300026078 Bacteria 3183
487 Ga0207702_10181168 3300026078 Bacteria 1940
488 Ga0207641_10004861 3300026088 Bacteria 11565
489 Ga0207641_10118081 3300026088 Bacteria 2362
490 Ga0207641_10417272 3300026088 Bacteria 1291
491 Ga0207648_10092525 3300026089 Bacteria 2644
492 Ga0207648_10173093 3300026089 Bacteria 1909
493 Ga0207676_10003268 3300026095 Bacteria 11535
494 Ga0207674_10008373 3300026116 Bacteria 11962
495 Ga0207674_10028803 3300026116 Bacteria 5855
496 Ga0207674_10158695 3300026116 Bacteria 2217
497 Ga0207675_100014732 3300026118 Bacteria 7293
498 Ga0207675_100019992 3300026118 Bacteria 6248
499 Ga0207675_100084010 3300026118 Bacteria 2987
500 Ga0207683_10001755 3300026121 Bacteria 19188
501 Ga0207683_10010244 3300026121 Bacteria 7992
502 Ga0207698_10011353 3300026142 Bacteria 5771
503 Ga0207698_10016262 3300026142 Bacteria 5010
504 Ga0207428_10009874 3300027907 Bacteria 8550
505 Ga0207428_10079370 3300027907 Bacteria 2566
506 Ga0207428_10321299 3300027907 Bacteria 1143
507 Ga0268266_10055062 3300028379 Bacteria 3419
508 Ga0268265_10056558 3300028380 Bacteria 2985
509 Ga0268264_10112285 3300028381 Bacteria 2389
510 Ga0265337_1055019 3300028556 Bacteria 1112
511 Ga0307517_10002916 3300028786 Bacteria 27096
512 Ga0307515_10000845 3300028794 Bacteria 70367
513 Ga0265338_10004550 3300028800 Bacteria 18669
514 Ga0307511_10011641 3300030521 Bacteria 8659
515 Ga0307512_10030128 3300030522 Bacteria 4727
516 Ga0307509_10019979 3300031507 Bacteria 7616
517 Ga0307509_10037358 3300031507 Bacteria 5310
518 Ga0316575_10016337 3300031665 Bacteria 2807
519 Ga0316579_10155949 3300031691 Bacteria 1102
520 Ga0316576_10011912 3300031727 Bacteria 5721
521 Ga0316576_10066587 3300031727 Bacteria 2649
522 Ga0316576_10561176 3300031727 Bacteria 836
523 Ga0316578_10006497 3300031728 Bacteria 5778
524 Ga0307516_10070070 3300031730 Bacteria 3371
525 Ga0316577_10035835 3300031733 Bacteria 2773
526 Ga0307413_10071265 3300031824 Bacteria 2189
527 Ga0307406_10057429 3300031901 Bacteria 2496
528 Ga0307409_100230441 3300031995 Bacteria 1679
529 Ga0307409_100367610 3300031995 Bacteria 1363
530 Ga0307409_100536642 3300031995 Bacteria 1146
531 Ga0307416_100074745 3300032002 Bacteria 2833
532 Ga0307411_10018902 3300032005 Bacteria 3966
533 Ga0307415_100105409 3300032126 Bacteria 2079
534 Ga0307415_100421941 3300032126 Bacteria 1145
535 Ga0307507_10039437 3300033179 Bacteria 4766
536 Ga0307507_10070361 3300033179 Bacteria 3174
537 Ga0307510_10019969 3300033180 Bacteria 7846
538 Ga0307510_10097383 3300033180 Bacteria 2752
539 Ga0316214_1008262 3300033545 Bacteria 1399
540 Ga0373930_0012825 3300034816 Bacteria 1535
541 Ga0373948_0018076 3300034817 Bacteria 1321
542 Ga0373926_0007030 3300035083 Bacteria 3741
543 Ga0373926_0021076 3300035083 Bacteria 2254
544 Ga0373929_0007087 3300035085 Bacteria 2040
545 Ga0373934_0000101 3300035086 Bacteria 29995
546 Ga0373934_0011618 3300035086 Bacteria 3313
547 Ga0373934_0032649 3300035086 Bacteria 2043
548 Ga0373934_0057862 3300035086 Bacteria 1542
549 Ga0373940_0058157 3300035088 Bacteria 1100
550 Ga0373944_0087609 3300035089 Bacteria 1036
551 Ga0373949_0050395 3300035090 Bacteria 1047
552 Ga0373951_0031707 3300035091 Bacteria 1247
553 Ga0373952_0002235 3300035092 Bacteria 3490
554 Ga0373923_0000264 3300035111 Bacteria 11443
555 Ga0373923_0004102 3300035111 Bacteria 4792
556 Ga0373923_0012992 3300035111 Bacteria 3093
557 Ga0373923_0040994 3300035111 Bacteria 1907
558 Ga0373923_0107447 3300035111 Bacteria 1236
559 Ga0373932_0028776 3300035112 Bacteria 1529
560 Ga0373936_0000263 3300035113 Bacteria 17271
561 Ga0373936_0000384 3300035113 Bacteria 15010
562 Ga0373936_0002894 3300035113 Bacteria 6410
563 Ga0373936_0010005 3300035113 Bacteria 3579
564 Ga0373936_0096227 3300035113 Bacteria 1245
565 Ga0373936_0149842 3300035113 Bacteria 1011
566 Ga0373939_0003193 3300035114 Bacteria 3843
567 Ga0373945_0015076 3300035116 Bacteria 2597
568 Ga0373945_0042604 3300035116 Bacteria 1645
569 Ga0373953_0010608 3300035117 Bacteria 3213
570 Ga0373953_0011778 3300035117 Bacteria 3080
571 Ga0373953_0044095 3300035117 Bacteria 1782
572 Ga0373954_0004360 3300035118 Bacteria 6083
573 Ga0373954_0008629 3300035118 Bacteria 4481
574 Ga0373956_0000095 3300035119 Bacteria 29811
575 Ga0373956_0018884 3300035119 Bacteria 2921
576 Ga0373956_0020931 3300035119 Bacteria 2788
577 Ga0373956_0043741 3300035119 Bacteria 1994
578 Ga0373956_0057897 3300035119 Bacteria 1752
579 Ga0373956_0088024 3300035119 Bacteria 1430
580 Ga0373957_0000385 3300035120 Bacteria 11170
581 Ga0373957_0004550 3300035120 Bacteria 4226
582 Ga0373957_0010447 3300035120 Bacteria 3069
583 Ga0373957_0017172 3300035120 Bacteria 2516
584 Ga0373957_0022949 3300035120 Bacteria 2227
585 Ga0373957_0035148 3300035120 Bacteria 1860
586 Ga0373957_0045166 3300035120 Bacteria 1668
587 Ga0373957_0047249 3300035120 Bacteria 1636
588 Ga0373957_0061095 3300035120 Bacteria 1459
589 Ga0373957_0146542 3300035120 Bacteria 967
590 Ga0373960_0017543 3300035121 Bacteria 1856
591 Ga0373943_0012651 3300035170 Bacteria 3803
592 Ga0373943_0036928 3300035170 Bacteria 2342
593 Ga0373943_0053670 3300035170 Bacteria 1991
594 Ga0373946_0020376 3300035171 Bacteria 2562
595 Ga0373955_0000002 3300035172 Bacteria 125763
596 Ga0373955_0023875 3300035172 Bacteria 3120
597 Ga0373955_0044502 3300035172 Bacteria 2391
598 Ga0373955_0131947 3300035172 Bacteria 1459
599 Ga0373942_0046116 3300035207 Bacteria 1206
600 Ga0373961_0064848 3300035241 Bacteria 1117
601 Ga0373962_0052983 3300035242 Bacteria 1173
602 Ga0316574_0016125 3300035398 Bacteria 4347
603 Ga0316574_0094095 3300035398 Bacteria 1913
604 Ga0373924_0000306 3300035410 Bacteria 15139
605 Ga0373924_0038851 3300035410 Bacteria 1942
606 Ga0373924_0058257 3300035410 Bacteria 1612
607 Ga0373924_0105579 3300035410 Bacteria 1214
608 Ga0373931_0123617 3300035691 Bacteria 1482
609 Ga0373931_0175364 3300035691 Bacteria 1266
610 Ga0373935_0017898 3300035692 Bacteria 4304
611 Ga0373935_0018974 3300035692 Bacteria 4192
612 Ga0373935_0031984 3300035692 Bacteria 3268
613 Ga0373935_0040003 3300035692 Bacteria 2940
614 Ga0373935_0286166 3300035692 Bacteria 1161
615 Ga0373927_0007355 3300035695 Bacteria 7454
616 Ga0373927_0331696 3300035695 Bacteria 1002
617 Ga0373933_0000029 3300035724 Bacteria 86829
618 Ga0373933_0001380 3300035724 Bacteria 14259
619 Ga0373933_0007481 3300035724 Bacteria 5963
620 Ga0373933_0069586 3300035724 Bacteria 2139
621 Ga0373933_0072990 3300035724 Bacteria 2090
622 Ga0373947_0002205 3300035725 Bacteria 11797
623 Ga0373947_0002535 3300035725 Bacteria 10986
624 Ga0373947_0084273 3300035725 Bacteria 1972
625 Ga0373947_0257306 3300035725 Bacteria 1156
626 Ga0373947_0304046 3300035725 Bacteria 1064
627 Ga0373937_0000362 3300036401 Bacteria 42228
628 Ga0373937_0005208 3300036401 Bacteria 11101
629 Ga0373937_0047429 3300036401 Bacteria 3930
630 Ga0373937_0078610 3300036401 Bacteria 3048
631 Ga0373937_0149356 3300036401 Bacteria 2188
632 Ga0373937_0225208 3300036401 Bacteria 1765
633 Ga0373937_0240902 3300036401 Bacteria 1704
634 Ga0373937_0252516 3300036401 Bacteria 1662
635 Ga0372808_020110 3300036459 Bacteria 959
636 Ga0316584_0082537 3300036712 Bacteria 2407
637 Ga0373925_0000665 3300037068 Bacteria 32298
638 Ga0373925_0001448 3300037068 Bacteria 20502
639 Ga0373925_0002171 3300037068 Bacteria 15985
640 Ga0373925_0031217 3300037068 Bacteria 3914
641 Ga0373925_0160648 3300037068 Bacteria 1769
642 Ga0373925_0392959 3300037068 Bacteria 1130
643 Ga0373925_0466080 3300037068 Bacteria 1035
644 Ga0395900_0242541 3300037418 Bacteria 1807
645 Ga0395898_0079991 3300037466 Bacteria 3152
646 Ga0395898_0581592 3300037466 Bacteria 1062
647 Ga0395905_0228580 3300037471 Bacteria 1740
648 Ga0395905_0447910 3300037471 Bacteria 1189
649 Ga0316581_0137974 3300037588 Bacteria 752
650 Ga0436364_0239700 3300037853 Bacteria 1631
651 Ga0436364_0455895 3300037853 Bacteria 3407
652 Ga0436364_0490334 3300037853 Bacteria 3197
653 Ga0436364_0954826 3300037853 Bacteria 5178
654 Ga0436364_0991115 3300037853 Bacteria 10432
655 Ga0436364_1135490 3300037853 Bacteria 8171
656 Ga0436364_1474170 3300037853 Bacteria 4287
657 Ga0436364_1492889 3300037853 Bacteria 100509
658 Ga0436364_1502084 3300037853 Bacteria 4831
659 Ga0436364_1513813 3300037853 Bacteria 12335
660 Ga0395901_0070186 3300038443 Bacteria 3650
661 Ga0395901_0295380 3300038443 Bacteria 1680
662 Ga0436365_0258162 3300039437 Bacteria 1999
663 Ga0436365_1661196 3300039437 Bacteria 2072
664 Ga0436365_1740178 3300039437 Bacteria 4052
665 Ga0436360_0834923 3300039438 Bacteria 934
666 Ga0436363_0595625 3300039450 Bacteria 833
667 Ga0436362_0237089 3300039453 Bacteria 1399
668 Ga0436362_0906744 3300039453 Bacteria 804
669 Ga0439436_0074006 3300041404 Bacteria 949
670 Ga0451798_0680473 3300041458 Bacteria 941
671 Ga0451833_1164257 3300041491 Bacteria 794
672 Ga0451837_0007545 3300041494 Bacteria 3239
673 Ga0451837_1389347 3300041494 Bacteria 1982
674 Ga0439449_0011013 3300042007 Bacteria 3412
675 Ga0466972_0008486 3300044658 Bacteria 5153
676 Ga0466972_0034884 3300044658 Bacteria 2463
677 Ga0466966_0113849 3300044684 Bacteria 1666
678 Ga0466966_0229156 3300044684 Bacteria 1121
679 Ga0466961_0044052 3300044693 Bacteria 2856
680 Ga0466961_0063845 3300044693 Bacteria 2340
681 Ga0466961_0346158 3300044693 Bacteria 905
682 Ga0466963_0013348 3300044694 Bacteria 5044
683 Ga0466963_0040371 3300044694 Bacteria 3059
684 Ga0466963_0075628 3300044694 Bacteria 2273
685 Ga0466963_0229704 3300044694 Bacteria 1300
686 Ga0466964_0047312 3300044706 Bacteria 1755
687 Ga0466964_0254458 3300044706 Bacteria 867
688 Ga0466971_0061573 3300044719 Bacteria 1697
689 Ga0466970_0006118 3300044765 Bacteria 5996
690 Ga0466970_0023818 3300044765 Bacteria 3201
691 Ga0466957_0002812 3300044842 Bacteria 9413
692 Ga0466957_0013330 3300044842 Bacteria 4769
693 Ga0466957_0251442 3300044842 Bacteria 1175
694 Ga0466959_0147079 3300045049 Bacteria 1662
695 Ga0466959_0223344 3300045049 Bacteria 1306
696 Ga0466958_0033367 3300045836 Bacteria 3067
697 Ga0466967_0021746 3300045976 Bacteria 5219
698 Ga0466967_0047375 3300045976 Bacteria 3747
699 Ga0466967_0211850 3300045976 Bacteria 1838
700 Ga0466967_0426560 3300045976 Bacteria 1293
701 Ga0495592_0000043 3300046454 Bacteria 122354
702 Ga0495592_0058605 3300046454 Bacteria 2839
703 Ga0495592_0097635 3300046454 Bacteria 2097
704 Ga0495592_0099233 3300046454 Bacteria 2077
705 Ga0495603_0000448 3300046455 Bacteria 22622
706 Ga0495629_0000931 3300046459 Bacteria 23551
707 Ga0495629_0004500 3300046459 Bacteria 10431
708 Ga0495629_0004652 3300046459 Bacteria 10273
709 Ga0495629_0012207 3300046459 Bacteria 6222
710 Ga0495629_0044660 3300046459 Bacteria 3109
711 Ga0495629_0081521 3300046459 Bacteria 2258
712 Ga0495629_0096002 3300046459 Bacteria 2068
713 Ga0495638_0012389 3300046460 Bacteria 5846
714 Ga0495641_0002833 3300046461 Bacteria 13414
715 Ga0495641_0004385 3300046461 Bacteria 9997
716 Ga0495641_0008639 3300046461 Bacteria 6168
717 Ga0495641_0036412 3300046461 Bacteria 2312
718 Ga0495651_0000135 3300046462 Bacteria 54990
719 Ga0495651_0000966 3300046462 Bacteria 22257
720 Ga0495651_0002221 3300046462 Bacteria 14991
721 Ga0495651_0008526 3300046462 Bacteria 7854
722 Ga0495651_0062476 3300046462 Bacteria 2849
723 Ga0495651_0074089 3300046462 Bacteria 2583
724 Ga0495653_0004969 3300046463 Bacteria 10794
725 Ga0495653_0016838 3300046463 Bacteria 5948
726 Ga0495653_0018600 3300046463 Bacteria 5639
727 Ga0495653_0033692 3300046463 Bacteria 4055
728 Ga0495653_0040287 3300046463 Bacteria 3651
729 Ga0495653_0162540 3300046463 Bacteria 1549
730 Ga0495653_0203840 3300046463 Bacteria 1340
731 Ga0495653_0279244 3300046463 Bacteria 1097
732 Ga0495653_0435284 3300046463 Bacteria 827
733 Ga0495580_0009782 3300046472 Bacteria 7521
734 Ga0495580_0061619 3300046472 Bacteria 2633
735 Ga0495582_0002660 3300046473 Bacteria 9970
736 Ga0495582_0005191 3300046473 Bacteria 7284
737 Ga0495582_0037012 3300046473 Bacteria 2684
738 Ga0495582_0104284 3300046473 Bacteria 1589
739 Ga0495639_0000703 3300046475 Bacteria 15322
740 Ga0495662_0004713 3300046476 Bacteria 6829
741 Ga0495662_0005311 3300046476 Bacteria 6458
742 Ga0495662_0013949 3300046476 Bacteria 3911
743 Ga0495662_0019432 3300046476 Bacteria 3286
744 Ga0495664_0003738 3300046477 Bacteria 8301
745 Ga0495664_0031476 3300046477 Bacteria 3110
746 Ga0495664_0081001 3300046477 Bacteria 1946
747 Ga0495594_0079930 3300046499 Bacteria 1825
748 Ga0495608_0000016 3300046511 Bacteria 196738
749 Ga0495608_0004214 3300046511 Bacteria 10308
750 Ga0495608_0007788 3300046511 Bacteria 7539
751 Ga0495608_0012724 3300046511 Bacteria 5839
752 Ga0495608_0023485 3300046511 Bacteria 4226
753 Ga0495608_0033389 3300046511 Bacteria 3478
754 Ga0495608_0070195 3300046511 Bacteria 2286
755 Ga0495608_0101783 3300046511 Bacteria 1852
756 Ga0495618_0004534 3300046514 Bacteria 8535
757 Ga0495618_0049436 3300046514 Bacteria 2655
758 Ga0495618_0086487 3300046514 Bacteria 2004
759 Ga0495628_0000034 3300046516 Bacteria 115264
760 Ga0495628_0068789 3300046516 Bacteria 2761
761 Ga0495628_0101714 3300046516 Bacteria 2218
762 Ga0495628_0108285 3300046516 Bacteria 2139
763 Ga0495628_0169026 3300046516 Bacteria 1658
764 Ga0495630_0004529 3300046517 Bacteria 9737
765 Ga0495630_0056328 3300046517 Bacteria 2946
766 Ga0495630_0075412 3300046517 Bacteria 2541
767 Ga0495630_0222639 3300046517 Bacteria 1440
768 Ga0495630_0273858 3300046517 Bacteria 1289
769 Ga0495630_0474923 3300046517 Bacteria 958
770 Ga0495652_0000174 3300046529 Bacteria 73044
771 Ga0495652_0004293 3300046529 Bacteria 13670
772 Ga0495652_0066976 3300046529 Bacteria 3011
773 Ga0495652_0081786 3300046529 Bacteria 2663
774 Ga0495652_0087805 3300046529 Bacteria 2550
775 Ga0495652_0131273 3300046529 Bacteria 1983
776 Ga0495652_0139783 3300046529 Bacteria 1905
777 Ga0495652_0145591 3300046529 Bacteria 1857
778 Ga0495665_0003719 3300046531 Bacteria 8272
779 Ga0495665_0004882 3300046531 Bacteria 7228
780 Ga0495665_0086288 3300046531 Bacteria 1649
781 Ga0495640_0007019 3300046533 Bacteria 8865
782 Ga0495640_0084868 3300046533 Bacteria 2099
783 Ga0495640_0112416 3300046533 Bacteria 1778
784 Ga0495640_0155559 3300046533 Bacteria 1467
785 Ga0495640_0194386 3300046533 Bacteria 1288
786 Ga0495640_0212207 3300046533 Bacteria 1223
787 Ga0495640_0303809 3300046533 Bacteria 991
788 Ga0495586_0003326 3300046535 Bacteria 8626
789 Ga0495586_0012499 3300046535 Bacteria 4504
790 Ga0495586_0184986 3300046535 Bacteria 1179
791 Ga0495587_0000044 3300046536 Bacteria 108443
792 Ga0495587_0005394 3300046536 Bacteria 8355
793 Ga0495587_0016948 3300046536 Bacteria 4530
794 Ga0495587_0027227 3300046536 Bacteria 3481
795 Ga0495587_0199888 3300046536 Bacteria 1130
796 Ga0495645_0022548 3300046543 Bacteria 4556
797 Ga0495645_0030241 3300046543 Bacteria 3943
798 Ga0495645_0034926 3300046543 Bacteria 3665
799 Ga0495645_0037566 3300046543 Bacteria 3531
800 Ga0495645_0051963 3300046543 Bacteria 2982
801 Ga0495645_0375636 3300046543 Bacteria 910
802 Ga0495622_0094570 3300046557 Bacteria 1372
803 Ga0495667_0000052 3300046559 Bacteria 108432
804 Ga0495667_0001554 3300046559 Bacteria 15235
805 Ga0495667_0003726 3300046559 Bacteria 10254
806 Ga0495667_0007717 3300046559 Bacteria 7292
807 Ga0495667_0015859 3300046559 Bacteria 5094
808 Ga0495667_0017126 3300046559 Bacteria 4894
809 Ga0495667_0027228 3300046559 Bacteria 3853
810 Ga0495667_0066992 3300046559 Bacteria 2346
811 Ga0495667_0112369 3300046559 Bacteria 1760
812 Ga0495667_0259858 3300046559 Bacteria 1104
813 Ga0495634_0002898 3300046642 Bacteria 14076
814 Ga0495634_0018001 3300046642 Bacteria 5034
815 Ga0495634_0056891 3300046642 Bacteria 2612
816 Ga0495634_0141921 3300046642 Bacteria 1524
817 Ga0495625_0026086 3300046660 Bacteria 4419
818 Ga0495635_0000862 3300046663 Bacteria 19903
819 Ga0495635_0011411 3300046663 Bacteria 6232
820 Ga0495635_0030524 3300046663 Bacteria 3745
821 Ga0495635_0039128 3300046663 Bacteria 3282
822 Ga0495635_0072092 3300046663 Bacteria 2367
823 Ga0495635_0088831 3300046663 Bacteria 2114
824 Ga0495635_0136665 3300046663 Bacteria 1670
825 Ga0495635_0203960 3300046663 Bacteria 1340
826 Ga0495635_0257941 3300046663 Bacteria 1174
827 Ga0495635_0294465 3300046663 Bacteria 1089
828 Ga0495588_0001192 3300046674 Bacteria 11221
829 Ga0495588_0043863 3300046674 Bacteria 2289
830 Ga0495588_0191399 3300046674 Bacteria 1080
831 Ga0495657_0000015 3300046675 Bacteria 187657
832 Ga0495657_0003936 3300046675 Bacteria 11921
833 Ga0495657_0009695 3300046675 Bacteria 7281
834 Ga0495657_0011699 3300046675 Bacteria 6546
835 Ga0495657_0013105 3300046675 Bacteria 6128
836 Ga0495657_0015891 3300046675 Bacteria 5494
837 Ga0495657_0015957 3300046675 Bacteria 5480
838 Ga0495657_0045712 3300046675 Bacteria 2969
839 Ga0495657_0048506 3300046675 Bacteria 2864
840 Ga0495657_0178971 3300046675 Bacteria 1302
841 Ga0495599_0000035 3300046678 Bacteria 103981
842 Ga0495599_0009512 3300046678 Bacteria 5943
843 Ga0495599_0121628 3300046678 Bacteria 1622
844 Ga0495599_0180222 3300046678 Bacteria 1302
845 Ga0495599_0205821 3300046678 Bacteria 1208
846 Ga0495623_0000767 3300046679 Bacteria 21507
847 Ga0495623_0043441 3300046679 Bacteria 2860
848 Ga0495623_0065142 3300046679 Bacteria 2279
849 Ga0495623_0084647 3300046679 Bacteria 1956
850 Ga0495623_0204589 3300046679 Bacteria 1133
851 Ga0495623_0274394 3300046679 Bacteria 940
852 Ga0495646_0002176 3300046680 Bacteria 11936
853 Ga0495646_0022208 3300046680 Bacteria 4003
854 Ga0495646_0053352 3300046680 Bacteria 2438
855 Ga0495646_0062723 3300046680 Bacteria 2209
856 Ga0495646_0122185 3300046680 Bacteria 1472
857 Ga0495646_0142203 3300046680 Bacteria 1340
858 Ga0495658_0004230 3300046683 Bacteria 7062
859 Ga0495658_0014284 3300046683 Bacteria 4055
860 Ga0495658_0209385 3300046683 Bacteria 1218
861 Ga0495613_0040458 3300046689 Bacteria 3453
862 Ga0495613_0063510 3300046689 Bacteria 2702
863 Ga0495613_0082889 3300046689 Bacteria 2328
864 Ga0495613_0166203 3300046689 Bacteria 1567
865 Ga0495613_0315677 3300046689 Bacteria 1079
866 Ga0495624_0012749 3300046690 Bacteria 5739
867 Ga0495624_0021323 3300046690 Bacteria 4297
868 Ga0495624_0093165 3300046690 Bacteria 1857
869 Ga0495670_0077873 3300046691 Bacteria 1686
870 Ga0495671_0006448 3300046692 Bacteria 6775
871 Ga0495589_0005208 3300046794 Bacteria 6878
872 Ga0495600_0004974 3300046809 Bacteria 7982
873 Ga0495600_0007374 3300046809 Bacteria 6726
874 Ga0495600_0048924 3300046809 Bacteria 2758
875 Ga0495600_0072957 3300046809 Bacteria 2241
876 Ga0495600_0111800 3300046809 Bacteria 1778
877 Ga0495600_0128487 3300046809 Bacteria 1647
878 Ga0495600_0163282 3300046809 Bacteria 1439
879 Ga0495581_0003852 3300047315 Bacteria 8631
880 Ga0495581_0035248 3300047315 Bacteria 2895
881 Ga0495581_0099794 3300047315 Bacteria 1686
882 Ga0495604_0000048 3300047317 Bacteria 108810
883 Ga0495604_0024556 3300047317 Bacteria 4808
884 Ga0495604_0030884 3300047317 Bacteria 4251
885 Ga0495604_0085167 3300047317 Bacteria 2359
886 Ga0495604_0098263 3300047317 Bacteria 2157
887 Ga0495604_0133042 3300047317 Bacteria 1785
888 Ga0495604_0260255 3300047317 Bacteria 1179
889 Ga0495674_0005311 3300047319 Bacteria 12358
890 Ga0495674_0013115 3300047319 Bacteria 7794
891 Ga0495674_0033330 3300047319 Bacteria 4667
892 Ga0495674_0072542 3300047319 Bacteria 2969
893 Ga0495674_0119404 3300047319 Bacteria 2228
894 Ga0495674_0162109 3300047319 Bacteria 1870
895 Ga0495674_0193690 3300047319 Bacteria 1688
896 Ga0495674_0248746 3300047319 Bacteria 1463
897 Ga0495676_0003200 3300047321 Bacteria 14801
898 Ga0495676_0030991 3300047321 Bacteria 4529
899 Ga0495676_0065365 3300047321 Bacteria 2823
900 Ga0495676_0075176 3300047321 Bacteria 2584
901 Ga0495676_0079253 3300047321 Bacteria 2498
902 Ga0495676_0127266 3300047321 Bacteria 1844
903 Ga0495676_0455862 3300047321 Bacteria 843
904 Ga0495680_0000069 3300047322 Bacteria 88766
905 Ga0495680_0004112 3300047322 Bacteria 13995
906 Ga0495680_0010588 3300047322 Bacteria 8225
907 Ga0495680_0011817 3300047322 Bacteria 7711
908 Ga0495680_0022401 3300047322 Bacteria 5264
909 Ga0495680_0027484 3300047322 Bacteria 4673
910 Ga0495680_0028813 3300047322 Bacteria 4551
911 Ga0495680_0067563 3300047322 Bacteria 2732
912 Ga0495680_0109944 3300047322 Bacteria 2043
913 Ga0495680_0116408 3300047322 Bacteria 1976
914 Ga0495680_0172113 3300047322 Bacteria 1567
915 Ga0495680_0224195 3300047322 Bacteria 1340
916 Ga0495687_004640 3300047443 Bacteria 9169
917 Ga0495675_0000685 3300047444 Bacteria 21288
918 Ga0495675_0004478 3300047444 Bacteria 8464
919 Ga0495675_0016613 3300047444 Bacteria 4655
920 Ga0495675_0037710 3300047444 Bacteria 3078
921 Ga0495675_0143150 3300047444 Bacteria 1481
922 Ga0495675_0251588 3300047444 Bacteria 1061
923 Ga0495675_0275965 3300047444 Bacteria 1003
924 Ga0495681_0035320 3300047470 Bacteria 2482
925 Ga0495684_0003133 3300047471 Bacteria 12974
926 Ga0495684_0004619 3300047471 Bacteria 10752
927 Ga0495684_0007538 3300047471 Bacteria 8421
928 Ga0495684_0023007 3300047471 Bacteria 4792
929 Ga0495684_0025322 3300047471 Bacteria 4562
930 Ga0495684_0064696 3300047471 Bacteria 2779
931 Ga0495684_0084760 3300047471 Bacteria 2403
932 Ga0495593_0024245 3300047673 Bacteria 3363
933 Ga0495602_0001615 3300048088 Bacteria 22410
934 Ga0495602_0018075 3300048088 Bacteria 7052
935 Ga0495602_0026606 3300048088 Bacteria 5577
936 Ga0495602_0037844 3300048088 Bacteria 4469
937 Ga0495602_0038337 3300048088 Bacteria 4432
938 Ga0495602_0041369 3300048088 Bacteria 4210
939 Ga0495602_0072982 3300048088 Bacteria 2923
940 Ga0495602_0082140 3300048088 Bacteria 2705
941 Ga0495602_0147407 3300048088 Bacteria 1854
942 Ga0495602_0182705 3300048088 Bacteria 1616
943 Ga0495602_0350017 3300048088 Bacteria 1066
944 Ga0495614_0023127 3300048089 Bacteria 2680
945 Ga0496100_0008298 3300048903 Bacteria 5790
946 Ga0496100_0022571 3300048903 Bacteria 3809
947 Ga0496100_0039952 3300048903 Bacteria 2982
948 Ga0496100_0078985 3300048903 Bacteria 2216
949 Ga0496100_0140956 3300048903 Bacteria 1709
950 Ga0496100_0213672 3300048903 Bacteria 1412
951 Ga0496101_0020981 3300048904 Bacteria 4483
952 Ga0496101_0067646 3300048904 Bacteria 2609
953 Ga0496101_0124435 3300048904 Bacteria 1953
954 Ga0496101_0128848 3300048904 Bacteria 1920
955 Ga0496101_0129321 3300048904 Bacteria 1916
956 Ga0496101_0214425 3300048904 Bacteria 1492
957 Ga0496101_0228922 3300048904 Bacteria 1444
958 Ga0496102_0000929 3300048905 Bacteria 27594
959 Ga0496102_0058675 3300048905 Bacteria 3517
960 Ga0496102_0076872 3300048905 Bacteria 3072
961 Ga0496102_0091753 3300048905 Bacteria 2812
962 Ga0496102_0153131 3300048905 Bacteria 2167
963 Ga0496103_0034521 3300048906 Bacteria 3093
964 Ga0496104_0000263 3300048907 Bacteria 46252
965 Ga0496104_0002013 3300048907 Bacteria 17642
966 Ga0496104_0005064 3300048907 Bacteria 11495
967 Ga0496104_0046865 3300048907 Bacteria 4073
968 Ga0496104_0070149 3300048907 Bacteria 3331
969 Ga0496104_0147530 3300048907 Bacteria 2259
970 Ga0496104_0152648 3300048907 Bacteria 2216
971 Ga0496104_0238384 3300048907 Bacteria 1731
972 Ga0496104_0273903 3300048907 Bacteria 1600
973 Ga0496105_0001788 3300048908 Bacteria 15363
974 Ga0496105_0025988 3300048908 Bacteria 4771
975 Ga0496105_0035101 3300048908 Bacteria 4126
976 Ga0496105_0039054 3300048908 Bacteria 3911
977 Ga0496105_0047571 3300048908 Bacteria 3540
978 Ga0496105_0067920 3300048908 Bacteria 2944
979 Ga0496105_0084410 3300048908 Bacteria 2623
980 Ga0496106_0004569 3300048909 Bacteria 10264
981 Ga0496106_0052854 3300048909 Bacteria 3066
982 Ga0496106_0174016 3300048909 Bacteria 1707
983 Ga0496106_0333026 3300048909 Bacteria 1219
984 Ga0496106_0573512 3300048909 Bacteria 905
985 Ga0496107_0021454 3300048910 Bacteria 4564
986 Ga0496107_0045441 3300048910 Bacteria 3159
987 Ga0496107_0063357 3300048910 Bacteria 2679
988 Ga0496107_0095309 3300048910 Bacteria 2177
989 Ga0496107_0202453 3300048910 Bacteria 1475
990 Ga0496107_0260182 3300048910 Bacteria 1291
991 Ga0496108_0007549 3300048911 Bacteria 8813
992 Ga0496108_0020982 3300048911 Bacteria 5370
993 Ga0496108_0074176 3300048911 Bacteria 2872
994 Ga0496108_0125293 3300048911 Bacteria 2205
995 Ga0496108_0238441 3300048911 Bacteria 1582
996 Ga0496108_0369867 3300048911 Bacteria 1251
997 Ga0496109_0007402 3300048912 Bacteria 9291
998 Ga0496109_0023097 3300048912 Bacteria 5517
999 Ga0496109_0029729 3300048912 Bacteria 4895
1000 Ga0496109_0032848 3300048912 Bacteria 4668
1001 Ga0496109_0039821 3300048912 Bacteria 4255
1002 Ga0496109_0050283 3300048912 Bacteria 3796
1003 Ga0496109_0220544 3300048912 Bacteria 1783
1004 Ga0496109_0312651 3300048912 Bacteria 1482
1005 Ga0496109_0407063 3300048912 Bacteria 1285
1006 Ga0496109_0538493 3300048912 Bacteria 1102
1007 Ga0496110_0002708 3300048913 Bacteria 13397
1008 Ga0496110_0022446 3300048913 Bacteria 5359
1009 Ga0496110_0033389 3300048913 Bacteria 4451
1010 Ga0496110_0173402 3300048913 Bacteria 1957
1011 Ga0496110_0445362 3300048913 Bacteria 1180
1012 Ga0496111_0002537 3300048914 Bacteria 11024
1013 Ga0496111_0080832 3300048914 Bacteria 2372
1014 Ga0496111_0084454 3300048914 Bacteria 2321
1015 Ga0496111_0191585 3300048914 Bacteria 1520
1016 Ga0496111_0274372 3300048914 Bacteria 1251
1017 Ga0496112_0000159 3300048915 Bacteria 42547
1018 Ga0496112_0014254 3300048915 Bacteria 7366
1019 Ga0496112_0024687 3300048915 Bacteria 5762
1020 Ga0496112_0106498 3300048915 Bacteria 2773
1021 Ga0496112_0177747 3300048915 Bacteria 2093
1022 Ga0496113_0006554 3300048916 Bacteria 7391
1023 Ga0496113_0027455 3300048916 Bacteria 4081
1024 Ga0496113_0073559 3300048916 Bacteria 2604
1025 Ga0496113_0188925 3300048916 Bacteria 1635
1026 Ga0496113_0287282 3300048916 Bacteria 1315
1027 Ga0496114_0012899 3300048917 Bacteria 6694
1028 Ga0496114_0028233 3300048917 Bacteria 4603
1029 Ga0496114_0048829 3300048917 Bacteria 3521
1030 Ga0496114_0056772 3300048917 Bacteria 3267
1031 Ga0496114_0062390 3300048917 Bacteria 3119
1032 Ga0496114_0079216 3300048917 Bacteria 2773
1033 Ga0496114_0092814 3300048917 Bacteria 2565
1034 Ga0496114_0670978 3300048917 Bacteria 910
1035 Ga0496115_0021236 3300048918 Bacteria 5013
1036 Ga0496115_0031981 3300048918 Bacteria 4149
1037 Ga0496115_0062701 3300048918 Bacteria 2999
1038 Ga0496115_0168843 3300048918 Bacteria 1809
1039 Ga0496115_0389467 3300048918 Bacteria 1132
1040 Ga0496122_0196991 3300048925 Bacteria 1182
1041 Ga0496125_0310490 3300048928 Bacteria 961
1042 Ga0496126_0027315 3300048929 Bacteria 5453
1043 Ga0496126_0031554 3300048929 Bacteria 5003
1044 Ga0496126_0037923 3300048929 Bacteria 4488
1045 Ga0496126_0211493 3300048929 Bacteria 1633
1046 Ga0501031_0003149 3300049568 Bacteria 10581
1047 Ga0501031_0008650 3300049568 Bacteria 6620
1048 Ga0501031_0043366 3300049568 Bacteria 2936
1049 Ga0501032_0029432 3300049569 Bacteria 3768
1050 Ga0501032_0033532 3300049569 Bacteria 3517
1051 Ga0501032_0151016 3300049569 Bacteria 1527
1052 Ga0501033_0006830 3300049570 Bacteria 8906
1053 Ga0501033_0007168 3300049570 Bacteria 8699
1054 Ga0501033_0041059 3300049570 Bacteria 3453
1055 Ga0501033_0083715 3300049570 Bacteria 2338
1056 Ga0501034_0035028 3300049571 Bacteria 5091
1057 Ga0501034_0067171 3300049571 Bacteria 3599
1058 Ga0501034_0103409 3300049571 Bacteria 2842
1059 Ga0501034_0145978 3300049571 Bacteria 2343
1060 Ga0501036_0007634 3300049572 Bacteria 8828
1061 Ga0501036_0090011 3300049572 Bacteria 2592
1062 Ga0501036_0181637 3300049572 Bacteria 1771
1063 Ga0501036_0237947 3300049572 Bacteria 1527
1064 Ga0501037_0094556 3300049573 Bacteria 2161
1065 Ga0501037_0335809 3300049573 Bacteria 1044
1066 Ga0501038_0005688 3300049574 Bacteria 11565
1067 Ga0501038_0105460 3300049574 Bacteria 2341
1068 Ga0501039_0001008 3300049575 Bacteria 20519
1069 Ga0501039_0004674 3300049575 Bacteria 10360
1070 Ga0501039_0171264 3300049575 Bacteria 1707
1071 Ga0501039_0618121 3300049575 Bacteria 849
1072 Ga0501040_0016271 3300049576 Bacteria 4920
1073 Ga0501040_0230685 3300049576 Bacteria 1318
1074 Ga0501041_0018351 3300049577 Bacteria 4168
1075 Ga0501041_0121766 3300049577 Bacteria 1622
1076 Ga0501042_0103845 3300049578 Bacteria 2045
1077 Ga0501043_0087121 3300049579 Bacteria 2454
1078 Ga0501043_0114972 3300049579 Bacteria 2112
1079 Ga0501043_0173761 3300049579 Bacteria 1680
1080 Ga0501043_0498774 3300049579 Bacteria 910
1081 Ga0501046_0013645 3300049580 Bacteria 6872
1082 Ga0501047_0006153 3300049581 Bacteria 11284
1083 Ga0501047_0011211 3300049581 Bacteria 8481
1084 Ga0501047_0394547 3300049581 Bacteria 1217
1085 Ga0501047_0676130 3300049581 Bacteria 850
1086 Ga0501048_0001302 3300049582 Bacteria 18920
1087 Ga0501048_0002817 3300049582 Bacteria 13277
1088 Ga0501048_0124358 3300049582 Bacteria 1824
1089 Ga0501067_0137914 3300049583 Bacteria 1358
1090 Ga0501068_0304002 3300049584 Bacteria 1021
1091 Ga0501070_0028990 3300049586 Bacteria 4642
1092 Ga0501070_0145471 3300049586 Bacteria 1956
1093 Ga0501070_0289775 3300049586 Bacteria 1334
1094 Ga0501071_0024723 3300049587 Bacteria 4201
1095 Ga0501072_0027284 3300049588 Bacteria 4455
1096 Ga0501072_0375380 3300049588 Bacteria 1128
1097 Ga0501074_0353461 3300049590 Bacteria 1043
1098 Ga0501075_0006844 3300049591 Bacteria 7870
1099 Ga0501076_0007635 3300049592 Bacteria 7875
1100 Ga0501077_0032713 3300049593 Bacteria 3311
1101 Ga0501079_0168435 3300049741 Bacteria 1708
1102 Ga0501035_0011100 3300049822 Bacteria 8341
1103 Ga0501035_0011350 3300049822 Bacteria 8258
1104 Ga0501035_0710947 3300049822 Bacteria 809
1105 Ga0501044_0007546 3300049823 Bacteria 11959
1106 Ga0501044_0015982 3300049823 Bacteria 8075
1107 Ga0501044_0227522 3300049823 Bacteria 1814
1108 Ga0501044_0270899 3300049823 Bacteria 1633
1109 Ga0501045_0000128 3300049824 Bacteria 39951
1110 Ga0501045_0035949 3300049824 Bacteria 3597
1111 Ga0501045_0197373 3300049824 Bacteria 1499
1112 nmdc:mga03n38_30676_c1 3300050490 Bacteria 2262
1113 nmdc:mga00v17_231881_c1 3300050491 Bacteria 1196
1114 nmdc:mga00v17_29413_c1 3300050491 Bacteria 3224
1115 nmdc:mga00v17_68711_c1 3300050491 Bacteria 2190
1116 nmdc:mga0yw44_5475_c1 3300050492 Bacteria 6005
1117 nmdc:mga0yw44_67171_c1 3300050492 Bacteria 2215
1118 nmdc:mga06z11_302671_c1 3300050494 Bacteria 951
1119 nmdc:mga05p37_43634_c1 3300050507 Bacteria 5517
1120 nmdc:mga09592_357055_c1 3300050508 Bacteria 1265
1121 nmdc:mga08y16_43759_c1 3300050511 Bacteria 4693
1122 nmdc:mga08y16_71631_c1 3300050511 Bacteria 3612
1123 nmdc:mga08y16_95906_c1 3300050511 Bacteria 3089
1124 nmdc:mga0n895_201902_c1 3300050512 Bacteria 2019
1125 nmdc:mga0n895_23448_c1 3300050512 Bacteria 5800
1126 nmdc:mga0n895_6914_c1 3300050512 Bacteria 9693
1127 nmdc:mga0rr50_3006_c1 3300050513 Bacteria 9643
1128 nmdc:mga0rr50_523891_c1 3300050513 Bacteria 1008
1129 nmdc:mga0rr50_73089_c1 3300050513 Bacteria 2621
1130 nmdc:mga08x19_11321_c1 3300050514 Bacteria 5369
1131 nmdc:mga08x19_1282_c1 3300050514 Bacteria 15600
1132 nmdc:mga08x19_87055_c1 3300050514 Bacteria 2057
1133 nmdc:mga0sz30_49429_c1 3300050516 Bacteria 1263
1134 Ga0495601_0002951 3300053077 Bacteria 9667
1135 Ga0495601_0017372 3300053077 Bacteria 4366
1136 Ga0495601_0018474 3300053077 Bacteria 4245
1137 Ga0495601_0022322 3300053077 Bacteria 3884
1138 Ga0495601_0032112 3300053077 Bacteria 3266
1139 Ga0495601_0042317 3300053077 Bacteria 2857
1140 Ga0495601_0094479 3300053077 Bacteria 1927
1141 Ga0495601_0139427 3300053077 Bacteria 1581
1142 Ga0495612_0011079 3300053078 Bacteria 3639
1143 Ga0495612_0011425 3300053078 Bacteria 3580
1144 Ga0495612_0094971 3300053078 Bacteria 1266
1145 Ga0495655_0010282 3300053083 Bacteria 1842
1146 Ga0495595_0000162 3300053084 Bacteria 26749
1147 Ga0495595_0005098 3300053084 Bacteria 5308
1148 Ga0495595_0012128 3300053084 Bacteria 3617
1149 Ga0495595_0053589 3300053084 Bacteria 1874
1150 Ga0495619_0009943 3300053085 Bacteria 5990
1151 Ga0495619_0013593 3300053085 Bacteria 5128
1152 Ga0495619_0014724 3300053085 Bacteria 4940
1153 Ga0500644_0038556 3300053088 Bacteria 1569
1154 Ga0500583_0147065 3300053092 Bacteria 1172
1155 Ga0500641_0005009 3300053096 Bacteria 4699
1156 Ga0500556_0000086 3300053104 Bacteria 87063
1157 Ga0500560_002305 3300053107 Bacteria 3610
1158 Ga0500562_001846 3300053108 Bacteria 5313
1159 Ga0500593_000565 3300053117 Bacteria 14324
1160 Ga0500655_000708 3300053133 Bacteria 6617
1161 Ga0500577_0012772 3300053142 Bacteria 2548
1162 Ga0501084_0006106 3300054114 Bacteria 9905
1163 Ga0501084_0710250 3300054114 Bacteria 848
1164 Ga0501082_0019284 3300060353 Bacteria 5879
1165 Ga0530510_0004113 3300061734 Bacteria 10043
1166 2643946882 2643221587 Bacteria 7586415
1167 2644034294 2643221604 Bacteria 5014917
1168 2644098690 2643221617 Bacteria 5139111
1169 2644116051 2643221620 Bacteria 5134593
1170 2644228749 2643221641 Bacteria 4490190
1171 2644435063 2643221677 Bacteria 7584031
1172 2644457903 2643221681 Bacteria 3707866
1173 2645722761 2643221961 Bacteria 3919167
1174 2645725733 2643221962 Bacteria 3874254
1175 2676484398 2675903059 Bacteria 8644972
1176 2738871536 2738541305 Bacteria 4910150
1177 2740166171 2739367898 Bacteria 4367674
1178 2774393490 2773857762 Bacteria 5971770
1179 2793977387 2791355406 Bacteria 11364898
1180 2808872498 2808606365 Bacteria 4301966
1181 2809195622 2808606439 Bacteria 5952208
1182 2812333542 2811994874 Bacteria 5367947
1183 2812350522 2811994878 Bacteria 5992952
1184 2819740200 2818991472 Bacteria 10089953
1185 2856744110 2856741275 Bacteria 8096094
1186 2862180851 2862178590 Bacteria 8583590
1187 2862575526 2862574272 Bacteria 10567477
1188 2891403566 2891395885 Bacteria 9251614
1189 2891564343 2891562705 Bacteria 8039471
1190 2891971876 2891968417 Bacteria 5821697
1191 2912762398 2912757875 Bacteria 7940295
1192 2984579090 2984576629 Bacteria 4248407
1193 2990260016 2990256926 Bacteria 4252839
1194 2995464865 2995463766 Bacteria 8577691
1195 8003315206 8003314358 Bacteria 10575343
1196 8025536874 8025530807 Bacteria 8495698
1197 8047716709 8047710418 Bacteria 11023148
1198 8047903554 8047893842 Bacteria 11723082
1199 8048356813 8048356638 Bacteria 11044339
1200 8048379008 8048369669 Bacteria 11666822
1201 8048388113 8048379754 Bacteria 11877923
1202 8054610045 8054609563 Bacteria 5170090
1203 8055174723 8055172936 Bacteria 9305943
1204 Ga0070709_10077157
1205 JGI24739J22299_10074272
1206 JGI24743J22301_10009419
1207 JGI24738J21930_10005489
1208 JGI25404J52841_10010555
1209 Ga0070658_10049656
1210 Ga0070658_10164455
1211 Ga0070683_100145261
1212 Ga0070690_100158485
1213 Ga0070690_100280803
1214 Ga0070670_100027661
1215 Ga0068869_100009064
1216 Ga0068869_100013540
1217 Ga0068869_100091214
1218 Ga0068869_100150784
1219 Ga0070666_10043691
1220 Ga0070666_10107835
1221 Ga0070680_100025795
1222 Ga0070680_100039708
1223 Ga0070682_100011309
1224 Ga0070682_100158280
1225 Ga0070682_100219967
1226 Ga0070682_100308236
1227 Ga0068868_100001738
1228 Ga0068868_100116560
1229 Ga0070660_100017931
1230 Ga0070660_100103162
1231 Ga0070689_100061491
1232 Ga0070691_10003832
1233 Ga0070687_100012858
1234 Ga0070687_100017559
1235 Ga0070661_100004959
1236 Ga0070661_100039922
1237 Ga0070692_10004181
1238 Ga0070692_10046146
1239 Ga0070692_10062498
1240 Ga0070692_10168752
1241 Ga0070668_100127331
1242 Ga0070675_100006254
1243 Ga0070675_100012160
1244 Ga0070671_100012625
1245 Ga0070671_100224350
1246 Ga0070673_100197398
1247 Ga0070688_100208277
1248 Ga0070659_100045613
1249 Ga0070659_100049396
1250 Ga0070659_100117742
1251 Ga0070659_100191879
1252 Ga0070709_10001827
1253 Ga0070709_10017307
1254 Ga0070714_100000076
1255 Ga0070714_100000630
1256 Ga0070714_100016313
1257 Ga0070714_100022645
1258 Ga0070714_100026551
1259 Ga0070714_100032567
1260 Ga0070714_100071758
1261 Ga0070714_100287565
1262 Ga0070714_100290885
1263 Ga0070713_100009273
1264 Ga0070713_100052282
1265 Ga0070713_100137108
1266 Ga0070713_100191388
1267 Ga0070713_100199361
1268 Ga0070713_100212874
1269 Ga0070713_100469101
1270 Ga0070713_100664113
1271 Ga0070710_10000145
1272 Ga0070710_10003172
1273 Ga0070710_10078199
1274 Ga0070710_10090224
1275 Ga0070701_10012256
1276 Ga0070711_100235448
1277 Ga0070711_100300878
1278 Ga0070711_100389726
1279 Ga0070705_100376474
1280 Ga0070700_100031520
1281 Ga0070700_100342360
1282 Ga0070708_100036965
1283 Ga0070708_100055285
1284 Ga0070708_100298384
1285 Ga0070663_100001480
1286 Ga0070663_100005175
1287 Ga0070663_100056286
1288 Ga0070663_100062969
1289 Ga0070678_100002453
1290 Ga0070678_100131008
1291 Ga0070678_100229817
1292 Ga0070662_100005331
1293 Ga0070681_10007532
1294 Ga0070681_10119510
1295 Ga0068867_100178930
1296 Ga0070685_10011347
1297 Ga0070685_10231373
1298 Ga0070706_100000349
1299 Ga0070706_100000813
1300 Ga0070706_100002736
1301 Ga0070706_100006549
1302 Ga0070706_100037946
1303 Ga0070706_100077404
1304 Ga0070706_100087281
1305 Ga0070707_100000381
1306 Ga0070707_100000524
1307 Ga0070707_100009405
1308 Ga0070707_100040335
1309 Ga0070707_100078480
1310 Ga0070707_100129806
1311 Ga0070707_100130763
1312 Ga0070707_100212185
1313 Ga0070698_100000951
1314 Ga0070698_100001154
1315 Ga0070698_100001699
1316 Ga0070698_100003087
1317 Ga0070698_100022634
1318 Ga0070698_100031767
1319 Ga0070698_100208451
1320 Ga0070698_100239085
1321 Ga0070698_100317030
1322 Ga0070699_100006729
1323 Ga0070679_100011412
1324 Ga0070679_100092058
1325 Ga0070679_100152529
1326 Ga0070684_100059161
1327 Ga0070684_100131961
1328 Ga0070697_100000447
1329 Ga0070697_100012490
1330 Ga0070697_100043185
1331 Ga0068853_100209106
1332 Ga0070672_100060681
1333 Ga0070672_100427122
1334 Ga0070672_100448610
1335 Ga0070686_100011554
1336 Ga0070686_100202084
1337 Ga0070695_100041487
1338 Ga0070696_100026054
1339 Ga0070693_100025368
1340 Ga0070693_100091402
1341 Ga0070665_100120949
1342 Ga0070665_100291786
1343 Ga0070704_100060378
1344 Ga0070704_100119718
1345 Ga0068855_100162206
1346 Ga0068855_100223669
1347 Ga0070664_100043727
1348 Ga0070664_100087969
1349 Ga0070664_100194287
1350 Ga0068857_100008010
1351 Ga0068857_100011670
1352 Ga0068857_100193668
1353 Ga0068857_100258507
1354 Ga0068854_100026349
1355 Ga0068854_100034654
1356 Ga0068856_100011106
1357 Ga0068856_100135540
1358 Ga0068856_100256307
1359 Ga0068856_100427453
1360 Ga0070702_100003036
1361 Ga0068852_100066276
1362 Ga0068852_100183518
1363 Ga0068859_100034967
1364 Ga0068859_100167028
1365 Ga0068864_100003373
1366 Ga0068864_100044849
1367 Ga0068864_100276717
1368 Ga0068861_100062872
1369 Ga0068851_10014136
1370 Ga0068870_10002608
1371 Ga0068870_10015521
1372 Ga0068863_100017352
1373 Ga0068863_100115786
1374 Ga0068863_100267039
1375 Ga0068863_100360693
1376 Ga0068858_100021460
1377 Ga0068858_100071310
1378 Ga0068858_100123031
1379 Ga0068860_100396126
1380 Ga0068862_100052069
1381 Ga0068862_100154589
1382 Ga0081455_10002124
1383 Ga0081455_10094227
1384 Ga0081540_1000582
1385 Ga0081540_1000756
1386 Ga0081539_10000127
1387 Ga0081539_10005011
1388 Ga0081539_10027065
1389 Ga0070717_10003556
1390 Ga0070717_10029458
1391 Ga0070717_10032114
1392 Ga0070717_10033576
1393 Ga0070717_10038774
1394 Ga0070717_10043560
1395 Ga0070717_10067857
1396 Ga0070717_10119033
1397 Ga0070717_10127904
1398 Ga0070717_10186750
1399 Ga0075363_100107153
1400 Ga0075364_10044399
1401 Ga0075364_10114395
1402 Ga0075364_10253218
1403 Ga0075432_10102543
1404 Ga0070715_10004309
1405 Ga0070715_10040652
1406 Ga0070715_10128455
1407 Ga0070716_100000508
1408 Ga0070716_100007882
1409 Ga0070716_100015589
1410 Ga0070716_100044320
1411 Ga0070716_100080295
1412 Ga0070712_100005372
1413 Ga0070712_100009334
1414 Ga0070712_100029059
1415 Ga0070712_100045417
1416 Ga0070712_100056408
1417 Ga0075369_10036161
1418 Ga0097621_100079576
1419 Ga0097621_100276555
1420 Ga0068871_100027412
1421 Ga0068871_100056948
1422 Ga0075428_100177928
1423 Ga0075428_100601023
1424 Ga0075430_100280130
1425 Ga0075431_100407153
1426 Ga0075433_10051187
1427 Ga0075433_10336727
1428 Ga0075433_10361918
1429 Ga0075433_10409791
1430 Ga0075434_100032233
1431 Ga0075434_100033506
1432 Ga0075434_100039315
1433 Ga0068865_100039011
1434 Ga0068865_100041107
1435 Ga0075436_100064740
1436 Ga0075436_100066572
1437 Ga0075436_100169009
1438 Ga0097620_100034967
1439 Ga0097620_100167031
1440 Ga0075435_100008746
1441 Ga0075435_100037863
1442 Ga0075435_100061836
1443 Ga0105240_10190377
1444 Ga0111539_10002633
1445 Ga0111539_10034507
1446 Ga0111539_10124766
1447 Ga0105245_10025589
1448 Ga0105245_10075578
1449 Ga0114129_10210261
1450 Ga0114129_10537231
1451 Ga0114129_11016986
1452 Ga0105243_10012670
1453 Ga0105243_10090047
1454 Ga0105243_10538320
1455 Ga0105241_10027438
1456 Ga0105241_10079336
1457 Ga0105241_10260942
1458 Ga0105241_10433309
1459 Ga0105242_10043614
1460 Ga0105242_10162088
1461 Ga0105242_10500030
1462 Ga0105248_10064723
1463 Ga0105248_10068285
1464 Ga0105237_10225066
1465 Ga0105238_10108005
1466 Ga0105238_11106273
1467 Ga0105249_10057141
1468 Ga0105249_10128313
1469 Ga0105239_10083549
1470 Ga0105239_10222503
1471 Ga0105246_10001046
1472 Ga0105246_10074624
1473 Ga0157335_1001533
1474 Ga0157342_1000629
1475 Ga0157373_10058350
1476 Ga0157373_10090051
1477 Ga0157371_10048553
1478 Ga0157370_10040361
1479 Ga0157370_10567634
1480 Ga0157369_10030215
1481 Ga0157369_10202544
1482 Ga0157369_10350611
1483 Ga0157369_10405716
1484 Ga0157369_10774703
1485 Ga0157374_10499685
1486 Ga0157378_10143331
1487 Ga0163162_10528450
1488 Ga0157372_10024291
1489 Ga0157372_10121581
1490 Ga0157372_11017817
1491 Ga0157375_10029871
1492 Ga0157375_10188851
1493 Ga0157375_10442072
1494 Ga0157375_11211775
1495 Ga0163163_10074068
1496 Ga0163163_10094916
1497 Ga0163163_10602639
1498 Ga0157380_10015485
1499 Ga0157377_10006040
1500 Ga0157379_10149162
1501 Ga0157379_10254059
1502 Ga0157376_10374968
1503 Ga0163161_10085542
1504 Ga0163161_10134516
1505 Ga0163161_10135521
1506 Ga0163161_10148532
1507 Ga0197907_10318288
1508 Ga0197907_10356126
1509 Ga0197907_10384303
1510 Ga0197907_10894406
1511 Ga0206356_10117693
1512 Ga0206356_10553711
1513 Ga0206356_10775408
1514 Ga0206356_11454669
1515 Ga0206356_11642507
1516 Ga0206356_11751201
1517 Ga0206355_1415136
1518 Ga0206351_10402913
1519 Ga0206352_10662284
1520 Ga0206350_10015471
1521 Ga0206350_10483273
1522 Ga0206354_11233094
1523 Ga0206353_10337382
1524 Ga0206353_10983463
1525 Ga0206353_11024964
1526 Ga0213876_10023166
1527 Ga0213875_10000656
1528 Ga0213875_10002258
1529 Ga0213875_10004419
1530 Ga0213875_10012191
1531 Ga0213875_10013455
1532 Ga0224712_10010732
1533 Ga0224712_10025009
1534 Ga0224712_10056531
1535 Ga0224712_10063647
1536 Ga0224572_1000926
1537 Ga0224572_1004645
1538 Ga0207426_1013882
1539 Ga0207692_10014656
1540 Ga0207692_10023748
1541 Ga0207692_10030089
1542 Ga0207692_10074661
1543 Ga0207692_10076608
1544 Ga0207692_10095492
1545 Ga0207692_10298567
1546 Ga0207642_10029802
1547 Ga0207642_10035497
1548 Ga0207688_10005687
1549 Ga0207688_10006105
1550 Ga0207688_10022025
1551 Ga0207688_10057212
1552 Ga0207647_10068591
1553 Ga0207647_10149445
1554 Ga0207685_10001217
1555 Ga0207685_10020818
1556 Ga0207699_10001589
1557 Ga0207699_10012585
1558 Ga0207699_10015976
1559 Ga0207699_10036378
1560 Ga0207699_10082702
1561 Ga0207643_10000215
1562 Ga0207705_10007059
1563 Ga0207705_10193033
1564 Ga0207684_10001715
1565 Ga0207684_10002461
1566 Ga0207684_10005381
1567 Ga0207684_10014889
1568 Ga0207684_10016382
1569 Ga0207684_10029210
1570 Ga0207684_10063319
1571 Ga0207684_10134284
1572 Ga0207684_10604994
1573 Ga0207654_10033839
1574 Ga0207707_10004913
1575 Ga0207707_10044829
1576 Ga0207707_10072011
1577 Ga0207671_10072231
1578 Ga0207693_10009380
1579 Ga0207693_10012263
1580 Ga0207693_10039473
1581 Ga0207663_10003579
1582 Ga0207663_10018255
1583 Ga0207663_10054027
1584 Ga0207663_10058432
1585 Ga0207663_10144519
1586 Ga0207663_10156392
1587 Ga0207663_10522975
1588 Ga0207660_10002966
1589 Ga0207660_10007062
1590 Ga0207660_10638051
1591 Ga0207662_10003307
1592 Ga0207657_10002090
1593 Ga0207657_10059138
1594 Ga0207657_10126874
1595 Ga0207649_10009551
1596 Ga0207649_10034467
1597 Ga0207649_10139205
1598 Ga0207652_10000592
1599 Ga0207652_10009921
1600 Ga0207652_10082676
1601 Ga0207646_10000065
1602 Ga0207646_10001312
1603 Ga0207646_10017053
1604 Ga0207646_10032398
1605 Ga0207646_10090348
1606 Ga0207646_10158032
1607 Ga0207681_10418708
1608 Ga0207694_10252193
1609 Ga0207650_10002455
1610 Ga0207650_10217403
1611 Ga0207659_10004667
1612 Ga0207687_10003055
1613 Ga0207687_10063389
1614 Ga0207687_10091074
1615 Ga0207687_10132506
1616 Ga0207687_10466323
1617 Ga0207700_10000218
1618 Ga0207700_10000229
1619 Ga0207700_10031067
1620 Ga0207700_10039433
1621 Ga0207700_10116457
1622 Ga0207700_10119665
1623 Ga0207700_10167917
1624 Ga0207700_10265128
1625 Ga0207664_10000588
1626 Ga0207664_10011479
1627 Ga0207664_10019149
1628 Ga0207664_10024584
1629 Ga0207664_10029877
1630 Ga0207664_10101334
1631 Ga0207664_10104036
1632 Ga0207664_10169210
1633 Ga0207664_10171012
1634 Ga0207664_10213200
1635 Ga0207664_10473025
1636 Ga0207644_10024769
1637 Ga0207690_10033467
1638 Ga0207706_10013237
1639 Ga0207706_10140752
1640 Ga0207706_10283673
1641 Ga0207686_10246526
1642 Ga0207709_10009672
1643 Ga0207709_10076383
1644 Ga0207709_10079764
1645 Ga0207670_10146039
1646 Ga0207670_10177881
1647 Ga0207665_10000193
1648 Ga0207665_10000369
1649 Ga0207665_10006989
1650 Ga0207665_10024374
1651 Ga0207665_10062983
1652 Ga0207691_10004250
1653 Ga0207691_10224727
1654 Ga0207691_10535967
1655 Ga0207711_10061229
1656 Ga0207711_10076178
1657 Ga0207711_10104209
1658 Ga0207689_10001149
1659 Ga0207689_10005138
1660 Ga0207689_10018067
1661 Ga0207661_10012466
1662 Ga0207661_10042117
1663 Ga0207661_10105958
1664 Ga0207679_10019362
1665 Ga0207679_10053069
1666 Ga0207679_10261105
1667 Ga0207667_10167467
1668 Ga0207667_10269652
1669 Ga0207712_10306895
1670 Ga0207668_10074135
1671 Ga0207640_10008388
1672 Ga0207640_10095164
1673 Ga0207658_10053817
1674 Ga0207677_10002476
1675 Ga0207677_10026127
1676 Ga0207677_10052799
1677 Ga0207703_10486739
1678 Ga0207639_10027269
1679 Ga0207639_10074960
1680 Ga0207678_10000552
1681 Ga0207678_10001019
1682 Ga0207678_10001856
1683 Ga0207678_10008054
1684 Ga0207678_10015961
1685 Ga0207708_10000933
1686 Ga0207708_10019775
1687 Ga0207708_10039703
1688 Ga0207702_10002139
1689 Ga0207702_10062383
1690 Ga0207702_10181168
1691 Ga0207641_10004861
1692 Ga0207641_10118081
1693 Ga0207641_10417272
1694 Ga0207648_10092525
1695 Ga0207648_10173093
1696 Ga0207676_10003268
1697 Ga0207674_10008373
1698 Ga0207674_10028803
1699 Ga0207674_10158695
1700 Ga0207675_100014732
1701 Ga0207675_100019992
1702 Ga0207675_100084010
1703 Ga0207683_10001755
1704 Ga0207683_10010244
1705 Ga0207698_10011353
1706 Ga0207698_10016262
1707 Ga0207428_10009874
1708 Ga0207428_10079370
1709 Ga0207428_10321299
1710 Ga0268266_10055062
1711 Ga0268265_10056558
1712 Ga0268264_10112285
1713 Ga0265337_1055019
1714 Ga0307517_10002916
1715 Ga0307515_10000845
1716 Ga0265338_10004550
1717 Ga0307511_10011641
1718 Ga0307512_10030128
1719 Ga0307509_10019979
1720 Ga0307509_10037358
1721 Ga0316575_10016337
1722 Ga0316579_10155949
1723 Ga0316576_10011912
1724 Ga0316576_10066587
1725 Ga0316576_10561176
1726 Ga0316578_10006497
1727 Ga0307516_10070070
1728 Ga0316577_10035835
1729 Ga0307413_10071265
1730 Ga0307406_10057429
1731 Ga0307409_100230441
1732 Ga0307409_100367610
1733 Ga0307409_100536642
1734 Ga0307416_100074745
1735 Ga0307411_10018902
1736 Ga0307415_100105409
1737 Ga0307415_100421941
1738 Ga0307507_10039437
1739 Ga0307507_10070361
1740 Ga0307510_10019969
1741 Ga0307510_10097383
1742 Ga0316214_1008262
1743 Ga0373930_0012825
1744 Ga0373948_0018076
1745 Ga0373926_0007030
1746 Ga0373926_0021076
1747 Ga0373929_0007087
1748 Ga0373934_0000101
1749 Ga0373934_0011618
1750 Ga0373934_0032649
1751 Ga0373934_0057862
1752 Ga0373940_0058157
1753 Ga0373944_0087609
1754 Ga0373949_0050395
1755 Ga0373951_0031707
1756 Ga0373952_0002235
1757 Ga0373923_0000264
1758 Ga0373923_0004102
1759 Ga0373923_0012992
1760 Ga0373923_0040994
1761 Ga0373923_0107447
1762 Ga0373932_0028776
1763 Ga0373936_0000263
1764 Ga0373936_0000384
1765 Ga0373936_0002894
1766 Ga0373936_0010005
1767 Ga0373936_0096227
1768 Ga0373936_0149842
1769 Ga0373939_0003193
1770 Ga0373945_0015076
1771 Ga0373945_0042604
1772 Ga0373953_0010608
1773 Ga0373953_0011778
1774 Ga0373953_0044095
1775 Ga0373954_0004360
1776 Ga0373954_0008629
1777 Ga0373956_0000095
1778 Ga0373956_0018884
1779 Ga0373956_0020931
1780 Ga0373956_0043741
1781 Ga0373956_0057897
1782 Ga0373956_0088024
1783 Ga0373957_0000385
1784 Ga0373957_0004550
1785 Ga0373957_0010447
1786 Ga0373957_0017172
1787 Ga0373957_0022949
1788 Ga0373957_0035148
1789 Ga0373957_0045166
1790 Ga0373957_0047249
1791 Ga0373957_0061095
1792 Ga0373957_0146542
1793 Ga0373960_0017543
1794 Ga0373943_0012651
1795 Ga0373943_0036928
1796 Ga0373943_0053670
1797 Ga0373946_0020376
1798 Ga0373955_0000002
1799 Ga0373955_0023875
1800 Ga0373955_0044502
1801 Ga0373955_0131947
1802 Ga0373942_0046116
1803 Ga0373961_0064848
1804 Ga0373962_0052983
1805 Ga0316574_0016125
1806 Ga0316574_0094095
1807 Ga0373924_0000306
1808 Ga0373924_0038851
1809 Ga0373924_0058257
1810 Ga0373924_0105579
1811 Ga0373931_0123617
1812 Ga0373931_0175364
1813 Ga0373935_0017898
1814 Ga0373935_0018974
1815 Ga0373935_0031984
1816 Ga0373935_0040003
1817 Ga0373935_0286166
1818 Ga0373927_0007355
1819 Ga0373927_0331696
1820 Ga0373933_0000029
1821 Ga0373933_0001380
1822 Ga0373933_0007481
1823 Ga0373933_0069586
1824 Ga0373933_0072990
1825 Ga0373947_0002205
1826 Ga0373947_0002535
1827 Ga0373947_0084273
1828 Ga0373947_0257306
1829 Ga0373947_0304046
1830 Ga0373937_0000362
1831 Ga0373937_0005208
1832 Ga0373937_0047429
1833 Ga0373937_0078610
1834 Ga0373937_0149356
1835 Ga0373937_0225208
1836 Ga0373937_0240902
1837 Ga0373937_0252516
1838 Ga0372808_020110
1839 Ga0316584_0082537
1840 Ga0373925_0000665
1841 Ga0373925_0001448
1842 Ga0373925_0002171
1843 Ga0373925_0031217
1844 Ga0373925_0160648
1845 Ga0373925_0392959
1846 Ga0373925_0466080
1847 Ga0395900_0242541
1848 Ga0395898_0079991
1849 Ga0395898_0581592
1850 Ga0395905_0228580
1851 Ga0395905_0447910
1852 Ga0316581_0137974
1853 Ga0436364_0239700
1854 Ga0436364_0455895
1855 Ga0436364_0490334
1856 Ga0436364_0954826
1857 Ga0436364_0991115
1858 Ga0436364_1135490
1859 Ga0436364_1474170
1860 Ga0436364_1492889
1861 Ga0436364_1502084
1862 Ga0436364_1513813
1863 Ga0395901_0070186
1864 Ga0395901_0295380
1865 Ga0436365_0258162
1866 Ga0436365_1661196
1867 Ga0436365_1740178
1868 Ga0436360_0834923
1869 Ga0436363_0595625
1870 Ga0436362_0237089
1871 Ga0436362_0906744
1872 Ga0439436_0074006
1873 Ga0451798_0680473
1874 Ga0451833_1164257
1875 Ga0451837_0007545
1876 Ga0451837_1389347
1877 Ga0439449_0011013
1878 Ga0466972_0008486
1879 Ga0466972_0034884
1880 Ga0466966_0113849
1881 Ga0466966_0229156
1882 Ga0466961_0044052
1883 Ga0466961_0063845
1884 Ga0466961_0346158
1885 Ga0466963_0013348
1886 Ga0466963_0040371
1887 Ga0466963_0075628
1888 Ga0466963_0229704
1889 Ga0466964_0047312
1890 Ga0466964_0254458
1891 Ga0466971_0061573
1892 Ga0466970_0006118
1893 Ga0466970_0023818
1894 Ga0466957_0002812
1895 Ga0466957_0013330
1896 Ga0466957_0251442
1897 Ga0466959_0147079
1898 Ga0466959_0223344
1899 Ga0466958_0033367
1900 Ga0466967_0021746
1901 Ga0466967_0047375
1902 Ga0466967_0211850
1903 Ga0466967_0426560
1904 Ga0495592_0000043
1905 Ga0495592_0058605
1906 Ga0495592_0097635
1907 Ga0495592_0099233
1908 Ga0495603_0000448
1909 Ga0495629_0000931
1910 Ga0495629_0004500
1911 Ga0495629_0004652
1912 Ga0495629_0012207
1913 Ga0495629_0044660
1914 Ga0495629_0081521
1915 Ga0495629_0096002
1916 Ga0495638_0012389
1917 Ga0495641_0002833
1918 Ga0495641_0004385
1919 Ga0495641_0008639
1920 Ga0495641_0036412
1921 Ga0495651_0000135
1922 Ga0495651_0000966
1923 Ga0495651_0002221
1924 Ga0495651_0008526
1925 Ga0495651_0062476
1926 Ga0495651_0074089
1927 Ga0495653_0004969
1928 Ga0495653_0016838
1929 Ga0495653_0018600
1930 Ga0495653_0033692
1931 Ga0495653_0040287
1932 Ga0495653_0162540
1933 Ga0495653_0203840
1934 Ga0495653_0279244
1935 Ga0495653_0435284
1936 Ga0495580_0009782
1937 Ga0495580_0061619
1938 Ga0495582_0002660
1939 Ga0495582_0005191
1940 Ga0495582_0037012
1941 Ga0495582_0104284
1942 Ga0495639_0000703
1943 Ga0495662_0004713
1944 Ga0495662_0005311
1945 Ga0495662_0013949
1946 Ga0495662_0019432
1947 Ga0495664_0003738
1948 Ga0495664_0031476
1949 Ga0495664_0081001
1950 Ga0495594_0079930
1951 Ga0495608_0000016
1952 Ga0495608_0004214
1953 Ga0495608_0007788
1954 Ga0495608_0012724
1955 Ga0495608_0023485
1956 Ga0495608_0033389
1957 Ga0495608_0070195
1958 Ga0495608_0101783
1959 Ga0495618_0004534
1960 Ga0495618_0049436
1961 Ga0495618_0086487
1962 Ga0495628_0000034
1963 Ga0495628_0068789
1964 Ga0495628_0101714
1965 Ga0495628_0108285
1966 Ga0495628_0169026
1967 Ga0495630_0004529
1968 Ga0495630_0056328
1969 Ga0495630_0075412
1970 Ga0495630_0222639
1971 Ga0495630_0273858
1972 Ga0495630_0474923
1973 Ga0495652_0000174
1974 Ga0495652_0004293
1975 Ga0495652_0066976
1976 Ga0495652_0081786
1977 Ga0495652_0087805
1978 Ga0495652_0131273
1979 Ga0495652_0139783
1980 Ga0495652_0145591
1981 Ga0495665_0003719
1982 Ga0495665_0004882
1983 Ga0495665_0086288
1984 Ga0495640_0007019
1985 Ga0495640_0084868
1986 Ga0495640_0112416
1987 Ga0495640_0155559
1988 Ga0495640_0194386
1989 Ga0495640_0212207
1990 Ga0495640_0303809
1991 Ga0495586_0003326
1992 Ga0495586_0012499
1993 Ga0495586_0184986
1994 Ga0495587_0000044
1995 Ga0495587_0005394
1996 Ga0495587_0016948
1997 Ga0495587_0027227
1998 Ga0495587_0199888
1999 Ga0495645_0022548
2000 Ga0495645_0030241
2001 Ga0495645_0034926
2002 Ga0495645_0037566
2003 Ga0495645_0051963
2004 Ga0495645_0375636
2005 Ga0495622_0094570
2006 Ga0495667_0000052
2007 Ga0495667_0001554
2008 Ga0495667_0003726
2009 Ga0495667_0007717
2010 Ga0495667_0015859
2011 Ga0495667_0017126
2012 Ga0495667_0027228
2013 Ga0495667_0066992
2014 Ga0495667_0112369
2015 Ga0495667_0259858
2016 Ga0495634_0002898
2017 Ga0495634_0018001
2018 Ga0495634_0056891
2019 Ga0495634_0141921
2020 Ga0495625_0026086
2021 Ga0495635_0000862
2022 Ga0495635_0011411
2023 Ga0495635_0030524
2024 Ga0495635_0039128
2025 Ga0495635_0072092
2026 Ga0495635_0088831
2027 Ga0495635_0136665
2028 Ga0495635_0203960
2029 Ga0495635_0257941
2030 Ga0495635_0294465
2031 Ga0495588_0001192
2032 Ga0495588_0043863
2033 Ga0495588_0191399
2034 Ga0495657_0000015
2035 Ga0495657_0003936
2036 Ga0495657_0009695
2037 Ga0495657_0011699
2038 Ga0495657_0013105
2039 Ga0495657_0015891
2040 Ga0495657_0015957
2041 Ga0495657_0045712
2042 Ga0495657_0048506
2043 Ga0495657_0178971
2044 Ga0495599_0000035
2045 Ga0495599_0009512
2046 Ga0495599_0121628
2047 Ga0495599_0180222
2048 Ga0495599_0205821
2049 Ga0495623_0000767
2050 Ga0495623_0043441
2051 Ga0495623_0065142
2052 Ga0495623_0084647
2053 Ga0495623_0204589
2054 Ga0495623_0274394
2055 Ga0495646_0002176
2056 Ga0495646_0022208
2057 Ga0495646_0053352
2058 Ga0495646_0062723
2059 Ga0495646_0122185
2060 Ga0495646_0142203
2061 Ga0495658_0004230
2062 Ga0495658_0014284
2063 Ga0495658_0209385
2064 Ga0495613_0040458
2065 Ga0495613_0063510
2066 Ga0495613_0082889
2067 Ga0495613_0166203
2068 Ga0495613_0315677
2069 Ga0495624_0012749
2070 Ga0495624_0021323
2071 Ga0495624_0093165
2072 Ga0495670_0077873
2073 Ga0495671_0006448
2074 Ga0495589_0005208
2075 Ga0495600_0004974
2076 Ga0495600_0007374
2077 Ga0495600_0048924
2078 Ga0495600_0072957
2079 Ga0495600_0111800
2080 Ga0495600_0128487
2081 Ga0495600_0163282
2082 Ga0495581_0003852
2083 Ga0495581_0035248
2084 Ga0495581_0099794
2085 Ga0495604_0000048
2086 Ga0495604_0024556
2087 Ga0495604_0030884
2088 Ga0495604_0085167
2089 Ga0495604_0098263
2090 Ga0495604_0133042
2091 Ga0495604_0260255
2092 Ga0495674_0005311
2093 Ga0495674_0013115
2094 Ga0495674_0033330
2095 Ga0495674_0072542
2096 Ga0495674_0119404
2097 Ga0495674_0162109
2098 Ga0495674_0193690
2099 Ga0495674_0248746
2100 Ga0495676_0003200
2101 Ga0495676_0030991
2102 Ga0495676_0065365
2103 Ga0495676_0075176
2104 Ga0495676_0079253
2105 Ga0495676_0127266
2106 Ga0495676_0455862
2107 Ga0495680_0000069
2108 Ga0495680_0004112
2109 Ga0495680_0010588
2110 Ga0495680_0011817
2111 Ga0495680_0022401
2112 Ga0495680_0027484
2113 Ga0495680_0028813
2114 Ga0495680_0067563
2115 Ga0495680_0109944
2116 Ga0495680_0116408
2117 Ga0495680_0172113
2118 Ga0495680_0224195
2119 Ga0495687_004640
2120 Ga0495675_0000685
2121 Ga0495675_0004478
2122 Ga0495675_0016613
2123 Ga0495675_0037710
2124 Ga0495675_0143150
2125 Ga0495675_0251588
2126 Ga0495675_0275965
2127 Ga0495681_0035320
2128 Ga0495684_0003133
2129 Ga0495684_0004619
2130 Ga0495684_0007538
2131 Ga0495684_0023007
2132 Ga0495684_0025322
2133 Ga0495684_0064696
2134 Ga0495684_0084760
2135 Ga0495593_0024245
2136 Ga0495602_0001615
2137 Ga0495602_0018075
2138 Ga0495602_0026606
2139 Ga0495602_0037844
2140 Ga0495602_0038337
2141 Ga0495602_0041369
2142 Ga0495602_0072982
2143 Ga0495602_0082140
2144 Ga0495602_0147407
2145 Ga0495602_0182705
2146 Ga0495602_0350017
2147 Ga0495614_0023127
2148 Ga0496100_0008298
2149 Ga0496100_0022571
2150 Ga0496100_0039952
2151 Ga0496100_0078985
2152 Ga0496100_0140956
2153 Ga0496100_0213672
2154 Ga0496101_0020981
2155 Ga0496101_0067646
2156 Ga0496101_0124435
2157 Ga0496101_0128848
2158 Ga0496101_0129321
2159 Ga0496101_0214425
2160 Ga0496101_0228922
2161 Ga0496102_0000929
2162 Ga0496102_0058675
2163 Ga0496102_0076872
2164 Ga0496102_0091753
2165 Ga0496102_0153131
2166 Ga0496103_0034521
2167 Ga0496104_0000263
2168 Ga0496104_0002013
2169 Ga0496104_0005064
2170 Ga0496104_0046865
2171 Ga0496104_0070149
2172 Ga0496104_0147530
2173 Ga0496104_0152648
2174 Ga0496104_0238384
2175 Ga0496104_0273903
2176 Ga0496105_0001788
2177 Ga0496105_0025988
2178 Ga0496105_0035101
2179 Ga0496105_0039054
2180 Ga0496105_0047571
2181 Ga0496105_0067920
2182 Ga0496105_0084410
2183 Ga0496106_0004569
2184 Ga0496106_0052854
2185 Ga0496106_0174016
2186 Ga0496106_0333026
2187 Ga0496106_0573512
2188 Ga0496107_0021454
2189 Ga0496107_0045441
2190 Ga0496107_0063357
2191 Ga0496107_0095309
2192 Ga0496107_0202453
2193 Ga0496107_0260182
2194 Ga0496108_0007549
2195 Ga0496108_0020982
2196 Ga0496108_0074176
2197 Ga0496108_0125293
2198 Ga0496108_0238441
2199 Ga0496108_0369867
2200 Ga0496109_0007402
2201 Ga0496109_0023097
2202 Ga0496109_0029729
2203 Ga0496109_0032848
2204 Ga0496109_0039821
2205 Ga0496109_0050283
2206 Ga0496109_0220544
2207 Ga0496109_0312651
2208 Ga0496109_0407063
2209 Ga0496109_0538493
2210 Ga0496110_0002708
2211 Ga0496110_0022446
2212 Ga0496110_0033389
2213 Ga0496110_0173402
2214 Ga0496110_0445362
2215 Ga0496111_0002537
2216 Ga0496111_0080832
2217 Ga0496111_0084454
2218 Ga0496111_0191585
2219 Ga0496111_0274372
2220 Ga0496112_0000159
2221 Ga0496112_0014254
2222 Ga0496112_0024687
2223 Ga0496112_0106498
2224 Ga0496112_0177747
2225 Ga0496113_0006554
2226 Ga0496113_0027455
2227 Ga0496113_0073559
2228 Ga0496113_0188925
2229 Ga0496113_0287282
2230 Ga0496114_0012899
2231 Ga0496114_0028233
2232 Ga0496114_0048829
2233 Ga0496114_0056772
2234 Ga0496114_0062390
2235 Ga0496114_0079216
2236 Ga0496114_0092814
2237 Ga0496114_0670978
2238 Ga0496115_0021236
2239 Ga0496115_0031981
2240 Ga0496115_0062701
2241 Ga0496115_0168843
2242 Ga0496115_0389467
2243 Ga0496122_0196991
2244 Ga0496125_0310490
2245 Ga0496126_0027315
2246 Ga0496126_0031554
2247 Ga0496126_0037923
2248 Ga0496126_0211493
2249 Ga0501031_0003149
2250 Ga0501031_0008650
2251 Ga0501031_0043366
2252 Ga0501032_0029432
2253 Ga0501032_0033532
2254 Ga0501032_0151016
2255 Ga0501033_0006830
2256 Ga0501033_0007168
2257 Ga0501033_0041059
2258 Ga0501033_0083715
2259 Ga0501034_0035028
2260 Ga0501034_0067171
2261 Ga0501034_0103409
2262 Ga0501034_0145978
2263 Ga0501036_0007634
2264 Ga0501036_0090011
2265 Ga0501036_0181637
2266 Ga0501036_0237947
2267 Ga0501037_0094556
2268 Ga0501037_0335809
2269 Ga0501038_0005688
2270 Ga0501038_0105460
2271 Ga0501039_0001008
2272 Ga0501039_0004674
2273 Ga0501039_0171264
2274 Ga0501039_0618121
2275 Ga0501040_0016271
2276 Ga0501040_0230685
2277 Ga0501041_0018351
2278 Ga0501041_0121766
2279 Ga0501042_0103845
2280 Ga0501043_0087121
2281 Ga0501043_0114972
2282 Ga0501043_0173761
2283 Ga0501043_0498774
2284 Ga0501046_0013645
2285 Ga0501047_0006153
2286 Ga0501047_0011211
2287 Ga0501047_0394547
2288 Ga0501047_0676130
2289 Ga0501048_0001302
2290 Ga0501048_0002817
2291 Ga0501048_0124358
2292 Ga0501067_0137914
2293 Ga0501068_0304002
2294 Ga0501070_0028990
2295 Ga0501070_0145471
2296 Ga0501070_0289775
2297 Ga0501071_0024723
2298 Ga0501072_0027284
2299 Ga0501072_0375380
2300 Ga0501074_0353461
2301 Ga0501075_0006844
2302 Ga0501076_0007635
2303 Ga0501077_0032713
2304 Ga0501079_0168435
2305 Ga0501035_0011100
2306 Ga0501035_0011350
2307 Ga0501035_0710947
2308 Ga0501044_0007546
2309 Ga0501044_0015982
2310 Ga0501044_0227522
2311 Ga0501044_0270899
2312 Ga0501045_0000128
2313 Ga0501045_0035949
2314 Ga0501045_0197373
2315 nmdc:mga03n38_30676_c1
2316 nmdc:mga00v17_231881_c1
2317 nmdc:mga00v17_29413_c1
2318 nmdc:mga00v17_68711_c1
2319 nmdc:mga0yw44_5475_c1
2320 nmdc:mga0yw44_67171_c1
2321 nmdc:mga06z11_302671_c1
2322 nmdc:mga05p37_43634_c1
2323 nmdc:mga09592_357055_c1
2324 nmdc:mga08y16_43759_c1
2325 nmdc:mga08y16_71631_c1
2326 nmdc:mga08y16_95906_c1
2327 nmdc:mga0n895_201902_c1
2328 nmdc:mga0n895_23448_c1
2329 nmdc:mga0n895_6914_c1
2330 nmdc:mga0rr50_3006_c1
2331 nmdc:mga0rr50_523891_c1
2332 nmdc:mga0rr50_73089_c1
2333 nmdc:mga08x19_11321_c1
2334 nmdc:mga08x19_1282_c1
2335 nmdc:mga08x19_87055_c1
2336 nmdc:mga0sz30_49429_c1
2337 Ga0495601_0002951
2338 Ga0495601_0017372
2339 Ga0495601_0018474
2340 Ga0495601_0022322
2341 Ga0495601_0032112
2342 Ga0495601_0042317
2343 Ga0495601_0094479
2344 Ga0495601_0139427
2345 Ga0495612_0011079
2346 Ga0495612_0011425
2347 Ga0495612_0094971
2348 Ga0495655_0010282
2349 Ga0495595_0000162
2350 Ga0495595_0005098
2351 Ga0495595_0012128
2352 Ga0495595_0053589
2353 Ga0495619_0009943
2354 Ga0495619_0013593
2355 Ga0495619_0014724
2356 Ga0500644_0038556
2357 Ga0500583_0147065
2358 Ga0500641_0005009
2359 Ga0500556_0000086
2360 Ga0500560_002305
2361 Ga0500562_001846
2362 Ga0500593_000565
2363 Ga0500655_000708
2364 Ga0500577_0012772
2365 Ga0501084_0006106
2366 Ga0501084_0710250
2367 Ga0501082_0019284
2368 Ga0530510_0004113
2369 2643946882
2370 2644034294
2371 2644098690
2372 2644116051
2373 2644228749
2374 2644435063
2375 2644457903
2376 2645722761
2377 2645725733
2378 2676484398
2379 2738871536
2380 2740166171
2381 2774393490
2382 2793977387
2383 2808872498
2384 2809195622
2385 2812333542
2386 2812350522
2387 2819740200
2388 2856744110
2389 2862180851
2390 2862575526
2391 2891403566
2392 2891564343
2393 2891971876
2394 2912762398
2395 2984579090
2396 2990260016
2397 2995464865
2398 8003315206
2399 8025536874
2400 8047716709
2401 8047903554
2402 8048356813
2403 8048379008
2404 8048388113
2405 8054610045
2406 8055174723

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

54

164

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

198

273

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pmu-assembly1.cif.gz_C crystal structure of the dna-binding domain of phop 0.9738 146 240
2pmu-assembly1.cif.gz_F crystal structure of the dna-binding domain of phop 0.9605 144 240
2pmu-assembly1.cif.gz_D crystal structure of the dna-binding domain of phop 0.9584 146 240
3q15-assembly2.cif.gz_D-3 crystal structure of raph complexed with spo0f 0.9373 19 131
2pmu-assembly1.cif.gz_A crystal structure of the dna-binding domain of phop 0.9352 146 240
ID Description Score Start End Superfamily
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 1.001 17 97 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9889 17 97 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9792 19 97 3.40.50.2300
af_P71814_19_100_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9712 19 97 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9618 18 97 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2S9FFS7-F1-model_v4 DNA-binding response regulator 0.8334 1 169 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A435B0I5-F1-model_v4 Response regulator transcription factor 0.8184 17 198 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7W9CRF2-F1-model_v4 Two-component system OmpR family response regulator 0.8111 3 243 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7W9CRF2-F1-model_v4 Two-component system OmpR family response regulator 0.7993 3 243 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A435B0I5-F1-model_v4 Response regulator transcription factor 0.7919 17 198 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map