F491520
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1195 | 474 | 972 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300047469|Ga0495673_0006978|Ga0495673_0006978_3832_4842 |
| Length | 320 |
| Sequence | VAEGIWPLSFNSDRRDISSACFESEPALMRRFSRPKPLLLGQYLRLFERAWFNLQTAWQPMSALSIGLDQYQVAVEARVIEGLDDDVSALTFDPVRKSLFTVTNKNSELIELSLDGQIIRRIALVGFGDPEAVEFISADTYVITDEYQHRLIKIHLEEDTTFLDAADAEQMTLGVHMSGNKGFEGLAYDSVGKRLFVAKERDPMLIYEVQGFPHYNPEKSYAVHVVNNPKRDAGMFVRDLSSLQYDERSGHLLALSDESRLILELDVDGRPLSTLSLNKGRQGLRKTVPQAEGIAMDDDGTMYLVSEPNLFYVFKKPPQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 7 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 8 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 9 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 10 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 11 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 12 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 13 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 14 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 15 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 16 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 17 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 18 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 19 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 20 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 21 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 22 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 23 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 24 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 25 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 26 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 27 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 28 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 29 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 30 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 31 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 32 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 33 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 34 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 35 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 36 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 37 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 38 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 39 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 40 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 41 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 42 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 43 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 44 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 45 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 46 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 47 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 48 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 49 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 50 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 51 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 52 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 53 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 54 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 55 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 56 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 57 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 58 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 59 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 60 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 61 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 62 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 63 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 64 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 65 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 66 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 67 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 68 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 69 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 70 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 71 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 72 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 73 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 74 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 75 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 76 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 77 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 78 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 79 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 80 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 81 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 82 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 83 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 84 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 85 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 86 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 87 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 88 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 89 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 90 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 91 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 92 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 93 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 94 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 95 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 96 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 97 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 98 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 99 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 100 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 101 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 102 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 103 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 104 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 105 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 106 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 107 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 108 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 109 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 110 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 111 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 112 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 113 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 114 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 115 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 116 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 117 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 118 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 119 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 120 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 121 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 122 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 123 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 124 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 125 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 126 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 127 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 128 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 129 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 130 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 131 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 132 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 133 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 134 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 135 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 136 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 137 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 138 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 139 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 140 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 141 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 142 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 143 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 144 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 145 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 146 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 147 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 148 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 149 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 150 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 151 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 152 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 153 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 154 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 155 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 156 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 157 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 158 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 159 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 160 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 161 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 162 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 163 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 164 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 165 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 166 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 167 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 168 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 169 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 170 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 171 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 172 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 173 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 174 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 175 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 176 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 177 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 178 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 179 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 180 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 181 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 182 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 183 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 184 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 185 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 186 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 187 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 188 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 189 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 190 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 191 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 192 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 193 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 194 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 195 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 196 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 197 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 198 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 199 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 200 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 201 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 202 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 203 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 204 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 205 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 206 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 207 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 208 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 209 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 210 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 211 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 212 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 213 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 214 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 215 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 216 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 217 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 218 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 219 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 224 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 227 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 228 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 229 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 230 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 231 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 232 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 233 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 234 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 235 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 245 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 253 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 254 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 255 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 256 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 258 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 268 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 270 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 291 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 292 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 294 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 295 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 297 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 298 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 299 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 300 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 301 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 302 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 303 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 304 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 305 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 306 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 307 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 308 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 309 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 310 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 311 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 312 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 313 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 314 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 315 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 316 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 317 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 318 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 319 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 320 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 321 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 322 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 323 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 324 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 325 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 326 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 327 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 328 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 329 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 330 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 331 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 332 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 333 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 334 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 335 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 336 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 337 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 338 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 339 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 340 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 341 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 342 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 343 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 344 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 345 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 346 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 347 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 348 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 349 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 350 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 351 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 423 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 424 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 425 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 426 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 427 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 428 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 429 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 430 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 431 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 432 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 433 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 434 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 435 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 436 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 437 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 438 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 439 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 440 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 444 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 445 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 446 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 447 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 448 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 449 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 450 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 451 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 452 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 453 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 454 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 455 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 456 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 457 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 458 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 459 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 460 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 461 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 462 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 463 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 464 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 465 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 466 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 467 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 468 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 469 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 470 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 471 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 472 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 473 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 474 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.34 |
| Metatranscriptomes | 0 |
| Isolates | 18.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.52 |
| Nodule | 2.51 |
| Rhizoplane | 6.11 |
| Rhizosphere | 74.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_100 | 2124908027 | Bacteria | 16970 |
| 2 | MRS2a_Contig_6775 | 2124908027 | Bacteria | 6303 |
| 3 | MRS2a_Contig_7922 | 2124908027 | Bacteria | 2499 |
| 4 | SwRhRL2b_contig_1421610 | 2162886007 | Bacteria | 2891 |
| 5 | SwRhRL2b_contig_2032209 | 2162886007 | Bacteria | 2239 |
| 6 | SwRhRL2b_contig_332858 | 2162886007 | Bacteria | 2506 |
| 7 | JGI24741J21665_1004037 | 3300001915 | Bacteria | 3341 |
| 8 | JGI25162J39368_1000505 | 3300002737 | Bacteria | 29260 |
| 9 | JGI25162J39368_1000520 | 3300002737 | Bacteria | 28748 |
| 10 | JGI25163J39215_1001487 | 3300002771 | Bacteria | 3766 |
| 11 | JGI25163J39215_1002247 | 3300002771 | Bacteria | 2139 |
| 12 | JGI25164J39214_1000342 | 3300002772 | Bacteria | 29260 |
| 13 | JGI25164J39214_1000350 | 3300002772 | Bacteria | 28748 |
| 14 | JGI25165J46597_1000629 | 3300003214 | Bacteria | 29260 |
| 15 | JGI25165J46597_1000645 | 3300003214 | Bacteria | 28748 |
| 16 | Ga0055538_1000032 | 3300003751 | Bacteria | 199718 |
| 17 | Ga0055539_1000043 | 3300003752 | Bacteria | 199718 |
| 18 | Ga0055533_1000052 | 3300003756 | Bacteria | 199718 |
| 19 | Ga0055532_1000047 | 3300003758 | Bacteria | 179201 |
| 20 | Ga0055525_1000062 | 3300003759 | Bacteria | 199718 |
| 21 | Ga0055535_1002417 | 3300003761 | Bacteria | 6584 |
| 22 | Ga0055536_1001893 | 3300003781 | Bacteria | 12148 |
| 23 | Ga0055536_1003161 | 3300003781 | Bacteria | 8927 |
| 24 | Ga0055536_1003315 | 3300003781 | Bacteria | 8713 |
| 25 | Ga0055536_1018841 | 3300003781 | Bacteria | 2194 |
| 26 | Ga0055530_10002669 | 3300003791 | Bacteria | 11138 |
| 27 | Ga0055530_10003441 | 3300003791 | Bacteria | 8998 |
| 28 | Ga0055530_10003585 | 3300003791 | Bacteria | 8721 |
| 29 | Ga0055540_1000101 | 3300003792 | Bacteria | 96054 |
| 30 | Ga0055540_1002054 | 3300003792 | Bacteria | 11121 |
| 31 | Ga0055540_1002471 | 3300003792 | Bacteria | 9720 |
| 32 | Ga0055531_10001108 | 3300003794 | Bacteria | 20956 |
| 33 | Ga0055541_1000030 | 3300003841 | Bacteria | 199616 |
| 34 | Ga0065714_10000338 | 3300005288 | Bacteria | 5539 |
| 35 | Ga0065714_10003528 | 3300005288 | Bacteria | 6830 |
| 36 | Ga0065714_10004326 | 3300005288 | Bacteria | 8763 |
| 37 | Ga0065714_10005396 | 3300005288 | Bacteria | 3929 |
| 38 | Ga0065714_10011336 | 3300005288 | Bacteria | 2506 |
| 39 | Ga0065714_10014633 | 3300005288 | Bacteria | 3222 |
| 40 | Ga0065714_10018388 | 3300005288 | Bacteria | 1728 |
| 41 | Ga0065714_10065956 | 3300005288 | Bacteria | 7979 |
| 42 | Ga0065714_10069189 | 3300005288 | Bacteria | 4336 |
| 43 | Ga0065714_10070624 | 3300005288 | Bacteria | 3811 |
| 44 | Ga0065714_10078669 | 3300005288 | Bacteria | 2572 |
| 45 | Ga0065714_10096637 | 3300005288 | Bacteria | 1753 |
| 46 | Ga0065704_10002468 | 3300005289 | Bacteria | 6643 |
| 47 | Ga0065704_10003468 | 3300005289 | Bacteria | 4536 |
| 48 | Ga0065704_10003725 | 3300005289 | Bacteria | 6998 |
| 49 | Ga0065704_10007238 | 3300005289 | Bacteria | 2585 |
| 50 | Ga0065704_10077802 | 3300005289 | Bacteria | 4615 |
| 51 | Ga0065704_10232881 | 3300005289 | Bacteria | 1038 |
| 52 | Ga0065712_10001329 | 3300005290 | Bacteria | 8917 |
| 53 | Ga0070670_100010511 | 3300005331 | Bacteria | 7902 |
| 54 | Ga0070670_100011900 | 3300005331 | Bacteria | 7439 |
| 55 | Ga0070661_100005363 | 3300005344 | Bacteria | 8839 |
| 56 | Ga0070669_100000430 | 3300005353 | Bacteria | 32172 |
| 57 | Ga0070669_100011273 | 3300005353 | Bacteria | 6347 |
| 58 | Ga0070662_100002011 | 3300005457 | Bacteria | 12454 |
| 59 | Ga0068853_100000187 | 3300005539 | Bacteria | 43749 |
| 60 | Ga0070665_100070954 | 3300005548 | Bacteria | 3490 |
| 61 | Ga0070665_100425541 | 3300005548 | Bacteria | 1336 |
| 62 | Ga0070664_100007442 | 3300005564 | Bacteria | 8839 |
| 63 | Ga0070664_100049753 | 3300005564 | Bacteria | 3545 |
| 64 | Ga0068854_100016186 | 3300005578 | Bacteria | 4964 |
| 65 | Ga0068851_10000007 | 3300005834 | Bacteria | 244101 |
| 66 | Ga0075364_10037354 | 3300006051 | Bacteria | 3144 |
| 67 | Ga0075364_10213561 | 3300006051 | Bacteria | 1309 |
| 68 | Ga0075432_10003629 | 3300006058 | Bacteria | 5248 |
| 69 | Ga0075432_10004104 | 3300006058 | Bacteria | 4967 |
| 70 | Ga0075432_10009832 | 3300006058 | Bacteria | 3251 |
| 71 | Ga0075432_10010422 | 3300006058 | Bacteria | 3153 |
| 72 | Ga0075432_10016445 | 3300006058 | Bacteria | 2524 |
| 73 | Ga0075432_10018866 | 3300006058 | Bacteria | 2354 |
| 74 | Ga0075362_10103030 | 3300006177 | Bacteria | 1336 |
| 75 | Ga0075436_100077685 | 3300006914 | Bacteria | 2299 |
| 76 | Ga0075436_100088872 | 3300006914 | Bacteria | 2147 |
| 77 | Ga0099823_1000043 | 3300006944 | Bacteria | 60786 |
| 78 | Ga0099823_1026491 | 3300006944 | Bacteria | 5116 |
| 79 | Ga0079104_1000862 | 3300006946 | Bacteria | 25141 |
| 80 | Ga0079104_1002683 | 3300006946 | Bacteria | 9181 |
| 81 | Ga0099826_10001943 | 3300006948 | Bacteria | 12943 |
| 82 | Ga0105251_10004675 | 3300009011 | Bacteria | 9206 |
| 83 | Ga0105251_10005898 | 3300009011 | Bacteria | 7918 |
| 84 | Ga0105251_10006408 | 3300009011 | Bacteria | 7504 |
| 85 | Ga0105251_10006413 | 3300009011 | Bacteria | 7496 |
| 86 | Ga0105251_10010091 | 3300009011 | Bacteria | 5511 |
| 87 | Ga0105251_10019472 | 3300009011 | Bacteria | 3584 |
| 88 | Ga0105251_10020061 | 3300009011 | Bacteria | 3518 |
| 89 | Ga0105251_10031084 | 3300009011 | Bacteria | 2674 |
| 90 | Ga0105251_10052928 | 3300009011 | Bacteria | 1931 |
| 91 | Ga0105244_10002122 | 3300009036 | Bacteria | 15243 |
| 92 | Ga0105244_10005335 | 3300009036 | Bacteria | 8559 |
| 93 | Ga0105244_10011282 | 3300009036 | Bacteria | 5373 |
| 94 | Ga0105244_10012116 | 3300009036 | Bacteria | 5119 |
| 95 | Ga0105244_10012478 | 3300009036 | Bacteria | 5017 |
| 96 | Ga0105244_10014699 | 3300009036 | Bacteria | 4520 |
| 97 | Ga0105244_10020554 | 3300009036 | Bacteria | 3665 |
| 98 | Ga0105244_10020950 | 3300009036 | Bacteria | 3622 |
| 99 | Ga0105244_10031702 | 3300009036 | Bacteria | 2804 |
| 100 | Ga0105244_10044979 | 3300009036 | Bacteria | 2272 |
| 101 | Ga0105244_10051446 | 3300009036 | Bacteria | 2099 |
| 102 | Ga0105244_10065116 | 3300009036 | Bacteria | 1827 |
| 103 | Ga0105244_10066896 | 3300009036 | Bacteria | 1798 |
| 104 | Ga0105244_10067608 | 3300009036 | Bacteria | 1787 |
| 105 | Ga0105244_10093917 | 3300009036 | Bacteria | 1473 |
| 106 | Ga0105250_10000963 | 3300009092 | Bacteria | 16868 |
| 107 | Ga0105250_10005377 | 3300009092 | Bacteria | 5749 |
| 108 | Ga0105250_10011357 | 3300009092 | Bacteria | 3695 |
| 109 | Ga0105250_10025184 | 3300009092 | Bacteria | 2398 |
| 110 | Ga0105250_10028362 | 3300009092 | Bacteria | 2254 |
| 111 | Ga0105250_10037059 | 3300009092 | Bacteria | 1957 |
| 112 | Ga0105250_10052573 | 3300009092 | Bacteria | 1634 |
| 113 | Ga0105243_10004174 | 3300009148 | Bacteria | 11453 |
| 114 | Ga0105243_10005271 | 3300009148 | Bacteria | 10113 |
| 115 | Ga0105243_10006873 | 3300009148 | Bacteria | 8770 |
| 116 | Ga0105243_10008207 | 3300009148 | Bacteria | 8021 |
| 117 | Ga0105243_10024853 | 3300009148 | Bacteria | 4573 |
| 118 | Ga0105243_10044423 | 3300009148 | Bacteria | 3486 |
| 119 | Ga0105243_10235679 | 3300009148 | Bacteria | 1626 |
| 120 | Ga0105242_10012773 | 3300009176 | Bacteria | 6469 |
| 121 | Ga0105242_10361181 | 3300009176 | Bacteria | 1344 |
| 122 | Ga0105248_10075305 | 3300009177 | Bacteria | 3793 |
| 123 | Ga0105237_10021239 | 3300009545 | Bacteria | 6678 |
| 124 | Ga0105237_10098036 | 3300009545 | Bacteria | 2922 |
| 125 | Ga0105249_10014890 | 3300009553 | Bacteria | 6879 |
| 126 | Ga0105246_10004966 | 3300011119 | Bacteria | 8098 |
| 127 | Ga0105246_10007194 | 3300011119 | Bacteria | 6817 |
| 128 | Ga0157345_1000215 | 3300012498 | Bacteria | 8685 |
| 129 | Ga0157345_1000830 | 3300012498 | Bacteria | 2341 |
| 130 | Ga0157373_10024148 | 3300013100 | Bacteria | 4406 |
| 131 | Ga0157373_10026918 | 3300013100 | Bacteria | 4150 |
| 132 | Ga0157373_10035307 | 3300013100 | Bacteria | 3590 |
| 133 | Ga0157373_10047733 | 3300013100 | Bacteria | 3053 |
| 134 | Ga0157373_10053819 | 3300013100 | Bacteria | 2861 |
| 135 | Ga0157373_10059873 | 3300013100 | Bacteria | 2698 |
| 136 | Ga0157373_10068601 | 3300013100 | Bacteria | 2506 |
| 137 | Ga0157373_10073151 | 3300013100 | Bacteria | 2419 |
| 138 | Ga0157373_10275628 | 3300013100 | Bacteria | 1191 |
| 139 | Ga0157371_10019357 | 3300013102 | Bacteria | 5022 |
| 140 | Ga0157371_10019739 | 3300013102 | Bacteria | 4965 |
| 141 | Ga0157370_10064516 | 3300013104 | Bacteria | 3467 |
| 142 | Ga0157370_10073912 | 3300013104 | Bacteria | 3216 |
| 143 | Ga0157370_10133233 | 3300013104 | Bacteria | 2317 |
| 144 | Ga0157370_10332815 | 3300013104 | Bacteria | 1400 |
| 145 | Ga0157369_10016075 | 3300013105 | Bacteria | 8420 |
| 146 | Ga0157369_10037609 | 3300013105 | Bacteria | 5299 |
| 147 | Ga0157369_10072612 | 3300013105 | Bacteria | 3694 |
| 148 | Ga0157369_10075803 | 3300013105 | Bacteria | 3605 |
| 149 | Ga0163162_10011142 | 3300013306 | Bacteria | 8759 |
| 150 | Ga0163162_10079014 | 3300013306 | Bacteria | 3356 |
| 151 | Ga0157372_10000574 | 3300013307 | Bacteria | 40249 |
| 152 | Ga0157372_10015655 | 3300013307 | Bacteria | 8132 |
| 153 | Ga0157372_10058524 | 3300013307 | Bacteria | 4308 |
| 154 | Ga0157375_10087624 | 3300013308 | Bacteria | 3166 |
| 155 | Ga0157375_10136022 | 3300013308 | Bacteria | 2581 |
| 156 | Ga0157375_10374403 | 3300013308 | Bacteria | 1590 |
| 157 | Ga0182008_10000775 | 3300014497 | Bacteria | 22401 |
| 158 | Ga0182008_10011058 | 3300014497 | Bacteria | 4813 |
| 159 | Ga0182008_10016544 | 3300014497 | Bacteria | 3832 |
| 160 | Ga0182008_10019084 | 3300014497 | Bacteria | 3544 |
| 161 | Ga0182008_10020649 | 3300014497 | Bacteria | 3388 |
| 162 | Ga0182008_10024642 | 3300014497 | Bacteria | 3061 |
| 163 | Ga0182008_10030716 | 3300014497 | Bacteria | 2707 |
| 164 | Ga0182008_10051554 | 3300014497 | Bacteria | 2041 |
| 165 | Ga0182008_10089215 | 3300014497 | Bacteria | 1519 |
| 166 | Ga0182006_1003195 | 3300015261 | Bacteria | 8535 |
| 167 | Ga0182006_1003355 | 3300015261 | Bacteria | 8236 |
| 168 | Ga0182006_1004172 | 3300015261 | Bacteria | 7174 |
| 169 | Ga0182006_1013613 | 3300015261 | Bacteria | 3525 |
| 170 | Ga0182006_1015336 | 3300015261 | Bacteria | 3286 |
| 171 | Ga0182006_1024909 | 3300015261 | Bacteria | 2463 |
| 172 | Ga0182006_1067837 | 3300015261 | Bacteria | 1330 |
| 173 | Ga0182007_10004090 | 3300015262 | Bacteria | 6713 |
| 174 | Ga0182007_10010484 | 3300015262 | Bacteria | 3657 |
| 175 | Ga0182007_10026603 | 3300015262 | Bacteria | 2003 |
| 176 | Ga0182007_10069819 | 3300015262 | Bacteria | 1151 |
| 177 | Ga0182005_1006390 | 3300015265 | Bacteria | 3608 |
| 178 | Ga0182005_1031348 | 3300015265 | Bacteria | 1448 |
| 179 | Ga0163161_10008495 | 3300017792 | Bacteria | 7113 |
| 180 | Ga0163161_10015693 | 3300017792 | Bacteria | 5282 |
| 181 | Ga0163161_10044204 | 3300017792 | Bacteria | 3208 |
| 182 | Ga0163161_10045458 | 3300017792 | Bacteria | 3167 |
| 183 | Ga0163161_10061922 | 3300017792 | Bacteria | 2725 |
| 184 | Ga0209435_100677 | 3300025206 | Bacteria | 5983 |
| 185 | Ga0209760_100027 | 3300025207 | Bacteria | 153290 |
| 186 | Ga0209760_100197 | 3300025207 | Bacteria | 29065 |
| 187 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 188 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 189 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 190 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 191 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 192 | Ga0209563_100744 | 3300025230 | Bacteria | 10006 |
| 193 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 194 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 195 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 196 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 197 | Ga0209258_100169 | 3300025242 | Bacteria | 145227 |
| 198 | Ga0209646_1000335 | 3300025246 | Bacteria | 35327 |
| 199 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 200 | Ga0209759_1013699 | 3300025256 | Bacteria | 2179 |
| 201 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 202 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 203 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 204 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 205 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 206 | Ga0209676_1000638 | 3300025292 | Bacteria | 50370 |
| 207 | Ga0209676_1005561 | 3300025292 | Bacteria | 6524 |
| 208 | Ga0209676_1025681 | 3300025292 | Bacteria | 1885 |
| 209 | Ga0209050_1000028 | 3300025298 | Bacteria | 477133 |
| 210 | Ga0209050_1000075 | 3300025298 | Bacteria | 286562 |
| 211 | Ga0209050_1003263 | 3300025298 | Bacteria | 12197 |
| 212 | Ga0209050_1004799 | 3300025298 | Bacteria | 8904 |
| 213 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 214 | Ga0209051_1000087 | 3300025303 | Bacteria | 181248 |
| 215 | Ga0209051_1000881 | 3300025303 | Bacteria | 30220 |
| 216 | Ga0209257_1000069 | 3300025304 | Bacteria | 339826 |
| 217 | Ga0209257_1006694 | 3300025304 | Bacteria | 7297 |
| 218 | Ga0207656_10000006 | 3300025321 | Bacteria | 395044 |
| 219 | Ga0207696_1000031 | 3300025711 | Bacteria | 384169 |
| 220 | Ga0207696_1000050 | 3300025711 | Bacteria | 276983 |
| 221 | Ga0207696_1000105 | 3300025711 | Bacteria | 163421 |
| 222 | Ga0207696_1000541 | 3300025711 | Bacteria | 30663 |
| 223 | Ga0207696_1007389 | 3300025711 | Bacteria | 4308 |
| 224 | Ga0207696_1007521 | 3300025711 | Bacteria | 4254 |
| 225 | Ga0207696_1007655 | 3300025711 | Bacteria | 4209 |
| 226 | Ga0207696_1009850 | 3300025711 | Bacteria | 3540 |
| 227 | Ga0207655_1000202 | 3300025728 | Bacteria | 103907 |
| 228 | Ga0207655_1000429 | 3300025728 | Bacteria | 56533 |
| 229 | Ga0207655_1000527 | 3300025728 | Bacteria | 48689 |
| 230 | Ga0207655_1001189 | 3300025728 | Bacteria | 25183 |
| 231 | Ga0207655_1001846 | 3300025728 | Bacteria | 18320 |
| 232 | Ga0207655_1003239 | 3300025728 | Bacteria | 12219 |
| 233 | Ga0207655_1011915 | 3300025728 | Bacteria | 5130 |
| 234 | Ga0207655_1011995 | 3300025728 | Bacteria | 5108 |
| 235 | Ga0207655_1012337 | 3300025728 | Bacteria | 5001 |
| 236 | Ga0207655_1013478 | 3300025728 | Bacteria | 4691 |
| 237 | Ga0207655_1015150 | 3300025728 | Bacteria | 4307 |
| 238 | Ga0207655_1015437 | 3300025728 | Bacteria | 4246 |
| 239 | Ga0207655_1016829 | 3300025728 | Bacteria | 3975 |
| 240 | Ga0207655_1020309 | 3300025728 | Bacteria | 3419 |
| 241 | Ga0207655_1021732 | 3300025728 | Bacteria | 3244 |
| 242 | Ga0207655_1024141 | 3300025728 | Bacteria | 2988 |
| 243 | Ga0207655_1025649 | 3300025728 | Bacteria | 2855 |
| 244 | Ga0207655_1035842 | 3300025728 | Bacteria | 2209 |
| 245 | Ga0207655_1037984 | 3300025728 | Bacteria | 2112 |
| 246 | Ga0207655_1042228 | 3300025728 | Bacteria | 1944 |
| 247 | Ga0207655_1083301 | 3300025728 | Bacteria | 1147 |
| 248 | Ga0207713_1001953 | 3300025735 | Bacteria | 15590 |
| 249 | Ga0207713_1003323 | 3300025735 | Bacteria | 11051 |
| 250 | Ga0207713_1004499 | 3300025735 | Bacteria | 9028 |
| 251 | Ga0207713_1004911 | 3300025735 | Bacteria | 8545 |
| 252 | Ga0207713_1005214 | 3300025735 | Bacteria | 8197 |
| 253 | Ga0207713_1007283 | 3300025735 | Bacteria | 6564 |
| 254 | Ga0207713_1008808 | 3300025735 | Bacteria | 5751 |
| 255 | Ga0207713_1008940 | 3300025735 | Bacteria | 5698 |
| 256 | Ga0207713_1012250 | 3300025735 | Bacteria | 4603 |
| 257 | Ga0207713_1034653 | 3300025735 | Bacteria | 2189 |
| 258 | Ga0207713_1035446 | 3300025735 | Bacteria | 2154 |
| 259 | Ga0207713_1038786 | 3300025735 | Bacteria | 2017 |
| 260 | Ga0207713_1042159 | 3300025735 | Bacteria | 1898 |
| 261 | Ga0207713_1042601 | 3300025735 | Bacteria | 1883 |
| 262 | Ga0207671_10000131 | 3300025914 | Bacteria | 116866 |
| 263 | Ga0207671_10055355 | 3300025914 | Bacteria | 2939 |
| 264 | Ga0207649_10000012 | 3300025920 | Bacteria | 265674 |
| 265 | Ga0207681_10000099 | 3300025923 | Bacteria | 73220 |
| 266 | Ga0207681_10002088 | 3300025923 | Bacteria | 12808 |
| 267 | Ga0207650_10000157 | 3300025925 | Bacteria | 81959 |
| 268 | Ga0207650_10000185 | 3300025925 | Bacteria | 72385 |
| 269 | Ga0207706_10001069 | 3300025933 | Bacteria | 27808 |
| 270 | Ga0207706_10004363 | 3300025933 | Bacteria | 13293 |
| 271 | Ga0207686_10044845 | 3300025934 | Bacteria | 2717 |
| 272 | Ga0207686_10367082 | 3300025934 | Bacteria | 1088 |
| 273 | Ga0207709_10000071 | 3300025935 | Bacteria | 181156 |
| 274 | Ga0207709_10000274 | 3300025935 | Bacteria | 60740 |
| 275 | Ga0207709_10004585 | 3300025935 | Bacteria | 7949 |
| 276 | Ga0207709_10006683 | 3300025935 | Bacteria | 6466 |
| 277 | Ga0207709_10009492 | 3300025935 | Bacteria | 5353 |
| 278 | Ga0207709_10182001 | 3300025935 | Bacteria | 1485 |
| 279 | Ga0207709_10278770 | 3300025935 | Bacteria | 1234 |
| 280 | Ga0207711_10058639 | 3300025941 | Bacteria | 3314 |
| 281 | Ga0207679_10000015 | 3300025945 | Bacteria | 265674 |
| 282 | Ga0207679_10020286 | 3300025945 | Bacteria | 4483 |
| 283 | Ga0207712_10022168 | 3300025961 | Bacteria | 4179 |
| 284 | Ga0207639_10001195 | 3300026041 | Bacteria | 17623 |
| 285 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 286 | Ga0209281_1000167 | 3300027111 | Bacteria | 155556 |
| 287 | Ga0209281_1012084 | 3300027111 | Bacteria | 1910 |
| 288 | Ga0209389_1000017 | 3300027296 | Bacteria | 180543 |
| 289 | Ga0209371_1000151 | 3300027312 | Bacteria | 109594 |
| 290 | Ga0209282_1014513 | 3300027666 | Bacteria | 5015 |
| 291 | Ga0207428_10032536 | 3300027907 | Bacteria | 4288 |
| 292 | Ga0207428_10044045 | 3300027907 | Bacteria | 3601 |
| 293 | Ga0207428_10068144 | 3300027907 | Bacteria | 2800 |
| 294 | Ga0207428_10078145 | 3300027907 | Bacteria | 2590 |
| 295 | Ga0207428_10096029 | 3300027907 | Bacteria | 2296 |
| 296 | Ga0207428_10110020 | 3300027907 | Bacteria | 2122 |
| 297 | Ga0207428_10130116 | 3300027907 | Bacteria | 1927 |
| 298 | Ga0207428_10171354 | 3300027907 | Bacteria | 1644 |
| 299 | Ga0207428_10187588 | 3300027907 | Bacteria | 1560 |
| 300 | Ga0268266_10052479 | 3300028379 | Bacteria | 3501 |
| 301 | Ga0307517_10054579 | 3300028786 | Bacteria | 3946 |
| 302 | Ga0268256_1000163 | 3300030500 | Bacteria | 83483 |
| 303 | Ga0316177_1055608 | 3300030731 | Bacteria | 3962 |
| 304 | Ga0314311_1078403 | 3300030733 | Bacteria | 4964 |
| 305 | Ga0316179_1074996 | 3300030734 | Bacteria | 1099 |
| 306 | Ga0316178_1112082 | 3300030735 | Bacteria | 20417 |
| 307 | Ga0316183_1010798 | 3300030742 | Bacteria | 1218 |
| 308 | Ga0316183_1097097 | 3300030742 | Bacteria | 2261 |
| 309 | Ga0316181_1187933 | 3300030744 | Bacteria | 3183 |
| 310 | Ga0307408_100007007 | 3300031548 | Bacteria | 7453 |
| 311 | Ga0307408_100011399 | 3300031548 | Bacteria | 5872 |
| 312 | Ga0307408_100012654 | 3300031548 | Bacteria | 5595 |
| 313 | Ga0307408_100014073 | 3300031548 | Bacteria | 5314 |
| 314 | Ga0307408_100040013 | 3300031548 | Bacteria | 3317 |
| 315 | Ga0307408_100481703 | 3300031548 | Bacteria | 1082 |
| 316 | Ga0307516_10148373 | 3300031730 | Bacteria | 2108 |
| 317 | Ga0307405_10001305 | 3300031731 | Bacteria | 10413 |
| 318 | Ga0307405_10014401 | 3300031731 | Bacteria | 4252 |
| 319 | Ga0307405_10016997 | 3300031731 | Bacteria | 3982 |
| 320 | Ga0307405_10215501 | 3300031731 | Bacteria | 1405 |
| 321 | Ga0307413_10005853 | 3300031824 | Bacteria | 5543 |
| 322 | Ga0307413_10007743 | 3300031824 | Bacteria | 5014 |
| 323 | Ga0307406_10005458 | 3300031901 | Bacteria | 6959 |
| 324 | Ga0307406_10011171 | 3300031901 | Bacteria | 5089 |
| 325 | Ga0307407_10276100 | 3300031903 | Bacteria | 1162 |
| 326 | Ga0307412_10004230 | 3300031911 | Bacteria | 8002 |
| 327 | Ga0307412_10008719 | 3300031911 | Bacteria | 5801 |
| 328 | Ga0307412_10011320 | 3300031911 | Bacteria | 5162 |
| 329 | Ga0307412_10044896 | 3300031911 | Bacteria | 2885 |
| 330 | Ga0307412_10202164 | 3300031911 | Bacteria | 1509 |
| 331 | Ga0307412_10312557 | 3300031911 | Bacteria | 1246 |
| 332 | Ga0307409_100031333 | 3300031995 | Bacteria | 3836 |
| 333 | Ga0307416_100060653 | 3300032002 | Bacteria | 3082 |
| 334 | Ga0307416_100219098 | 3300032002 | Bacteria | 1823 |
| 335 | Ga0307414_10018388 | 3300032004 | Bacteria | 4301 |
| 336 | Ga0307414_10031486 | 3300032004 | Bacteria | 3480 |
| 337 | Ga0307414_10054895 | 3300032004 | Bacteria | 2786 |
| 338 | Ga0307414_10126987 | 3300032004 | Bacteria | 1972 |
| 339 | Ga0307414_10156579 | 3300032004 | Bacteria | 1804 |
| 340 | Ga0307411_10005924 | 3300032005 | Bacteria | 6069 |
| 341 | Ga0307411_10030052 | 3300032005 | Bacteria | 3326 |
| 342 | Ga0307411_10463962 | 3300032005 | Bacteria | 1062 |
| 343 | Ga0307510_10024760 | 3300033180 | Bacteria | 6931 |
| 344 | Ga0237819_04056 | 3300038705 | Bacteria | 2474 |
| 345 | Ga0439438_004340 | 3300041405 | Bacteria | 5466 |
| 346 | Ga0439438_004433 | 3300041405 | Bacteria | 5388 |
| 347 | Ga0439438_004815 | 3300041405 | Bacteria | 5087 |
| 348 | Ga0439438_006349 | 3300041405 | Bacteria | 4186 |
| 349 | Ga0439438_007274 | 3300041405 | Bacteria | 3799 |
| 350 | Ga0439438_007651 | 3300041405 | Bacteria | 3668 |
| 351 | Ga0439438_009930 | 3300041405 | Bacteria | 3050 |
| 352 | Ga0439438_011906 | 3300041405 | Bacteria | 2688 |
| 353 | Ga0439438_012356 | 3300041405 | Bacteria | 2620 |
| 354 | Ga0439438_017221 | 3300041405 | Bacteria | 2084 |
| 355 | Ga0439438_025183 | 3300041405 | Bacteria | 1623 |
| 356 | Ga0439438_040312 | 3300041405 | Bacteria | 1214 |
| 357 | Ga0439447_001339 | 3300041407 | Bacteria | 8971 |
| 358 | Ga0439447_003195 | 3300041407 | Bacteria | 5834 |
| 359 | Ga0439447_004769 | 3300041407 | Bacteria | 4614 |
| 360 | Ga0439447_010086 | 3300041407 | Bacteria | 2820 |
| 361 | Ga0439447_010369 | 3300041407 | Bacteria | 2767 |
| 362 | Ga0439447_019804 | 3300041407 | Bacteria | 1790 |
| 363 | Ga0439447_022891 | 3300041407 | Bacteria | 1632 |
| 364 | Ga0439447_029090 | 3300041407 | Bacteria | 1401 |
| 365 | Ga0439447_033395 | 3300041407 | Bacteria | 1283 |
| 366 | Ga0439466_0003842 | 3300041411 | Bacteria | 5797 |
| 367 | Ga0439466_0011563 | 3300041411 | Bacteria | 3264 |
| 368 | Ga0439466_0014290 | 3300041411 | Bacteria | 2893 |
| 369 | Ga0439466_0019483 | 3300041411 | Bacteria | 2428 |
| 370 | Ga0439466_0021314 | 3300041411 | Bacteria | 2298 |
| 371 | Ga0439466_0030038 | 3300041411 | Bacteria | 1866 |
| 372 | Ga0439465_0008277 | 3300041413 | Bacteria | 3283 |
| 373 | Ga0439431_0001670 | 3300041997 | Bacteria | 4894 |
| 374 | Ga0439445_0055508 | 3300042004 | Bacteria | 1075 |
| 375 | Ga0439432_002400 | 3300042006 | Bacteria | 7069 |
| 376 | Ga0439432_002579 | 3300042006 | Bacteria | 6823 |
| 377 | Ga0439432_005807 | 3300042006 | Bacteria | 4431 |
| 378 | Ga0439432_009019 | 3300042006 | Bacteria | 3486 |
| 379 | Ga0439432_009772 | 3300042006 | Bacteria | 3337 |
| 380 | Ga0439432_011855 | 3300042006 | Bacteria | 2995 |
| 381 | Ga0439432_013390 | 3300042006 | Bacteria | 2791 |
| 382 | Ga0439432_014816 | 3300042006 | Bacteria | 2636 |
| 383 | Ga0439432_039379 | 3300042006 | Bacteria | 1502 |
| 384 | Ga0439451_001490 | 3300042009 | Bacteria | 4625 |
| 385 | Ga0439451_007318 | 3300042009 | Bacteria | 2252 |
| 386 | Ga0439452_000629 | 3300042010 | Bacteria | 17815 |
| 387 | Ga0439452_001636 | 3300042010 | Bacteria | 8851 |
| 388 | Ga0439452_003235 | 3300042010 | Bacteria | 5755 |
| 389 | Ga0439452_004618 | 3300042010 | Bacteria | 4576 |
| 390 | Ga0439452_007060 | 3300042010 | Bacteria | 3465 |
| 391 | Ga0439452_007904 | 3300042010 | Bacteria | 3224 |
| 392 | Ga0439452_011312 | 3300042010 | Bacteria | 2567 |
| 393 | Ga0439452_018907 | 3300042010 | Bacteria | 1827 |
| 394 | Ga0439452_026541 | 3300042010 | Bacteria | 1460 |
| 395 | Ga0439456_000053 | 3300042013 | Bacteria | 42489 |
| 396 | Ga0439456_001369 | 3300042013 | Bacteria | 4874 |
| 397 | Ga0439456_001856 | 3300042013 | Bacteria | 4264 |
| 398 | Ga0439456_017180 | 3300042013 | Bacteria | 1516 |
| 399 | Ga0439456_023275 | 3300042013 | Bacteria | 1313 |
| 400 | Ga0439463_000524 | 3300042016 | Bacteria | 10791 |
| 401 | Ga0439463_007520 | 3300042016 | Bacteria | 2688 |
| 402 | Ga0450911_001540 | 3300042115 | Bacteria | 5228 |
| 403 | Ga0450911_002373 | 3300042115 | Bacteria | 3753 |
| 404 | Ga0450911_002657 | 3300042115 | Bacteria | 3418 |
| 405 | Ga0450911_006569 | 3300042115 | Bacteria | 1727 |
| 406 | Ga0450919_002332 | 3300042121 | Bacteria | 2460 |
| 407 | Ga0450919_009349 | 3300042121 | Bacteria | 1125 |
| 408 | Ga0450922_000335 | 3300042124 | Bacteria | 5001 |
| 409 | Ga0450922_000947 | 3300042124 | Bacteria | 2951 |
| 410 | Ga0450922_001656 | 3300042124 | Bacteria | 2183 |
| 411 | Ga0450923_000685 | 3300042125 | Bacteria | 3975 |
| 412 | Ga0450890_000839 | 3300042127 | Bacteria | 4428 |
| 413 | Ga0450900_000816 | 3300042136 | Bacteria | 2726 |
| 414 | Ga0450902_003311 | 3300042137 | Bacteria | 2347 |
| 415 | Ga0450902_010035 | 3300042137 | Bacteria | 1496 |
| 416 | Ga0450902_010270 | 3300042137 | Bacteria | 1479 |
| 417 | Ga0450902_024457 | 3300042137 | Bacteria | 1005 |
| 418 | Ga0450903_001776 | 3300042138 | Bacteria | 3950 |
| 419 | Ga0450903_005153 | 3300042138 | Bacteria | 2195 |
| 420 | Ga0450903_022109 | 3300042138 | Bacteria | 981 |
| 421 | Ga0450904_001012 | 3300042139 | Bacteria | 4352 |
| 422 | Ga0450904_001414 | 3300042139 | Bacteria | 3400 |
| 423 | Ga0450905_015974 | 3300042142 | Bacteria | 1080 |
| 424 | Ga0450906_001083 | 3300042145 | Bacteria | 6010 |
| 425 | Ga0450906_001397 | 3300042145 | Bacteria | 5275 |
| 426 | Ga0450906_002105 | 3300042145 | Bacteria | 4348 |
| 427 | Ga0450907_000570 | 3300042146 | Bacteria | 9956 |
| 428 | Ga0450907_001019 | 3300042146 | Bacteria | 6564 |
| 429 | Ga0450907_001083 | 3300042146 | Bacteria | 6306 |
| 430 | Ga0450907_006182 | 3300042146 | Bacteria | 2005 |
| 431 | Ga0450910_001521 | 3300042147 | Bacteria | 2939 |
| 432 | Ga0439446_0002695 | 3300042156 | Bacteria | 4293 |
| 433 | Ga0439446_0005912 | 3300042156 | Bacteria | 3167 |
| 434 | Ga0450908_004786 | 3300042184 | Bacteria | 2604 |
| 435 | Ga0450908_023796 | 3300042184 | Bacteria | 1072 |
| 436 | Ga0450909_001322 | 3300042185 | Bacteria | 3451 |
| 437 | Ga0450909_007627 | 3300042185 | Bacteria | 1566 |
| 438 | Ga0439434_0002134 | 3300042435 | Bacteria | 5723 |
| 439 | Ga0439434_0015350 | 3300042435 | Bacteria | 2284 |
| 440 | Ga0439434_0016586 | 3300042435 | Bacteria | 2202 |
| 441 | Ga0439464_0014780 | 3300042439 | Bacteria | 2102 |
| 442 | Ga0439460_0006549 | 3300042461 | Bacteria | 2895 |
| 443 | Ga0450918_008906 | 3300042531 | Bacteria | 1761 |
| 444 | Ga0450893_0008849 | 3300042532 | Bacteria | 1643 |
| 445 | Ga0450893_0013314 | 3300042532 | Bacteria | 1370 |
| 446 | Ga0450901_000659 | 3300042533 | Bacteria | 4069 |
| 447 | Ga0450901_001364 | 3300042533 | Bacteria | 2805 |
| 448 | Ga0439440_0001997 | 3300042993 | Bacteria | 3796 |
| 449 | Ga0439440_0003420 | 3300042993 | Bacteria | 3059 |
| 450 | Ga0439440_0008496 | 3300042993 | Bacteria | 2109 |
| 451 | Ga0439440_0014270 | 3300042993 | Bacteria | 1713 |
| 452 | Ga0495617_001915 | 3300046452 | Bacteria | 8738 |
| 453 | Ga0495617_003481 | 3300046452 | Bacteria | 5913 |
| 454 | Ga0495617_010344 | 3300046452 | Bacteria | 3196 |
| 455 | Ga0495617_010677 | 3300046452 | Bacteria | 3145 |
| 456 | Ga0495617_012058 | 3300046452 | Bacteria | 2948 |
| 457 | Ga0495617_031069 | 3300046452 | Bacteria | 1794 |
| 458 | Ga0495627_001624 | 3300046453 | Bacteria | 12566 |
| 459 | Ga0495627_003510 | 3300046453 | Bacteria | 6874 |
| 460 | Ga0495627_009174 | 3300046453 | Bacteria | 3650 |
| 461 | Ga0495627_012137 | 3300046453 | Bacteria | 3067 |
| 462 | Ga0495627_013416 | 3300046453 | Bacteria | 2882 |
| 463 | Ga0495627_026110 | 3300046453 | Bacteria | 1887 |
| 464 | Ga0495603_0006004 | 3300046455 | Bacteria | 7261 |
| 465 | Ga0495603_0150634 | 3300046455 | Bacteria | 1351 |
| 466 | Ga0495590_0003127 | 3300046457 | Bacteria | 6768 |
| 467 | Ga0495590_0003352 | 3300046457 | Bacteria | 6549 |
| 468 | Ga0495590_0012587 | 3300046457 | Bacteria | 3137 |
| 469 | Ga0495590_0062260 | 3300046457 | Bacteria | 1306 |
| 470 | Ga0495591_003153 | 3300046458 | Bacteria | 8713 |
| 471 | Ga0495591_004283 | 3300046458 | Bacteria | 7049 |
| 472 | Ga0495591_004488 | 3300046458 | Bacteria | 6821 |
| 473 | Ga0495591_006239 | 3300046458 | Bacteria | 5315 |
| 474 | Ga0495591_010128 | 3300046458 | Bacteria | 3682 |
| 475 | Ga0495591_011182 | 3300046458 | Bacteria | 3416 |
| 476 | Ga0495591_011932 | 3300046458 | Bacteria | 3261 |
| 477 | Ga0495591_014957 | 3300046458 | Bacteria | 2761 |
| 478 | Ga0495591_015045 | 3300046458 | Bacteria | 2749 |
| 479 | Ga0495591_015501 | 3300046458 | Bacteria | 2689 |
| 480 | Ga0495591_017673 | 3300046458 | Bacteria | 2440 |
| 481 | Ga0495591_034663 | 3300046458 | Bacteria | 1483 |
| 482 | Ga0495638_0009475 | 3300046460 | Bacteria | 6829 |
| 483 | Ga0495638_0011832 | 3300046460 | Bacteria | 6003 |
| 484 | Ga0495638_0013267 | 3300046460 | Bacteria | 5619 |
| 485 | Ga0495638_0015777 | 3300046460 | Bacteria | 5061 |
| 486 | Ga0495638_0030199 | 3300046460 | Bacteria | 3490 |
| 487 | Ga0495638_0044266 | 3300046460 | Bacteria | 2804 |
| 488 | Ga0495638_0044293 | 3300046460 | Bacteria | 2803 |
| 489 | Ga0495638_0058255 | 3300046460 | Bacteria | 2394 |
| 490 | Ga0495638_0075465 | 3300046460 | Bacteria | 2054 |
| 491 | Ga0495638_0076892 | 3300046460 | Bacteria | 2033 |
| 492 | Ga0495638_0082025 | 3300046460 | Bacteria | 1956 |
| 493 | Ga0495638_0133599 | 3300046460 | Bacteria | 1455 |
| 494 | Ga0495638_0136825 | 3300046460 | Bacteria | 1433 |
| 495 | Ga0495638_0142404 | 3300046460 | Bacteria | 1398 |
| 496 | Ga0495653_0023527 | 3300046463 | Bacteria | 4974 |
| 497 | Ga0495653_0059618 | 3300046463 | Bacteria | 2896 |
| 498 | Ga0495653_0078471 | 3300046463 | Bacteria | 2448 |
| 499 | Ga0495650_0005232 | 3300046471 | Bacteria | 8512 |
| 500 | Ga0495650_0007138 | 3300046471 | Bacteria | 6782 |
| 501 | Ga0495650_0011643 | 3300046471 | Bacteria | 4797 |
| 502 | Ga0495650_0025018 | 3300046471 | Bacteria | 2808 |
| 503 | Ga0495650_0025554 | 3300046471 | Bacteria | 2765 |
| 504 | Ga0495650_0027313 | 3300046471 | Bacteria | 2639 |
| 505 | Ga0495650_0038282 | 3300046471 | Bacteria | 2080 |
| 506 | Ga0495605_0006401 | 3300046474 | Bacteria | 6778 |
| 507 | Ga0495605_0006443 | 3300046474 | Bacteria | 6746 |
| 508 | Ga0495605_0006887 | 3300046474 | Bacteria | 6491 |
| 509 | Ga0495605_0012694 | 3300046474 | Bacteria | 4666 |
| 510 | Ga0495605_0024749 | 3300046474 | Bacteria | 3137 |
| 511 | Ga0495605_0026013 | 3300046474 | Bacteria | 3044 |
| 512 | Ga0495605_0044234 | 3300046474 | Bacteria | 2203 |
| 513 | Ga0495605_0051096 | 3300046474 | Bacteria | 2014 |
| 514 | Ga0495639_0000618 | 3300046475 | Bacteria | 16506 |
| 515 | Ga0495584_0004951 | 3300046491 | Bacteria | 7100 |
| 516 | Ga0495584_0005944 | 3300046491 | Bacteria | 6430 |
| 517 | Ga0495584_0010791 | 3300046491 | Bacteria | 4689 |
| 518 | Ga0495584_0015709 | 3300046491 | Bacteria | 3860 |
| 519 | Ga0495584_0022255 | 3300046491 | Bacteria | 3217 |
| 520 | Ga0495584_0025400 | 3300046491 | Bacteria | 3003 |
| 521 | Ga0495584_0028519 | 3300046491 | Bacteria | 2829 |
| 522 | Ga0495584_0029537 | 3300046491 | Bacteria | 2779 |
| 523 | Ga0495584_0040259 | 3300046491 | Bacteria | 2359 |
| 524 | Ga0495584_0066306 | 3300046491 | Bacteria | 1815 |
| 525 | Ga0495584_0140869 | 3300046491 | Bacteria | 1224 |
| 526 | Ga0495585_0004323 | 3300046492 | Bacteria | 9243 |
| 527 | Ga0495585_0013861 | 3300046492 | Bacteria | 4710 |
| 528 | Ga0495585_0016686 | 3300046492 | Bacteria | 4254 |
| 529 | Ga0495585_0018674 | 3300046492 | Bacteria | 3998 |
| 530 | Ga0495585_0037361 | 3300046492 | Bacteria | 2735 |
| 531 | Ga0495585_0042190 | 3300046492 | Bacteria | 2556 |
| 532 | Ga0495585_0047495 | 3300046492 | Bacteria | 2391 |
| 533 | Ga0495585_0114349 | 3300046492 | Bacteria | 1432 |
| 534 | Ga0495585_0126273 | 3300046492 | Bacteria | 1349 |
| 535 | Ga0495594_0035849 | 3300046499 | Bacteria | 2703 |
| 536 | Ga0495596_0003041 | 3300046500 | Bacteria | 8674 |
| 537 | Ga0495607_0001950 | 3300046501 | Bacteria | 17432 |
| 538 | Ga0495607_0004818 | 3300046501 | Bacteria | 9842 |
| 539 | Ga0495607_0005886 | 3300046501 | Bacteria | 8707 |
| 540 | Ga0495607_0018420 | 3300046501 | Bacteria | 4452 |
| 541 | Ga0495607_0019378 | 3300046501 | Bacteria | 4323 |
| 542 | Ga0495607_0036325 | 3300046501 | Bacteria | 2969 |
| 543 | Ga0495607_0041502 | 3300046501 | Bacteria | 2732 |
| 544 | Ga0495607_0045042 | 3300046501 | Bacteria | 2597 |
| 545 | Ga0495607_0055040 | 3300046501 | Bacteria | 2290 |
| 546 | Ga0495607_0068849 | 3300046501 | Bacteria | 1983 |
| 547 | Ga0495607_0091741 | 3300046501 | Bacteria | 1644 |
| 548 | Ga0495583_0007949 | 3300046506 | Bacteria | 6568 |
| 549 | Ga0495583_0012824 | 3300046506 | Bacteria | 4715 |
| 550 | Ga0495583_0027807 | 3300046506 | Bacteria | 2787 |
| 551 | Ga0495583_0034504 | 3300046506 | Bacteria | 2423 |
| 552 | Ga0495606_0009480 | 3300046507 | Bacteria | 8228 |
| 553 | Ga0495606_0012126 | 3300046507 | Bacteria | 6949 |
| 554 | Ga0495606_0025644 | 3300046507 | Bacteria | 4217 |
| 555 | Ga0495606_0026067 | 3300046507 | Bacteria | 4170 |
| 556 | Ga0495606_0045607 | 3300046507 | Bacteria | 2903 |
| 557 | Ga0495606_0048201 | 3300046507 | Bacteria | 2804 |
| 558 | Ga0495606_0075522 | 3300046507 | Bacteria | 2108 |
| 559 | Ga0495606_0080632 | 3300046507 | Bacteria | 2024 |
| 560 | Ga0495606_0155396 | 3300046507 | Bacteria | 1339 |
| 561 | Ga0495606_0176458 | 3300046507 | Bacteria | 1235 |
| 562 | Ga0495610_0014034 | 3300046512 | Bacteria | 4730 |
| 563 | Ga0495610_0020284 | 3300046512 | Bacteria | 3693 |
| 564 | Ga0495610_0020948 | 3300046512 | Bacteria | 3609 |
| 565 | Ga0495610_0021050 | 3300046512 | Bacteria | 3597 |
| 566 | Ga0495610_0021782 | 3300046512 | Bacteria | 3518 |
| 567 | Ga0495610_0022552 | 3300046512 | Bacteria | 3441 |
| 568 | Ga0495610_0024368 | 3300046512 | Bacteria | 3267 |
| 569 | Ga0495610_0098872 | 3300046512 | Bacteria | 1310 |
| 570 | Ga0495610_0140962 | 3300046512 | Bacteria | 1037 |
| 571 | Ga0495616_0009098 | 3300046513 | Bacteria | 5827 |
| 572 | Ga0495616_0009478 | 3300046513 | Bacteria | 5687 |
| 573 | Ga0495616_0010742 | 3300046513 | Bacteria | 5281 |
| 574 | Ga0495616_0010805 | 3300046513 | Bacteria | 5262 |
| 575 | Ga0495616_0017441 | 3300046513 | Bacteria | 3960 |
| 576 | Ga0495616_0019496 | 3300046513 | Bacteria | 3700 |
| 577 | Ga0495616_0019634 | 3300046513 | Bacteria | 3686 |
| 578 | Ga0495616_0029966 | 3300046513 | Bacteria | 2865 |
| 579 | Ga0495616_0030061 | 3300046513 | Bacteria | 2859 |
| 580 | Ga0495616_0035616 | 3300046513 | Bacteria | 2573 |
| 581 | Ga0495616_0037504 | 3300046513 | Bacteria | 2493 |
| 582 | Ga0495620_0000024 | 3300046515 | Bacteria | 126428 |
| 583 | Ga0495620_0003664 | 3300046515 | Bacteria | 8771 |
| 584 | Ga0495620_0006093 | 3300046515 | Bacteria | 6663 |
| 585 | Ga0495620_0008902 | 3300046515 | Bacteria | 5365 |
| 586 | Ga0495620_0009862 | 3300046515 | Bacteria | 5059 |
| 587 | Ga0495620_0019325 | 3300046515 | Bacteria | 3352 |
| 588 | Ga0495620_0025639 | 3300046515 | Bacteria | 2785 |
| 589 | Ga0495630_0060005 | 3300046517 | Bacteria | 2854 |
| 590 | Ga0495630_0078261 | 3300046517 | Bacteria | 2493 |
| 591 | Ga0495631_0000782 | 3300046518 | Bacteria | 20373 |
| 592 | Ga0495631_0003546 | 3300046518 | Bacteria | 8532 |
| 593 | Ga0495631_0004038 | 3300046518 | Bacteria | 7895 |
| 594 | Ga0495631_0018453 | 3300046518 | Bacteria | 3283 |
| 595 | Ga0495631_0050033 | 3300046518 | Bacteria | 1828 |
| 596 | Ga0495632_0003986 | 3300046519 | Bacteria | 10217 |
| 597 | Ga0495632_0007720 | 3300046519 | Bacteria | 6716 |
| 598 | Ga0495632_0008848 | 3300046519 | Bacteria | 6123 |
| 599 | Ga0495632_0012171 | 3300046519 | Bacteria | 4973 |
| 600 | Ga0495632_0012683 | 3300046519 | Bacteria | 4846 |
| 601 | Ga0495632_0015219 | 3300046519 | Bacteria | 4324 |
| 602 | Ga0495632_0018672 | 3300046519 | Bacteria | 3799 |
| 603 | Ga0495632_0021560 | 3300046519 | Bacteria | 3470 |
| 604 | Ga0495632_0024505 | 3300046519 | Bacteria | 3203 |
| 605 | Ga0495632_0025416 | 3300046519 | Bacteria | 3132 |
| 606 | Ga0495632_0026402 | 3300046519 | Bacteria | 3057 |
| 607 | Ga0495632_0045272 | 3300046519 | Bacteria | 2192 |
| 608 | Ga0495632_0051196 | 3300046519 | Bacteria | 2033 |
| 609 | Ga0495632_0061990 | 3300046519 | Bacteria | 1813 |
| 610 | Ga0495632_0106170 | 3300046519 | Bacteria | 1321 |
| 611 | Ga0495637_0003367 | 3300046520 | Bacteria | 8494 |
| 612 | Ga0495637_0003640 | 3300046520 | Bacteria | 8162 |
| 613 | Ga0495637_0006679 | 3300046520 | Bacteria | 5773 |
| 614 | Ga0495637_0007795 | 3300046520 | Bacteria | 5287 |
| 615 | Ga0495637_0021232 | 3300046520 | Bacteria | 2979 |
| 616 | Ga0495637_0026416 | 3300046520 | Bacteria | 2606 |
| 617 | Ga0495637_0027219 | 3300046520 | Bacteria | 2560 |
| 618 | Ga0495637_0027253 | 3300046520 | Bacteria | 2559 |
| 619 | Ga0495637_0028038 | 3300046520 | Bacteria | 2516 |
| 620 | Ga0495637_0031733 | 3300046520 | Bacteria | 2333 |
| 621 | Ga0495637_0039044 | 3300046520 | Bacteria | 2052 |
| 622 | Ga0495637_0040565 | 3300046520 | Bacteria | 2003 |
| 623 | Ga0495637_0079311 | 3300046520 | Bacteria | 1311 |
| 624 | Ga0495643_0003187 | 3300046522 | Bacteria | 12185 |
| 625 | Ga0495643_0005296 | 3300046522 | Bacteria | 8759 |
| 626 | Ga0495643_0010231 | 3300046522 | Bacteria | 5778 |
| 627 | Ga0495643_0017685 | 3300046522 | Bacteria | 4161 |
| 628 | Ga0495643_0027096 | 3300046522 | Bacteria | 3224 |
| 629 | Ga0495643_0040577 | 3300046522 | Bacteria | 2541 |
| 630 | Ga0495644_0005333 | 3300046523 | Bacteria | 5019 |
| 631 | Ga0495644_0006587 | 3300046523 | Bacteria | 4500 |
| 632 | Ga0495644_0014316 | 3300046523 | Bacteria | 3040 |
| 633 | Ga0495644_0043522 | 3300046523 | Bacteria | 1689 |
| 634 | Ga0495644_0077115 | 3300046523 | Bacteria | 1255 |
| 635 | Ga0495648_0008560 | 3300046524 | Bacteria | 8034 |
| 636 | Ga0495648_0009482 | 3300046524 | Bacteria | 7533 |
| 637 | Ga0495648_0010142 | 3300046524 | Bacteria | 7209 |
| 638 | Ga0495648_0021367 | 3300046524 | Bacteria | 4482 |
| 639 | Ga0495648_0028226 | 3300046524 | Bacteria | 3742 |
| 640 | Ga0495648_0028927 | 3300046524 | Bacteria | 3683 |
| 641 | Ga0495648_0034429 | 3300046524 | Bacteria | 3295 |
| 642 | Ga0495648_0042487 | 3300046524 | Bacteria | 2859 |
| 643 | Ga0495648_0048455 | 3300046524 | Bacteria | 2615 |
| 644 | Ga0495648_0051724 | 3300046524 | Bacteria | 2500 |
| 645 | Ga0495648_0052510 | 3300046524 | Bacteria | 2475 |
| 646 | Ga0495648_0086519 | 3300046524 | Bacteria | 1767 |
| 647 | Ga0495666_0011691 | 3300046526 | Bacteria | 4377 |
| 648 | Ga0495666_0023360 | 3300046526 | Bacteria | 3057 |
| 649 | Ga0495666_0023961 | 3300046526 | Bacteria | 3018 |
| 650 | Ga0495642_0002921 | 3300046528 | Bacteria | 6807 |
| 651 | Ga0495642_0007182 | 3300046528 | Bacteria | 4274 |
| 652 | Ga0495642_0008299 | 3300046528 | Bacteria | 3973 |
| 653 | Ga0495654_0002894 | 3300046530 | Bacteria | 10767 |
| 654 | Ga0495654_0005790 | 3300046530 | Bacteria | 7119 |
| 655 | Ga0495654_0008657 | 3300046530 | Bacteria | 5608 |
| 656 | Ga0495654_0011090 | 3300046530 | Bacteria | 4892 |
| 657 | Ga0495654_0012450 | 3300046530 | Bacteria | 4567 |
| 658 | Ga0495654_0015236 | 3300046530 | Bacteria | 4085 |
| 659 | Ga0495654_0016508 | 3300046530 | Bacteria | 3901 |
| 660 | Ga0495654_0017047 | 3300046530 | Bacteria | 3824 |
| 661 | Ga0495654_0029012 | 3300046530 | Bacteria | 2824 |
| 662 | Ga0495654_0029349 | 3300046530 | Bacteria | 2805 |
| 663 | Ga0495654_0031420 | 3300046530 | Bacteria | 2695 |
| 664 | Ga0495654_0064096 | 3300046530 | Bacteria | 1757 |
| 665 | Ga0495654_0066380 | 3300046530 | Bacteria | 1719 |
| 666 | Ga0495654_0083478 | 3300046530 | Bacteria | 1493 |
| 667 | Ga0495587_0020180 | 3300046536 | Bacteria | 4116 |
| 668 | Ga0495609_0008895 | 3300046538 | Bacteria | 4886 |
| 669 | Ga0495609_0010955 | 3300046538 | Bacteria | 4331 |
| 670 | Ga0495609_0031441 | 3300046538 | Bacteria | 2412 |
| 671 | Ga0495609_0032866 | 3300046538 | Bacteria | 2355 |
| 672 | Ga0495609_0033112 | 3300046538 | Bacteria | 2346 |
| 673 | Ga0495609_0061468 | 3300046538 | Bacteria | 1659 |
| 674 | Ga0495597_0008012 | 3300046542 | Bacteria | 5316 |
| 675 | Ga0495597_0018848 | 3300046542 | Bacteria | 3234 |
| 676 | Ga0495597_0019929 | 3300046542 | Bacteria | 3130 |
| 677 | Ga0495597_0028751 | 3300046542 | Bacteria | 2542 |
| 678 | Ga0495597_0030084 | 3300046542 | Bacteria | 2476 |
| 679 | Ga0495597_0040217 | 3300046542 | Bacteria | 2090 |
| 680 | Ga0495597_0045529 | 3300046542 | Bacteria | 1946 |
| 681 | Ga0495622_0003094 | 3300046557 | Bacteria | 7888 |
| 682 | Ga0495622_0004331 | 3300046557 | Bacteria | 6608 |
| 683 | Ga0495622_0008208 | 3300046557 | Bacteria | 4837 |
| 684 | Ga0495622_0024425 | 3300046557 | Bacteria | 2822 |
| 685 | Ga0495622_0071131 | 3300046557 | Bacteria | 1605 |
| 686 | Ga0495622_0112442 | 3300046557 | Bacteria | 1246 |
| 687 | Ga0495633_0006730 | 3300046558 | Bacteria | 6765 |
| 688 | Ga0495633_0025605 | 3300046558 | Bacteria | 2903 |
| 689 | Ga0495633_0027683 | 3300046558 | Bacteria | 2769 |
| 690 | Ga0495656_0020142 | 3300046615 | Bacteria | 2584 |
| 691 | Ga0495656_0031179 | 3300046615 | Bacteria | 2160 |
| 692 | Ga0495668_0005611 | 3300046616 | Bacteria | 8438 |
| 693 | Ga0495668_0026738 | 3300046616 | Bacteria | 3272 |
| 694 | Ga0495668_0027226 | 3300046616 | Bacteria | 3239 |
| 695 | Ga0495634_0008631 | 3300046642 | Bacteria | 7563 |
| 696 | Ga0495611_0002437 | 3300046648 | Bacteria | 8502 |
| 697 | Ga0495611_0012912 | 3300046648 | Bacteria | 3551 |
| 698 | Ga0495611_0026950 | 3300046648 | Bacteria | 2510 |
| 699 | Ga0495625_0023608 | 3300046660 | Bacteria | 4695 |
| 700 | Ga0495625_0035793 | 3300046660 | Bacteria | 3655 |
| 701 | Ga0495625_0045114 | 3300046660 | Bacteria | 3188 |
| 702 | Ga0495625_0053777 | 3300046660 | Bacteria | 2878 |
| 703 | Ga0495625_0059405 | 3300046660 | Bacteria | 2713 |
| 704 | Ga0495625_0081652 | 3300046660 | Bacteria | 2249 |
| 705 | Ga0495625_0112568 | 3300046660 | Bacteria | 1859 |
| 706 | Ga0495635_0039955 | 3300046663 | Bacteria | 3244 |
| 707 | Ga0495659_0001126 | 3300046664 | Bacteria | 9300 |
| 708 | Ga0495659_0003711 | 3300046664 | Bacteria | 4854 |
| 709 | Ga0495659_0035213 | 3300046664 | Bacteria | 1763 |
| 710 | Ga0495661_0000984 | 3300046665 | Bacteria | 25707 |
| 711 | Ga0495661_0016556 | 3300046665 | Bacteria | 4883 |
| 712 | Ga0495661_0027362 | 3300046665 | Bacteria | 3661 |
| 713 | Ga0495661_0036520 | 3300046665 | Bacteria | 3076 |
| 714 | Ga0495661_0037117 | 3300046665 | Bacteria | 3044 |
| 715 | Ga0495661_0038675 | 3300046665 | Bacteria | 2968 |
| 716 | Ga0495661_0107336 | 3300046665 | Bacteria | 1561 |
| 717 | Ga0495588_0074846 | 3300046674 | Bacteria | 1763 |
| 718 | Ga0495588_0135172 | 3300046674 | Bacteria | 1301 |
| 719 | Ga0495657_0084706 | 3300046675 | Bacteria | 2044 |
| 720 | Ga0495623_0006490 | 3300046679 | Bacteria | 7612 |
| 721 | Ga0495646_0022041 | 3300046680 | Bacteria | 4020 |
| 722 | Ga0495613_0055279 | 3300046689 | Bacteria | 2917 |
| 723 | Ga0495624_0006003 | 3300046690 | Bacteria | 8664 |
| 724 | Ga0495624_0311915 | 3300046690 | Bacteria | 948 |
| 725 | Ga0495670_0006430 | 3300046691 | Bacteria | 5770 |
| 726 | Ga0495670_0007333 | 3300046691 | Bacteria | 5422 |
| 727 | Ga0495670_0015189 | 3300046691 | Bacteria | 3787 |
| 728 | Ga0495670_0022039 | 3300046691 | Bacteria | 3146 |
| 729 | Ga0495670_0042966 | 3300046691 | Bacteria | 2255 |
| 730 | Ga0495670_0055689 | 3300046691 | Bacteria | 1983 |
| 731 | Ga0495670_0098630 | 3300046691 | Bacteria | 1502 |
| 732 | Ga0495670_0249360 | 3300046691 | Bacteria | 946 |
| 733 | Ga0495671_0004458 | 3300046692 | Bacteria | 8372 |
| 734 | Ga0495671_0010292 | 3300046692 | Bacteria | 5191 |
| 735 | Ga0495671_0020410 | 3300046692 | Bacteria | 3491 |
| 736 | Ga0495671_0029279 | 3300046692 | Bacteria | 2828 |
| 737 | Ga0495671_0031327 | 3300046692 | Bacteria | 2719 |
| 738 | Ga0495671_0031929 | 3300046692 | Bacteria | 2690 |
| 739 | Ga0495671_0043609 | 3300046692 | Bacteria | 2251 |
| 740 | Ga0495671_0056309 | 3300046692 | Bacteria | 1946 |
| 741 | Ga0495671_0071259 | 3300046692 | Bacteria | 1707 |
| 742 | Ga0495671_0081140 | 3300046692 | Bacteria | 1589 |
| 743 | Ga0495671_0192682 | 3300046692 | Bacteria | 989 |
| 744 | Ga0495649_0009968 | 3300046694 | Bacteria | 5616 |
| 745 | Ga0495649_0013352 | 3300046694 | Bacteria | 4739 |
| 746 | Ga0495649_0022482 | 3300046694 | Bacteria | 3528 |
| 747 | Ga0495649_0026148 | 3300046694 | Bacteria | 3248 |
| 748 | Ga0495649_0037053 | 3300046694 | Bacteria | 2677 |
| 749 | Ga0495649_0038218 | 3300046694 | Bacteria | 2634 |
| 750 | Ga0495649_0043087 | 3300046694 | Bacteria | 2464 |
| 751 | Ga0495649_0068080 | 3300046694 | Bacteria | 1910 |
| 752 | Ga0495649_0071523 | 3300046694 | Bacteria | 1859 |
| 753 | Ga0495649_0113940 | 3300046694 | Bacteria | 1432 |
| 754 | Ga0495649_0117054 | 3300046694 | Bacteria | 1410 |
| 755 | Ga0495589_0003564 | 3300046794 | Bacteria | 8415 |
| 756 | Ga0495589_0004669 | 3300046794 | Bacteria | 7279 |
| 757 | Ga0495589_0006341 | 3300046794 | Bacteria | 6245 |
| 758 | Ga0495589_0012732 | 3300046794 | Bacteria | 4348 |
| 759 | Ga0495589_0029137 | 3300046794 | Bacteria | 2782 |
| 760 | Ga0495589_0033781 | 3300046794 | Bacteria | 2568 |
| 761 | Ga0495589_0092582 | 3300046794 | Bacteria | 1467 |
| 762 | Ga0495589_0100803 | 3300046794 | Bacteria | 1397 |
| 763 | Ga0495589_0104005 | 3300046794 | Bacteria | 1372 |
| 764 | Ga0495600_0053710 | 3300046809 | Bacteria | 2631 |
| 765 | Ga0495600_0286010 | 3300046809 | Bacteria | 1043 |
| 766 | Ga0495660_0013816 | 3300046810 | Bacteria | 4680 |
| 767 | Ga0495660_0025416 | 3300046810 | Bacteria | 3364 |
| 768 | Ga0495660_0026036 | 3300046810 | Bacteria | 3318 |
| 769 | Ga0495660_0028870 | 3300046810 | Bacteria | 3131 |
| 770 | Ga0495660_0034716 | 3300046810 | Bacteria | 2820 |
| 771 | Ga0495660_0040239 | 3300046810 | Bacteria | 2591 |
| 772 | Ga0495660_0041564 | 3300046810 | Bacteria | 2544 |
| 773 | Ga0495660_0047773 | 3300046810 | Bacteria | 2342 |
| 774 | Ga0495660_0050464 | 3300046810 | Bacteria | 2266 |
| 775 | Ga0495660_0072687 | 3300046810 | Bacteria | 1821 |
| 776 | Ga0495660_0089589 | 3300046810 | Bacteria | 1601 |
| 777 | Ga0495604_0011519 | 3300047317 | Bacteria | 7025 |
| 778 | Ga0495604_0042466 | 3300047317 | Bacteria | 3563 |
| 779 | Ga0495636_0001835 | 3300047318 | Bacteria | 8124 |
| 780 | Ga0495672_0007310 | 3300047320 | Bacteria | 8331 |
| 781 | Ga0495672_0008442 | 3300047320 | Bacteria | 7601 |
| 782 | Ga0495672_0009010 | 3300047320 | Bacteria | 7280 |
| 783 | Ga0495672_0010128 | 3300047320 | Bacteria | 6742 |
| 784 | Ga0495672_0010461 | 3300047320 | Bacteria | 6606 |
| 785 | Ga0495672_0011167 | 3300047320 | Bacteria | 6350 |
| 786 | Ga0495672_0012745 | 3300047320 | Bacteria | 5845 |
| 787 | Ga0495672_0031188 | 3300047320 | Bacteria | 3330 |
| 788 | Ga0495672_0031607 | 3300047320 | Bacteria | 3303 |
| 789 | Ga0495672_0032736 | 3300047320 | Bacteria | 3229 |
| 790 | Ga0495672_0033623 | 3300047320 | Bacteria | 3175 |
| 791 | Ga0495672_0034094 | 3300047320 | Bacteria | 3148 |
| 792 | Ga0495672_0037737 | 3300047320 | Bacteria | 2953 |
| 793 | Ga0495672_0038871 | 3300047320 | Bacteria | 2898 |
| 794 | Ga0495672_0044315 | 3300047320 | Bacteria | 2669 |
| 795 | Ga0495672_0128903 | 3300047320 | Bacteria | 1333 |
| 796 | Ga0495676_0025893 | 3300047321 | Bacteria | 5056 |
| 797 | Ga0495676_0052914 | 3300047321 | Bacteria | 3238 |
| 798 | Ga0495680_0021393 | 3300047322 | Bacteria | 5416 |
| 799 | Ga0495680_0022051 | 3300047322 | Bacteria | 5318 |
| 800 | Ga0495680_0032391 | 3300047322 | Bacteria | 4243 |
| 801 | Ga0495680_0041037 | 3300047322 | Bacteria | 3681 |
| 802 | Ga0495683_0005020 | 3300047323 | Bacteria | 7413 |
| 803 | Ga0495683_0006289 | 3300047323 | Bacteria | 6497 |
| 804 | Ga0495683_0016417 | 3300047323 | Bacteria | 3845 |
| 805 | Ga0495683_0025315 | 3300047323 | Bacteria | 3043 |
| 806 | Ga0495683_0026077 | 3300047323 | Bacteria | 2991 |
| 807 | Ga0495687_005265 | 3300047443 | Bacteria | 8311 |
| 808 | Ga0495687_008214 | 3300047443 | Bacteria | 6009 |
| 809 | Ga0495687_011443 | 3300047443 | Bacteria | 4771 |
| 810 | Ga0495687_016269 | 3300047443 | Bacteria | 3745 |
| 811 | Ga0495677_0002936 | 3300047445 | Bacteria | 6628 |
| 812 | Ga0495679_012688 | 3300047446 | Bacteria | 3193 |
| 813 | Ga0495679_013579 | 3300047446 | Bacteria | 3049 |
| 814 | Ga0495679_036874 | 3300047446 | Bacteria | 1541 |
| 815 | Ga0495673_0005580 | 3300047469 | Bacteria | 7581 |
| 816 | Ga0495673_0006685 | 3300047469 | Bacteria | 6751 |
| 817 | Ga0495673_0006978 | 3300047469 | Bacteria | 6571 |
| 818 | Ga0495673_0017520 | 3300047469 | Bacteria | 3632 |
| 819 | Ga0495673_0017632 | 3300047469 | Bacteria | 3617 |
| 820 | Ga0495673_0019801 | 3300047469 | Bacteria | 3365 |
| 821 | Ga0495673_0019904 | 3300047469 | Bacteria | 3353 |
| 822 | Ga0495673_0021537 | 3300047469 | Bacteria | 3180 |
| 823 | Ga0495673_0024993 | 3300047469 | Bacteria | 2874 |
| 824 | Ga0495673_0028164 | 3300047469 | Bacteria | 2664 |
| 825 | Ga0495673_0031106 | 3300047469 | Bacteria | 2501 |
| 826 | Ga0495673_0033019 | 3300047469 | Bacteria | 2406 |
| 827 | Ga0495673_0049966 | 3300047469 | Bacteria | 1838 |
| 828 | Ga0495673_0093202 | 3300047469 | Bacteria | 1228 |
| 829 | Ga0495673_0106601 | 3300047469 | Bacteria | 1125 |
| 830 | Ga0495681_0004211 | 3300047470 | Bacteria | 9865 |
| 831 | Ga0495681_0006190 | 3300047470 | Bacteria | 7894 |
| 832 | Ga0495681_0008023 | 3300047470 | Bacteria | 6660 |
| 833 | Ga0495681_0008909 | 3300047470 | Bacteria | 6232 |
| 834 | Ga0495681_0015296 | 3300047470 | Bacteria | 4347 |
| 835 | Ga0495681_0019493 | 3300047470 | Bacteria | 3702 |
| 836 | Ga0495681_0020098 | 3300047470 | Bacteria | 3630 |
| 837 | Ga0495681_0020401 | 3300047470 | Bacteria | 3597 |
| 838 | Ga0495681_0021907 | 3300047470 | Bacteria | 3432 |
| 839 | Ga0495681_0024142 | 3300047470 | Bacteria | 3212 |
| 840 | Ga0495681_0025103 | 3300047470 | Bacteria | 3123 |
| 841 | Ga0495681_0043100 | 3300047470 | Bacteria | 2178 |
| 842 | Ga0495681_0067886 | 3300047470 | Bacteria | 1623 |
| 843 | Ga0495681_0071058 | 3300047470 | Bacteria | 1577 |
| 844 | Ga0495681_0099051 | 3300047470 | Bacteria | 1276 |
| 845 | Ga0495684_0050609 | 3300047471 | Bacteria | 3171 |
| 846 | Ga0495686_0012644 | 3300047472 | Bacteria | 5897 |
| 847 | Ga0495686_0012839 | 3300047472 | Bacteria | 5841 |
| 848 | Ga0495686_0025248 | 3300047472 | Bacteria | 3897 |
| 849 | Ga0495686_0039999 | 3300047472 | Bacteria | 2992 |
| 850 | Ga0495686_0042347 | 3300047472 | Bacteria | 2896 |
| 851 | Ga0495686_0058786 | 3300047472 | Bacteria | 2395 |
| 852 | Ga0495593_0028342 | 3300047673 | Bacteria | 3075 |
| 853 | Ga0495593_0037175 | 3300047673 | Bacteria | 2635 |
| 854 | Ga0495593_0067996 | 3300047673 | Bacteria | 1854 |
| 855 | Ga0495593_0071428 | 3300047673 | Bacteria | 1802 |
| 856 | Ga0495593_0198555 | 3300047673 | Bacteria | 1008 |
| 857 | Ga0495602_0013655 | 3300048088 | Bacteria | 8286 |
| 858 | Ga0495626_0004350 | 3300048091 | Bacteria | 8724 |
| 859 | Ga0495626_0004559 | 3300048091 | Bacteria | 8450 |
| 860 | Ga0495626_0004589 | 3300048091 | Bacteria | 8422 |
| 861 | Ga0495626_0006443 | 3300048091 | Bacteria | 6686 |
| 862 | Ga0495626_0009233 | 3300048091 | Bacteria | 5336 |
| 863 | Ga0495626_0010576 | 3300048091 | Bacteria | 4912 |
| 864 | Ga0495626_0012862 | 3300048091 | Bacteria | 4368 |
| 865 | Ga0495626_0023713 | 3300048091 | Bacteria | 3017 |
| 866 | Ga0495626_0023800 | 3300048091 | Bacteria | 3010 |
| 867 | Ga0495626_0028737 | 3300048091 | Bacteria | 2692 |
| 868 | Ga0495626_0090772 | 3300048091 | Bacteria | 1343 |
| 869 | Ga0496102_0014431 | 3300048905 | Bacteria | 6863 |
| 870 | Ga0496103_0046247 | 3300048906 | Bacteria | 2686 |
| 871 | Ga0496105_0234156 | 3300048908 | Bacteria | 1492 |
| 872 | Ga0496106_0066648 | 3300048909 | Bacteria | 2743 |
| 873 | Ga0496110_0081857 | 3300048913 | Bacteria | 2878 |
| 874 | Ga0496110_0199219 | 3300048913 | Bacteria | 1819 |
| 875 | Ga0496110_0217912 | 3300048913 | Bacteria | 1736 |
| 876 | Ga0496114_0304905 | 3300048917 | Bacteria | 1406 |
| 877 | Ga0496115_0035998 | 3300048918 | Bacteria | 3918 |
| 878 | Ga0496116_0001912 | 3300048919 | Bacteria | 22425 |
| 879 | Ga0496116_0011426 | 3300048919 | Bacteria | 7348 |
| 880 | Ga0496116_0018064 | 3300048919 | Bacteria | 5450 |
| 881 | Ga0496116_0020968 | 3300048919 | Bacteria | 4942 |
| 882 | Ga0496116_0044487 | 3300048919 | Bacteria | 3015 |
| 883 | Ga0496116_0046630 | 3300048919 | Bacteria | 2924 |
| 884 | Ga0496116_0059604 | 3300048919 | Bacteria | 2481 |
| 885 | Ga0496117_0001687 | 3300048920 | Bacteria | 30677 |
| 886 | Ga0496117_0005699 | 3300048920 | Bacteria | 12968 |
| 887 | Ga0496117_0009483 | 3300048920 | Bacteria | 9049 |
| 888 | Ga0496117_0012371 | 3300048920 | Bacteria | 7530 |
| 889 | Ga0496117_0012935 | 3300048920 | Bacteria | 7313 |
| 890 | Ga0496117_0040183 | 3300048920 | Bacteria | 3444 |
| 891 | Ga0496117_0059359 | 3300048920 | Bacteria | 2642 |
| 892 | Ga0496117_0064470 | 3300048920 | Bacteria | 2497 |
| 893 | Ga0496117_0170849 | 3300048920 | Bacteria | 1262 |
| 894 | Ga0496117_0216692 | 3300048920 | Bacteria | 1069 |
| 895 | Ga0496118_0003034 | 3300048921 | Bacteria | 21650 |
| 896 | Ga0496118_0026990 | 3300048921 | Bacteria | 4873 |
| 897 | Ga0496118_0043691 | 3300048921 | Bacteria | 3518 |
| 898 | Ga0496118_0047760 | 3300048921 | Bacteria | 3314 |
| 899 | Ga0496118_0054080 | 3300048921 | Bacteria | 3044 |
| 900 | Ga0496118_0080977 | 3300048921 | Bacteria | 2282 |
| 901 | Ga0496118_0106831 | 3300048921 | Bacteria | 1871 |
| 902 | Ga0496118_0215315 | 3300048921 | Bacteria | 1123 |
| 903 | Ga0496119_0000082 | 3300048922 | Bacteria | 138565 |
| 904 | Ga0496119_0048737 | 3300048922 | Bacteria | 2624 |
| 905 | Ga0496119_0067006 | 3300048922 | Bacteria | 2118 |
| 906 | Ga0496120_0002004 | 3300048923 | Bacteria | 22154 |
| 907 | Ga0496120_0009188 | 3300048923 | Bacteria | 7043 |
| 908 | Ga0496120_0076964 | 3300048923 | Bacteria | 1816 |
| 909 | Ga0496121_0003478 | 3300048924 | Bacteria | 22418 |
| 910 | Ga0496121_0062081 | 3300048924 | Bacteria | 3063 |
| 911 | Ga0496121_0067227 | 3300048924 | Bacteria | 2905 |
| 912 | Ga0496121_0116006 | 3300048924 | Bacteria | 2032 |
| 913 | Ga0496121_0130445 | 3300048924 | Bacteria | 1882 |
| 914 | Ga0496121_0142410 | 3300048924 | Bacteria | 1776 |
| 915 | Ga0496121_0164377 | 3300048924 | Bacteria | 1619 |
| 916 | Ga0496122_0010958 | 3300048925 | Bacteria | 9270 |
| 917 | Ga0496122_0015474 | 3300048925 | Bacteria | 7291 |
| 918 | Ga0496122_0040475 | 3300048925 | Bacteria | 3702 |
| 919 | Ga0496122_0048270 | 3300048925 | Bacteria | 3276 |
| 920 | Ga0496123_0000850 | 3300048926 | Bacteria | 48744 |
| 921 | Ga0496123_0019192 | 3300048926 | Bacteria | 5396 |
| 922 | Ga0496123_0025654 | 3300048926 | Bacteria | 4436 |
| 923 | Ga0496123_0033959 | 3300048926 | Bacteria | 3663 |
| 924 | Ga0496123_0038097 | 3300048926 | Bacteria | 3385 |
| 925 | Ga0496123_0067584 | 3300048926 | Bacteria | 2256 |
| 926 | Ga0496123_0175513 | 3300048926 | Bacteria | 1125 |
| 927 | Ga0496124_0011287 | 3300048927 | Bacteria | 8943 |
| 928 | Ga0496124_0011574 | 3300048927 | Bacteria | 8805 |
| 929 | Ga0496124_0016417 | 3300048927 | Bacteria | 7040 |
| 930 | Ga0496124_0017717 | 3300048927 | Bacteria | 6702 |
| 931 | Ga0496124_0018126 | 3300048927 | Bacteria | 6606 |
| 932 | Ga0496124_0034123 | 3300048927 | Bacteria | 4470 |
| 933 | Ga0496124_0036581 | 3300048927 | Bacteria | 4280 |
| 934 | Ga0496124_0054559 | 3300048927 | Bacteria | 3382 |
| 935 | Ga0496124_0055326 | 3300048927 | Bacteria | 3353 |
| 936 | Ga0496124_0153816 | 3300048927 | Bacteria | 1801 |
| 937 | Ga0496124_0249458 | 3300048927 | Bacteria | 1314 |
| 938 | Ga0496124_0284060 | 3300048927 | Bacteria | 1205 |
| 939 | Ga0496125_0000440 | 3300048928 | Bacteria | 75937 |
| 940 | Ga0496125_0009363 | 3300048928 | Bacteria | 10089 |
| 941 | Ga0496125_0015568 | 3300048928 | Bacteria | 7345 |
| 942 | Ga0496125_0025655 | 3300048928 | Bacteria | 5391 |
| 943 | Ga0496125_0059459 | 3300048928 | Bacteria | 3079 |
| 944 | Ga0496125_0061840 | 3300048928 | Bacteria | 3000 |
| 945 | Ga0496125_0062043 | 3300048928 | Bacteria | 2992 |
| 946 | Ga0496125_0076542 | 3300048928 | Bacteria | 2583 |
| 947 | Ga0496126_0035392 | 3300048929 | Bacteria | 4681 |
| 948 | Ga0496126_0103250 | 3300048929 | Bacteria | 2491 |
| 949 | Ga0495678_005937 | 3300049459 | Bacteria | 6600 |
| 950 | Ga0495678_006763 | 3300049459 | Bacteria | 6039 |
| 951 | Ga0495678_009609 | 3300049459 | Bacteria | 4768 |
| 952 | Ga0495678_012389 | 3300049459 | Bacteria | 4046 |
| 953 | Ga0495678_030238 | 3300049459 | Bacteria | 2267 |
| 954 | Ga0495678_037974 | 3300049459 | Bacteria | 1952 |
| 955 | Ga0495678_054261 | 3300049459 | Bacteria | 1535 |
| 956 | Ga0495678_070472 | 3300049459 | Bacteria | 1283 |
| 957 | Ga0495678_091828 | 3300049459 | Bacteria | 1068 |
| 958 | Ga0495682_0005818 | 3300049460 | Bacteria | 5068 |
| 959 | Ga0495682_0013699 | 3300049460 | Bacteria | 3082 |
| 960 | Ga0495682_0014625 | 3300049460 | Bacteria | 2975 |
| 961 | Ga0495682_0096787 | 3300049460 | Bacteria | 1059 |
| 962 | Ga0501034_0000223 | 3300049571 | Bacteria | 107509 |
| 963 | Ga0501222_002026 | 3300049662 | Bacteria | 2804 |
| 964 | Ga0501241_001559 | 3300049758 | Bacteria | 4600 |
| 965 | Ga0501241_019063 | 3300049758 | Bacteria | 1258 |
| 966 | Ga0501226_002299 | 3300049853 | Bacteria | 2345 |
| 967 | nmdc:mga00v17_140830_c1 | 3300050491 | Bacteria | 1546 |
| 968 | nmdc:mga00v17_22823_c1 | 3300050491 | Bacteria | 3615 |
| 969 | nmdc:mga00v17_47703_c1 | 3300050491 | Bacteria | 2595 |
| 970 | nmdc:mga00v17_49445_c1 | 3300050491 | Bacteria | 2551 |
| 971 | Ga0500572_002411 | 3300053111 | Bacteria | 4507 |
| 972 | Ga0500659_0008307 | 3300053135 | Bacteria | 5723 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 2124908027 | MRS2a_Contig_7922 | MRS2a_00767030 | 251 |
| 2 | 3300048926 | Ga0496123_0025654 | Ga0496123_0025654_1367_2149 | 251 |
| 3 | 3300042013 | Ga0439456_017180 | Ga0439456_017180_720_1487 | 255 |
| 4 | 3300042461 | Ga0439460_0006549 | Ga0439460_0006549_2099_2866 | 255 |
| 5 | 3300046523 | Ga0495644_0077115 | Ga0495644_0077115_27_809 | 260 |
| 6 | 3300048921 | Ga0496118_0106831 | Ga0496118_0106831_814_1737 | 264 |
| 7 | 3300046538 | Ga0495609_0032866 | Ga0495609_0032866_428_1273 | 271 |
| 8 | 3300046507 | Ga0495606_0155396 | Ga0495606_0155396_201_1049 | 273 |
| 9 | 3300046538 | Ga0495609_0061468 | Ga0495609_0061468_413_1330 | 274 |
| 10 | 3300049460 | Ga0495682_0014625 | Ga0495682_0014625_1454_2371 | 274 |
| 11 | 3300046452 | Ga0495617_003481 | Ga0495617_003481_3729_4646 | 276 |
| 12 | 3300046690 | Ga0495624_0311915 | Ga0495624_0311915_90_923 | 276 |
| 13 | 3300047673 | Ga0495593_0198555 | Ga0495593_0198555_146_997 | 276 |
| 14 | 3300005548 | Ga0070665_100070954 | Ga0070665_1000709544 | 277 |
| 15 | 3300006058 | Ga0075432_10009832 | Ga0075432_100098322 | 277 |
| 16 | 3300028379 | Ga0268266_10052479 | Ga0268266_100524793 | 277 |
| 17 | 3300031548 | Ga0307408_100014073 | Ga0307408_1000140735 | 277 |
| 18 | 3300032004 | Ga0307414_10126987 | Ga0307414_101269872 | 277 |
| 19 | 3300042139 | Ga0450904_001012 | Ga0450904_001012_1857_2774 | 277 |
| 20 | 3300046471 | Ga0495650_0007138 | Ga0495650_0007138_1543_2451 | 277 |
| 21 | 3300046506 | Ga0495583_0007949 | Ga0495583_0007949_1485_2393 | 277 |
| 22 | 3300046512 | Ga0495610_0098872 | Ga0495610_0098872_328_1236 | 277 |
| 23 | 3300046519 | Ga0495632_0003986 | Ga0495632_0003986_1416_2324 | 277 |
| 24 | 3300046665 | Ga0495661_0000984 | Ga0495661_0000984_17300_18208 | 277 |
| 25 | 3300046692 | Ga0495671_0056309 | Ga0495671_0056309_12_845 | 277 |
| 26 | 3300048924 | Ga0496121_0130445 | Ga0496121_0130445_11_844 | 277 |
| 27 | 3300049758 | Ga0501241_001559 | Ga0501241_001559_2427_3344 | 277 |
| 28 | 3300006058 | Ga0075432_10016445 | Ga0075432_100164453 | 279 |
| 29 | 3300025728 | Ga0207655_1083301 | Ga0207655_10833011 | 279 |
| 30 | 3300027907 | Ga0207428_10032536 | Ga0207428_100325364 | 279 |
| 31 | 3300050491 | nmdc:mga00v17_47703_c1 | nmdc:mga00v17_47703_c1_1385_2302 | 279 |
| 32 | iso_pu_bacteria | 2913036834 | 2913037063 | 279 |
| 33 | 3300042147 | Ga0450910_001521 | Ga0450910_001521_1512_2381 | 280 |
| 34 | 3300047443 | Ga0495687_016269 | Ga0495687_016269_1082_1999 | 280 |
| 35 | 3300014497 | Ga0182008_10011058 | Ga0182008_100110582 | 281 |
| 36 | 3300015261 | Ga0182006_1004172 | Ga0182006_10041725 | 281 |
| 37 | 3300042006 | Ga0439432_002400 | Ga0439432_002400_3591_4463 | 281 |
| 38 | 3300046460 | Ga0495638_0044293 | Ga0495638_0044293_257_1174 | 281 |
| 39 | 3300046691 | Ga0495670_0022039 | Ga0495670_0022039_2136_3053 | 281 |
| 40 | 3300047443 | Ga0495687_005265 | Ga0495687_005265_3766_4683 | 281 |
| 41 | 2124908027 | MRS2a_Contig_6775 | MRS2a_00631960 | 282 |
| 42 | 3300005288 | Ga0065714_10011336 | Ga0065714_100113362 | 282 |
| 43 | 3300013100 | Ga0157373_10026918 | Ga0157373_100269184 | 282 |
| 44 | 3300014497 | Ga0182008_10020649 | Ga0182008_100206492 | 282 |
| 45 | 3300015261 | Ga0182006_1003195 | Ga0182006_10031956 | 282 |
| 46 | 3300015261 | Ga0182006_1015336 | Ga0182006_10153362 | 282 |
| 47 | 3300015262 | Ga0182007_10004090 | Ga0182007_100040903 | 282 |
| 48 | 3300015265 | Ga0182005_1006390 | Ga0182005_10063902 | 282 |
| 49 | 3300046460 | Ga0495638_0076892 | Ga0495638_0076892_64_981 | 282 |
| 50 | 3300046474 | Ga0495605_0026013 | Ga0495605_0026013_1784_2659 | 282 |
| 51 | 3300046475 | Ga0495639_0000618 | Ga0495639_0000618_11363_12238 | 282 |
| 52 | 3300046501 | Ga0495607_0005886 | Ga0495607_0005886_3543_4421 | 282 |
| 53 | 3300046506 | Ga0495583_0027807 | Ga0495583_0027807_1649_2524 | 282 |
| 54 | 3300046530 | Ga0495654_0005790 | Ga0495654_0005790_2161_3036 | 282 |
| 55 | 3300046557 | Ga0495622_0004331 | Ga0495622_0004331_3597_4472 | 282 |
| 56 | 3300046664 | Ga0495659_0001126 | Ga0495659_0001126_4482_5357 | 282 |
| 57 | 3300046794 | Ga0495589_0012732 | Ga0495589_0012732_2038_2913 | 282 |
| 58 | 3300047320 | Ga0495672_0007310 | Ga0495672_0007310_3432_4307 | 282 |
| 59 | 3300047323 | Ga0495683_0005020 | Ga0495683_0005020_2175_3050 | 282 |
| 60 | 3300047443 | Ga0495687_008214 | Ga0495687_008214_1134_2009 | 282 |
| 61 | 3300048091 | Ga0495626_0004589 | Ga0495626_0004589_3447_4322 | 282 |
| 62 | 3300048909 | Ga0496106_0066648 | Ga0496106_0066648_1506_2381 | 282 |
| 63 | 3300048919 | Ga0496116_0011426 | Ga0496116_0011426_4301_5176 | 282 |
| 64 | 3300048921 | Ga0496118_0080977 | Ga0496118_0080977_1307_2182 | 282 |
| 65 | 3300048924 | Ga0496121_0142410 | Ga0496121_0142410_886_1761 | 282 |
| 66 | 3300048925 | Ga0496122_0015474 | Ga0496122_0015474_2147_3022 | 282 |
| 67 | 3300048926 | Ga0496123_0038097 | Ga0496123_0038097_2086_2961 | 282 |
| 68 | iso_pu_bacteria | 2511231007 | 2511272461 | 282 |
| 69 | 3300002737 | JGI25162J39368_1000520 | JGI25162J39368_100052023 | 283 |
| 70 | 3300002771 | JGI25163J39215_1002247 | JGI25163J39215_10022473 | 283 |
| 71 | 3300002772 | JGI25164J39214_1000350 | JGI25164J39214_100035023 | 283 |
| 72 | 3300003214 | JGI25165J46597_1000645 | JGI25165J46597_100064523 | 283 |
| 73 | 3300009148 | Ga0105243_10024853 | Ga0105243_100248532 | 283 |
| 74 | 3300013100 | Ga0157373_10024148 | Ga0157373_100241484 | 283 |
| 75 | 3300013105 | Ga0157369_10016075 | Ga0157369_100160754 | 283 |
| 76 | 3300013105 | Ga0157369_10072612 | Ga0157369_100726122 | 283 |
| 77 | 3300013308 | Ga0157375_10087624 | Ga0157375_100876243 | 283 |
| 78 | 3300025207 | Ga0209760_100027 | Ga0209760_100027140 | 283 |
| 79 | 3300025231 | Ga0207427_100006 | Ga0207427_100006472 | 283 |
| 80 | 3300025233 | Ga0209437_100013 | Ga0209437_100013472 | 283 |
| 81 | 3300025261 | Ga0209233_1000022 | Ga0209233_1000022472 | 283 |
| 82 | 3300041405 | Ga0439438_017221 | Ga0439438_017221_826_1707 | 284 |
| 83 | 3300041407 | Ga0439447_004769 | Ga0439447_004769_826_1707 | 284 |
| 84 | 3300041411 | Ga0439466_0021314 | Ga0439466_0021314_1069_1950 | 284 |
| 85 | 3300042006 | Ga0439432_013390 | Ga0439432_013390_1572_2453 | 284 |
| 86 | 3300042010 | Ga0439452_003235 | Ga0439452_003235_744_1625 | 284 |
| 87 | 3300042137 | Ga0450902_003311 | Ga0450902_003311_1422_2303 | 284 |
| 88 | 3300042137 | Ga0450902_010270 | Ga0450902_010270_229_1110 | 284 |
| 89 | 3300042138 | Ga0450903_022109 | Ga0450903_022109_53_934 | 284 |
| 90 | 3300042184 | Ga0450908_023796 | Ga0450908_023796_65_946 | 284 |
| 91 | 3300049459 | Ga0495678_030238 | Ga0495678_030238_79_966 | 284 |
| 92 | 3300009036 | Ga0105244_10020950 | Ga0105244_100209502 | 285 |
| 93 | 3300009092 | Ga0105250_10052573 | Ga0105250_100525732 | 285 |
| 94 | 3300012498 | Ga0157345_1000215 | Ga0157345_10002156 | 285 |
| 95 | 3300025728 | Ga0207655_1011995 | Ga0207655_10119954 | 285 |
| 96 | 3300046453 | Ga0495627_013416 | Ga0495627_013416_743_1630 | 285 |
| 97 | 3300046513 | Ga0495616_0029966 | Ga0495616_0029966_1376_2263 | 285 |
| 98 | 3300046520 | Ga0495637_0040565 | Ga0495637_0040565_768_1655 | 285 |
| 99 | 3300046809 | Ga0495600_0286010 | Ga0495600_0286010_145_1029 | 285 |
| 100 | 3300046810 | Ga0495660_0050464 | Ga0495660_0050464_1281_2168 | 285 |
| 101 | 3300047320 | Ga0495672_0010461 | Ga0495672_0010461_1918_2835 | 285 |
| 102 | 3300048091 | Ga0495626_0023713 | Ga0495626_0023713_466_1383 | 285 |
| 103 | 3300003781 | Ga0055536_1018841 | Ga0055536_10188412 | 286 |
| 104 | 3300003791 | Ga0055530_10003441 | Ga0055530_100034414 | 286 |
| 105 | 3300003792 | Ga0055540_1000101 | Ga0055540_100010190 | 286 |
| 106 | 3300025292 | Ga0209676_1005561 | Ga0209676_10055613 | 286 |
| 107 | 3300025298 | Ga0209050_1000028 | Ga0209050_100002851 | 286 |
| 108 | 3300025303 | Ga0209051_1000087 | Ga0209051_100008751 | 286 |
| 109 | 3300025304 | Ga0209257_1006694 | Ga0209257_10066945 | 286 |
| 110 | 3300046471 | Ga0495650_0038282 | Ga0495650_0038282_702_1589 | 286 |
| 111 | 3300046507 | Ga0495606_0009480 | Ga0495606_0009480_3831_4718 | 286 |
| 112 | 3300046507 | Ga0495606_0045607 | Ga0495606_0045607_1914_2801 | 286 |
| 113 | 3300046515 | Ga0495620_0008902 | Ga0495620_0008902_804_1691 | 286 |
| 114 | 3300046519 | Ga0495632_0025416 | Ga0495632_0025416_561_1448 | 286 |
| 115 | 3300046520 | Ga0495637_0027253 | Ga0495637_0027253_1418_2335 | 286 |
| 116 | 3300046520 | Ga0495637_0039044 | Ga0495637_0039044_512_1399 | 286 |
| 117 | 3300046524 | Ga0495648_0051724 | Ga0495648_0051724_1519_2406 | 286 |
| 118 | 3300046530 | Ga0495654_0011090 | Ga0495654_0011090_1356_2243 | 286 |
| 119 | 3300046538 | Ga0495609_0008895 | Ga0495609_0008895_1896_2783 | 286 |
| 120 | 3300046557 | Ga0495622_0008208 | Ga0495622_0008208_313_1200 | 286 |
| 121 | 3300046660 | Ga0495625_0045114 | Ga0495625_0045114_1088_1975 | 286 |
| 122 | 3300046665 | Ga0495661_0027362 | Ga0495661_0027362_508_1395 | 286 |
| 123 | 3300046692 | Ga0495671_0031929 | Ga0495671_0031929_1300_2187 | 286 |
| 124 | 3300046794 | Ga0495589_0003564 | Ga0495589_0003564_3895_4782 | 286 |
| 125 | 3300046810 | Ga0495660_0034716 | Ga0495660_0034716_1847_2734 | 286 |
| 126 | 3300046810 | Ga0495660_0047773 | Ga0495660_0047773_503_1390 | 286 |
| 127 | 3300047470 | Ga0495681_0020401 | Ga0495681_0020401_726_1613 | 286 |
| 128 | 3300047470 | Ga0495681_0099051 | Ga0495681_0099051_375_1262 | 286 |
| 129 | 3300048091 | Ga0495626_0004350 | Ga0495626_0004350_3521_4408 | 286 |
| 130 | 3300005289 | Ga0065704_10232881 | Ga0065704_102328811 | 287 |
| 131 | 3300042009 | Ga0439451_001490 | Ga0439451_001490_3593_4483 | 287 |
| 132 | 3300042010 | Ga0439452_007060 | Ga0439452_007060_397_1287 | 287 |
| 133 | 3300042533 | Ga0450901_001364 | Ga0450901_001364_1495_2412 | 287 |
| 134 | 3300046474 | Ga0495605_0006401 | Ga0495605_0006401_2692_3594 | 287 |
| 135 | 3300046517 | Ga0495630_0078261 | Ga0495630_0078261_275_1228 | 287 |
| 136 | 3300047322 | Ga0495680_0032391 | Ga0495680_0032391_1960_2913 | 287 |
| 137 | 3300047673 | Ga0495593_0067996 | Ga0495593_0067996_26_979 | 287 |
| 138 | 3300048927 | Ga0496124_0055326 | Ga0496124_0055326_67_969 | 287 |
| 139 | iso_pu_bacteria | 2599185155 | 2599331170 | 287 |
| 140 | iso_pu_bacteria | 8055878733 | 8055881143 | 287 |
| 141 | 3300031548 | Ga0307408_100481703 | Ga0307408_1004817031 | 288 |
| 142 | 3300031995 | Ga0307409_100031333 | Ga0307409_1000313334 | 288 |
| 143 | 3300042993 | Ga0439440_0014270 | Ga0439440_0014270_339_1250 | 288 |
| 144 | iso_pu_bacteria | 2623620446 | 2624494903 | 288 |
| 145 | iso_pu_bacteria | 2919697872 | 2919700605 | 288 |
| 146 | iso_pu_bacteria | 2945961074 | 2945966817 | 288 |
| 147 | iso_pu_bacteria | 8019775933 | 8019777712 | 288 |
| 148 | iso_pu_bacteria | 8056115690 | 8056116563 | 288 |
| 149 | iso_pu_bacteria | 8056120720 | 8056120993 | 288 |
| 150 | 3300030744 | Ga0316181_1187933 | Ga0316181_11879333 | 289 |
| 151 | 3300046512 | Ga0495610_0022552 | Ga0495610_0022552_2104_3021 | 289 |
| 152 | 3300048926 | Ga0496123_0033959 | Ga0496123_0033959_1617_2525 | 289 |
| 153 | iso_pu_bacteria | 2554235341 | 2555672805 | 289 |
| 154 | iso_pu_bacteria | 2597489888 | 2597866599 | 289 |
| 155 | iso_pu_bacteria | 2597489889 | 2597872456 | 289 |
| 156 | iso_pu_bacteria | 2599185160 | 2599355991 | 289 |
| 157 | iso_pu_bacteria | 2599185161 | 2599362607 | 289 |
| 158 | iso_pu_bacteria | 2599185162 | 2599369087 | 289 |
| 159 | iso_pu_bacteria | 2599185163 | 2599375716 | 289 |
| 160 | iso_pu_bacteria | 2599185164 | 2599381097 | 289 |
| 161 | iso_pu_bacteria | 2599185165 | 2599387387 | 289 |
| 162 | iso_pu_bacteria | 2599185166 | 2599394574 | 289 |
| 163 | iso_pu_bacteria | 2599185167 | 2599400570 | 289 |
| 164 | iso_pu_bacteria | 2599185168 | 2599406339 | 289 |
| 165 | iso_pu_bacteria | 2599185179 | 2599449894 | 289 |
| 166 | iso_pu_bacteria | 2599185181 | 2599462825 | 289 |
| 167 | iso_pu_bacteria | 2599185182 | 2599467752 | 289 |
| 168 | iso_pu_bacteria | 2599185186 | 2599491842 | 289 |
| 169 | iso_pu_bacteria | 2599185189 | 2599505719 | 289 |
| 170 | iso_pu_bacteria | 2599185190 | 2599511968 | 289 |
| 171 | iso_pu_bacteria | 2599185191 | 2599516952 | 289 |
| 172 | iso_pu_bacteria | 2599185290 | 2599892670 | 289 |
| 173 | iso_pu_bacteria | 2599185356 | 2600215451 | 289 |
| 174 | iso_pu_bacteria | 2600255296 | 2601693476 | 289 |
| 175 | iso_pu_bacteria | 2600255313 | 2601775617 | 289 |
| 176 | iso_pu_bacteria | 2606217733 | 2608383158 | 289 |
| 177 | iso_pu_bacteria | 2643221571 | 2643872234 | 289 |
| 178 | iso_pu_bacteria | 2643221650 | 2644285088 | 289 |
| 179 | iso_pu_bacteria | 2643221713 | 2644620136 | 289 |
| 180 | iso_pu_bacteria | 2667528171 | 2671099247 | 289 |
| 181 | iso_pu_bacteria | 2721755607 | 2723251335 | 289 |
| 182 | iso_pu_bacteria | 2818991464 | 2819704369 | 289 |
| 183 | iso_pu_bacteria | 2842826826 | 2842831316 | 289 |
| 184 | iso_pu_bacteria | 2842837860 | 2842837868 | 289 |
| 185 | iso_pu_bacteria | 2844665904 | 2844667058 | 289 |
| 186 | iso_pu_bacteria | 2860867994 | 2860872998 | 289 |
| 187 | iso_pu_bacteria | 2908446538 | 2908452543 | 289 |
| 188 | iso_pu_bacteria | 2917070673 | 2917076701 | 289 |
| 189 | iso_pu_bacteria | 2929189879 | 2929195120 | 289 |
| 190 | iso_pu_bacteria | 2931390751 | 2931396379 | 289 |
| 191 | iso_pu_bacteria | 2935353572 | 2935358332 | 289 |
| 192 | iso_pu_bacteria | 2946006987 | 2946013324 | 289 |
| 193 | iso_pu_bacteria | 2946027586 | 2946027873 | 289 |
| 194 | iso_pu_bacteria | 2947233263 | 2947234393 | 289 |
| 195 | iso_pu_bacteria | 2988728565 | 2988732001 | 289 |
| 196 | iso_pu_bacteria | 637000220 | 637323242 | 289 |
| 197 | iso_pu_bacteria | 8011350971 | 8011351758 | 289 |
| 198 | iso_pu_bacteria | 8054347763 | 8054349613 | 289 |
| 199 | iso_pu_bacteria | 8056148874 | 8056151526 | 289 |
| 200 | 3300013102 | Ga0157371_10019739 | Ga0157371_100197392 | 290 |
| 201 | 3300014497 | Ga0182008_10089215 | Ga0182008_100892152 | 290 |
| 202 | 3300015262 | Ga0182007_10069819 | Ga0182007_100698191 | 290 |
| 203 | 3300030731 | Ga0316177_1055608 | Ga0316177_10556083 | 290 |
| 204 | 3300041405 | Ga0439438_004815 | Ga0439438_004815_857_1771 | 290 |
| 205 | 3300041997 | Ga0439431_0001670 | Ga0439431_0001670_3131_4045 | 290 |
| 206 | 3300042004 | Ga0439445_0055508 | Ga0439445_0055508_116_1030 | 290 |
| 207 | 3300042006 | Ga0439432_005807 | Ga0439432_005807_879_1793 | 290 |
| 208 | 3300042156 | Ga0439446_0002695 | Ga0439446_0002695_730_1644 | 290 |
| 209 | 3300042435 | Ga0439434_0016586 | Ga0439434_0016586_11_925 | 290 |
| 210 | iso_pu_bacteria | 2511231006 | 2511269073 | 290 |
| 211 | iso_pu_bacteria | 2511231024 | 2511374699 | 290 |
| 212 | iso_pu_bacteria | 2512047018 | 2512327189 | 290 |
| 213 | iso_pu_bacteria | 2554235231 | 2555247229 | 290 |
| 214 | iso_pu_bacteria | 2582580891 | 2583795220 | 290 |
| 215 | iso_pu_bacteria | 2597489887 | 2597860851 | 290 |
| 216 | iso_pu_bacteria | 2599185185 | 2599485913 | 290 |
| 217 | iso_pu_bacteria | 2599185257 | 2599804696 | 290 |
| 218 | iso_pu_bacteria | 2600254931 | 2600363577 | 290 |
| 219 | iso_pu_bacteria | 2671180172 | 2671771703 | 290 |
| 220 | iso_pu_bacteria | 2675903515 | 2678260750 | 290 |
| 221 | iso_pu_bacteria | 2740892503 | 2743740393 | 290 |
| 222 | iso_pu_bacteria | 2744054620 | 2745006070 | 290 |
| 223 | iso_pu_bacteria | 2806310737 | 2807406071 | 290 |
| 224 | iso_pu_bacteria | 2806310745 | 2807454423 | 290 |
| 225 | iso_pu_bacteria | 2808606361 | 2808858888 | 290 |
| 226 | iso_pu_bacteria | 2808606376 | 2808923794 | 290 |
| 227 | iso_pu_bacteria | 2808606378 | 2808938969 | 290 |
| 228 | iso_pu_bacteria | 2808606380 | 2808945821 | 290 |
| 229 | iso_pu_bacteria | 2808606383 | 2808967392 | 290 |
| 230 | iso_pu_bacteria | 2808606389 | 2809002214 | 290 |
| 231 | iso_pu_bacteria | 2912963787 | 2912963982 | 290 |
| 232 | iso_pu_bacteria | 2919155634 | 2919155876 | 290 |
| 233 | iso_pu_bacteria | 2923153595 | 2923159486 | 290 |
| 234 | iso_pu_bacteria | 2939651529 | 2939655080 | 290 |
| 235 | iso_pu_bacteria | 2984286254 | 2984286630 | 290 |
| 236 | iso_pu_bacteria | 3007803356 | 3007804268 | 290 |
| 237 | iso_pu_bacteria | 3007872151 | 3007873330 | 290 |
| 238 | iso_pu_bacteria | 8015687852 | 8015693585 | 290 |
| 239 | iso_pu_bacteria | 8019769354 | 8019769799 | 290 |
| 240 | iso_pu_bacteria | 8052494512 | 8052494880 | 290 |
| 241 | iso_pu_bacteria | 8055770955 | 8055776831 | 290 |
| 242 | iso_pu_bacteria | 8056137416 | 8056137661 | 290 |
| 243 | iso_pu_bacteria | 8057798959 | 8057801909 | 290 |
| 244 | 3300003781 | Ga0055536_1003161 | Ga0055536_10031616 | 291 |
| 245 | 3300009036 | Ga0105244_10002122 | Ga0105244_1000212214 | 291 |
| 246 | 3300009092 | Ga0105250_10025184 | Ga0105250_100251843 | 291 |
| 247 | 3300009148 | Ga0105243_10005271 | Ga0105243_100052713 | 291 |
| 248 | 3300011119 | Ga0105246_10007194 | Ga0105246_100071943 | 291 |
| 249 | 3300013100 | Ga0157373_10059873 | Ga0157373_100598732 | 291 |
| 250 | 3300014497 | Ga0182008_10019084 | Ga0182008_100190844 | 291 |
| 251 | 3300015261 | Ga0182006_1003355 | Ga0182006_10033554 | 291 |
| 252 | 3300025230 | Ga0209563_100744 | Ga0209563_1007449 | 291 |
| 253 | 3300025292 | Ga0209676_1000041 | Ga0209676_1000041202 | 291 |
| 254 | 3300025292 | Ga0209676_1025681 | Ga0209676_10256812 | 291 |
| 255 | 3300025298 | Ga0209050_1004799 | Ga0209050_10047996 | 291 |
| 256 | 3300025728 | Ga0207655_1003239 | Ga0207655_10032393 | 291 |
| 257 | 3300025935 | Ga0207709_10009492 | Ga0207709_100094922 | 291 |
| 258 | 3300027111 | Ga0209281_1012084 | Ga0209281_10120842 | 291 |
| 259 | 3300027907 | Ga0207428_10068144 | Ga0207428_100681443 | 291 |
| 260 | 3300030734 | Ga0316179_1074996 | Ga0316179_10749961 | 291 |
| 261 | 3300030735 | Ga0316178_1112082 | Ga0316178_111208213 | 291 |
| 262 | 3300031548 | Ga0307408_100011399 | Ga0307408_1000113994 | 291 |
| 263 | 3300031903 | Ga0307407_10276100 | Ga0307407_102761002 | 291 |
| 264 | 3300031911 | Ga0307412_10044896 | Ga0307412_100448962 | 291 |
| 265 | 3300031911 | Ga0307412_10202164 | Ga0307412_102021641 | 291 |
| 266 | 3300031911 | Ga0307412_10312557 | Ga0307412_103125572 | 291 |
| 267 | 3300032004 | Ga0307414_10054895 | Ga0307414_100548952 | 291 |
| 268 | 3300032005 | Ga0307411_10030052 | Ga0307411_100300522 | 291 |
| 269 | 3300041405 | Ga0439438_007274 | Ga0439438_007274_876_1793 | 291 |
| 270 | 3300041405 | Ga0439438_007651 | Ga0439438_007651_740_1657 | 291 |
| 271 | 3300041407 | Ga0439447_033395 | Ga0439447_033395_332_1249 | 291 |
| 272 | 3300041411 | Ga0439466_0014290 | Ga0439466_0014290_1501_2418 | 291 |
| 273 | 3300042006 | Ga0439432_009772 | Ga0439432_009772_744_1661 | 291 |
| 274 | 3300042010 | Ga0439452_000629 | Ga0439452_000629_15668_16585 | 291 |
| 275 | 3300042010 | Ga0439452_018907 | Ga0439452_018907_456_1373 | 291 |
| 276 | 3300042013 | Ga0439456_001856 | Ga0439456_001856_1745_2662 | 291 |
| 277 | 3300042115 | Ga0450911_002373 | Ga0450911_002373_1225_2142 | 291 |
| 278 | 3300042139 | Ga0450904_001414 | Ga0450904_001414_2422_3339 | 291 |
| 279 | 3300042145 | Ga0450906_001397 | Ga0450906_001397_642_1559 | 291 |
| 280 | 3300042145 | Ga0450906_002105 | Ga0450906_002105_2111_3028 | 291 |
| 281 | 3300042146 | Ga0450907_006182 | Ga0450907_006182_618_1535 | 291 |
| 282 | 3300046524 | Ga0495648_0028927 | Ga0495648_0028927_1835_2752 | 291 |
| 283 | 3300047320 | Ga0495672_0012745 | Ga0495672_0012745_3733_4650 | 291 |
| 284 | 3300047469 | Ga0495673_0006978 | Ga0495673_0006978_3832_4842 | 291 |
| 285 | 3300050491 | nmdc:mga00v17_49445_c1 | nmdc:mga00v17_49445_c1_637_1554 | 291 |
| 286 | iso_pu_bacteria | 2511231020 | 2511349298 | 291 |
| 287 | iso_pu_bacteria | 2511231031 | 2511413496 | 291 |
| 288 | iso_pu_bacteria | 2511231156 | 2511822230 | 291 |
| 289 | iso_pu_bacteria | 2599185188 | 2599502685 | 291 |
| 290 | iso_pu_bacteria | 2599185212 | 2599613188 | 291 |
| 291 | iso_pu_bacteria | 2599185248 | 2599769179 | 291 |
| 292 | iso_pu_bacteria | 2599185288 | 2599879006 | 291 |
| 293 | iso_pu_bacteria | 2599185289 | 2599888423 | 291 |
| 294 | iso_pu_bacteria | 2599185291 | 2599900331 | 291 |
| 295 | iso_pu_bacteria | 2599185300 | 2599934383 | 291 |
| 296 | iso_pu_bacteria | 2599185302 | 2599943838 | 291 |
| 297 | iso_pu_bacteria | 2599185303 | 2599951420 | 291 |
| 298 | iso_pu_bacteria | 2599185304 | 2599956241 | 291 |
| 299 | iso_pu_bacteria | 2599185305 | 2599961657 | 291 |
| 300 | iso_pu_bacteria | 2599185306 | 2599965805 | 291 |
| 301 | iso_pu_bacteria | 2599185308 | 2599977446 | 291 |
| 302 | iso_pu_bacteria | 2599185309 | 2599984913 | 291 |
| 303 | iso_pu_bacteria | 2599185310 | 2599990913 | 291 |
| 304 | iso_pu_bacteria | 2599185311 | 2599996198 | 291 |
| 305 | iso_pu_bacteria | 2599185312 | 2600002161 | 291 |
| 306 | iso_pu_bacteria | 2599185313 | 2600004630 | 291 |
| 307 | iso_pu_bacteria | 2599185314 | 2600011701 | 291 |
| 308 | iso_pu_bacteria | 2599185315 | 2600018871 | 291 |
| 309 | iso_pu_bacteria | 2599185316 | 2600024497 | 291 |
| 310 | iso_pu_bacteria | 2599185317 | 2600030001 | 291 |
| 311 | iso_pu_bacteria | 2599185318 | 2600034903 | 291 |
| 312 | iso_pu_bacteria | 2599185319 | 2600043134 | 291 |
| 313 | iso_pu_bacteria | 2599185320 | 2600047850 | 291 |
| 314 | iso_pu_bacteria | 2599185321 | 2600055127 | 291 |
| 315 | iso_pu_bacteria | 2599185322 | 2600060154 | 291 |
| 316 | iso_pu_bacteria | 2599185323 | 2600065934 | 291 |
| 317 | iso_pu_bacteria | 2599185324 | 2600071550 | 291 |
| 318 | iso_pu_bacteria | 2599185325 | 2600079216 | 291 |
| 319 | iso_pu_bacteria | 2600254930 | 2600359310 | 291 |
| 320 | iso_pu_bacteria | 2619619299 | 2621296877 | 291 |
| 321 | iso_pu_bacteria | 2651869719 | 2652548964 | 291 |
| 322 | iso_pu_bacteria | 2667528170 | 2671092547 | 291 |
| 323 | iso_pu_bacteria | 2667528176 | 2671127118 | 291 |
| 324 | iso_pu_bacteria | 2675903420 | 2677897093 | 291 |
| 325 | iso_pu_bacteria | 2738541265 | 2738671697 | 291 |
| 326 | iso_pu_bacteria | 2738541282 | 2738750091 | 291 |
| 327 | iso_pu_bacteria | 2738541294 | 2738807222 | 291 |
| 328 | iso_pu_bacteria | 2738541303 | 2738859131 | 291 |
| 329 | iso_pu_bacteria | 2738541309 | 2738894582 | 291 |
| 330 | iso_pu_bacteria | 2765235841 | 2765581444 | 291 |
| 331 | iso_pu_bacteria | 2791355520 | 2794598877 | 291 |
| 332 | iso_pu_bacteria | 2808606385 | 2808976115 | 291 |
| 333 | iso_pu_bacteria | 2808606388 | 2808993218 | 291 |
| 334 | iso_pu_bacteria | 2816332298 | 2817494010 | 291 |
| 335 | iso_pu_bacteria | 2825651385 | 2825654490 | 291 |
| 336 | iso_pu_bacteria | 2834028612 | 2834030917 | 291 |
| 337 | iso_pu_bacteria | 2842854478 | 2842858860 | 291 |
| 338 | iso_pu_bacteria | 2852612431 | 2852616320 | 291 |
| 339 | iso_pu_bacteria | 2852667396 | 2852671288 | 291 |
| 340 | iso_pu_bacteria | 2904550169 | 2904551359 | 291 |
| 341 | iso_pu_bacteria | 2919481497 | 2919486364 | 291 |
| 342 | iso_pu_bacteria | 2923586266 | 2923589519 | 291 |
| 343 | iso_pu_bacteria | 2929144301 | 2929144579 | 291 |
| 344 | iso_pu_bacteria | 2931369376 | 2931372068 | 291 |
| 345 | iso_pu_bacteria | 2945928738 | 2945930943 | 291 |
| 346 | iso_pu_bacteria | 3007395558 | 3007399429 | 291 |
| 347 | iso_pu_bacteria | 8054285046 | 8054288509 | 291 |
| 348 | iso_pu_bacteria | 8054503363 | 8054508901 | 291 |
| 349 | iso_pu_bacteria | 8055817908 | 8055823868 | 291 |
| 350 | iso_pu_bacteria | 8056131705 | 8056137279 | 291 |
| 351 | iso_pu_bacteria | 8056143049 | 8056143506 | 291 |
| 352 | iso_pu_bacteria | 8056161164 | 8056163600 | 291 |
| 353 | 3300005288 | Ga0065714_10069189 | Ga0065714_100691892 | 292 |
| 354 | 3300006058 | Ga0075432_10004104 | Ga0075432_100041042 | 292 |
| 355 | 3300006946 | Ga0079104_1002683 | Ga0079104_10026837 | 292 |
| 356 | 3300009036 | Ga0105244_10044979 | Ga0105244_100449792 | 292 |
| 357 | 3300009036 | Ga0105244_10066896 | Ga0105244_100668962 | 292 |
| 358 | 3300013307 | Ga0157372_10058524 | Ga0157372_100585243 | 292 |
| 359 | 3300017792 | Ga0163161_10044204 | Ga0163161_100442043 | 292 |
| 360 | 3300025728 | Ga0207655_1001189 | Ga0207655_100118920 | 292 |
| 361 | 3300025728 | Ga0207655_1015437 | Ga0207655_10154373 | 292 |
| 362 | 3300025728 | Ga0207655_1037984 | Ga0207655_10379841 | 292 |
| 363 | 3300025728 | Ga0207655_1042228 | Ga0207655_10422282 | 292 |
| 364 | 3300025735 | Ga0207713_1042159 | Ga0207713_10421592 | 292 |
| 365 | 3300027111 | Ga0209281_1000016 | Ga0209281_1000016282 | 292 |
| 366 | 3300038705 | Ga0237819_04056 | Ga0237819_04056_788_1705 | 292 |
| 367 | 3300041405 | Ga0439438_004433 | Ga0439438_004433_1311_2213 | 292 |
| 368 | 3300046453 | Ga0495627_001624 | Ga0495627_001624_7321_8232 | 292 |
| 369 | 3300046458 | Ga0495591_011932 | Ga0495591_011932_1962_2867 | 292 |
| 370 | 3300046460 | Ga0495638_0015777 | Ga0495638_0015777_575_1492 | 292 |
| 371 | 3300046474 | Ga0495605_0006887 | Ga0495605_0006887_4359_5276 | 292 |
| 372 | 3300046492 | Ga0495585_0016686 | Ga0495585_0016686_2774_3691 | 292 |
| 373 | 3300046507 | Ga0495606_0176458 | Ga0495606_0176458_259_1176 | 292 |
| 374 | 3300046518 | Ga0495631_0003546 | Ga0495631_0003546_3478_4389 | 292 |
| 375 | 3300046519 | Ga0495632_0015219 | Ga0495632_0015219_1267_2178 | 292 |
| 376 | 3300046519 | Ga0495632_0024505 | Ga0495632_0024505_356_1261 | 292 |
| 377 | 3300046520 | Ga0495637_0028038 | Ga0495637_0028038_1099_2016 | 292 |
| 378 | 3300046522 | Ga0495643_0040577 | Ga0495643_0040577_1225_2142 | 292 |
| 379 | 3300046524 | Ga0495648_0042487 | Ga0495648_0042487_85_1002 | 292 |
| 380 | 3300046524 | Ga0495648_0048455 | Ga0495648_0048455_1614_2531 | 292 |
| 381 | 3300046530 | Ga0495654_0002894 | Ga0495654_0002894_4146_5057 | 292 |
| 382 | 3300046530 | Ga0495654_0017047 | Ga0495654_0017047_1206_2123 | 292 |
| 383 | 3300046530 | Ga0495654_0083478 | Ga0495654_0083478_359_1276 | 292 |
| 384 | 3300046542 | Ga0495597_0045529 | Ga0495597_0045529_808_1725 | 292 |
| 385 | 3300046665 | Ga0495661_0016556 | Ga0495661_0016556_391_1296 | 292 |
| 386 | 3300046692 | Ga0495671_0031327 | Ga0495671_0031327_1251_2168 | 292 |
| 387 | 3300046694 | Ga0495649_0013352 | Ga0495649_0013352_3256_4173 | 292 |
| 388 | 3300047320 | Ga0495672_0009010 | Ga0495672_0009010_2155_3060 | 292 |
| 389 | 3300047320 | Ga0495672_0038871 | Ga0495672_0038871_1796_2707 | 292 |
| 390 | 3300048091 | Ga0495626_0090772 | Ga0495626_0090772_348_1265 | 292 |
| 391 | 3300048927 | Ga0496124_0054559 | Ga0496124_0054559_2165_3064 | 292 |
| 392 | iso_pu_bacteria | 2511231004 | 2511254029 | 292 |
| 393 | iso_pu_bacteria | 2511231008 | 2511277625 | 292 |
| 394 | iso_pu_bacteria | 2511231010 | 2511289373 | 292 |
| 395 | iso_pu_bacteria | 2511231011 | 2511296399 | 292 |
| 396 | iso_pu_bacteria | 2511231012 | 2511302846 | 292 |
| 397 | iso_pu_bacteria | 2511231014 | 2511312006 | 292 |
| 398 | iso_pu_bacteria | 2511231015 | 2511318705 | 292 |
| 399 | iso_pu_bacteria | 2511231016 | 2511324866 | 292 |
| 400 | iso_pu_bacteria | 2511231017 | 2511329639 | 292 |
| 401 | iso_pu_bacteria | 2511231018 | 2511336864 | 292 |
| 402 | iso_pu_bacteria | 2511231019 | 2511344828 | 292 |
| 403 | iso_pu_bacteria | 2511231021 | 2511359318 | 292 |
| 404 | iso_pu_bacteria | 2511231022 | 2511360926 | 292 |
| 405 | iso_pu_bacteria | 2511231023 | 2511372470 | 292 |
| 406 | iso_pu_bacteria | 2600255318 | 2601798591 | 292 |
| 407 | iso_pu_bacteria | 2603880185 | 2606077485 | 292 |
| 408 | iso_pu_bacteria | 2603880199 | 2606129269 | 292 |
| 409 | iso_pu_bacteria | 2623620443 | 2624483381 | 292 |
| 410 | iso_pu_bacteria | 2643221565 | 2643842932 | 292 |
| 411 | iso_pu_bacteria | 2643221589 | 2643955665 | 292 |
| 412 | iso_pu_bacteria | 2643221602 | 2644020459 | 292 |
| 413 | iso_pu_bacteria | 2643221633 | 2644184516 | 292 |
| 414 | iso_pu_bacteria | 2713897148 | 2715749862 | 292 |
| 415 | iso_pu_bacteria | 2713897149 | 2715754878 | 292 |
| 416 | iso_pu_bacteria | 2718217725 | 2718636582 | 292 |
| 417 | iso_pu_bacteria | 2738543004 | 2739199027 | 292 |
| 418 | iso_pu_bacteria | 2738543015 | 2739258968 | 292 |
| 419 | iso_pu_bacteria | 2738543025 | 2739312537 | 292 |
| 420 | iso_pu_bacteria | 2773857670 | 2774118409 | 292 |
| 421 | iso_pu_bacteria | 2773857673 | 2774135601 | 292 |
| 422 | iso_pu_bacteria | 2784132063 | 2784261850 | 292 |
| 423 | iso_pu_bacteria | 2784132072 | 2784317914 | 292 |
| 424 | iso_pu_bacteria | 2808606377 | 2808928474 | 292 |
| 425 | iso_pu_bacteria | 2808606381 | 2808950343 | 292 |
| 426 | iso_pu_bacteria | 2808606382 | 2808959875 | 292 |
| 427 | iso_pu_bacteria | 2808606445 | 2809217152 | 292 |
| 428 | iso_pu_bacteria | 2818991456 | 2819655099 | 292 |
| 429 | iso_pu_bacteria | 2842832357 | 2842833431 | 292 |
| 430 | iso_pu_bacteria | 2842843487 | 2842845659 | 292 |
| 431 | iso_pu_bacteria | 2852657418 | 2852659646 | 292 |
| 432 | iso_pu_bacteria | 2860339153 | 2860341682 | 292 |
| 433 | iso_pu_bacteria | 2878029506 | 2878035323 | 292 |
| 434 | iso_pu_bacteria | 2880230671 | 2880235964 | 292 |
| 435 | iso_pu_bacteria | 2904518522 | 2904518988 | 292 |
| 436 | iso_pu_bacteria | 2919063839 | 2919065550 | 292 |
| 437 | iso_pu_bacteria | 2919385768 | 2919389218 | 292 |
| 438 | iso_pu_bacteria | 2919456309 | 2919457516 | 292 |
| 439 | iso_pu_bacteria | 2919487758 | 2919488197 | 292 |
| 440 | iso_pu_bacteria | 2931396565 | 2931398044 | 292 |
| 441 | iso_pu_bacteria | 2939636861 | 2939640836 | 292 |
| 442 | iso_pu_bacteria | 2969304461 | 2969310143 | 292 |
| 443 | iso_pu_bacteria | 2974289157 | 2974294109 | 292 |
| 444 | iso_pu_bacteria | 2998139840 | 2998145366 | 292 |
| 445 | iso_pu_bacteria | 3007511990 | 3007517147 | 292 |
| 446 | iso_pu_bacteria | 3007614139 | 3007615522 | 292 |
| 447 | iso_pu_bacteria | 3007619802 | 3007622490 | 292 |
| 448 | iso_pu_bacteria | 3007718800 | 3007720497 | 292 |
| 449 | iso_pu_bacteria | 3007855910 | 3007859161 | 292 |
| 450 | iso_pu_bacteria | 3007861166 | 3007865133 | 292 |
| 451 | iso_pu_bacteria | 8029995093 | 8029995533 | 292 |
| 452 | iso_pu_bacteria | 8056125926 | 8056131573 | 292 |
| 453 | iso_pu_bacteria | 8056155041 | 8056160820 | 292 |
| 454 | iso_pu_bacteria | 8056172158 | 8056177442 | 292 |
| 455 | iso_pu_bacteria | 8056177738 | 8056181968 | 292 |
| 456 | iso_pu_bacteria | 8056569372 | 8056570434 | 292 |
| 457 | 3300001915 | JGI24741J21665_1004037 | JGI24741J21665_10040372 | 293 |
| 458 | 3300002737 | JGI25162J39368_1000505 | JGI25162J39368_10005058 | 293 |
| 459 | 3300002771 | JGI25163J39215_1001487 | JGI25163J39215_10014874 | 293 |
| 460 | 3300002772 | JGI25164J39214_1000342 | JGI25164J39214_100034221 | 293 |
| 461 | 3300003214 | JGI25165J46597_1000629 | JGI25165J46597_100062921 | 293 |
| 462 | 3300003751 | Ga0055538_1000032 | Ga0055538_1000032105 | 293 |
| 463 | 3300003752 | Ga0055539_1000043 | Ga0055539_1000043105 | 293 |
| 464 | 3300003756 | Ga0055533_1000052 | Ga0055533_1000052105 | 293 |
| 465 | 3300003758 | Ga0055532_1000047 | Ga0055532_100004785 | 293 |
| 466 | 3300003759 | Ga0055525_1000062 | Ga0055525_1000062105 | 293 |
| 467 | 3300003761 | Ga0055535_1002417 | Ga0055535_10024175 | 293 |
| 468 | 3300003841 | Ga0055541_1000030 | Ga0055541_1000030105 | 293 |
| 469 | 3300005288 | Ga0065714_10014633 | Ga0065714_100146333 | 293 |
| 470 | 3300005289 | Ga0065704_10007238 | Ga0065704_100072382 | 293 |
| 471 | 3300005353 | Ga0070669_100011273 | Ga0070669_1000112732 | 293 |
| 472 | 3300005457 | Ga0070662_100002011 | Ga0070662_1000020116 | 293 |
| 473 | 3300005539 | Ga0068853_100000187 | Ga0068853_10000018741 | 293 |
| 474 | 3300005564 | Ga0070664_100049753 | Ga0070664_1000497532 | 293 |
| 475 | 3300005578 | Ga0068854_100016186 | Ga0068854_1000161865 | 293 |
| 476 | 3300005834 | Ga0068851_10000007 | Ga0068851_100000077 | 293 |
| 477 | 3300009011 | Ga0105251_10005898 | Ga0105251_100058984 | 293 |
| 478 | 3300009011 | Ga0105251_10006408 | Ga0105251_100064084 | 293 |
| 479 | 3300009092 | Ga0105250_10005377 | Ga0105250_100053773 | 293 |
| 480 | 3300009148 | Ga0105243_10004174 | Ga0105243_100041745 | 293 |
| 481 | 3300009148 | Ga0105243_10044423 | Ga0105243_100444233 | 293 |
| 482 | 3300009177 | Ga0105248_10075305 | Ga0105248_100753053 | 293 |
| 483 | 3300009545 | Ga0105237_10098036 | Ga0105237_100980363 | 293 |
| 484 | 3300009553 | Ga0105249_10014890 | Ga0105249_100148904 | 293 |
| 485 | 3300011119 | Ga0105246_10004966 | Ga0105246_100049665 | 293 |
| 486 | 3300013102 | Ga0157371_10019357 | Ga0157371_100193574 | 293 |
| 487 | 3300013104 | Ga0157370_10133233 | Ga0157370_101332332 | 293 |
| 488 | 3300013105 | Ga0157369_10037609 | Ga0157369_100376094 | 293 |
| 489 | 3300013105 | Ga0157369_10075803 | Ga0157369_100758034 | 293 |
| 490 | 3300014497 | Ga0182008_10000775 | Ga0182008_100007758 | 293 |
| 491 | 3300014497 | Ga0182008_10024642 | Ga0182008_100246422 | 293 |
| 492 | 3300014497 | Ga0182008_10030716 | Ga0182008_100307162 | 293 |
| 493 | 3300015261 | Ga0182006_1013613 | Ga0182006_10136133 | 293 |
| 494 | 3300017792 | Ga0163161_10045458 | Ga0163161_100454582 | 293 |
| 495 | 3300025206 | Ga0209435_100677 | Ga0209435_1006772 | 293 |
| 496 | 3300025207 | Ga0209760_100197 | Ga0209760_10019721 | 293 |
| 497 | 3300025224 | Ga0209784_100007 | Ga0209784_100007411 | 293 |
| 498 | 3300025225 | Ga0209566_100009 | Ga0209566_100009411 | 293 |
| 499 | 3300025226 | Ga0209674_100021 | Ga0209674_100021411 | 293 |
| 500 | 3300025229 | Ga0209147_100009 | Ga0209147_100009411 | 293 |
| 501 | 3300025230 | Ga0209563_100018 | Ga0209563_100018411 | 293 |
| 502 | 3300025231 | Ga0207427_100005 | Ga0207427_100005302 | 293 |
| 503 | 3300025233 | Ga0209437_100018 | Ga0209437_100018212 | 293 |
| 504 | 3300025242 | Ga0209258_100169 | Ga0209258_10016973 | 293 |
| 505 | 3300025246 | Ga0209646_1000335 | Ga0209646_10003358 | 293 |
| 506 | 3300025253 | Ga0209677_100012 | Ga0209677_100012411 | 293 |
| 507 | 3300025256 | Ga0209759_1013699 | Ga0209759_10136991 | 293 |
| 508 | 3300025261 | Ga0209233_1000021 | Ga0209233_1000021302 | 293 |
| 509 | 3300025321 | Ga0207656_10000006 | Ga0207656_1000000695 | 293 |
| 510 | 3300025735 | Ga0207713_1003323 | Ga0207713_10033239 | 293 |
| 511 | 3300025735 | Ga0207713_1005214 | Ga0207713_10052146 | 293 |
| 512 | 3300025914 | Ga0207671_10055355 | Ga0207671_100553553 | 293 |
| 513 | 3300025923 | Ga0207681_10000099 | Ga0207681_1000009967 | 293 |
| 514 | 3300025933 | Ga0207706_10001069 | Ga0207706_1000106922 | 293 |
| 515 | 3300025935 | Ga0207709_10000274 | Ga0207709_1000027417 | 293 |
| 516 | 3300025935 | Ga0207709_10278770 | Ga0207709_102787702 | 293 |
| 517 | 3300025941 | Ga0207711_10058639 | Ga0207711_100586393 | 293 |
| 518 | 3300025945 | Ga0207679_10020286 | Ga0207679_100202864 | 293 |
| 519 | 3300025961 | Ga0207712_10022168 | Ga0207712_100221684 | 293 |
| 520 | 3300026041 | Ga0207639_10001195 | Ga0207639_100011954 | 293 |
| 521 | 3300027907 | Ga0207428_10171354 | Ga0207428_101713542 | 293 |
| 522 | 3300028786 | Ga0307517_10054579 | Ga0307517_100545793 | 293 |
| 523 | 3300046491 | Ga0495584_0028519 | Ga0495584_0028519_1271_2188 | 293 |
| 524 | 3300046507 | Ga0495606_0026067 | Ga0495606_0026067_2058_2966 | 293 |
| 525 | 3300046558 | Ga0495633_0027683 | Ga0495633_0027683_1504_2409 | 293 |
| 526 | 3300047320 | Ga0495672_0033623 | Ga0495672_0033623_293_1198 | 293 |
| 527 | 3300047446 | Ga0495679_013579 | Ga0495679_013579_90_1007 | 293 |
| 528 | 3300047469 | Ga0495673_0049966 | Ga0495673_0049966_89_1006 | 293 |
| 529 | 3300047469 | Ga0495673_0093202 | Ga0495673_0093202_67_975 | 293 |
| 530 | 3300048091 | Ga0495626_0023800 | Ga0495626_0023800_442_1359 | 293 |
| 531 | 3300048919 | Ga0496116_0001912 | Ga0496116_0001912_5860_6765 | 293 |
| 532 | 3300048919 | Ga0496116_0018064 | Ga0496116_0018064_748_1665 | 293 |
| 533 | 3300048920 | Ga0496117_0005699 | Ga0496117_0005699_5916_6821 | 293 |
| 534 | 3300048920 | Ga0496117_0012371 | Ga0496117_0012371_3742_4650 | 293 |
| 535 | 3300048920 | Ga0496117_0216692 | Ga0496117_0216692_66_983 | 293 |
| 536 | 3300048921 | Ga0496118_0026990 | Ga0496118_0026990_3779_4684 | 293 |
| 537 | 3300048921 | Ga0496118_0215315 | Ga0496118_0215315_127_1044 | 293 |
| 538 | 3300048922 | Ga0496119_0048737 | Ga0496119_0048737_1252_2160 | 293 |
| 539 | 3300048923 | Ga0496120_0009188 | Ga0496120_0009188_2520_3428 | 293 |
| 540 | 3300048924 | Ga0496121_0003478 | Ga0496121_0003478_5846_6751 | 293 |
| 541 | 3300048925 | Ga0496122_0010958 | Ga0496122_0010958_2803_3708 | 293 |
| 542 | 3300048925 | Ga0496122_0040475 | Ga0496122_0040475_888_1796 | 293 |
| 543 | 3300048926 | Ga0496123_0019192 | Ga0496123_0019192_2966_3871 | 293 |
| 544 | 3300048927 | Ga0496124_0016417 | Ga0496124_0016417_3623_4531 | 293 |
| 545 | 3300048927 | Ga0496124_0036581 | Ga0496124_0036581_1959_2876 | 293 |
| 546 | 3300048928 | Ga0496125_0009363 | Ga0496125_0009363_5801_6709 | 293 |
| 547 | 3300048928 | Ga0496125_0015568 | Ga0496125_0015568_2696_3604 | 293 |
| 548 | 3300049459 | Ga0495678_012389 | Ga0495678_012389_1874_2791 | 293 |
| 549 | 3300049459 | Ga0495678_070472 | Ga0495678_070472_126_1031 | 293 |
| 550 | 2162886007 | SwRhRL2b_contig_1421610 | SwRhRL2b_0797.00003760 | 294 |
| 551 | 2162886007 | SwRhRL2b_contig_332858 | SwRhRL2b_0696.00006700 | 294 |
| 552 | 3300003781 | Ga0055536_1003315 | Ga0055536_10033156 | 294 |
| 553 | 3300003791 | Ga0055530_10003585 | Ga0055530_100035854 | 294 |
| 554 | 3300003792 | Ga0055540_1002471 | Ga0055540_10024716 | 294 |
| 555 | 3300003794 | Ga0055531_10001108 | Ga0055531_1000110817 | 294 |
| 556 | 3300005289 | Ga0065704_10002468 | Ga0065704_100024683 | 294 |
| 557 | 3300005289 | Ga0065704_10003725 | Ga0065704_100037253 | 294 |
| 558 | 3300005289 | Ga0065704_10077802 | Ga0065704_100778023 | 294 |
| 559 | 3300006944 | Ga0099823_1000043 | Ga0099823_10000433 | 294 |
| 560 | 3300006944 | Ga0099823_1026491 | Ga0099823_10264914 | 294 |
| 561 | 3300009011 | Ga0105251_10019472 | Ga0105251_100194724 | 294 |
| 562 | 3300009036 | Ga0105244_10005335 | Ga0105244_100053356 | 294 |
| 563 | 3300009036 | Ga0105244_10012478 | Ga0105244_100124785 | 294 |
| 564 | 3300009036 | Ga0105244_10014699 | Ga0105244_100146994 | 294 |
| 565 | 3300009036 | Ga0105244_10031702 | Ga0105244_100317023 | 294 |
| 566 | 3300009036 | Ga0105244_10065116 | Ga0105244_100651162 | 294 |
| 567 | 3300009036 | Ga0105244_10067608 | Ga0105244_100676082 | 294 |
| 568 | 3300009148 | Ga0105243_10008207 | Ga0105243_100082075 | 294 |
| 569 | 3300009148 | Ga0105243_10235679 | Ga0105243_102356791 | 294 |
| 570 | 3300009176 | Ga0105242_10361181 | Ga0105242_103611812 | 294 |
| 571 | 3300013104 | Ga0157370_10332815 | Ga0157370_103328152 | 294 |
| 572 | 3300013307 | Ga0157372_10000574 | Ga0157372_1000057416 | 294 |
| 573 | 3300025292 | Ga0209676_1000015 | Ga0209676_1000015441 | 294 |
| 574 | 3300025292 | Ga0209676_1000638 | Ga0209676_100063814 | 294 |
| 575 | 3300025298 | Ga0209050_1000075 | Ga0209050_1000075252 | 294 |
| 576 | 3300025303 | Ga0209051_1000012 | Ga0209051_1000012239 | 294 |
| 577 | 3300025304 | Ga0209257_1000069 | Ga0209257_100006924 | 294 |
| 578 | 3300025711 | Ga0207696_1000050 | Ga0207696_1000050135 | 294 |
| 579 | 3300025711 | Ga0207696_1007389 | Ga0207696_10073891 | 294 |
| 580 | 3300025728 | Ga0207655_1000429 | Ga0207655_100042928 | 294 |
| 581 | 3300025728 | Ga0207655_1000527 | Ga0207655_100052722 | 294 |
| 582 | 3300025728 | Ga0207655_1011915 | Ga0207655_10119152 | 294 |
| 583 | 3300025728 | Ga0207655_1012337 | Ga0207655_10123375 | 294 |
| 584 | 3300025728 | Ga0207655_1020309 | Ga0207655_10203093 | 294 |
| 585 | 3300025728 | Ga0207655_1035842 | Ga0207655_10358422 | 294 |
| 586 | 3300025735 | Ga0207713_1038786 | Ga0207713_10387862 | 294 |
| 587 | 3300025735 | Ga0207713_1042601 | Ga0207713_10426012 | 294 |
| 588 | 3300025934 | Ga0207686_10367082 | Ga0207686_103670822 | 294 |
| 589 | 3300025935 | Ga0207709_10004585 | Ga0207709_100045854 | 294 |
| 590 | 3300025935 | Ga0207709_10006683 | Ga0207709_100066835 | 294 |
| 591 | 3300025935 | Ga0207709_10182001 | Ga0207709_101820011 | 294 |
| 592 | 3300027296 | Ga0209389_1000017 | Ga0209389_100001787 | 294 |
| 593 | 3300027312 | Ga0209371_1000151 | Ga0209371_100015130 | 294 |
| 594 | 3300030500 | Ga0268256_1000163 | Ga0268256_10001638 | 294 |
| 595 | 3300030733 | Ga0314311_1078403 | Ga0314311_10784034 | 294 |
| 596 | 3300030742 | Ga0316183_1010798 | Ga0316183_10107981 | 294 |
| 597 | 3300030742 | Ga0316183_1097097 | Ga0316183_10970972 | 294 |
| 598 | 3300031548 | Ga0307408_100007007 | Ga0307408_1000070077 | 294 |
| 599 | 3300031731 | Ga0307405_10001305 | Ga0307405_100013057 | 294 |
| 600 | 3300031824 | Ga0307413_10005853 | Ga0307413_100058536 | 294 |
| 601 | 3300031901 | Ga0307406_10005458 | Ga0307406_100054587 | 294 |
| 602 | 3300031911 | Ga0307412_10004230 | Ga0307412_100042307 | 294 |
| 603 | 3300032002 | Ga0307416_100060653 | Ga0307416_1000606532 | 294 |
| 604 | 3300032004 | Ga0307414_10018388 | Ga0307414_100183882 | 294 |
| 605 | 3300032005 | Ga0307411_10005924 | Ga0307411_100059246 | 294 |
| 606 | 3300042013 | Ga0439456_000053 | Ga0439456_000053_37298_38209 | 294 |
| 607 | 3300042016 | Ga0439463_000524 | Ga0439463_000524_6280_7191 | 294 |
| 608 | 3300042016 | Ga0439463_007520 | Ga0439463_007520_1643_2554 | 294 |
| 609 | 3300042136 | Ga0450900_000816 | Ga0450900_000816_1784_2695 | 294 |
| 610 | 3300042137 | Ga0450902_010035 | Ga0450902_010035_384_1295 | 294 |
| 611 | 3300042533 | Ga0450901_000659 | Ga0450901_000659_1790_2701 | 294 |
| 612 | 3300042993 | Ga0439440_0003420 | Ga0439440_0003420_1334_2245 | 294 |
| 613 | 3300046453 | Ga0495627_026110 | Ga0495627_026110_305_1222 | 294 |
| 614 | 3300046458 | Ga0495591_004488 | Ga0495591_004488_2029_2946 | 294 |
| 615 | 3300046458 | Ga0495591_014957 | Ga0495591_014957_424_1341 | 294 |
| 616 | 3300046460 | Ga0495638_0075465 | Ga0495638_0075465_691_1608 | 294 |
| 617 | 3300046474 | Ga0495605_0024749 | Ga0495605_0024749_1426_2340 | 294 |
| 618 | 3300046491 | Ga0495584_0066306 | Ga0495584_0066306_469_1383 | 294 |
| 619 | 3300046515 | Ga0495620_0000024 | Ga0495620_0000024_32108_33010 | 294 |
| 620 | 3300046518 | Ga0495631_0050033 | Ga0495631_0050033_433_1347 | 294 |
| 621 | 3300046519 | Ga0495632_0012171 | Ga0495632_0012171_2780_3682 | 294 |
| 622 | 3300046519 | Ga0495632_0106170 | Ga0495632_0106170_270_1187 | 294 |
| 623 | 3300046520 | Ga0495637_0079311 | Ga0495637_0079311_104_1018 | 294 |
| 624 | 3300046522 | Ga0495643_0003187 | Ga0495643_0003187_3900_4802 | 294 |
| 625 | 3300046522 | Ga0495643_0005296 | Ga0495643_0005296_4394_5296 | 294 |
| 626 | 3300046522 | Ga0495643_0017685 | Ga0495643_0017685_1061_1975 | 294 |
| 627 | 3300046524 | Ga0495648_0009482 | Ga0495648_0009482_2653_3555 | 294 |
| 628 | 3300046524 | Ga0495648_0028226 | Ga0495648_0028226_2027_2944 | 294 |
| 629 | 3300046530 | Ga0495654_0031420 | Ga0495654_0031420_575_1489 | 294 |
| 630 | 3300046557 | Ga0495622_0003094 | Ga0495622_0003094_3899_4858 | 294 |
| 631 | 3300046615 | Ga0495656_0020142 | Ga0495656_0020142_1338_2255 | 294 |
| 632 | 3300046660 | Ga0495625_0112568 | Ga0495625_0112568_285_1202 | 294 |
| 633 | 3300046665 | Ga0495661_0038675 | Ga0495661_0038675_686_1600 | 294 |
| 634 | 3300046674 | Ga0495588_0074846 | Ga0495588_0074846_416_1375 | 294 |
| 635 | 3300046694 | Ga0495649_0026148 | Ga0495649_0026148_1841_2758 | 294 |
| 636 | 3300046810 | Ga0495660_0072687 | Ga0495660_0072687_155_1072 | 294 |
| 637 | 3300047320 | Ga0495672_0031607 | Ga0495672_0031607_1476_2390 | 294 |
| 638 | 3300047469 | Ga0495673_0106601 | Ga0495673_0106601_11_925 | 294 |
| 639 | 3300048917 | Ga0496114_0304905 | Ga0496114_0304905_171_1073 | 294 |
| 640 | 3300048918 | Ga0496115_0035998 | Ga0496115_0035998_1213_2130 | 294 |
| 641 | 3300048919 | Ga0496116_0046630 | Ga0496116_0046630_1624_2526 | 294 |
| 642 | 3300048920 | Ga0496117_0001687 | Ga0496117_0001687_25639_26541 | 294 |
| 643 | 3300048920 | Ga0496117_0009483 | Ga0496117_0009483_3704_4606 | 294 |
| 644 | 3300048920 | Ga0496117_0012935 | Ga0496117_0012935_3748_4650 | 294 |
| 645 | 3300048921 | Ga0496118_0003034 | Ga0496118_0003034_16129_17031 | 294 |
| 646 | 3300048921 | Ga0496118_0043691 | Ga0496118_0043691_45_947 | 294 |
| 647 | 3300048922 | Ga0496119_0000082 | Ga0496119_0000082_113856_114758 | 294 |
| 648 | 3300048923 | Ga0496120_0002004 | Ga0496120_0002004_17443_18345 | 294 |
| 649 | 3300048924 | Ga0496121_0116006 | Ga0496121_0116006_1036_1938 | 294 |
| 650 | 3300048924 | Ga0496121_0164377 | Ga0496121_0164377_636_1553 | 294 |
| 651 | 3300048926 | Ga0496123_0000850 | Ga0496123_0000850_18422_19324 | 294 |
| 652 | 3300048926 | Ga0496123_0175513 | Ga0496123_0175513_134_1036 | 294 |
| 653 | 3300048927 | Ga0496124_0011287 | Ga0496124_0011287_3718_4620 | 294 |
| 654 | 3300048927 | Ga0496124_0017717 | Ga0496124_0017717_2190_3101 | 294 |
| 655 | 3300048927 | Ga0496124_0034123 | Ga0496124_0034123_2061_2963 | 294 |
| 656 | 3300048927 | Ga0496124_0249458 | Ga0496124_0249458_105_1007 | 294 |
| 657 | 3300048928 | Ga0496125_0000440 | Ga0496125_0000440_6211_7113 | 294 |
| 658 | 3300048928 | Ga0496125_0061840 | Ga0496125_0061840_1343_2245 | 294 |
| 659 | 3300049459 | Ga0495678_037974 | Ga0495678_037974_104_1018 | 294 |
| 660 | 3300049571 | Ga0501034_0000223 | Ga0501034_0000223_26701_27603 | 294 |
| 661 | 3300049662 | Ga0501222_002026 | Ga0501222_002026_354_1265 | 294 |
| 662 | 3300050491 | nmdc:mga00v17_140830_c1 | nmdc:mga00v17_140830_c1_327_1241 | 294 |
| 663 | 3300053135 | Ga0500659_0008307 | Ga0500659_0008307_2756_3658 | 294 |
| 664 | 2162886007 | SwRhRL2b_contig_2032209 | SwRhRL2b_0912.00006810 | 295 |
| 665 | 3300003781 | Ga0055536_1001893 | Ga0055536_10018937 | 295 |
| 666 | 3300003791 | Ga0055530_10002669 | Ga0055530_100026697 | 295 |
| 667 | 3300003792 | Ga0055540_1002054 | Ga0055540_10020547 | 295 |
| 668 | 3300005288 | Ga0065714_10004326 | Ga0065714_100043264 | 295 |
| 669 | 3300005288 | Ga0065714_10018388 | Ga0065714_100183881 | 295 |
| 670 | 3300005288 | Ga0065714_10065956 | Ga0065714_100659565 | 295 |
| 671 | 3300005288 | Ga0065714_10096637 | Ga0065714_100966371 | 295 |
| 672 | 3300005289 | Ga0065704_10003468 | Ga0065704_100034684 | 295 |
| 673 | 3300005290 | Ga0065712_10001329 | Ga0065712_100013298 | 295 |
| 674 | 3300005331 | Ga0070670_100010511 | Ga0070670_1000105114 | 295 |
| 675 | 3300005331 | Ga0070670_100011900 | Ga0070670_1000119004 | 295 |
| 676 | 3300005344 | Ga0070661_100005363 | Ga0070661_1000053635 | 295 |
| 677 | 3300005548 | Ga0070665_100425541 | Ga0070665_1004255412 | 295 |
| 678 | 3300005564 | Ga0070664_100007442 | Ga0070664_1000074426 | 295 |
| 679 | 3300006058 | Ga0075432_10010422 | Ga0075432_100104222 | 295 |
| 680 | 3300006946 | Ga0079104_1000862 | Ga0079104_100086220 | 295 |
| 681 | 3300006948 | Ga0099826_10001943 | Ga0099826_1000194311 | 295 |
| 682 | 3300009011 | Ga0105251_10004675 | Ga0105251_100046755 | 295 |
| 683 | 3300009011 | Ga0105251_10010091 | Ga0105251_100100914 | 295 |
| 684 | 3300009011 | Ga0105251_10052928 | Ga0105251_100529282 | 295 |
| 685 | 3300009036 | Ga0105244_10011282 | Ga0105244_100112822 | 295 |
| 686 | 3300009036 | Ga0105244_10012116 | Ga0105244_100121162 | 295 |
| 687 | 3300009036 | Ga0105244_10093917 | Ga0105244_100939172 | 295 |
| 688 | 3300009092 | Ga0105250_10000963 | Ga0105250_100009632 | 295 |
| 689 | 3300009092 | Ga0105250_10037059 | Ga0105250_100370592 | 295 |
| 690 | 3300009176 | Ga0105242_10012773 | Ga0105242_100127732 | 295 |
| 691 | 3300009545 | Ga0105237_10021239 | Ga0105237_100212392 | 295 |
| 692 | 3300013100 | Ga0157373_10035307 | Ga0157373_100353072 | 295 |
| 693 | 3300013100 | Ga0157373_10047733 | Ga0157373_100477333 | 295 |
| 694 | 3300013100 | Ga0157373_10068601 | Ga0157373_100686011 | 295 |
| 695 | 3300013100 | Ga0157373_10073151 | Ga0157373_100731512 | 295 |
| 696 | 3300013104 | Ga0157370_10064516 | Ga0157370_100645163 | 295 |
| 697 | 3300013104 | Ga0157370_10073912 | Ga0157370_100739123 | 295 |
| 698 | 3300013306 | Ga0163162_10011142 | Ga0163162_100111424 | 295 |
| 699 | 3300013306 | Ga0163162_10079014 | Ga0163162_100790143 | 295 |
| 700 | 3300013308 | Ga0157375_10136022 | Ga0157375_101360222 | 295 |
| 701 | 3300013308 | Ga0157375_10374403 | Ga0157375_103744031 | 295 |
| 702 | 3300015262 | Ga0182007_10010484 | Ga0182007_100104842 | 295 |
| 703 | 3300017792 | Ga0163161_10015693 | Ga0163161_100156932 | 295 |
| 704 | 3300017792 | Ga0163161_10061922 | Ga0163161_100619223 | 295 |
| 705 | 3300025292 | Ga0209676_1000030 | Ga0209676_1000030240 | 295 |
| 706 | 3300025298 | Ga0209050_1003263 | Ga0209050_10032637 | 295 |
| 707 | 3300025303 | Ga0209051_1000881 | Ga0209051_10008818 | 295 |
| 708 | 3300025711 | Ga0207696_1000541 | Ga0207696_100054126 | 295 |
| 709 | 3300025711 | Ga0207696_1007521 | Ga0207696_10075212 | 295 |
| 710 | 3300025728 | Ga0207655_1001846 | Ga0207655_10018466 | 295 |
| 711 | 3300025728 | Ga0207655_1013478 | Ga0207655_10134782 | 295 |
| 712 | 3300025728 | Ga0207655_1016829 | Ga0207655_10168294 | 295 |
| 713 | 3300025728 | Ga0207655_1021732 | Ga0207655_10217323 | 295 |
| 714 | 3300025735 | Ga0207713_1001953 | Ga0207713_10019533 | 295 |
| 715 | 3300025735 | Ga0207713_1007283 | Ga0207713_10072834 | 295 |
| 716 | 3300025735 | Ga0207713_1008808 | Ga0207713_10088084 | 295 |
| 717 | 3300025735 | Ga0207713_1012250 | Ga0207713_10122505 | 295 |
| 718 | 3300025914 | Ga0207671_10000131 | Ga0207671_1000013111 | 295 |
| 719 | 3300025920 | Ga0207649_10000012 | Ga0207649_1000001276 | 295 |
| 720 | 3300025925 | Ga0207650_10000157 | Ga0207650_1000015760 | 295 |
| 721 | 3300025925 | Ga0207650_10000185 | Ga0207650_1000018546 | 295 |
| 722 | 3300025934 | Ga0207686_10044845 | Ga0207686_100448451 | 295 |
| 723 | 3300025945 | Ga0207679_10000015 | Ga0207679_1000001576 | 295 |
| 724 | 3300027111 | Ga0209281_1000167 | Ga0209281_100016780 | 295 |
| 725 | 3300027666 | Ga0209282_1014513 | Ga0209282_10145134 | 295 |
| 726 | 3300027907 | Ga0207428_10044045 | Ga0207428_100440454 | 295 |
| 727 | 3300027907 | Ga0207428_10096029 | Ga0207428_100960292 | 295 |
| 728 | 3300027907 | Ga0207428_10187588 | Ga0207428_101875882 | 295 |
| 729 | 3300031548 | Ga0307408_100012654 | Ga0307408_1000126544 | 295 |
| 730 | 3300031548 | Ga0307408_100040013 | Ga0307408_1000400131 | 295 |
| 731 | 3300031731 | Ga0307405_10014401 | Ga0307405_100144014 | 295 |
| 732 | 3300031731 | Ga0307405_10016997 | Ga0307405_100169972 | 295 |
| 733 | 3300031731 | Ga0307405_10215501 | Ga0307405_102155011 | 295 |
| 734 | 3300031824 | Ga0307413_10007743 | Ga0307413_100077432 | 295 |
| 735 | 3300031901 | Ga0307406_10011171 | Ga0307406_100111712 | 295 |
| 736 | 3300031911 | Ga0307412_10008719 | Ga0307412_100087194 | 295 |
| 737 | 3300031911 | Ga0307412_10011320 | Ga0307412_100113204 | 295 |
| 738 | 3300032004 | Ga0307414_10031486 | Ga0307414_100314863 | 295 |
| 739 | 3300032004 | Ga0307414_10156579 | Ga0307414_101565792 | 295 |
| 740 | 3300032005 | Ga0307411_10463962 | Ga0307411_104639621 | 295 |
| 741 | 3300033180 | Ga0307510_10024760 | Ga0307510_100247603 | 295 |
| 742 | 3300041405 | Ga0439438_004340 | Ga0439438_004340_3015_3929 | 295 |
| 743 | 3300041405 | Ga0439438_006349 | Ga0439438_006349_1497_2411 | 295 |
| 744 | 3300041405 | Ga0439438_040312 | Ga0439438_040312_92_1018 | 295 |
| 745 | 3300041407 | Ga0439447_029090 | Ga0439447_029090_358_1272 | 295 |
| 746 | 3300042006 | Ga0439432_009019 | Ga0439432_009019_1021_1935 | 295 |
| 747 | 3300042010 | Ga0439452_026541 | Ga0439452_026541_407_1321 | 295 |
| 748 | 3300042185 | Ga0450909_001322 | Ga0450909_001322_1795_2709 | 295 |
| 749 | 3300046452 | Ga0495617_031069 | Ga0495617_031069_370_1287 | 295 |
| 750 | 3300046453 | Ga0495627_003510 | Ga0495627_003510_3831_4748 | 295 |
| 751 | 3300046453 | Ga0495627_012137 | Ga0495627_012137_518_1435 | 295 |
| 752 | 3300046457 | Ga0495590_0062260 | Ga0495590_0062260_77_994 | 295 |
| 753 | 3300046458 | Ga0495591_004283 | Ga0495591_004283_2276_3193 | 295 |
| 754 | 3300046458 | Ga0495591_006239 | Ga0495591_006239_2930_3847 | 295 |
| 755 | 3300046458 | Ga0495591_015501 | Ga0495591_015501_1680_2597 | 295 |
| 756 | 3300046460 | Ga0495638_0044266 | Ga0495638_0044266_64_981 | 295 |
| 757 | 3300046460 | Ga0495638_0058255 | Ga0495638_0058255_121_1035 | 295 |
| 758 | 3300046471 | Ga0495650_0025018 | Ga0495650_0025018_425_1339 | 295 |
| 759 | 3300046471 | Ga0495650_0027313 | Ga0495650_0027313_505_1422 | 295 |
| 760 | 3300046474 | Ga0495605_0044234 | Ga0495605_0044234_724_1638 | 295 |
| 761 | 3300046474 | Ga0495605_0051096 | Ga0495605_0051096_522_1439 | 295 |
| 762 | 3300046491 | Ga0495584_0040259 | Ga0495584_0040259_1088_2005 | 295 |
| 763 | 3300046492 | Ga0495585_0013861 | Ga0495585_0013861_3270_4187 | 295 |
| 764 | 3300046492 | Ga0495585_0037361 | Ga0495585_0037361_1270_2187 | 295 |
| 765 | 3300046492 | Ga0495585_0042190 | Ga0495585_0042190_1134_2051 | 295 |
| 766 | 3300046492 | Ga0495585_0114349 | Ga0495585_0114349_279_1193 | 295 |
| 767 | 3300046501 | Ga0495607_0018420 | Ga0495607_0018420_2236_3153 | 295 |
| 768 | 3300046506 | Ga0495583_0034504 | Ga0495583_0034504_1175_2089 | 295 |
| 769 | 3300046507 | Ga0495606_0048201 | Ga0495606_0048201_1831_2745 | 295 |
| 770 | 3300046507 | Ga0495606_0080632 | Ga0495606_0080632_564_1481 | 295 |
| 771 | 3300046512 | Ga0495610_0020284 | Ga0495610_0020284_2472_3386 | 295 |
| 772 | 3300046512 | Ga0495610_0140962 | Ga0495610_0140962_99_1016 | 295 |
| 773 | 3300046513 | Ga0495616_0009478 | Ga0495616_0009478_1178_2095 | 295 |
| 774 | 3300046513 | Ga0495616_0010742 | Ga0495616_0010742_1152_2066 | 295 |
| 775 | 3300046513 | Ga0495616_0030061 | Ga0495616_0030061_1367_2284 | 295 |
| 776 | 3300046515 | Ga0495620_0009862 | Ga0495620_0009862_758_1675 | 295 |
| 777 | 3300046515 | Ga0495620_0025639 | Ga0495620_0025639_89_1006 | 295 |
| 778 | 3300046518 | Ga0495631_0004038 | Ga0495631_0004038_3441_4358 | 295 |
| 779 | 3300046519 | Ga0495632_0008848 | Ga0495632_0008848_4289_5203 | 295 |
| 780 | 3300046519 | Ga0495632_0051196 | Ga0495632_0051196_293_1210 | 295 |
| 781 | 3300046520 | Ga0495637_0006679 | Ga0495637_0006679_1064_1981 | 295 |
| 782 | 3300046520 | Ga0495637_0031733 | Ga0495637_0031733_147_1064 | 295 |
| 783 | 3300046522 | Ga0495643_0010231 | Ga0495643_0010231_3591_4508 | 295 |
| 784 | 3300046522 | Ga0495643_0027096 | Ga0495643_0027096_487_1404 | 295 |
| 785 | 3300046523 | Ga0495644_0014316 | Ga0495644_0014316_1367_2284 | 295 |
| 786 | 3300046523 | Ga0495644_0043522 | Ga0495644_0043522_664_1581 | 295 |
| 787 | 3300046524 | Ga0495648_0021367 | Ga0495648_0021367_1553_2470 | 295 |
| 788 | 3300046524 | Ga0495648_0034429 | Ga0495648_0034429_1064_1981 | 295 |
| 789 | 3300046530 | Ga0495654_0015236 | Ga0495654_0015236_2826_3740 | 295 |
| 790 | 3300046530 | Ga0495654_0016508 | Ga0495654_0016508_1009_1926 | 295 |
| 791 | 3300046538 | Ga0495609_0010955 | Ga0495609_0010955_1349_2266 | 295 |
| 792 | 3300046557 | Ga0495622_0024425 | Ga0495622_0024425_1465_2379 | 295 |
| 793 | 3300046557 | Ga0495622_0112442 | Ga0495622_0112442_215_1132 | 295 |
| 794 | 3300046615 | Ga0495656_0031179 | Ga0495656_0031179_1143_2057 | 295 |
| 795 | 3300046642 | Ga0495634_0008631 | Ga0495634_0008631_2544_3461 | 295 |
| 796 | 3300046648 | Ga0495611_0002437 | Ga0495611_0002437_3783_4700 | 295 |
| 797 | 3300046660 | Ga0495625_0035793 | Ga0495625_0035793_1958_2875 | 295 |
| 798 | 3300046665 | Ga0495661_0107336 | Ga0495661_0107336_436_1353 | 295 |
| 799 | 3300046691 | Ga0495670_0007333 | Ga0495670_0007333_3737_4654 | 295 |
| 800 | 3300046691 | Ga0495670_0042966 | Ga0495670_0042966_79_996 | 295 |
| 801 | 3300046691 | Ga0495670_0098630 | Ga0495670_0098630_110_1027 | 295 |
| 802 | 3300046692 | Ga0495671_0192682 | Ga0495671_0192682_55_972 | 295 |
| 803 | 3300046794 | Ga0495589_0006341 | Ga0495589_0006341_1989_2903 | 295 |
| 804 | 3300046794 | Ga0495589_0104005 | Ga0495589_0104005_18_935 | 295 |
| 805 | 3300046810 | Ga0495660_0041564 | Ga0495660_0041564_393_1310 | 295 |
| 806 | 3300046810 | Ga0495660_0089589 | Ga0495660_0089589_667_1584 | 295 |
| 807 | 3300047320 | Ga0495672_0032736 | Ga0495672_0032736_1502_2419 | 295 |
| 808 | 3300047320 | Ga0495672_0128903 | Ga0495672_0128903_332_1249 | 295 |
| 809 | 3300047445 | Ga0495677_0002936 | Ga0495677_0002936_1650_2564 | 295 |
| 810 | 3300047446 | Ga0495679_012688 | Ga0495679_012688_496_1413 | 295 |
| 811 | 3300047469 | Ga0495673_0017632 | Ga0495673_0017632_1905_2822 | 295 |
| 812 | 3300047469 | Ga0495673_0019904 | Ga0495673_0019904_1681_2598 | 295 |
| 813 | 3300047470 | Ga0495681_0008023 | Ga0495681_0008023_1949_2866 | 295 |
| 814 | 3300047470 | Ga0495681_0024142 | Ga0495681_0024142_1898_2815 | 295 |
| 815 | 3300047470 | Ga0495681_0025103 | Ga0495681_0025103_117_1034 | 295 |
| 816 | 3300047470 | Ga0495681_0071058 | Ga0495681_0071058_635_1552 | 295 |
| 817 | 3300047472 | Ga0495686_0012644 | Ga0495686_0012644_3710_4627 | 295 |
| 818 | 3300047472 | Ga0495686_0042347 | Ga0495686_0042347_698_1615 | 295 |
| 819 | 3300048091 | Ga0495626_0006443 | Ga0495626_0006443_3879_4796 | 295 |
| 820 | 3300048091 | Ga0495626_0009233 | Ga0495626_0009233_3411_4328 | 295 |
| 821 | 3300048091 | Ga0495626_0028737 | Ga0495626_0028737_1252_2169 | 295 |
| 822 | 3300048913 | Ga0496110_0081857 | Ga0496110_0081857_1357_2265 | 295 |
| 823 | 3300048920 | Ga0496117_0170849 | Ga0496117_0170849_157_1071 | 295 |
| 824 | 3300048927 | Ga0496124_0018126 | Ga0496124_0018126_1519_2427 | 295 |
| 825 | 3300048928 | Ga0496125_0025655 | Ga0496125_0025655_3955_4863 | 295 |
| 826 | 3300048928 | Ga0496125_0076542 | Ga0496125_0076542_1238_2155 | 295 |
| 827 | 3300048929 | Ga0496126_0035392 | Ga0496126_0035392_525_1433 | 295 |
| 828 | 3300049459 | Ga0495678_006763 | Ga0495678_006763_1359_2276 | 295 |
| 829 | 3300049460 | Ga0495682_0005818 | Ga0495682_0005818_643_1560 | 295 |
| 830 | 3300049758 | Ga0501241_019063 | Ga0501241_019063_316_1230 | 295 |
| 831 | 3300049853 | Ga0501226_002299 | Ga0501226_002299_1169_2083 | 295 |
| 832 | 2124908027 | MRS2a_Contig_100 | MRS2a_00002860 | 296 |
| 833 | 3300005288 | Ga0065714_10000338 | Ga0065714_100003384 | 296 |
| 834 | 3300005288 | Ga0065714_10003528 | Ga0065714_100035284 | 296 |
| 835 | 3300005288 | Ga0065714_10005396 | Ga0065714_100053964 | 296 |
| 836 | 3300005288 | Ga0065714_10070624 | Ga0065714_100706245 | 296 |
| 837 | 3300005288 | Ga0065714_10078669 | Ga0065714_100786692 | 296 |
| 838 | 3300005353 | Ga0070669_100000430 | Ga0070669_10000043025 | 296 |
| 839 | 3300006051 | Ga0075364_10037354 | Ga0075364_100373542 | 296 |
| 840 | 3300006051 | Ga0075364_10213561 | Ga0075364_102135612 | 296 |
| 841 | 3300006058 | Ga0075432_10003629 | Ga0075432_100036293 | 296 |
| 842 | 3300006058 | Ga0075432_10018866 | Ga0075432_100188662 | 296 |
| 843 | 3300006177 | Ga0075362_10103030 | Ga0075362_101030302 | 296 |
| 844 | 3300006914 | Ga0075436_100077685 | Ga0075436_1000776852 | 296 |
| 845 | 3300006914 | Ga0075436_100088872 | Ga0075436_1000888722 | 296 |
| 846 | 3300009011 | Ga0105251_10006413 | Ga0105251_100064136 | 296 |
| 847 | 3300009011 | Ga0105251_10020061 | Ga0105251_100200614 | 296 |
| 848 | 3300009011 | Ga0105251_10031084 | Ga0105251_100310842 | 296 |
| 849 | 3300009036 | Ga0105244_10020554 | Ga0105244_100205542 | 296 |
| 850 | 3300009036 | Ga0105244_10051446 | Ga0105244_100514462 | 296 |
| 851 | 3300009092 | Ga0105250_10011357 | Ga0105250_100113573 | 296 |
| 852 | 3300009092 | Ga0105250_10028362 | Ga0105250_100283621 | 296 |
| 853 | 3300009148 | Ga0105243_10006873 | Ga0105243_100068735 | 296 |
| 854 | 3300012498 | Ga0157345_1000830 | Ga0157345_10008302 | 296 |
| 855 | 3300013100 | Ga0157373_10053819 | Ga0157373_100538193 | 296 |
| 856 | 3300013100 | Ga0157373_10275628 | Ga0157373_102756281 | 296 |
| 857 | 3300013307 | Ga0157372_10015655 | Ga0157372_100156554 | 296 |
| 858 | 3300014497 | Ga0182008_10016544 | Ga0182008_100165442 | 296 |
| 859 | 3300014497 | Ga0182008_10051554 | Ga0182008_100515542 | 296 |
| 860 | 3300015261 | Ga0182006_1024909 | Ga0182006_10249092 | 296 |
| 861 | 3300015261 | Ga0182006_1067837 | Ga0182006_10678372 | 296 |
| 862 | 3300015262 | Ga0182007_10026603 | Ga0182007_100266032 | 296 |
| 863 | 3300015265 | Ga0182005_1031348 | Ga0182005_10313481 | 296 |
| 864 | 3300017792 | Ga0163161_10008495 | Ga0163161_100084954 | 296 |
| 865 | 3300025711 | Ga0207696_1000031 | Ga0207696_1000031203 | 296 |
| 866 | 3300025711 | Ga0207696_1000105 | Ga0207696_100010523 | 296 |
| 867 | 3300025711 | Ga0207696_1007655 | Ga0207696_10076554 | 296 |
| 868 | 3300025711 | Ga0207696_1009850 | Ga0207696_10098503 | 296 |
| 869 | 3300025728 | Ga0207655_1000202 | Ga0207655_100020272 | 296 |
| 870 | 3300025728 | Ga0207655_1015150 | Ga0207655_10151503 | 296 |
| 871 | 3300025728 | Ga0207655_1024141 | Ga0207655_10241413 | 296 |
| 872 | 3300025728 | Ga0207655_1025649 | Ga0207655_10256492 | 296 |
| 873 | 3300025735 | Ga0207713_1004499 | Ga0207713_10044997 | 296 |
| 874 | 3300025735 | Ga0207713_1004911 | Ga0207713_10049114 | 296 |
| 875 | 3300025735 | Ga0207713_1008940 | Ga0207713_10089402 | 296 |
| 876 | 3300025735 | Ga0207713_1034653 | Ga0207713_10346532 | 296 |
| 877 | 3300025735 | Ga0207713_1035446 | Ga0207713_10354461 | 296 |
| 878 | 3300025923 | Ga0207681_10002088 | Ga0207681_100020883 | 296 |
| 879 | 3300025933 | Ga0207706_10004363 | Ga0207706_100043633 | 296 |
| 880 | 3300025935 | Ga0207709_10000071 | Ga0207709_1000007153 | 296 |
| 881 | 3300027907 | Ga0207428_10078145 | Ga0207428_100781453 | 296 |
| 882 | 3300027907 | Ga0207428_10110020 | Ga0207428_101100202 | 296 |
| 883 | 3300027907 | Ga0207428_10130116 | Ga0207428_101301162 | 296 |
| 884 | 3300031730 | Ga0307516_10148373 | Ga0307516_101483731 | 296 |
| 885 | 3300032002 | Ga0307416_100219098 | Ga0307416_1002190982 | 296 |
| 886 | 3300041405 | Ga0439438_009930 | Ga0439438_009930_563_1480 | 296 |
| 887 | 3300041405 | Ga0439438_011906 | Ga0439438_011906_388_1305 | 296 |
| 888 | 3300041405 | Ga0439438_012356 | Ga0439438_012356_1460_2377 | 296 |
| 889 | 3300041405 | Ga0439438_025183 | Ga0439438_025183_651_1568 | 296 |
| 890 | 3300041407 | Ga0439447_001339 | Ga0439447_001339_3639_4556 | 296 |
| 891 | 3300041407 | Ga0439447_003195 | Ga0439447_003195_4147_5064 | 296 |
| 892 | 3300041407 | Ga0439447_010086 | Ga0439447_010086_1484_2401 | 296 |
| 893 | 3300041407 | Ga0439447_010369 | Ga0439447_010369_1528_2445 | 296 |
| 894 | 3300041407 | Ga0439447_019804 | Ga0439447_019804_622_1539 | 296 |
| 895 | 3300041407 | Ga0439447_022891 | Ga0439447_022891_496_1413 | 296 |
| 896 | 3300041411 | Ga0439466_0003842 | Ga0439466_0003842_4455_5372 | 296 |
| 897 | 3300041411 | Ga0439466_0011563 | Ga0439466_0011563_605_1522 | 296 |
| 898 | 3300041411 | Ga0439466_0019483 | Ga0439466_0019483_490_1407 | 296 |
| 899 | 3300041411 | Ga0439466_0030038 | Ga0439466_0030038_475_1392 | 296 |
| 900 | 3300041413 | Ga0439465_0008277 | Ga0439465_0008277_1698_2615 | 296 |
| 901 | 3300042006 | Ga0439432_002579 | Ga0439432_002579_4373_5290 | 296 |
| 902 | 3300042006 | Ga0439432_011855 | Ga0439432_011855_616_1533 | 296 |
| 903 | 3300042006 | Ga0439432_014816 | Ga0439432_014816_1281_2198 | 296 |
| 904 | 3300042006 | Ga0439432_039379 | Ga0439432_039379_404_1321 | 296 |
| 905 | 3300042009 | Ga0439451_007318 | Ga0439451_007318_400_1317 | 296 |
| 906 | 3300042010 | Ga0439452_001636 | Ga0439452_001636_3648_4565 | 296 |
| 907 | 3300042010 | Ga0439452_004618 | Ga0439452_004618_3623_4540 | 296 |
| 908 | 3300042010 | Ga0439452_007904 | Ga0439452_007904_1508_2425 | 296 |
| 909 | 3300042010 | Ga0439452_011312 | Ga0439452_011312_384_1301 | 296 |
| 910 | 3300042013 | Ga0439456_001369 | Ga0439456_001369_3651_4568 | 296 |
| 911 | 3300042013 | Ga0439456_023275 | Ga0439456_023275_199_1116 | 296 |
| 912 | 3300042115 | Ga0450911_001540 | Ga0450911_001540_3948_4865 | 296 |
| 913 | 3300042115 | Ga0450911_002657 | Ga0450911_002657_1501_2418 | 296 |
| 914 | 3300042115 | Ga0450911_006569 | Ga0450911_006569_97_1014 | 296 |
| 915 | 3300042121 | Ga0450919_002332 | Ga0450919_002332_577_1494 | 296 |
| 916 | 3300042121 | Ga0450919_009349 | Ga0450919_009349_108_1025 | 296 |
| 917 | 3300042124 | Ga0450922_000335 | Ga0450922_000335_1987_2904 | 296 |
| 918 | 3300042124 | Ga0450922_000947 | Ga0450922_000947_372_1289 | 296 |
| 919 | 3300042124 | Ga0450922_001656 | Ga0450922_001656_790_1707 | 296 |
| 920 | 3300042125 | Ga0450923_000685 | Ga0450923_000685_1535_2452 | 296 |
| 921 | 3300042127 | Ga0450890_000839 | Ga0450890_000839_1326_2243 | 296 |
| 922 | 3300042137 | Ga0450902_024457 | Ga0450902_024457_78_995 | 296 |
| 923 | 3300042138 | Ga0450903_001776 | Ga0450903_001776_1441_2358 | 296 |
| 924 | 3300042138 | Ga0450903_005153 | Ga0450903_005153_619_1536 | 296 |
| 925 | 3300042142 | Ga0450905_015974 | Ga0450905_015974_95_1012 | 296 |
| 926 | 3300042145 | Ga0450906_001083 | Ga0450906_001083_4354_5271 | 296 |
| 927 | 3300042146 | Ga0450907_000570 | Ga0450907_000570_4690_5607 | 296 |
| 928 | 3300042146 | Ga0450907_001019 | Ga0450907_001019_3428_4345 | 296 |
| 929 | 3300042146 | Ga0450907_001083 | Ga0450907_001083_4163_5080 | 296 |
| 930 | 3300042156 | Ga0439446_0005912 | Ga0439446_0005912_2143_3060 | 296 |
| 931 | 3300042184 | Ga0450908_004786 | Ga0450908_004786_1280_2197 | 296 |
| 932 | 3300042185 | Ga0450909_007627 | Ga0450909_007627_592_1509 | 296 |
| 933 | 3300042435 | Ga0439434_0002134 | Ga0439434_0002134_2406_3323 | 296 |
| 934 | 3300042435 | Ga0439434_0015350 | Ga0439434_0015350_667_1584 | 296 |
| 935 | 3300042439 | Ga0439464_0014780 | Ga0439464_0014780_780_1697 | 296 |
| 936 | 3300042531 | Ga0450918_008906 | Ga0450918_008906_39_956 | 296 |
| 937 | 3300042532 | Ga0450893_0008849 | Ga0450893_0008849_111_1028 | 296 |
| 938 | 3300042532 | Ga0450893_0013314 | Ga0450893_0013314_94_1011 | 296 |
| 939 | 3300042993 | Ga0439440_0001997 | Ga0439440_0001997_1725_2642 | 296 |
| 940 | 3300042993 | Ga0439440_0008496 | Ga0439440_0008496_369_1286 | 296 |
| 941 | 3300046452 | Ga0495617_001915 | Ga0495617_001915_3522_4439 | 296 |
| 942 | 3300046452 | Ga0495617_010344 | Ga0495617_010344_2105_3022 | 296 |
| 943 | 3300046452 | Ga0495617_010677 | Ga0495617_010677_171_1088 | 296 |
| 944 | 3300046452 | Ga0495617_012058 | Ga0495617_012058_1422_2339 | 296 |
| 945 | 3300046453 | Ga0495627_009174 | Ga0495627_009174_740_1657 | 296 |
| 946 | 3300046455 | Ga0495603_0006004 | Ga0495603_0006004_2050_2967 | 296 |
| 947 | 3300046455 | Ga0495603_0150634 | Ga0495603_0150634_306_1223 | 296 |
| 948 | 3300046457 | Ga0495590_0003127 | Ga0495590_0003127_4279_5196 | 296 |
| 949 | 3300046457 | Ga0495590_0003352 | Ga0495590_0003352_1877_2794 | 296 |
| 950 | 3300046457 | Ga0495590_0012587 | Ga0495590_0012587_2176_3093 | 296 |
| 951 | 3300046458 | Ga0495591_003153 | Ga0495591_003153_4162_5079 | 296 |
| 952 | 3300046458 | Ga0495591_010128 | Ga0495591_010128_925_1842 | 296 |
| 953 | 3300046458 | Ga0495591_011182 | Ga0495591_011182_1239_2162 | 296 |
| 954 | 3300046458 | Ga0495591_015045 | Ga0495591_015045_1763_2680 | 296 |
| 955 | 3300046458 | Ga0495591_017673 | Ga0495591_017673_114_1031 | 296 |
| 956 | 3300046458 | Ga0495591_034663 | Ga0495591_034663_154_1071 | 296 |
| 957 | 3300046460 | Ga0495638_0009475 | Ga0495638_0009475_2184_3101 | 296 |
| 958 | 3300046460 | Ga0495638_0011832 | Ga0495638_0011832_3905_4822 | 296 |
| 959 | 3300046460 | Ga0495638_0013267 | Ga0495638_0013267_1372_2289 | 296 |
| 960 | 3300046460 | Ga0495638_0030199 | Ga0495638_0030199_1821_2738 | 296 |
| 961 | 3300046460 | Ga0495638_0082025 | Ga0495638_0082025_81_998 | 296 |
| 962 | 3300046460 | Ga0495638_0133599 | Ga0495638_0133599_521_1438 | 296 |
| 963 | 3300046460 | Ga0495638_0136825 | Ga0495638_0136825_203_1120 | 296 |
| 964 | 3300046460 | Ga0495638_0142404 | Ga0495638_0142404_129_1046 | 296 |
| 965 | 3300046463 | Ga0495653_0023527 | Ga0495653_0023527_4018_4935 | 296 |
| 966 | 3300046463 | Ga0495653_0059618 | Ga0495653_0059618_1265_2182 | 296 |
| 967 | 3300046463 | Ga0495653_0078471 | Ga0495653_0078471_645_1562 | 296 |
| 968 | 3300046471 | Ga0495650_0005232 | Ga0495650_0005232_3434_4351 | 296 |
| 969 | 3300046471 | Ga0495650_0011643 | Ga0495650_0011643_2531_3448 | 296 |
| 970 | 3300046471 | Ga0495650_0025554 | Ga0495650_0025554_1809_2726 | 296 |
| 971 | 3300046474 | Ga0495605_0006443 | Ga0495605_0006443_3928_4845 | 296 |
| 972 | 3300046474 | Ga0495605_0012694 | Ga0495605_0012694_3010_3927 | 296 |
| 973 | 3300046491 | Ga0495584_0004951 | Ga0495584_0004951_1649_2566 | 296 |
| 974 | 3300046491 | Ga0495584_0005944 | Ga0495584_0005944_3324_4241 | 296 |
| 975 | 3300046491 | Ga0495584_0010791 | Ga0495584_0010791_3337_4254 | 296 |
| 976 | 3300046491 | Ga0495584_0015709 | Ga0495584_0015709_1251_2168 | 296 |
| 977 | 3300046491 | Ga0495584_0022255 | Ga0495584_0022255_676_1593 | 296 |
| 978 | 3300046491 | Ga0495584_0025400 | Ga0495584_0025400_528_1445 | 296 |
| 979 | 3300046491 | Ga0495584_0029537 | Ga0495584_0029537_507_1424 | 296 |
| 980 | 3300046491 | Ga0495584_0140869 | Ga0495584_0140869_90_1007 | 296 |
| 981 | 3300046492 | Ga0495585_0004323 | Ga0495585_0004323_4116_5033 | 296 |
| 982 | 3300046492 | Ga0495585_0018674 | Ga0495585_0018674_2589_3506 | 296 |
| 983 | 3300046492 | Ga0495585_0047495 | Ga0495585_0047495_692_1609 | 296 |
| 984 | 3300046492 | Ga0495585_0126273 | Ga0495585_0126273_254_1171 | 296 |
| 985 | 3300046499 | Ga0495594_0035849 | Ga0495594_0035849_1744_2661 | 296 |
| 986 | 3300046500 | Ga0495596_0003041 | Ga0495596_0003041_4157_5074 | 296 |
| 987 | 3300046501 | Ga0495607_0001950 | Ga0495607_0001950_1482_2399 | 296 |
| 988 | 3300046501 | Ga0495607_0004818 | Ga0495607_0004818_4389_5306 | 296 |
| 989 | 3300046501 | Ga0495607_0019378 | Ga0495607_0019378_1229_2146 | 296 |
| 990 | 3300046501 | Ga0495607_0036325 | Ga0495607_0036325_1668_2585 | 296 |
| 991 | 3300046501 | Ga0495607_0041502 | Ga0495607_0041502_1171_2088 | 296 |
| 992 | 3300046501 | Ga0495607_0045042 | Ga0495607_0045042_99_1016 | 296 |
| 993 | 3300046501 | Ga0495607_0055040 | Ga0495607_0055040_160_1077 | 296 |
| 994 | 3300046501 | Ga0495607_0068849 | Ga0495607_0068849_475_1392 | 296 |
| 995 | 3300046501 | Ga0495607_0091741 | Ga0495607_0091741_314_1231 | 296 |
| 996 | 3300046506 | Ga0495583_0012824 | Ga0495583_0012824_1625_2548 | 296 |
| 997 | 3300046507 | Ga0495606_0012126 | Ga0495606_0012126_3895_4812 | 296 |
| 998 | 3300046507 | Ga0495606_0025644 | Ga0495606_0025644_686_1603 | 296 |
| 999 | 3300046507 | Ga0495606_0075522 | Ga0495606_0075522_498_1415 | 296 |
| 1000 | 3300046512 | Ga0495610_0014034 | Ga0495610_0014034_2040_2957 | 296 |
| 1001 | 3300046512 | Ga0495610_0020948 | Ga0495610_0020948_490_1407 | 296 |
| 1002 | 3300046512 | Ga0495610_0021050 | Ga0495610_0021050_480_1397 | 296 |
| 1003 | 3300046512 | Ga0495610_0021782 | Ga0495610_0021782_2084_3007 | 296 |
| 1004 | 3300046512 | Ga0495610_0024368 | Ga0495610_0024368_557_1474 | 296 |
| 1005 | 3300046513 | Ga0495616_0009098 | Ga0495616_0009098_3666_4583 | 296 |
| 1006 | 3300046513 | Ga0495616_0010805 | Ga0495616_0010805_2733_3650 | 296 |
| 1007 | 3300046513 | Ga0495616_0017441 | Ga0495616_0017441_1752_2669 | 296 |
| 1008 | 3300046513 | Ga0495616_0019496 | Ga0495616_0019496_2586_3503 | 296 |
| 1009 | 3300046513 | Ga0495616_0019634 | Ga0495616_0019634_1163_2080 | 296 |
| 1010 | 3300046513 | Ga0495616_0035616 | Ga0495616_0035616_157_1074 | 296 |
| 1011 | 3300046513 | Ga0495616_0037504 | Ga0495616_0037504_1389_2306 | 296 |
| 1012 | 3300046515 | Ga0495620_0003664 | Ga0495620_0003664_4194_5111 | 296 |
| 1013 | 3300046515 | Ga0495620_0006093 | Ga0495620_0006093_3891_4808 | 296 |
| 1014 | 3300046515 | Ga0495620_0019325 | Ga0495620_0019325_2020_2937 | 296 |
| 1015 | 3300046517 | Ga0495630_0060005 | Ga0495630_0060005_400_1317 | 296 |
| 1016 | 3300046518 | Ga0495631_0000782 | Ga0495631_0000782_4122_5039 | 296 |
| 1017 | 3300046518 | Ga0495631_0018453 | Ga0495631_0018453_586_1503 | 296 |
| 1018 | 3300046519 | Ga0495632_0007720 | Ga0495632_0007720_1195_2112 | 296 |
| 1019 | 3300046519 | Ga0495632_0012683 | Ga0495632_0012683_2277_3194 | 296 |
| 1020 | 3300046519 | Ga0495632_0018672 | Ga0495632_0018672_2317_3234 | 296 |
| 1021 | 3300046519 | Ga0495632_0021560 | Ga0495632_0021560_226_1143 | 296 |
| 1022 | 3300046519 | Ga0495632_0026402 | Ga0495632_0026402_1764_2681 | 296 |
| 1023 | 3300046519 | Ga0495632_0045272 | Ga0495632_0045272_852_1769 | 296 |
| 1024 | 3300046519 | Ga0495632_0061990 | Ga0495632_0061990_603_1520 | 296 |
| 1025 | 3300046520 | Ga0495637_0003367 | Ga0495637_0003367_4157_5074 | 296 |
| 1026 | 3300046520 | Ga0495637_0003640 | Ga0495637_0003640_3910_4827 | 296 |
| 1027 | 3300046520 | Ga0495637_0007795 | Ga0495637_0007795_3592_4509 | 296 |
| 1028 | 3300046520 | Ga0495637_0021232 | Ga0495637_0021232_1671_2588 | 296 |
| 1029 | 3300046520 | Ga0495637_0026416 | Ga0495637_0026416_618_1535 | 296 |
| 1030 | 3300046520 | Ga0495637_0027219 | Ga0495637_0027219_1273_2190 | 296 |
| 1031 | 3300046523 | Ga0495644_0005333 | Ga0495644_0005333_1973_2890 | 296 |
| 1032 | 3300046523 | Ga0495644_0006587 | Ga0495644_0006587_3103_4020 | 296 |
| 1033 | 3300046524 | Ga0495648_0008560 | Ga0495648_0008560_3654_4571 | 296 |
| 1034 | 3300046524 | Ga0495648_0010142 | Ga0495648_0010142_2355_3272 | 296 |
| 1035 | 3300046524 | Ga0495648_0052510 | Ga0495648_0052510_1418_2335 | 296 |
| 1036 | 3300046524 | Ga0495648_0086519 | Ga0495648_0086519_606_1523 | 296 |
| 1037 | 3300046526 | Ga0495666_0011691 | Ga0495666_0011691_2668_3585 | 296 |
| 1038 | 3300046526 | Ga0495666_0023360 | Ga0495666_0023360_1249_2166 | 296 |
| 1039 | 3300046526 | Ga0495666_0023961 | Ga0495666_0023961_1617_2534 | 296 |
| 1040 | 3300046528 | Ga0495642_0002921 | Ga0495642_0002921_3919_4836 | 296 |
| 1041 | 3300046528 | Ga0495642_0007182 | Ga0495642_0007182_1161_2078 | 296 |
| 1042 | 3300046528 | Ga0495642_0008299 | Ga0495642_0008299_1912_2829 | 296 |
| 1043 | 3300046530 | Ga0495654_0008657 | Ga0495654_0008657_2917_3834 | 296 |
| 1044 | 3300046530 | Ga0495654_0012450 | Ga0495654_0012450_1544_2461 | 296 |
| 1045 | 3300046530 | Ga0495654_0029012 | Ga0495654_0029012_930_1847 | 296 |
| 1046 | 3300046530 | Ga0495654_0029349 | Ga0495654_0029349_700_1623 | 296 |
| 1047 | 3300046530 | Ga0495654_0064096 | Ga0495654_0064096_731_1648 | 296 |
| 1048 | 3300046530 | Ga0495654_0066380 | Ga0495654_0066380_329_1246 | 296 |
| 1049 | 3300046536 | Ga0495587_0020180 | Ga0495587_0020180_1028_1945 | 296 |
| 1050 | 3300046538 | Ga0495609_0031441 | Ga0495609_0031441_65_982 | 296 |
| 1051 | 3300046538 | Ga0495609_0033112 | Ga0495609_0033112_1365_2282 | 296 |
| 1052 | 3300046542 | Ga0495597_0008012 | Ga0495597_0008012_715_1632 | 296 |
| 1053 | 3300046542 | Ga0495597_0018848 | Ga0495597_0018848_653_1570 | 296 |
| 1054 | 3300046542 | Ga0495597_0019929 | Ga0495597_0019929_566_1483 | 296 |
| 1055 | 3300046542 | Ga0495597_0028751 | Ga0495597_0028751_1266_2183 | 296 |
| 1056 | 3300046542 | Ga0495597_0030084 | Ga0495597_0030084_99_1016 | 296 |
| 1057 | 3300046542 | Ga0495597_0040217 | Ga0495597_0040217_73_990 | 296 |
| 1058 | 3300046557 | Ga0495622_0071131 | Ga0495622_0071131_518_1441 | 296 |
| 1059 | 3300046558 | Ga0495633_0006730 | Ga0495633_0006730_1670_2587 | 296 |
| 1060 | 3300046558 | Ga0495633_0025605 | Ga0495633_0025605_1578_2495 | 296 |
| 1061 | 3300046616 | Ga0495668_0005611 | Ga0495668_0005611_3359_4276 | 296 |
| 1062 | 3300046616 | Ga0495668_0026738 | Ga0495668_0026738_1879_2796 | 296 |
| 1063 | 3300046616 | Ga0495668_0027226 | Ga0495668_0027226_556_1473 | 296 |
| 1064 | 3300046648 | Ga0495611_0012912 | Ga0495611_0012912_1315_2232 | 296 |
| 1065 | 3300046648 | Ga0495611_0026950 | Ga0495611_0026950_323_1240 | 296 |
| 1066 | 3300046660 | Ga0495625_0023608 | Ga0495625_0023608_1996_2913 | 296 |
| 1067 | 3300046660 | Ga0495625_0053777 | Ga0495625_0053777_1862_2779 | 296 |
| 1068 | 3300046660 | Ga0495625_0059405 | Ga0495625_0059405_466_1383 | 296 |
| 1069 | 3300046660 | Ga0495625_0081652 | Ga0495625_0081652_101_1018 | 296 |
| 1070 | 3300046663 | Ga0495635_0039955 | Ga0495635_0039955_574_1491 | 296 |
| 1071 | 3300046664 | Ga0495659_0003711 | Ga0495659_0003711_1825_2742 | 296 |
| 1072 | 3300046664 | Ga0495659_0035213 | Ga0495659_0035213_804_1721 | 296 |
| 1073 | 3300046665 | Ga0495661_0036520 | Ga0495661_0036520_729_1646 | 296 |
| 1074 | 3300046665 | Ga0495661_0037117 | Ga0495661_0037117_812_1729 | 296 |
| 1075 | 3300046674 | Ga0495588_0135172 | Ga0495588_0135172_248_1171 | 296 |
| 1076 | 3300046675 | Ga0495657_0084706 | Ga0495657_0084706_432_1349 | 296 |
| 1077 | 3300046679 | Ga0495623_0006490 | Ga0495623_0006490_3422_4339 | 296 |
| 1078 | 3300046680 | Ga0495646_0022041 | Ga0495646_0022041_2076_2993 | 296 |
| 1079 | 3300046689 | Ga0495613_0055279 | Ga0495613_0055279_547_1464 | 296 |
| 1080 | 3300046690 | Ga0495624_0006003 | Ga0495624_0006003_3718_4635 | 296 |
| 1081 | 3300046691 | Ga0495670_0006430 | Ga0495670_0006430_4124_5041 | 296 |
| 1082 | 3300046691 | Ga0495670_0015189 | Ga0495670_0015189_1602_2519 | 296 |
| 1083 | 3300046691 | Ga0495670_0055689 | Ga0495670_0055689_599_1516 | 296 |
| 1084 | 3300046691 | Ga0495670_0249360 | Ga0495670_0249360_19_936 | 296 |
| 1085 | 3300046692 | Ga0495671_0004458 | Ga0495671_0004458_3424_4341 | 296 |
| 1086 | 3300046692 | Ga0495671_0010292 | Ga0495671_0010292_3470_4387 | 296 |
| 1087 | 3300046692 | Ga0495671_0020410 | Ga0495671_0020410_2233_3150 | 296 |
| 1088 | 3300046692 | Ga0495671_0029279 | Ga0495671_0029279_1100_2017 | 296 |
| 1089 | 3300046692 | Ga0495671_0043609 | Ga0495671_0043609_114_1037 | 296 |
| 1090 | 3300046692 | Ga0495671_0071259 | Ga0495671_0071259_59_976 | 296 |
| 1091 | 3300046692 | Ga0495671_0081140 | Ga0495671_0081140_393_1310 | 296 |
| 1092 | 3300046694 | Ga0495649_0009968 | Ga0495649_0009968_3484_4401 | 296 |
| 1093 | 3300046694 | Ga0495649_0022482 | Ga0495649_0022482_1374_2291 | 296 |
| 1094 | 3300046694 | Ga0495649_0037053 | Ga0495649_0037053_1678_2595 | 296 |
| 1095 | 3300046694 | Ga0495649_0038218 | Ga0495649_0038218_562_1479 | 296 |
| 1096 | 3300046694 | Ga0495649_0043087 | Ga0495649_0043087_1399_2316 | 296 |
| 1097 | 3300046694 | Ga0495649_0068080 | Ga0495649_0068080_375_1292 | 296 |
| 1098 | 3300046694 | Ga0495649_0071523 | Ga0495649_0071523_253_1170 | 296 |
| 1099 | 3300046694 | Ga0495649_0113940 | Ga0495649_0113940_97_1014 | 296 |
| 1100 | 3300046694 | Ga0495649_0117054 | Ga0495649_0117054_271_1188 | 296 |
| 1101 | 3300046794 | Ga0495589_0004669 | Ga0495589_0004669_4376_5293 | 296 |
| 1102 | 3300046794 | Ga0495589_0029137 | Ga0495589_0029137_1505_2422 | 296 |
| 1103 | 3300046794 | Ga0495589_0033781 | Ga0495589_0033781_322_1239 | 296 |
| 1104 | 3300046794 | Ga0495589_0092582 | Ga0495589_0092582_134_1051 | 296 |
| 1105 | 3300046794 | Ga0495589_0100803 | Ga0495589_0100803_78_995 | 296 |
| 1106 | 3300046809 | Ga0495600_0053710 | Ga0495600_0053710_1234_2151 | 296 |
| 1107 | 3300046810 | Ga0495660_0013816 | Ga0495660_0013816_14_931 | 296 |
| 1108 | 3300046810 | Ga0495660_0025416 | Ga0495660_0025416_402_1319 | 296 |
| 1109 | 3300046810 | Ga0495660_0026036 | Ga0495660_0026036_279_1196 | 296 |
| 1110 | 3300046810 | Ga0495660_0028870 | Ga0495660_0028870_977_1894 | 296 |
| 1111 | 3300046810 | Ga0495660_0040239 | Ga0495660_0040239_28_945 | 296 |
| 1112 | 3300047317 | Ga0495604_0011519 | Ga0495604_0011519_1796_2713 | 296 |
| 1113 | 3300047317 | Ga0495604_0042466 | Ga0495604_0042466_1451_2371 | 296 |
| 1114 | 3300047318 | Ga0495636_0001835 | Ga0495636_0001835_2800_3717 | 296 |
| 1115 | 3300047320 | Ga0495672_0008442 | Ga0495672_0008442_2804_3721 | 296 |
| 1116 | 3300047320 | Ga0495672_0010128 | Ga0495672_0010128_3467_4384 | 296 |
| 1117 | 3300047320 | Ga0495672_0011167 | Ga0495672_0011167_1365_2282 | 296 |
| 1118 | 3300047320 | Ga0495672_0031188 | Ga0495672_0031188_1493_2410 | 296 |
| 1119 | 3300047320 | Ga0495672_0034094 | Ga0495672_0034094_122_1039 | 296 |
| 1120 | 3300047320 | Ga0495672_0037737 | Ga0495672_0037737_1864_2781 | 296 |
| 1121 | 3300047320 | Ga0495672_0044315 | Ga0495672_0044315_1484_2401 | 296 |
| 1122 | 3300047321 | Ga0495676_0025893 | Ga0495676_0025893_712_1629 | 296 |
| 1123 | 3300047321 | Ga0495676_0052914 | Ga0495676_0052914_67_984 | 296 |
| 1124 | 3300047322 | Ga0495680_0021393 | Ga0495680_0021393_4000_4917 | 296 |
| 1125 | 3300047322 | Ga0495680_0022051 | Ga0495680_0022051_1826_2743 | 296 |
| 1126 | 3300047322 | Ga0495680_0041037 | Ga0495680_0041037_1529_2446 | 296 |
| 1127 | 3300047323 | Ga0495683_0006289 | Ga0495683_0006289_3698_4615 | 296 |
| 1128 | 3300047323 | Ga0495683_0016417 | Ga0495683_0016417_2185_3102 | 296 |
| 1129 | 3300047323 | Ga0495683_0025315 | Ga0495683_0025315_1885_2802 | 296 |
| 1130 | 3300047323 | Ga0495683_0026077 | Ga0495683_0026077_1640_2557 | 296 |
| 1131 | 3300047443 | Ga0495687_011443 | Ga0495687_011443_384_1301 | 296 |
| 1132 | 3300047446 | Ga0495679_036874 | Ga0495679_036874_467_1387 | 296 |
| 1133 | 3300047469 | Ga0495673_0005580 | Ga0495673_0005580_3297_4214 | 296 |
| 1134 | 3300047469 | Ga0495673_0006685 | Ga0495673_0006685_1939_2856 | 296 |
| 1135 | 3300047469 | Ga0495673_0017520 | Ga0495673_0017520_702_1619 | 296 |
| 1136 | 3300047469 | Ga0495673_0019801 | Ga0495673_0019801_1244_2161 | 296 |
| 1137 | 3300047469 | Ga0495673_0021537 | Ga0495673_0021537_1012_1929 | 296 |
| 1138 | 3300047469 | Ga0495673_0024993 | Ga0495673_0024993_1099_2016 | 296 |
| 1139 | 3300047469 | Ga0495673_0028164 | Ga0495673_0028164_1225_2148 | 296 |
| 1140 | 3300047469 | Ga0495673_0031106 | Ga0495673_0031106_170_1087 | 296 |
| 1141 | 3300047469 | Ga0495673_0033019 | Ga0495673_0033019_411_1328 | 296 |
| 1142 | 3300047470 | Ga0495681_0004211 | Ga0495681_0004211_7478_8395 | 296 |
| 1143 | 3300047470 | Ga0495681_0006190 | Ga0495681_0006190_2231_3148 | 296 |
| 1144 | 3300047470 | Ga0495681_0008909 | Ga0495681_0008909_3616_4533 | 296 |
| 1145 | 3300047470 | Ga0495681_0015296 | Ga0495681_0015296_2318_3235 | 296 |
| 1146 | 3300047470 | Ga0495681_0019493 | Ga0495681_0019493_1207_2124 | 296 |
| 1147 | 3300047470 | Ga0495681_0020098 | Ga0495681_0020098_1005_1922 | 296 |
| 1148 | 3300047470 | Ga0495681_0021907 | Ga0495681_0021907_526_1443 | 296 |
| 1149 | 3300047470 | Ga0495681_0043100 | Ga0495681_0043100_332_1249 | 296 |
| 1150 | 3300047470 | Ga0495681_0067886 | Ga0495681_0067886_74_991 | 296 |
| 1151 | 3300047471 | Ga0495684_0050609 | Ga0495684_0050609_1419_2339 | 296 |
| 1152 | 3300047472 | Ga0495686_0012839 | Ga0495686_0012839_2230_3147 | 296 |
| 1153 | 3300047472 | Ga0495686_0025248 | Ga0495686_0025248_1546_2463 | 296 |
| 1154 | 3300047472 | Ga0495686_0039999 | Ga0495686_0039999_602_1519 | 296 |
| 1155 | 3300047472 | Ga0495686_0058786 | Ga0495686_0058786_334_1251 | 296 |
| 1156 | 3300047673 | Ga0495593_0028342 | Ga0495593_0028342_1136_2053 | 296 |
| 1157 | 3300047673 | Ga0495593_0037175 | Ga0495593_0037175_1447_2367 | 296 |
| 1158 | 3300047673 | Ga0495593_0071428 | Ga0495593_0071428_638_1555 | 296 |
| 1159 | 3300048088 | Ga0495602_0013655 | Ga0495602_0013655_3679_4596 | 296 |
| 1160 | 3300048091 | Ga0495626_0004559 | Ga0495626_0004559_3345_4262 | 296 |
| 1161 | 3300048091 | Ga0495626_0010576 | Ga0495626_0010576_256_1179 | 296 |
| 1162 | 3300048091 | Ga0495626_0012862 | Ga0495626_0012862_2257_3174 | 296 |
| 1163 | 3300048905 | Ga0496102_0014431 | Ga0496102_0014431_1795_2712 | 296 |
| 1164 | 3300048906 | Ga0496103_0046247 | Ga0496103_0046247_1726_2643 | 296 |
| 1165 | 3300048908 | Ga0496105_0234156 | Ga0496105_0234156_287_1204 | 296 |
| 1166 | 3300048913 | Ga0496110_0199219 | Ga0496110_0199219_412_1329 | 296 |
| 1167 | 3300048913 | Ga0496110_0217912 | Ga0496110_0217912_41_958 | 296 |
| 1168 | 3300048919 | Ga0496116_0020968 | Ga0496116_0020968_3637_4554 | 296 |
| 1169 | 3300048919 | Ga0496116_0044487 | Ga0496116_0044487_490_1407 | 296 |
| 1170 | 3300048919 | Ga0496116_0059604 | Ga0496116_0059604_1475_2392 | 296 |
| 1171 | 3300048920 | Ga0496117_0040183 | Ga0496117_0040183_2020_2937 | 296 |
| 1172 | 3300048920 | Ga0496117_0059359 | Ga0496117_0059359_1394_2311 | 296 |
| 1173 | 3300048920 | Ga0496117_0064470 | Ga0496117_0064470_42_959 | 296 |
| 1174 | 3300048921 | Ga0496118_0047760 | Ga0496118_0047760_2069_2986 | 296 |
| 1175 | 3300048921 | Ga0496118_0054080 | Ga0496118_0054080_389_1306 | 296 |
| 1176 | 3300048922 | Ga0496119_0067006 | Ga0496119_0067006_94_1011 | 296 |
| 1177 | 3300048923 | Ga0496120_0076964 | Ga0496120_0076964_468_1385 | 296 |
| 1178 | 3300048924 | Ga0496121_0062081 | Ga0496121_0062081_1762_2679 | 296 |
| 1179 | 3300048924 | Ga0496121_0067227 | Ga0496121_0067227_335_1252 | 296 |
| 1180 | 3300048925 | Ga0496122_0048270 | Ga0496122_0048270_186_1103 | 296 |
| 1181 | 3300048926 | Ga0496123_0067584 | Ga0496123_0067584_1297_2214 | 296 |
| 1182 | 3300048927 | Ga0496124_0011574 | Ga0496124_0011574_4271_5188 | 296 |
| 1183 | 3300048927 | Ga0496124_0153816 | Ga0496124_0153816_779_1696 | 296 |
| 1184 | 3300048927 | Ga0496124_0284060 | Ga0496124_0284060_192_1109 | 296 |
| 1185 | 3300048928 | Ga0496125_0059459 | Ga0496125_0059459_1773_2690 | 296 |
| 1186 | 3300048928 | Ga0496125_0062043 | Ga0496125_0062043_412_1329 | 296 |
| 1187 | 3300048929 | Ga0496126_0103250 | Ga0496126_0103250_1495_2412 | 296 |
| 1188 | 3300049459 | Ga0495678_005937 | Ga0495678_005937_4489_5406 | 296 |
| 1189 | 3300049459 | Ga0495678_009609 | Ga0495678_009609_546_1463 | 296 |
| 1190 | 3300049459 | Ga0495678_054261 | Ga0495678_054261_369_1286 | 296 |
| 1191 | 3300049459 | Ga0495678_091828 | Ga0495678_091828_73_990 | 296 |
| 1192 | 3300049460 | Ga0495682_0013699 | Ga0495682_0013699_523_1440 | 296 |
| 1193 | 3300049460 | Ga0495682_0096787 | Ga0495682_0096787_104_1021 | 296 |
| 1194 | 3300050491 | nmdc:mga00v17_22823_c1 | nmdc:mga00v17_22823_c1_1835_2752 | 296 |
| 1195 | 3300053111 | Ga0500572_002411 | Ga0500572_002411_210_1127 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qqz-assembly1.cif.gz_A | crystal structure of the c-terminal domain of the yjik protein from escherichia coli cft073 | 0.9191 | 43 | 288 |
| 3qqz-assembly1.cif.gz_A | crystal structure of the c-terminal domain of the yjik protein from escherichia coli cft073 | 0.9118 | 43 | 288 |
| 2ylz-assembly1.cif.gz_A-2 | snapshots of enzymatic baeyer-villiger catalysis: oxygen activation and intermediate stabilization: met446gly mutant | 0.8498 | 62 | 86 |
| 4c77-assembly1.cif.gz_A | phenylacetone monooxygenase: oxidised r337k mutant in complex with apadp | 0.8026 | 62 | 86 |
| 5v36-assembly1.cif.gz_A | 1.88 angstrom resolution crystal structure of glutathione reductase from streptococcus mutans ua159 in complex with fad | 0.797 | 259 | 287 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P39382_36_281_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9321 | 47 | 288 | 2.120.10.30 |
| af_P39382_36_281_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8988 | 47 | 288 | 2.120.10.30 |
| af_A0A1D6KXL6_69_164_2.40.10.480 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.8205 | 213 | 291 | 2.40.10.480 |
| af_D3ZQG6_660_743_2.40.10.500 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.8125 | 207 | 288 | 2.40.10.500 |
| af_Q03601_890_974_2.40.10.500 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.8026 | 207 | 287 | 2.40.10.500 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A659PWZ3-F1-model_v4 | Uncharacterized protein | 0.9822 | 210 | 292 |
GO:0005886
|
| AF-A0A379XWD9-F1-model_v4 | Inner membrane protein | 0.9788 | 210 | 293 |
GO:0005886
|
| AF-A0A6N8MWV3-F1-model_v4 | deleted | 0.9709 | 223 | 293 |
|
| AF-A0A352E5W3-F1-model_v4 | deleted | 0.9705 | 48 | 290 |
|
| AF-A0A2L1KH01-F1-model_v4 | Outer membrane protein assembly factor YaeT | 0.9692 | 211 | 292 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar