F491520

General Info

Members Datasets Scaffolds Average Seq Length
1195 474 972 300

Family's Representative Sequence

Representative Sequence 3300047469|Ga0495673_0006978|Ga0495673_0006978_3832_4842
Length 320
Sequence VAEGIWPLSFNSDRRDISSACFESEPALMRRFSRPKPLLLGQYLRLFERAWFNLQTAWQPMSALSIGLDQYQVAVEARVIEGLDDDVSALTFDPVRKSLFTVTNKNSELIELSLDGQIIRRIALVGFGDPEAVEFISADTYVITDEYQHRLIKIHLEEDTTFLDAADAEQMTLGVHMSGNKGFEGLAYDSVGKRLFVAKERDPMLIYEVQGFPHYNPEKSYAVHVVNNPKRDAGMFVRDLSSLQYDERSGHLLALSDESRLILELDVDGRPLSTLSLNKGRQGLRKTVPQAEGIAMDDDGTMYLVSEPNLFYVFKKPPQP

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231024 Pseudomonas sp. GM84 Isolate Nodule
21 2511231031 Pseudomonas sp. GM16 Isolate Nodule
22 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
23 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
24 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
25 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
26 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
27 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
28 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
29 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
30 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
31 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
32 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
33 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
34 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
35 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
36 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
37 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
38 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
39 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
40 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
41 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
42 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
43 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
44 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
45 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
46 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
47 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
48 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
49 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
50 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
51 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
52 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
53 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
54 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
55 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
56 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
57 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
58 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
59 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
60 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
61 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
62 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
63 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
64 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
65 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
66 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
67 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
68 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
69 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
70 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
71 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
72 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
73 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
74 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
75 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
76 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
77 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
78 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
79 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
80 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
81 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
82 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
83 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
84 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
85 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
86 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
87 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
88 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
89 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
90 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
91 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
92 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
93 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
94 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
95 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
96 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
97 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
98 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
99 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
100 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
101 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
102 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
103 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
104 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
105 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
106 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
107 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
108 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
109 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
110 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
111 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
112 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
113 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
114 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
115 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
116 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
117 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
118 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
119 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
120 2765235841 Pseudomonas putida AA7 Isolate Unclassified
121 2773857670 Pseudomonas sp. 478 Isolate Unclassified
122 2773857673 Pseudomonas sp. 443 Isolate Unclassified
123 2784132063 Pseudomonas sp. 424 Isolate Unclassified
124 2784132072 Pseudomonas sp. 460 Isolate Unclassified
125 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
126 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
127 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
128 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
129 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
130 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
131 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
132 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
133 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
134 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
135 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
136 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
137 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
138 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
139 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
140 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
141 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
142 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
143 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
144 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
145 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
146 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
147 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
148 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
149 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
150 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
151 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
152 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
153 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
154 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
155 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
156 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
157 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
158 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
159 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
160 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
161 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
162 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
163 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
164 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
165 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
166 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
167 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
168 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
169 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
170 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
171 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
172 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
173 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
174 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
175 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
176 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
177 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
178 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
179 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
180 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
181 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
182 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
183 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
184 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
185 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
186 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
187 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
188 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
189 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
190 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
191 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
192 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
193 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
194 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
195 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
196 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
197 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
198 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
199 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
200 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
201 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
202 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
203 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
204 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
205 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
206 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
207 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
208 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
209 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
210 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
211 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
212 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
213 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
214 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
215 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
216 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
217 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
218 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
219 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
220 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
221 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
222 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
223 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
224 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
225 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
226 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
227 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
228 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
229 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
230 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
231 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
232 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
233 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
234 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
235 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
236 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
237 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
238 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
239 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
240 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
241 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
242 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
243 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
244 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
245 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
246 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
247 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
248 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
249 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
250 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
251 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
252 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
253 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
254 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
255 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
256 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
257 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
258 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
259 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
265 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
266 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
268 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
270 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
271 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
291 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
292 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
294 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
295 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
297 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
298 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
299 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
300 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
301 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
302 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
303 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
304 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
305 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
306 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
307 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
308 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
309 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
310 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
311 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
312 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
313 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
314 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
315 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
316 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
317 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
318 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
319 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
320 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
321 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
322 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
323 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
324 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
325 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
326 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
327 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
328 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
329 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
330 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
331 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
332 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
333 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
334 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
335 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
336 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
337 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
338 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
339 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
340 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
341 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
342 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
343 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
344 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
345 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
346 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
347 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
348 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
349 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
350 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
351 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
352 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
353 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
354 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
355 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
356 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
357 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
358 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
359 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
360 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
361 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
362 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
363 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
364 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
365 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
366 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
367 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
368 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
369 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
370 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
371 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
372 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
373 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
374 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
375 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
376 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
377 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
378 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
379 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
380 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
381 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
382 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
383 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
384 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
385 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
386 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
387 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
388 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
389 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
390 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
391 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
392 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
393 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
394 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
395 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
396 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
397 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
398 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
399 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
400 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
401 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
402 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
403 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
404 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
405 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
406 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
407 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
408 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
409 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
410 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
411 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
412 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
413 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
414 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
415 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
416 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
417 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
418 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
419 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
420 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
421 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
422 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
423 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
424 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
425 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
426 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
427 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
428 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
429 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
430 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
431 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
432 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
433 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
434 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
435 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
436 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
437 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
438 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
439 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
440 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
441 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
442 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
444 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
445 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
446 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
447 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
448 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
449 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
450 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
451 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
452 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
453 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
454 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
455 8052494512 Pseudomonas putida LD6 Isolate Unclassified
456 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
457 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
458 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
459 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
460 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
461 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
462 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
463 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
464 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
465 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
466 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
467 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
468 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
469 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
470 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
471 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
472 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
473 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
474 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.34
Metatranscriptomes 0
Isolates 18.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.52
Nodule 2.51
Rhizoplane 6.11
Rhizosphere 74.64
Stem 0
Stem Tuber 0
Unclassified 11.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_100 2124908027 Bacteria 16970
2 MRS2a_Contig_6775 2124908027 Bacteria 6303
3 MRS2a_Contig_7922 2124908027 Bacteria 2499
4 SwRhRL2b_contig_1421610 2162886007 Bacteria 2891
5 SwRhRL2b_contig_2032209 2162886007 Bacteria 2239
6 SwRhRL2b_contig_332858 2162886007 Bacteria 2506
7 JGI24741J21665_1004037 3300001915 Bacteria 3341
8 JGI25162J39368_1000505 3300002737 Bacteria 29260
9 JGI25162J39368_1000520 3300002737 Bacteria 28748
10 JGI25163J39215_1001487 3300002771 Bacteria 3766
11 JGI25163J39215_1002247 3300002771 Bacteria 2139
12 JGI25164J39214_1000342 3300002772 Bacteria 29260
13 JGI25164J39214_1000350 3300002772 Bacteria 28748
14 JGI25165J46597_1000629 3300003214 Bacteria 29260
15 JGI25165J46597_1000645 3300003214 Bacteria 28748
16 Ga0055538_1000032 3300003751 Bacteria 199718
17 Ga0055539_1000043 3300003752 Bacteria 199718
18 Ga0055533_1000052 3300003756 Bacteria 199718
19 Ga0055532_1000047 3300003758 Bacteria 179201
20 Ga0055525_1000062 3300003759 Bacteria 199718
21 Ga0055535_1002417 3300003761 Bacteria 6584
22 Ga0055536_1001893 3300003781 Bacteria 12148
23 Ga0055536_1003161 3300003781 Bacteria 8927
24 Ga0055536_1003315 3300003781 Bacteria 8713
25 Ga0055536_1018841 3300003781 Bacteria 2194
26 Ga0055530_10002669 3300003791 Bacteria 11138
27 Ga0055530_10003441 3300003791 Bacteria 8998
28 Ga0055530_10003585 3300003791 Bacteria 8721
29 Ga0055540_1000101 3300003792 Bacteria 96054
30 Ga0055540_1002054 3300003792 Bacteria 11121
31 Ga0055540_1002471 3300003792 Bacteria 9720
32 Ga0055531_10001108 3300003794 Bacteria 20956
33 Ga0055541_1000030 3300003841 Bacteria 199616
34 Ga0065714_10000338 3300005288 Bacteria 5539
35 Ga0065714_10003528 3300005288 Bacteria 6830
36 Ga0065714_10004326 3300005288 Bacteria 8763
37 Ga0065714_10005396 3300005288 Bacteria 3929
38 Ga0065714_10011336 3300005288 Bacteria 2506
39 Ga0065714_10014633 3300005288 Bacteria 3222
40 Ga0065714_10018388 3300005288 Bacteria 1728
41 Ga0065714_10065956 3300005288 Bacteria 7979
42 Ga0065714_10069189 3300005288 Bacteria 4336
43 Ga0065714_10070624 3300005288 Bacteria 3811
44 Ga0065714_10078669 3300005288 Bacteria 2572
45 Ga0065714_10096637 3300005288 Bacteria 1753
46 Ga0065704_10002468 3300005289 Bacteria 6643
47 Ga0065704_10003468 3300005289 Bacteria 4536
48 Ga0065704_10003725 3300005289 Bacteria 6998
49 Ga0065704_10007238 3300005289 Bacteria 2585
50 Ga0065704_10077802 3300005289 Bacteria 4615
51 Ga0065704_10232881 3300005289 Bacteria 1038
52 Ga0065712_10001329 3300005290 Bacteria 8917
53 Ga0070670_100010511 3300005331 Bacteria 7902
54 Ga0070670_100011900 3300005331 Bacteria 7439
55 Ga0070661_100005363 3300005344 Bacteria 8839
56 Ga0070669_100000430 3300005353 Bacteria 32172
57 Ga0070669_100011273 3300005353 Bacteria 6347
58 Ga0070662_100002011 3300005457 Bacteria 12454
59 Ga0068853_100000187 3300005539 Bacteria 43749
60 Ga0070665_100070954 3300005548 Bacteria 3490
61 Ga0070665_100425541 3300005548 Bacteria 1336
62 Ga0070664_100007442 3300005564 Bacteria 8839
63 Ga0070664_100049753 3300005564 Bacteria 3545
64 Ga0068854_100016186 3300005578 Bacteria 4964
65 Ga0068851_10000007 3300005834 Bacteria 244101
66 Ga0075364_10037354 3300006051 Bacteria 3144
67 Ga0075364_10213561 3300006051 Bacteria 1309
68 Ga0075432_10003629 3300006058 Bacteria 5248
69 Ga0075432_10004104 3300006058 Bacteria 4967
70 Ga0075432_10009832 3300006058 Bacteria 3251
71 Ga0075432_10010422 3300006058 Bacteria 3153
72 Ga0075432_10016445 3300006058 Bacteria 2524
73 Ga0075432_10018866 3300006058 Bacteria 2354
74 Ga0075362_10103030 3300006177 Bacteria 1336
75 Ga0075436_100077685 3300006914 Bacteria 2299
76 Ga0075436_100088872 3300006914 Bacteria 2147
77 Ga0099823_1000043 3300006944 Bacteria 60786
78 Ga0099823_1026491 3300006944 Bacteria 5116
79 Ga0079104_1000862 3300006946 Bacteria 25141
80 Ga0079104_1002683 3300006946 Bacteria 9181
81 Ga0099826_10001943 3300006948 Bacteria 12943
82 Ga0105251_10004675 3300009011 Bacteria 9206
83 Ga0105251_10005898 3300009011 Bacteria 7918
84 Ga0105251_10006408 3300009011 Bacteria 7504
85 Ga0105251_10006413 3300009011 Bacteria 7496
86 Ga0105251_10010091 3300009011 Bacteria 5511
87 Ga0105251_10019472 3300009011 Bacteria 3584
88 Ga0105251_10020061 3300009011 Bacteria 3518
89 Ga0105251_10031084 3300009011 Bacteria 2674
90 Ga0105251_10052928 3300009011 Bacteria 1931
91 Ga0105244_10002122 3300009036 Bacteria 15243
92 Ga0105244_10005335 3300009036 Bacteria 8559
93 Ga0105244_10011282 3300009036 Bacteria 5373
94 Ga0105244_10012116 3300009036 Bacteria 5119
95 Ga0105244_10012478 3300009036 Bacteria 5017
96 Ga0105244_10014699 3300009036 Bacteria 4520
97 Ga0105244_10020554 3300009036 Bacteria 3665
98 Ga0105244_10020950 3300009036 Bacteria 3622
99 Ga0105244_10031702 3300009036 Bacteria 2804
100 Ga0105244_10044979 3300009036 Bacteria 2272
101 Ga0105244_10051446 3300009036 Bacteria 2099
102 Ga0105244_10065116 3300009036 Bacteria 1827
103 Ga0105244_10066896 3300009036 Bacteria 1798
104 Ga0105244_10067608 3300009036 Bacteria 1787
105 Ga0105244_10093917 3300009036 Bacteria 1473
106 Ga0105250_10000963 3300009092 Bacteria 16868
107 Ga0105250_10005377 3300009092 Bacteria 5749
108 Ga0105250_10011357 3300009092 Bacteria 3695
109 Ga0105250_10025184 3300009092 Bacteria 2398
110 Ga0105250_10028362 3300009092 Bacteria 2254
111 Ga0105250_10037059 3300009092 Bacteria 1957
112 Ga0105250_10052573 3300009092 Bacteria 1634
113 Ga0105243_10004174 3300009148 Bacteria 11453
114 Ga0105243_10005271 3300009148 Bacteria 10113
115 Ga0105243_10006873 3300009148 Bacteria 8770
116 Ga0105243_10008207 3300009148 Bacteria 8021
117 Ga0105243_10024853 3300009148 Bacteria 4573
118 Ga0105243_10044423 3300009148 Bacteria 3486
119 Ga0105243_10235679 3300009148 Bacteria 1626
120 Ga0105242_10012773 3300009176 Bacteria 6469
121 Ga0105242_10361181 3300009176 Bacteria 1344
122 Ga0105248_10075305 3300009177 Bacteria 3793
123 Ga0105237_10021239 3300009545 Bacteria 6678
124 Ga0105237_10098036 3300009545 Bacteria 2922
125 Ga0105249_10014890 3300009553 Bacteria 6879
126 Ga0105246_10004966 3300011119 Bacteria 8098
127 Ga0105246_10007194 3300011119 Bacteria 6817
128 Ga0157345_1000215 3300012498 Bacteria 8685
129 Ga0157345_1000830 3300012498 Bacteria 2341
130 Ga0157373_10024148 3300013100 Bacteria 4406
131 Ga0157373_10026918 3300013100 Bacteria 4150
132 Ga0157373_10035307 3300013100 Bacteria 3590
133 Ga0157373_10047733 3300013100 Bacteria 3053
134 Ga0157373_10053819 3300013100 Bacteria 2861
135 Ga0157373_10059873 3300013100 Bacteria 2698
136 Ga0157373_10068601 3300013100 Bacteria 2506
137 Ga0157373_10073151 3300013100 Bacteria 2419
138 Ga0157373_10275628 3300013100 Bacteria 1191
139 Ga0157371_10019357 3300013102 Bacteria 5022
140 Ga0157371_10019739 3300013102 Bacteria 4965
141 Ga0157370_10064516 3300013104 Bacteria 3467
142 Ga0157370_10073912 3300013104 Bacteria 3216
143 Ga0157370_10133233 3300013104 Bacteria 2317
144 Ga0157370_10332815 3300013104 Bacteria 1400
145 Ga0157369_10016075 3300013105 Bacteria 8420
146 Ga0157369_10037609 3300013105 Bacteria 5299
147 Ga0157369_10072612 3300013105 Bacteria 3694
148 Ga0157369_10075803 3300013105 Bacteria 3605
149 Ga0163162_10011142 3300013306 Bacteria 8759
150 Ga0163162_10079014 3300013306 Bacteria 3356
151 Ga0157372_10000574 3300013307 Bacteria 40249
152 Ga0157372_10015655 3300013307 Bacteria 8132
153 Ga0157372_10058524 3300013307 Bacteria 4308
154 Ga0157375_10087624 3300013308 Bacteria 3166
155 Ga0157375_10136022 3300013308 Bacteria 2581
156 Ga0157375_10374403 3300013308 Bacteria 1590
157 Ga0182008_10000775 3300014497 Bacteria 22401
158 Ga0182008_10011058 3300014497 Bacteria 4813
159 Ga0182008_10016544 3300014497 Bacteria 3832
160 Ga0182008_10019084 3300014497 Bacteria 3544
161 Ga0182008_10020649 3300014497 Bacteria 3388
162 Ga0182008_10024642 3300014497 Bacteria 3061
163 Ga0182008_10030716 3300014497 Bacteria 2707
164 Ga0182008_10051554 3300014497 Bacteria 2041
165 Ga0182008_10089215 3300014497 Bacteria 1519
166 Ga0182006_1003195 3300015261 Bacteria 8535
167 Ga0182006_1003355 3300015261 Bacteria 8236
168 Ga0182006_1004172 3300015261 Bacteria 7174
169 Ga0182006_1013613 3300015261 Bacteria 3525
170 Ga0182006_1015336 3300015261 Bacteria 3286
171 Ga0182006_1024909 3300015261 Bacteria 2463
172 Ga0182006_1067837 3300015261 Bacteria 1330
173 Ga0182007_10004090 3300015262 Bacteria 6713
174 Ga0182007_10010484 3300015262 Bacteria 3657
175 Ga0182007_10026603 3300015262 Bacteria 2003
176 Ga0182007_10069819 3300015262 Bacteria 1151
177 Ga0182005_1006390 3300015265 Bacteria 3608
178 Ga0182005_1031348 3300015265 Bacteria 1448
179 Ga0163161_10008495 3300017792 Bacteria 7113
180 Ga0163161_10015693 3300017792 Bacteria 5282
181 Ga0163161_10044204 3300017792 Bacteria 3208
182 Ga0163161_10045458 3300017792 Bacteria 3167
183 Ga0163161_10061922 3300017792 Bacteria 2725
184 Ga0209435_100677 3300025206 Bacteria 5983
185 Ga0209760_100027 3300025207 Bacteria 153290
186 Ga0209760_100197 3300025207 Bacteria 29065
187 Ga0209784_100007 3300025224 Bacteria 747715
188 Ga0209566_100009 3300025225 Bacteria 554018
189 Ga0209674_100021 3300025226 Bacteria 629811
190 Ga0209147_100009 3300025229 Bacteria 747409
191 Ga0209563_100018 3300025230 Bacteria 747850
192 Ga0209563_100744 3300025230 Bacteria 10006
193 Ga0207427_100005 3300025231 Bacteria 797999
194 Ga0207427_100006 3300025231 Bacteria 785415
195 Ga0209437_100013 3300025233 Bacteria 785457
196 Ga0209437_100018 3300025233 Bacteria 694400
197 Ga0209258_100169 3300025242 Bacteria 145227
198 Ga0209646_1000335 3300025246 Bacteria 35327
199 Ga0209677_100012 3300025253 Bacteria 554018
200 Ga0209759_1013699 3300025256 Bacteria 2179
201 Ga0209233_1000021 3300025261 Bacteria 798078
202 Ga0209233_1000022 3300025261 Bacteria 785415
203 Ga0209676_1000015 3300025292 Bacteria 784458
204 Ga0209676_1000030 3300025292 Bacteria 506421
205 Ga0209676_1000041 3300025292 Bacteria 424583
206 Ga0209676_1000638 3300025292 Bacteria 50370
207 Ga0209676_1005561 3300025292 Bacteria 6524
208 Ga0209676_1025681 3300025292 Bacteria 1885
209 Ga0209050_1000028 3300025298 Bacteria 477133
210 Ga0209050_1000075 3300025298 Bacteria 286562
211 Ga0209050_1003263 3300025298 Bacteria 12197
212 Ga0209050_1004799 3300025298 Bacteria 8904
213 Ga0209051_1000012 3300025303 Bacteria 595474
214 Ga0209051_1000087 3300025303 Bacteria 181248
215 Ga0209051_1000881 3300025303 Bacteria 30220
216 Ga0209257_1000069 3300025304 Bacteria 339826
217 Ga0209257_1006694 3300025304 Bacteria 7297
218 Ga0207656_10000006 3300025321 Bacteria 395044
219 Ga0207696_1000031 3300025711 Bacteria 384169
220 Ga0207696_1000050 3300025711 Bacteria 276983
221 Ga0207696_1000105 3300025711 Bacteria 163421
222 Ga0207696_1000541 3300025711 Bacteria 30663
223 Ga0207696_1007389 3300025711 Bacteria 4308
224 Ga0207696_1007521 3300025711 Bacteria 4254
225 Ga0207696_1007655 3300025711 Bacteria 4209
226 Ga0207696_1009850 3300025711 Bacteria 3540
227 Ga0207655_1000202 3300025728 Bacteria 103907
228 Ga0207655_1000429 3300025728 Bacteria 56533
229 Ga0207655_1000527 3300025728 Bacteria 48689
230 Ga0207655_1001189 3300025728 Bacteria 25183
231 Ga0207655_1001846 3300025728 Bacteria 18320
232 Ga0207655_1003239 3300025728 Bacteria 12219
233 Ga0207655_1011915 3300025728 Bacteria 5130
234 Ga0207655_1011995 3300025728 Bacteria 5108
235 Ga0207655_1012337 3300025728 Bacteria 5001
236 Ga0207655_1013478 3300025728 Bacteria 4691
237 Ga0207655_1015150 3300025728 Bacteria 4307
238 Ga0207655_1015437 3300025728 Bacteria 4246
239 Ga0207655_1016829 3300025728 Bacteria 3975
240 Ga0207655_1020309 3300025728 Bacteria 3419
241 Ga0207655_1021732 3300025728 Bacteria 3244
242 Ga0207655_1024141 3300025728 Bacteria 2988
243 Ga0207655_1025649 3300025728 Bacteria 2855
244 Ga0207655_1035842 3300025728 Bacteria 2209
245 Ga0207655_1037984 3300025728 Bacteria 2112
246 Ga0207655_1042228 3300025728 Bacteria 1944
247 Ga0207655_1083301 3300025728 Bacteria 1147
248 Ga0207713_1001953 3300025735 Bacteria 15590
249 Ga0207713_1003323 3300025735 Bacteria 11051
250 Ga0207713_1004499 3300025735 Bacteria 9028
251 Ga0207713_1004911 3300025735 Bacteria 8545
252 Ga0207713_1005214 3300025735 Bacteria 8197
253 Ga0207713_1007283 3300025735 Bacteria 6564
254 Ga0207713_1008808 3300025735 Bacteria 5751
255 Ga0207713_1008940 3300025735 Bacteria 5698
256 Ga0207713_1012250 3300025735 Bacteria 4603
257 Ga0207713_1034653 3300025735 Bacteria 2189
258 Ga0207713_1035446 3300025735 Bacteria 2154
259 Ga0207713_1038786 3300025735 Bacteria 2017
260 Ga0207713_1042159 3300025735 Bacteria 1898
261 Ga0207713_1042601 3300025735 Bacteria 1883
262 Ga0207671_10000131 3300025914 Bacteria 116866
263 Ga0207671_10055355 3300025914 Bacteria 2939
264 Ga0207649_10000012 3300025920 Bacteria 265674
265 Ga0207681_10000099 3300025923 Bacteria 73220
266 Ga0207681_10002088 3300025923 Bacteria 12808
267 Ga0207650_10000157 3300025925 Bacteria 81959
268 Ga0207650_10000185 3300025925 Bacteria 72385
269 Ga0207706_10001069 3300025933 Bacteria 27808
270 Ga0207706_10004363 3300025933 Bacteria 13293
271 Ga0207686_10044845 3300025934 Bacteria 2717
272 Ga0207686_10367082 3300025934 Bacteria 1088
273 Ga0207709_10000071 3300025935 Bacteria 181156
274 Ga0207709_10000274 3300025935 Bacteria 60740
275 Ga0207709_10004585 3300025935 Bacteria 7949
276 Ga0207709_10006683 3300025935 Bacteria 6466
277 Ga0207709_10009492 3300025935 Bacteria 5353
278 Ga0207709_10182001 3300025935 Bacteria 1485
279 Ga0207709_10278770 3300025935 Bacteria 1234
280 Ga0207711_10058639 3300025941 Bacteria 3314
281 Ga0207679_10000015 3300025945 Bacteria 265674
282 Ga0207679_10020286 3300025945 Bacteria 4483
283 Ga0207712_10022168 3300025961 Bacteria 4179
284 Ga0207639_10001195 3300026041 Bacteria 17623
285 Ga0209281_1000016 3300027111 Bacteria 588107
286 Ga0209281_1000167 3300027111 Bacteria 155556
287 Ga0209281_1012084 3300027111 Bacteria 1910
288 Ga0209389_1000017 3300027296 Bacteria 180543
289 Ga0209371_1000151 3300027312 Bacteria 109594
290 Ga0209282_1014513 3300027666 Bacteria 5015
291 Ga0207428_10032536 3300027907 Bacteria 4288
292 Ga0207428_10044045 3300027907 Bacteria 3601
293 Ga0207428_10068144 3300027907 Bacteria 2800
294 Ga0207428_10078145 3300027907 Bacteria 2590
295 Ga0207428_10096029 3300027907 Bacteria 2296
296 Ga0207428_10110020 3300027907 Bacteria 2122
297 Ga0207428_10130116 3300027907 Bacteria 1927
298 Ga0207428_10171354 3300027907 Bacteria 1644
299 Ga0207428_10187588 3300027907 Bacteria 1560
300 Ga0268266_10052479 3300028379 Bacteria 3501
301 Ga0307517_10054579 3300028786 Bacteria 3946
302 Ga0268256_1000163 3300030500 Bacteria 83483
303 Ga0316177_1055608 3300030731 Bacteria 3962
304 Ga0314311_1078403 3300030733 Bacteria 4964
305 Ga0316179_1074996 3300030734 Bacteria 1099
306 Ga0316178_1112082 3300030735 Bacteria 20417
307 Ga0316183_1010798 3300030742 Bacteria 1218
308 Ga0316183_1097097 3300030742 Bacteria 2261
309 Ga0316181_1187933 3300030744 Bacteria 3183
310 Ga0307408_100007007 3300031548 Bacteria 7453
311 Ga0307408_100011399 3300031548 Bacteria 5872
312 Ga0307408_100012654 3300031548 Bacteria 5595
313 Ga0307408_100014073 3300031548 Bacteria 5314
314 Ga0307408_100040013 3300031548 Bacteria 3317
315 Ga0307408_100481703 3300031548 Bacteria 1082
316 Ga0307516_10148373 3300031730 Bacteria 2108
317 Ga0307405_10001305 3300031731 Bacteria 10413
318 Ga0307405_10014401 3300031731 Bacteria 4252
319 Ga0307405_10016997 3300031731 Bacteria 3982
320 Ga0307405_10215501 3300031731 Bacteria 1405
321 Ga0307413_10005853 3300031824 Bacteria 5543
322 Ga0307413_10007743 3300031824 Bacteria 5014
323 Ga0307406_10005458 3300031901 Bacteria 6959
324 Ga0307406_10011171 3300031901 Bacteria 5089
325 Ga0307407_10276100 3300031903 Bacteria 1162
326 Ga0307412_10004230 3300031911 Bacteria 8002
327 Ga0307412_10008719 3300031911 Bacteria 5801
328 Ga0307412_10011320 3300031911 Bacteria 5162
329 Ga0307412_10044896 3300031911 Bacteria 2885
330 Ga0307412_10202164 3300031911 Bacteria 1509
331 Ga0307412_10312557 3300031911 Bacteria 1246
332 Ga0307409_100031333 3300031995 Bacteria 3836
333 Ga0307416_100060653 3300032002 Bacteria 3082
334 Ga0307416_100219098 3300032002 Bacteria 1823
335 Ga0307414_10018388 3300032004 Bacteria 4301
336 Ga0307414_10031486 3300032004 Bacteria 3480
337 Ga0307414_10054895 3300032004 Bacteria 2786
338 Ga0307414_10126987 3300032004 Bacteria 1972
339 Ga0307414_10156579 3300032004 Bacteria 1804
340 Ga0307411_10005924 3300032005 Bacteria 6069
341 Ga0307411_10030052 3300032005 Bacteria 3326
342 Ga0307411_10463962 3300032005 Bacteria 1062
343 Ga0307510_10024760 3300033180 Bacteria 6931
344 Ga0237819_04056 3300038705 Bacteria 2474
345 Ga0439438_004340 3300041405 Bacteria 5466
346 Ga0439438_004433 3300041405 Bacteria 5388
347 Ga0439438_004815 3300041405 Bacteria 5087
348 Ga0439438_006349 3300041405 Bacteria 4186
349 Ga0439438_007274 3300041405 Bacteria 3799
350 Ga0439438_007651 3300041405 Bacteria 3668
351 Ga0439438_009930 3300041405 Bacteria 3050
352 Ga0439438_011906 3300041405 Bacteria 2688
353 Ga0439438_012356 3300041405 Bacteria 2620
354 Ga0439438_017221 3300041405 Bacteria 2084
355 Ga0439438_025183 3300041405 Bacteria 1623
356 Ga0439438_040312 3300041405 Bacteria 1214
357 Ga0439447_001339 3300041407 Bacteria 8971
358 Ga0439447_003195 3300041407 Bacteria 5834
359 Ga0439447_004769 3300041407 Bacteria 4614
360 Ga0439447_010086 3300041407 Bacteria 2820
361 Ga0439447_010369 3300041407 Bacteria 2767
362 Ga0439447_019804 3300041407 Bacteria 1790
363 Ga0439447_022891 3300041407 Bacteria 1632
364 Ga0439447_029090 3300041407 Bacteria 1401
365 Ga0439447_033395 3300041407 Bacteria 1283
366 Ga0439466_0003842 3300041411 Bacteria 5797
367 Ga0439466_0011563 3300041411 Bacteria 3264
368 Ga0439466_0014290 3300041411 Bacteria 2893
369 Ga0439466_0019483 3300041411 Bacteria 2428
370 Ga0439466_0021314 3300041411 Bacteria 2298
371 Ga0439466_0030038 3300041411 Bacteria 1866
372 Ga0439465_0008277 3300041413 Bacteria 3283
373 Ga0439431_0001670 3300041997 Bacteria 4894
374 Ga0439445_0055508 3300042004 Bacteria 1075
375 Ga0439432_002400 3300042006 Bacteria 7069
376 Ga0439432_002579 3300042006 Bacteria 6823
377 Ga0439432_005807 3300042006 Bacteria 4431
378 Ga0439432_009019 3300042006 Bacteria 3486
379 Ga0439432_009772 3300042006 Bacteria 3337
380 Ga0439432_011855 3300042006 Bacteria 2995
381 Ga0439432_013390 3300042006 Bacteria 2791
382 Ga0439432_014816 3300042006 Bacteria 2636
383 Ga0439432_039379 3300042006 Bacteria 1502
384 Ga0439451_001490 3300042009 Bacteria 4625
385 Ga0439451_007318 3300042009 Bacteria 2252
386 Ga0439452_000629 3300042010 Bacteria 17815
387 Ga0439452_001636 3300042010 Bacteria 8851
388 Ga0439452_003235 3300042010 Bacteria 5755
389 Ga0439452_004618 3300042010 Bacteria 4576
390 Ga0439452_007060 3300042010 Bacteria 3465
391 Ga0439452_007904 3300042010 Bacteria 3224
392 Ga0439452_011312 3300042010 Bacteria 2567
393 Ga0439452_018907 3300042010 Bacteria 1827
394 Ga0439452_026541 3300042010 Bacteria 1460
395 Ga0439456_000053 3300042013 Bacteria 42489
396 Ga0439456_001369 3300042013 Bacteria 4874
397 Ga0439456_001856 3300042013 Bacteria 4264
398 Ga0439456_017180 3300042013 Bacteria 1516
399 Ga0439456_023275 3300042013 Bacteria 1313
400 Ga0439463_000524 3300042016 Bacteria 10791
401 Ga0439463_007520 3300042016 Bacteria 2688
402 Ga0450911_001540 3300042115 Bacteria 5228
403 Ga0450911_002373 3300042115 Bacteria 3753
404 Ga0450911_002657 3300042115 Bacteria 3418
405 Ga0450911_006569 3300042115 Bacteria 1727
406 Ga0450919_002332 3300042121 Bacteria 2460
407 Ga0450919_009349 3300042121 Bacteria 1125
408 Ga0450922_000335 3300042124 Bacteria 5001
409 Ga0450922_000947 3300042124 Bacteria 2951
410 Ga0450922_001656 3300042124 Bacteria 2183
411 Ga0450923_000685 3300042125 Bacteria 3975
412 Ga0450890_000839 3300042127 Bacteria 4428
413 Ga0450900_000816 3300042136 Bacteria 2726
414 Ga0450902_003311 3300042137 Bacteria 2347
415 Ga0450902_010035 3300042137 Bacteria 1496
416 Ga0450902_010270 3300042137 Bacteria 1479
417 Ga0450902_024457 3300042137 Bacteria 1005
418 Ga0450903_001776 3300042138 Bacteria 3950
419 Ga0450903_005153 3300042138 Bacteria 2195
420 Ga0450903_022109 3300042138 Bacteria 981
421 Ga0450904_001012 3300042139 Bacteria 4352
422 Ga0450904_001414 3300042139 Bacteria 3400
423 Ga0450905_015974 3300042142 Bacteria 1080
424 Ga0450906_001083 3300042145 Bacteria 6010
425 Ga0450906_001397 3300042145 Bacteria 5275
426 Ga0450906_002105 3300042145 Bacteria 4348
427 Ga0450907_000570 3300042146 Bacteria 9956
428 Ga0450907_001019 3300042146 Bacteria 6564
429 Ga0450907_001083 3300042146 Bacteria 6306
430 Ga0450907_006182 3300042146 Bacteria 2005
431 Ga0450910_001521 3300042147 Bacteria 2939
432 Ga0439446_0002695 3300042156 Bacteria 4293
433 Ga0439446_0005912 3300042156 Bacteria 3167
434 Ga0450908_004786 3300042184 Bacteria 2604
435 Ga0450908_023796 3300042184 Bacteria 1072
436 Ga0450909_001322 3300042185 Bacteria 3451
437 Ga0450909_007627 3300042185 Bacteria 1566
438 Ga0439434_0002134 3300042435 Bacteria 5723
439 Ga0439434_0015350 3300042435 Bacteria 2284
440 Ga0439434_0016586 3300042435 Bacteria 2202
441 Ga0439464_0014780 3300042439 Bacteria 2102
442 Ga0439460_0006549 3300042461 Bacteria 2895
443 Ga0450918_008906 3300042531 Bacteria 1761
444 Ga0450893_0008849 3300042532 Bacteria 1643
445 Ga0450893_0013314 3300042532 Bacteria 1370
446 Ga0450901_000659 3300042533 Bacteria 4069
447 Ga0450901_001364 3300042533 Bacteria 2805
448 Ga0439440_0001997 3300042993 Bacteria 3796
449 Ga0439440_0003420 3300042993 Bacteria 3059
450 Ga0439440_0008496 3300042993 Bacteria 2109
451 Ga0439440_0014270 3300042993 Bacteria 1713
452 Ga0495617_001915 3300046452 Bacteria 8738
453 Ga0495617_003481 3300046452 Bacteria 5913
454 Ga0495617_010344 3300046452 Bacteria 3196
455 Ga0495617_010677 3300046452 Bacteria 3145
456 Ga0495617_012058 3300046452 Bacteria 2948
457 Ga0495617_031069 3300046452 Bacteria 1794
458 Ga0495627_001624 3300046453 Bacteria 12566
459 Ga0495627_003510 3300046453 Bacteria 6874
460 Ga0495627_009174 3300046453 Bacteria 3650
461 Ga0495627_012137 3300046453 Bacteria 3067
462 Ga0495627_013416 3300046453 Bacteria 2882
463 Ga0495627_026110 3300046453 Bacteria 1887
464 Ga0495603_0006004 3300046455 Bacteria 7261
465 Ga0495603_0150634 3300046455 Bacteria 1351
466 Ga0495590_0003127 3300046457 Bacteria 6768
467 Ga0495590_0003352 3300046457 Bacteria 6549
468 Ga0495590_0012587 3300046457 Bacteria 3137
469 Ga0495590_0062260 3300046457 Bacteria 1306
470 Ga0495591_003153 3300046458 Bacteria 8713
471 Ga0495591_004283 3300046458 Bacteria 7049
472 Ga0495591_004488 3300046458 Bacteria 6821
473 Ga0495591_006239 3300046458 Bacteria 5315
474 Ga0495591_010128 3300046458 Bacteria 3682
475 Ga0495591_011182 3300046458 Bacteria 3416
476 Ga0495591_011932 3300046458 Bacteria 3261
477 Ga0495591_014957 3300046458 Bacteria 2761
478 Ga0495591_015045 3300046458 Bacteria 2749
479 Ga0495591_015501 3300046458 Bacteria 2689
480 Ga0495591_017673 3300046458 Bacteria 2440
481 Ga0495591_034663 3300046458 Bacteria 1483
482 Ga0495638_0009475 3300046460 Bacteria 6829
483 Ga0495638_0011832 3300046460 Bacteria 6003
484 Ga0495638_0013267 3300046460 Bacteria 5619
485 Ga0495638_0015777 3300046460 Bacteria 5061
486 Ga0495638_0030199 3300046460 Bacteria 3490
487 Ga0495638_0044266 3300046460 Bacteria 2804
488 Ga0495638_0044293 3300046460 Bacteria 2803
489 Ga0495638_0058255 3300046460 Bacteria 2394
490 Ga0495638_0075465 3300046460 Bacteria 2054
491 Ga0495638_0076892 3300046460 Bacteria 2033
492 Ga0495638_0082025 3300046460 Bacteria 1956
493 Ga0495638_0133599 3300046460 Bacteria 1455
494 Ga0495638_0136825 3300046460 Bacteria 1433
495 Ga0495638_0142404 3300046460 Bacteria 1398
496 Ga0495653_0023527 3300046463 Bacteria 4974
497 Ga0495653_0059618 3300046463 Bacteria 2896
498 Ga0495653_0078471 3300046463 Bacteria 2448
499 Ga0495650_0005232 3300046471 Bacteria 8512
500 Ga0495650_0007138 3300046471 Bacteria 6782
501 Ga0495650_0011643 3300046471 Bacteria 4797
502 Ga0495650_0025018 3300046471 Bacteria 2808
503 Ga0495650_0025554 3300046471 Bacteria 2765
504 Ga0495650_0027313 3300046471 Bacteria 2639
505 Ga0495650_0038282 3300046471 Bacteria 2080
506 Ga0495605_0006401 3300046474 Bacteria 6778
507 Ga0495605_0006443 3300046474 Bacteria 6746
508 Ga0495605_0006887 3300046474 Bacteria 6491
509 Ga0495605_0012694 3300046474 Bacteria 4666
510 Ga0495605_0024749 3300046474 Bacteria 3137
511 Ga0495605_0026013 3300046474 Bacteria 3044
512 Ga0495605_0044234 3300046474 Bacteria 2203
513 Ga0495605_0051096 3300046474 Bacteria 2014
514 Ga0495639_0000618 3300046475 Bacteria 16506
515 Ga0495584_0004951 3300046491 Bacteria 7100
516 Ga0495584_0005944 3300046491 Bacteria 6430
517 Ga0495584_0010791 3300046491 Bacteria 4689
518 Ga0495584_0015709 3300046491 Bacteria 3860
519 Ga0495584_0022255 3300046491 Bacteria 3217
520 Ga0495584_0025400 3300046491 Bacteria 3003
521 Ga0495584_0028519 3300046491 Bacteria 2829
522 Ga0495584_0029537 3300046491 Bacteria 2779
523 Ga0495584_0040259 3300046491 Bacteria 2359
524 Ga0495584_0066306 3300046491 Bacteria 1815
525 Ga0495584_0140869 3300046491 Bacteria 1224
526 Ga0495585_0004323 3300046492 Bacteria 9243
527 Ga0495585_0013861 3300046492 Bacteria 4710
528 Ga0495585_0016686 3300046492 Bacteria 4254
529 Ga0495585_0018674 3300046492 Bacteria 3998
530 Ga0495585_0037361 3300046492 Bacteria 2735
531 Ga0495585_0042190 3300046492 Bacteria 2556
532 Ga0495585_0047495 3300046492 Bacteria 2391
533 Ga0495585_0114349 3300046492 Bacteria 1432
534 Ga0495585_0126273 3300046492 Bacteria 1349
535 Ga0495594_0035849 3300046499 Bacteria 2703
536 Ga0495596_0003041 3300046500 Bacteria 8674
537 Ga0495607_0001950 3300046501 Bacteria 17432
538 Ga0495607_0004818 3300046501 Bacteria 9842
539 Ga0495607_0005886 3300046501 Bacteria 8707
540 Ga0495607_0018420 3300046501 Bacteria 4452
541 Ga0495607_0019378 3300046501 Bacteria 4323
542 Ga0495607_0036325 3300046501 Bacteria 2969
543 Ga0495607_0041502 3300046501 Bacteria 2732
544 Ga0495607_0045042 3300046501 Bacteria 2597
545 Ga0495607_0055040 3300046501 Bacteria 2290
546 Ga0495607_0068849 3300046501 Bacteria 1983
547 Ga0495607_0091741 3300046501 Bacteria 1644
548 Ga0495583_0007949 3300046506 Bacteria 6568
549 Ga0495583_0012824 3300046506 Bacteria 4715
550 Ga0495583_0027807 3300046506 Bacteria 2787
551 Ga0495583_0034504 3300046506 Bacteria 2423
552 Ga0495606_0009480 3300046507 Bacteria 8228
553 Ga0495606_0012126 3300046507 Bacteria 6949
554 Ga0495606_0025644 3300046507 Bacteria 4217
555 Ga0495606_0026067 3300046507 Bacteria 4170
556 Ga0495606_0045607 3300046507 Bacteria 2903
557 Ga0495606_0048201 3300046507 Bacteria 2804
558 Ga0495606_0075522 3300046507 Bacteria 2108
559 Ga0495606_0080632 3300046507 Bacteria 2024
560 Ga0495606_0155396 3300046507 Bacteria 1339
561 Ga0495606_0176458 3300046507 Bacteria 1235
562 Ga0495610_0014034 3300046512 Bacteria 4730
563 Ga0495610_0020284 3300046512 Bacteria 3693
564 Ga0495610_0020948 3300046512 Bacteria 3609
565 Ga0495610_0021050 3300046512 Bacteria 3597
566 Ga0495610_0021782 3300046512 Bacteria 3518
567 Ga0495610_0022552 3300046512 Bacteria 3441
568 Ga0495610_0024368 3300046512 Bacteria 3267
569 Ga0495610_0098872 3300046512 Bacteria 1310
570 Ga0495610_0140962 3300046512 Bacteria 1037
571 Ga0495616_0009098 3300046513 Bacteria 5827
572 Ga0495616_0009478 3300046513 Bacteria 5687
573 Ga0495616_0010742 3300046513 Bacteria 5281
574 Ga0495616_0010805 3300046513 Bacteria 5262
575 Ga0495616_0017441 3300046513 Bacteria 3960
576 Ga0495616_0019496 3300046513 Bacteria 3700
577 Ga0495616_0019634 3300046513 Bacteria 3686
578 Ga0495616_0029966 3300046513 Bacteria 2865
579 Ga0495616_0030061 3300046513 Bacteria 2859
580 Ga0495616_0035616 3300046513 Bacteria 2573
581 Ga0495616_0037504 3300046513 Bacteria 2493
582 Ga0495620_0000024 3300046515 Bacteria 126428
583 Ga0495620_0003664 3300046515 Bacteria 8771
584 Ga0495620_0006093 3300046515 Bacteria 6663
585 Ga0495620_0008902 3300046515 Bacteria 5365
586 Ga0495620_0009862 3300046515 Bacteria 5059
587 Ga0495620_0019325 3300046515 Bacteria 3352
588 Ga0495620_0025639 3300046515 Bacteria 2785
589 Ga0495630_0060005 3300046517 Bacteria 2854
590 Ga0495630_0078261 3300046517 Bacteria 2493
591 Ga0495631_0000782 3300046518 Bacteria 20373
592 Ga0495631_0003546 3300046518 Bacteria 8532
593 Ga0495631_0004038 3300046518 Bacteria 7895
594 Ga0495631_0018453 3300046518 Bacteria 3283
595 Ga0495631_0050033 3300046518 Bacteria 1828
596 Ga0495632_0003986 3300046519 Bacteria 10217
597 Ga0495632_0007720 3300046519 Bacteria 6716
598 Ga0495632_0008848 3300046519 Bacteria 6123
599 Ga0495632_0012171 3300046519 Bacteria 4973
600 Ga0495632_0012683 3300046519 Bacteria 4846
601 Ga0495632_0015219 3300046519 Bacteria 4324
602 Ga0495632_0018672 3300046519 Bacteria 3799
603 Ga0495632_0021560 3300046519 Bacteria 3470
604 Ga0495632_0024505 3300046519 Bacteria 3203
605 Ga0495632_0025416 3300046519 Bacteria 3132
606 Ga0495632_0026402 3300046519 Bacteria 3057
607 Ga0495632_0045272 3300046519 Bacteria 2192
608 Ga0495632_0051196 3300046519 Bacteria 2033
609 Ga0495632_0061990 3300046519 Bacteria 1813
610 Ga0495632_0106170 3300046519 Bacteria 1321
611 Ga0495637_0003367 3300046520 Bacteria 8494
612 Ga0495637_0003640 3300046520 Bacteria 8162
613 Ga0495637_0006679 3300046520 Bacteria 5773
614 Ga0495637_0007795 3300046520 Bacteria 5287
615 Ga0495637_0021232 3300046520 Bacteria 2979
616 Ga0495637_0026416 3300046520 Bacteria 2606
617 Ga0495637_0027219 3300046520 Bacteria 2560
618 Ga0495637_0027253 3300046520 Bacteria 2559
619 Ga0495637_0028038 3300046520 Bacteria 2516
620 Ga0495637_0031733 3300046520 Bacteria 2333
621 Ga0495637_0039044 3300046520 Bacteria 2052
622 Ga0495637_0040565 3300046520 Bacteria 2003
623 Ga0495637_0079311 3300046520 Bacteria 1311
624 Ga0495643_0003187 3300046522 Bacteria 12185
625 Ga0495643_0005296 3300046522 Bacteria 8759
626 Ga0495643_0010231 3300046522 Bacteria 5778
627 Ga0495643_0017685 3300046522 Bacteria 4161
628 Ga0495643_0027096 3300046522 Bacteria 3224
629 Ga0495643_0040577 3300046522 Bacteria 2541
630 Ga0495644_0005333 3300046523 Bacteria 5019
631 Ga0495644_0006587 3300046523 Bacteria 4500
632 Ga0495644_0014316 3300046523 Bacteria 3040
633 Ga0495644_0043522 3300046523 Bacteria 1689
634 Ga0495644_0077115 3300046523 Bacteria 1255
635 Ga0495648_0008560 3300046524 Bacteria 8034
636 Ga0495648_0009482 3300046524 Bacteria 7533
637 Ga0495648_0010142 3300046524 Bacteria 7209
638 Ga0495648_0021367 3300046524 Bacteria 4482
639 Ga0495648_0028226 3300046524 Bacteria 3742
640 Ga0495648_0028927 3300046524 Bacteria 3683
641 Ga0495648_0034429 3300046524 Bacteria 3295
642 Ga0495648_0042487 3300046524 Bacteria 2859
643 Ga0495648_0048455 3300046524 Bacteria 2615
644 Ga0495648_0051724 3300046524 Bacteria 2500
645 Ga0495648_0052510 3300046524 Bacteria 2475
646 Ga0495648_0086519 3300046524 Bacteria 1767
647 Ga0495666_0011691 3300046526 Bacteria 4377
648 Ga0495666_0023360 3300046526 Bacteria 3057
649 Ga0495666_0023961 3300046526 Bacteria 3018
650 Ga0495642_0002921 3300046528 Bacteria 6807
651 Ga0495642_0007182 3300046528 Bacteria 4274
652 Ga0495642_0008299 3300046528 Bacteria 3973
653 Ga0495654_0002894 3300046530 Bacteria 10767
654 Ga0495654_0005790 3300046530 Bacteria 7119
655 Ga0495654_0008657 3300046530 Bacteria 5608
656 Ga0495654_0011090 3300046530 Bacteria 4892
657 Ga0495654_0012450 3300046530 Bacteria 4567
658 Ga0495654_0015236 3300046530 Bacteria 4085
659 Ga0495654_0016508 3300046530 Bacteria 3901
660 Ga0495654_0017047 3300046530 Bacteria 3824
661 Ga0495654_0029012 3300046530 Bacteria 2824
662 Ga0495654_0029349 3300046530 Bacteria 2805
663 Ga0495654_0031420 3300046530 Bacteria 2695
664 Ga0495654_0064096 3300046530 Bacteria 1757
665 Ga0495654_0066380 3300046530 Bacteria 1719
666 Ga0495654_0083478 3300046530 Bacteria 1493
667 Ga0495587_0020180 3300046536 Bacteria 4116
668 Ga0495609_0008895 3300046538 Bacteria 4886
669 Ga0495609_0010955 3300046538 Bacteria 4331
670 Ga0495609_0031441 3300046538 Bacteria 2412
671 Ga0495609_0032866 3300046538 Bacteria 2355
672 Ga0495609_0033112 3300046538 Bacteria 2346
673 Ga0495609_0061468 3300046538 Bacteria 1659
674 Ga0495597_0008012 3300046542 Bacteria 5316
675 Ga0495597_0018848 3300046542 Bacteria 3234
676 Ga0495597_0019929 3300046542 Bacteria 3130
677 Ga0495597_0028751 3300046542 Bacteria 2542
678 Ga0495597_0030084 3300046542 Bacteria 2476
679 Ga0495597_0040217 3300046542 Bacteria 2090
680 Ga0495597_0045529 3300046542 Bacteria 1946
681 Ga0495622_0003094 3300046557 Bacteria 7888
682 Ga0495622_0004331 3300046557 Bacteria 6608
683 Ga0495622_0008208 3300046557 Bacteria 4837
684 Ga0495622_0024425 3300046557 Bacteria 2822
685 Ga0495622_0071131 3300046557 Bacteria 1605
686 Ga0495622_0112442 3300046557 Bacteria 1246
687 Ga0495633_0006730 3300046558 Bacteria 6765
688 Ga0495633_0025605 3300046558 Bacteria 2903
689 Ga0495633_0027683 3300046558 Bacteria 2769
690 Ga0495656_0020142 3300046615 Bacteria 2584
691 Ga0495656_0031179 3300046615 Bacteria 2160
692 Ga0495668_0005611 3300046616 Bacteria 8438
693 Ga0495668_0026738 3300046616 Bacteria 3272
694 Ga0495668_0027226 3300046616 Bacteria 3239
695 Ga0495634_0008631 3300046642 Bacteria 7563
696 Ga0495611_0002437 3300046648 Bacteria 8502
697 Ga0495611_0012912 3300046648 Bacteria 3551
698 Ga0495611_0026950 3300046648 Bacteria 2510
699 Ga0495625_0023608 3300046660 Bacteria 4695
700 Ga0495625_0035793 3300046660 Bacteria 3655
701 Ga0495625_0045114 3300046660 Bacteria 3188
702 Ga0495625_0053777 3300046660 Bacteria 2878
703 Ga0495625_0059405 3300046660 Bacteria 2713
704 Ga0495625_0081652 3300046660 Bacteria 2249
705 Ga0495625_0112568 3300046660 Bacteria 1859
706 Ga0495635_0039955 3300046663 Bacteria 3244
707 Ga0495659_0001126 3300046664 Bacteria 9300
708 Ga0495659_0003711 3300046664 Bacteria 4854
709 Ga0495659_0035213 3300046664 Bacteria 1763
710 Ga0495661_0000984 3300046665 Bacteria 25707
711 Ga0495661_0016556 3300046665 Bacteria 4883
712 Ga0495661_0027362 3300046665 Bacteria 3661
713 Ga0495661_0036520 3300046665 Bacteria 3076
714 Ga0495661_0037117 3300046665 Bacteria 3044
715 Ga0495661_0038675 3300046665 Bacteria 2968
716 Ga0495661_0107336 3300046665 Bacteria 1561
717 Ga0495588_0074846 3300046674 Bacteria 1763
718 Ga0495588_0135172 3300046674 Bacteria 1301
719 Ga0495657_0084706 3300046675 Bacteria 2044
720 Ga0495623_0006490 3300046679 Bacteria 7612
721 Ga0495646_0022041 3300046680 Bacteria 4020
722 Ga0495613_0055279 3300046689 Bacteria 2917
723 Ga0495624_0006003 3300046690 Bacteria 8664
724 Ga0495624_0311915 3300046690 Bacteria 948
725 Ga0495670_0006430 3300046691 Bacteria 5770
726 Ga0495670_0007333 3300046691 Bacteria 5422
727 Ga0495670_0015189 3300046691 Bacteria 3787
728 Ga0495670_0022039 3300046691 Bacteria 3146
729 Ga0495670_0042966 3300046691 Bacteria 2255
730 Ga0495670_0055689 3300046691 Bacteria 1983
731 Ga0495670_0098630 3300046691 Bacteria 1502
732 Ga0495670_0249360 3300046691 Bacteria 946
733 Ga0495671_0004458 3300046692 Bacteria 8372
734 Ga0495671_0010292 3300046692 Bacteria 5191
735 Ga0495671_0020410 3300046692 Bacteria 3491
736 Ga0495671_0029279 3300046692 Bacteria 2828
737 Ga0495671_0031327 3300046692 Bacteria 2719
738 Ga0495671_0031929 3300046692 Bacteria 2690
739 Ga0495671_0043609 3300046692 Bacteria 2251
740 Ga0495671_0056309 3300046692 Bacteria 1946
741 Ga0495671_0071259 3300046692 Bacteria 1707
742 Ga0495671_0081140 3300046692 Bacteria 1589
743 Ga0495671_0192682 3300046692 Bacteria 989
744 Ga0495649_0009968 3300046694 Bacteria 5616
745 Ga0495649_0013352 3300046694 Bacteria 4739
746 Ga0495649_0022482 3300046694 Bacteria 3528
747 Ga0495649_0026148 3300046694 Bacteria 3248
748 Ga0495649_0037053 3300046694 Bacteria 2677
749 Ga0495649_0038218 3300046694 Bacteria 2634
750 Ga0495649_0043087 3300046694 Bacteria 2464
751 Ga0495649_0068080 3300046694 Bacteria 1910
752 Ga0495649_0071523 3300046694 Bacteria 1859
753 Ga0495649_0113940 3300046694 Bacteria 1432
754 Ga0495649_0117054 3300046694 Bacteria 1410
755 Ga0495589_0003564 3300046794 Bacteria 8415
756 Ga0495589_0004669 3300046794 Bacteria 7279
757 Ga0495589_0006341 3300046794 Bacteria 6245
758 Ga0495589_0012732 3300046794 Bacteria 4348
759 Ga0495589_0029137 3300046794 Bacteria 2782
760 Ga0495589_0033781 3300046794 Bacteria 2568
761 Ga0495589_0092582 3300046794 Bacteria 1467
762 Ga0495589_0100803 3300046794 Bacteria 1397
763 Ga0495589_0104005 3300046794 Bacteria 1372
764 Ga0495600_0053710 3300046809 Bacteria 2631
765 Ga0495600_0286010 3300046809 Bacteria 1043
766 Ga0495660_0013816 3300046810 Bacteria 4680
767 Ga0495660_0025416 3300046810 Bacteria 3364
768 Ga0495660_0026036 3300046810 Bacteria 3318
769 Ga0495660_0028870 3300046810 Bacteria 3131
770 Ga0495660_0034716 3300046810 Bacteria 2820
771 Ga0495660_0040239 3300046810 Bacteria 2591
772 Ga0495660_0041564 3300046810 Bacteria 2544
773 Ga0495660_0047773 3300046810 Bacteria 2342
774 Ga0495660_0050464 3300046810 Bacteria 2266
775 Ga0495660_0072687 3300046810 Bacteria 1821
776 Ga0495660_0089589 3300046810 Bacteria 1601
777 Ga0495604_0011519 3300047317 Bacteria 7025
778 Ga0495604_0042466 3300047317 Bacteria 3563
779 Ga0495636_0001835 3300047318 Bacteria 8124
780 Ga0495672_0007310 3300047320 Bacteria 8331
781 Ga0495672_0008442 3300047320 Bacteria 7601
782 Ga0495672_0009010 3300047320 Bacteria 7280
783 Ga0495672_0010128 3300047320 Bacteria 6742
784 Ga0495672_0010461 3300047320 Bacteria 6606
785 Ga0495672_0011167 3300047320 Bacteria 6350
786 Ga0495672_0012745 3300047320 Bacteria 5845
787 Ga0495672_0031188 3300047320 Bacteria 3330
788 Ga0495672_0031607 3300047320 Bacteria 3303
789 Ga0495672_0032736 3300047320 Bacteria 3229
790 Ga0495672_0033623 3300047320 Bacteria 3175
791 Ga0495672_0034094 3300047320 Bacteria 3148
792 Ga0495672_0037737 3300047320 Bacteria 2953
793 Ga0495672_0038871 3300047320 Bacteria 2898
794 Ga0495672_0044315 3300047320 Bacteria 2669
795 Ga0495672_0128903 3300047320 Bacteria 1333
796 Ga0495676_0025893 3300047321 Bacteria 5056
797 Ga0495676_0052914 3300047321 Bacteria 3238
798 Ga0495680_0021393 3300047322 Bacteria 5416
799 Ga0495680_0022051 3300047322 Bacteria 5318
800 Ga0495680_0032391 3300047322 Bacteria 4243
801 Ga0495680_0041037 3300047322 Bacteria 3681
802 Ga0495683_0005020 3300047323 Bacteria 7413
803 Ga0495683_0006289 3300047323 Bacteria 6497
804 Ga0495683_0016417 3300047323 Bacteria 3845
805 Ga0495683_0025315 3300047323 Bacteria 3043
806 Ga0495683_0026077 3300047323 Bacteria 2991
807 Ga0495687_005265 3300047443 Bacteria 8311
808 Ga0495687_008214 3300047443 Bacteria 6009
809 Ga0495687_011443 3300047443 Bacteria 4771
810 Ga0495687_016269 3300047443 Bacteria 3745
811 Ga0495677_0002936 3300047445 Bacteria 6628
812 Ga0495679_012688 3300047446 Bacteria 3193
813 Ga0495679_013579 3300047446 Bacteria 3049
814 Ga0495679_036874 3300047446 Bacteria 1541
815 Ga0495673_0005580 3300047469 Bacteria 7581
816 Ga0495673_0006685 3300047469 Bacteria 6751
817 Ga0495673_0006978 3300047469 Bacteria 6571
818 Ga0495673_0017520 3300047469 Bacteria 3632
819 Ga0495673_0017632 3300047469 Bacteria 3617
820 Ga0495673_0019801 3300047469 Bacteria 3365
821 Ga0495673_0019904 3300047469 Bacteria 3353
822 Ga0495673_0021537 3300047469 Bacteria 3180
823 Ga0495673_0024993 3300047469 Bacteria 2874
824 Ga0495673_0028164 3300047469 Bacteria 2664
825 Ga0495673_0031106 3300047469 Bacteria 2501
826 Ga0495673_0033019 3300047469 Bacteria 2406
827 Ga0495673_0049966 3300047469 Bacteria 1838
828 Ga0495673_0093202 3300047469 Bacteria 1228
829 Ga0495673_0106601 3300047469 Bacteria 1125
830 Ga0495681_0004211 3300047470 Bacteria 9865
831 Ga0495681_0006190 3300047470 Bacteria 7894
832 Ga0495681_0008023 3300047470 Bacteria 6660
833 Ga0495681_0008909 3300047470 Bacteria 6232
834 Ga0495681_0015296 3300047470 Bacteria 4347
835 Ga0495681_0019493 3300047470 Bacteria 3702
836 Ga0495681_0020098 3300047470 Bacteria 3630
837 Ga0495681_0020401 3300047470 Bacteria 3597
838 Ga0495681_0021907 3300047470 Bacteria 3432
839 Ga0495681_0024142 3300047470 Bacteria 3212
840 Ga0495681_0025103 3300047470 Bacteria 3123
841 Ga0495681_0043100 3300047470 Bacteria 2178
842 Ga0495681_0067886 3300047470 Bacteria 1623
843 Ga0495681_0071058 3300047470 Bacteria 1577
844 Ga0495681_0099051 3300047470 Bacteria 1276
845 Ga0495684_0050609 3300047471 Bacteria 3171
846 Ga0495686_0012644 3300047472 Bacteria 5897
847 Ga0495686_0012839 3300047472 Bacteria 5841
848 Ga0495686_0025248 3300047472 Bacteria 3897
849 Ga0495686_0039999 3300047472 Bacteria 2992
850 Ga0495686_0042347 3300047472 Bacteria 2896
851 Ga0495686_0058786 3300047472 Bacteria 2395
852 Ga0495593_0028342 3300047673 Bacteria 3075
853 Ga0495593_0037175 3300047673 Bacteria 2635
854 Ga0495593_0067996 3300047673 Bacteria 1854
855 Ga0495593_0071428 3300047673 Bacteria 1802
856 Ga0495593_0198555 3300047673 Bacteria 1008
857 Ga0495602_0013655 3300048088 Bacteria 8286
858 Ga0495626_0004350 3300048091 Bacteria 8724
859 Ga0495626_0004559 3300048091 Bacteria 8450
860 Ga0495626_0004589 3300048091 Bacteria 8422
861 Ga0495626_0006443 3300048091 Bacteria 6686
862 Ga0495626_0009233 3300048091 Bacteria 5336
863 Ga0495626_0010576 3300048091 Bacteria 4912
864 Ga0495626_0012862 3300048091 Bacteria 4368
865 Ga0495626_0023713 3300048091 Bacteria 3017
866 Ga0495626_0023800 3300048091 Bacteria 3010
867 Ga0495626_0028737 3300048091 Bacteria 2692
868 Ga0495626_0090772 3300048091 Bacteria 1343
869 Ga0496102_0014431 3300048905 Bacteria 6863
870 Ga0496103_0046247 3300048906 Bacteria 2686
871 Ga0496105_0234156 3300048908 Bacteria 1492
872 Ga0496106_0066648 3300048909 Bacteria 2743
873 Ga0496110_0081857 3300048913 Bacteria 2878
874 Ga0496110_0199219 3300048913 Bacteria 1819
875 Ga0496110_0217912 3300048913 Bacteria 1736
876 Ga0496114_0304905 3300048917 Bacteria 1406
877 Ga0496115_0035998 3300048918 Bacteria 3918
878 Ga0496116_0001912 3300048919 Bacteria 22425
879 Ga0496116_0011426 3300048919 Bacteria 7348
880 Ga0496116_0018064 3300048919 Bacteria 5450
881 Ga0496116_0020968 3300048919 Bacteria 4942
882 Ga0496116_0044487 3300048919 Bacteria 3015
883 Ga0496116_0046630 3300048919 Bacteria 2924
884 Ga0496116_0059604 3300048919 Bacteria 2481
885 Ga0496117_0001687 3300048920 Bacteria 30677
886 Ga0496117_0005699 3300048920 Bacteria 12968
887 Ga0496117_0009483 3300048920 Bacteria 9049
888 Ga0496117_0012371 3300048920 Bacteria 7530
889 Ga0496117_0012935 3300048920 Bacteria 7313
890 Ga0496117_0040183 3300048920 Bacteria 3444
891 Ga0496117_0059359 3300048920 Bacteria 2642
892 Ga0496117_0064470 3300048920 Bacteria 2497
893 Ga0496117_0170849 3300048920 Bacteria 1262
894 Ga0496117_0216692 3300048920 Bacteria 1069
895 Ga0496118_0003034 3300048921 Bacteria 21650
896 Ga0496118_0026990 3300048921 Bacteria 4873
897 Ga0496118_0043691 3300048921 Bacteria 3518
898 Ga0496118_0047760 3300048921 Bacteria 3314
899 Ga0496118_0054080 3300048921 Bacteria 3044
900 Ga0496118_0080977 3300048921 Bacteria 2282
901 Ga0496118_0106831 3300048921 Bacteria 1871
902 Ga0496118_0215315 3300048921 Bacteria 1123
903 Ga0496119_0000082 3300048922 Bacteria 138565
904 Ga0496119_0048737 3300048922 Bacteria 2624
905 Ga0496119_0067006 3300048922 Bacteria 2118
906 Ga0496120_0002004 3300048923 Bacteria 22154
907 Ga0496120_0009188 3300048923 Bacteria 7043
908 Ga0496120_0076964 3300048923 Bacteria 1816
909 Ga0496121_0003478 3300048924 Bacteria 22418
910 Ga0496121_0062081 3300048924 Bacteria 3063
911 Ga0496121_0067227 3300048924 Bacteria 2905
912 Ga0496121_0116006 3300048924 Bacteria 2032
913 Ga0496121_0130445 3300048924 Bacteria 1882
914 Ga0496121_0142410 3300048924 Bacteria 1776
915 Ga0496121_0164377 3300048924 Bacteria 1619
916 Ga0496122_0010958 3300048925 Bacteria 9270
917 Ga0496122_0015474 3300048925 Bacteria 7291
918 Ga0496122_0040475 3300048925 Bacteria 3702
919 Ga0496122_0048270 3300048925 Bacteria 3276
920 Ga0496123_0000850 3300048926 Bacteria 48744
921 Ga0496123_0019192 3300048926 Bacteria 5396
922 Ga0496123_0025654 3300048926 Bacteria 4436
923 Ga0496123_0033959 3300048926 Bacteria 3663
924 Ga0496123_0038097 3300048926 Bacteria 3385
925 Ga0496123_0067584 3300048926 Bacteria 2256
926 Ga0496123_0175513 3300048926 Bacteria 1125
927 Ga0496124_0011287 3300048927 Bacteria 8943
928 Ga0496124_0011574 3300048927 Bacteria 8805
929 Ga0496124_0016417 3300048927 Bacteria 7040
930 Ga0496124_0017717 3300048927 Bacteria 6702
931 Ga0496124_0018126 3300048927 Bacteria 6606
932 Ga0496124_0034123 3300048927 Bacteria 4470
933 Ga0496124_0036581 3300048927 Bacteria 4280
934 Ga0496124_0054559 3300048927 Bacteria 3382
935 Ga0496124_0055326 3300048927 Bacteria 3353
936 Ga0496124_0153816 3300048927 Bacteria 1801
937 Ga0496124_0249458 3300048927 Bacteria 1314
938 Ga0496124_0284060 3300048927 Bacteria 1205
939 Ga0496125_0000440 3300048928 Bacteria 75937
940 Ga0496125_0009363 3300048928 Bacteria 10089
941 Ga0496125_0015568 3300048928 Bacteria 7345
942 Ga0496125_0025655 3300048928 Bacteria 5391
943 Ga0496125_0059459 3300048928 Bacteria 3079
944 Ga0496125_0061840 3300048928 Bacteria 3000
945 Ga0496125_0062043 3300048928 Bacteria 2992
946 Ga0496125_0076542 3300048928 Bacteria 2583
947 Ga0496126_0035392 3300048929 Bacteria 4681
948 Ga0496126_0103250 3300048929 Bacteria 2491
949 Ga0495678_005937 3300049459 Bacteria 6600
950 Ga0495678_006763 3300049459 Bacteria 6039
951 Ga0495678_009609 3300049459 Bacteria 4768
952 Ga0495678_012389 3300049459 Bacteria 4046
953 Ga0495678_030238 3300049459 Bacteria 2267
954 Ga0495678_037974 3300049459 Bacteria 1952
955 Ga0495678_054261 3300049459 Bacteria 1535
956 Ga0495678_070472 3300049459 Bacteria 1283
957 Ga0495678_091828 3300049459 Bacteria 1068
958 Ga0495682_0005818 3300049460 Bacteria 5068
959 Ga0495682_0013699 3300049460 Bacteria 3082
960 Ga0495682_0014625 3300049460 Bacteria 2975
961 Ga0495682_0096787 3300049460 Bacteria 1059
962 Ga0501034_0000223 3300049571 Bacteria 107509
963 Ga0501222_002026 3300049662 Bacteria 2804
964 Ga0501241_001559 3300049758 Bacteria 4600
965 Ga0501241_019063 3300049758 Bacteria 1258
966 Ga0501226_002299 3300049853 Bacteria 2345
967 nmdc:mga00v17_140830_c1 3300050491 Bacteria 1546
968 nmdc:mga00v17_22823_c1 3300050491 Bacteria 3615
969 nmdc:mga00v17_47703_c1 3300050491 Bacteria 2595
970 nmdc:mga00v17_49445_c1 3300050491 Bacteria 2551
971 Ga0500572_002411 3300053111 Bacteria 4507
972 Ga0500659_0008307 3300053135 Bacteria 5723

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 2124908027 MRS2a_Contig_7922 MRS2a_00767030 251
2 3300048926 Ga0496123_0025654 Ga0496123_0025654_1367_2149 251
3 3300042013 Ga0439456_017180 Ga0439456_017180_720_1487 255
4 3300042461 Ga0439460_0006549 Ga0439460_0006549_2099_2866 255
5 3300046523 Ga0495644_0077115 Ga0495644_0077115_27_809 260
6 3300048921 Ga0496118_0106831 Ga0496118_0106831_814_1737 264
7 3300046538 Ga0495609_0032866 Ga0495609_0032866_428_1273 271
8 3300046507 Ga0495606_0155396 Ga0495606_0155396_201_1049 273
9 3300046538 Ga0495609_0061468 Ga0495609_0061468_413_1330 274
10 3300049460 Ga0495682_0014625 Ga0495682_0014625_1454_2371 274
11 3300046452 Ga0495617_003481 Ga0495617_003481_3729_4646 276
12 3300046690 Ga0495624_0311915 Ga0495624_0311915_90_923 276
13 3300047673 Ga0495593_0198555 Ga0495593_0198555_146_997 276
14 3300005548 Ga0070665_100070954 Ga0070665_1000709544 277
15 3300006058 Ga0075432_10009832 Ga0075432_100098322 277
16 3300028379 Ga0268266_10052479 Ga0268266_100524793 277
17 3300031548 Ga0307408_100014073 Ga0307408_1000140735 277
18 3300032004 Ga0307414_10126987 Ga0307414_101269872 277
19 3300042139 Ga0450904_001012 Ga0450904_001012_1857_2774 277
20 3300046471 Ga0495650_0007138 Ga0495650_0007138_1543_2451 277
21 3300046506 Ga0495583_0007949 Ga0495583_0007949_1485_2393 277
22 3300046512 Ga0495610_0098872 Ga0495610_0098872_328_1236 277
23 3300046519 Ga0495632_0003986 Ga0495632_0003986_1416_2324 277
24 3300046665 Ga0495661_0000984 Ga0495661_0000984_17300_18208 277
25 3300046692 Ga0495671_0056309 Ga0495671_0056309_12_845 277
26 3300048924 Ga0496121_0130445 Ga0496121_0130445_11_844 277
27 3300049758 Ga0501241_001559 Ga0501241_001559_2427_3344 277
28 3300006058 Ga0075432_10016445 Ga0075432_100164453 279
29 3300025728 Ga0207655_1083301 Ga0207655_10833011 279
30 3300027907 Ga0207428_10032536 Ga0207428_100325364 279
31 3300050491 nmdc:mga00v17_47703_c1 nmdc:mga00v17_47703_c1_1385_2302 279
32 iso_pu_bacteria 2913036834 2913037063 279
33 3300042147 Ga0450910_001521 Ga0450910_001521_1512_2381 280
34 3300047443 Ga0495687_016269 Ga0495687_016269_1082_1999 280
35 3300014497 Ga0182008_10011058 Ga0182008_100110582 281
36 3300015261 Ga0182006_1004172 Ga0182006_10041725 281
37 3300042006 Ga0439432_002400 Ga0439432_002400_3591_4463 281
38 3300046460 Ga0495638_0044293 Ga0495638_0044293_257_1174 281
39 3300046691 Ga0495670_0022039 Ga0495670_0022039_2136_3053 281
40 3300047443 Ga0495687_005265 Ga0495687_005265_3766_4683 281
41 2124908027 MRS2a_Contig_6775 MRS2a_00631960 282
42 3300005288 Ga0065714_10011336 Ga0065714_100113362 282
43 3300013100 Ga0157373_10026918 Ga0157373_100269184 282
44 3300014497 Ga0182008_10020649 Ga0182008_100206492 282
45 3300015261 Ga0182006_1003195 Ga0182006_10031956 282
46 3300015261 Ga0182006_1015336 Ga0182006_10153362 282
47 3300015262 Ga0182007_10004090 Ga0182007_100040903 282
48 3300015265 Ga0182005_1006390 Ga0182005_10063902 282
49 3300046460 Ga0495638_0076892 Ga0495638_0076892_64_981 282
50 3300046474 Ga0495605_0026013 Ga0495605_0026013_1784_2659 282
51 3300046475 Ga0495639_0000618 Ga0495639_0000618_11363_12238 282
52 3300046501 Ga0495607_0005886 Ga0495607_0005886_3543_4421 282
53 3300046506 Ga0495583_0027807 Ga0495583_0027807_1649_2524 282
54 3300046530 Ga0495654_0005790 Ga0495654_0005790_2161_3036 282
55 3300046557 Ga0495622_0004331 Ga0495622_0004331_3597_4472 282
56 3300046664 Ga0495659_0001126 Ga0495659_0001126_4482_5357 282
57 3300046794 Ga0495589_0012732 Ga0495589_0012732_2038_2913 282
58 3300047320 Ga0495672_0007310 Ga0495672_0007310_3432_4307 282
59 3300047323 Ga0495683_0005020 Ga0495683_0005020_2175_3050 282
60 3300047443 Ga0495687_008214 Ga0495687_008214_1134_2009 282
61 3300048091 Ga0495626_0004589 Ga0495626_0004589_3447_4322 282
62 3300048909 Ga0496106_0066648 Ga0496106_0066648_1506_2381 282
63 3300048919 Ga0496116_0011426 Ga0496116_0011426_4301_5176 282
64 3300048921 Ga0496118_0080977 Ga0496118_0080977_1307_2182 282
65 3300048924 Ga0496121_0142410 Ga0496121_0142410_886_1761 282
66 3300048925 Ga0496122_0015474 Ga0496122_0015474_2147_3022 282
67 3300048926 Ga0496123_0038097 Ga0496123_0038097_2086_2961 282
68 iso_pu_bacteria 2511231007 2511272461 282
69 3300002737 JGI25162J39368_1000520 JGI25162J39368_100052023 283
70 3300002771 JGI25163J39215_1002247 JGI25163J39215_10022473 283
71 3300002772 JGI25164J39214_1000350 JGI25164J39214_100035023 283
72 3300003214 JGI25165J46597_1000645 JGI25165J46597_100064523 283
73 3300009148 Ga0105243_10024853 Ga0105243_100248532 283
74 3300013100 Ga0157373_10024148 Ga0157373_100241484 283
75 3300013105 Ga0157369_10016075 Ga0157369_100160754 283
76 3300013105 Ga0157369_10072612 Ga0157369_100726122 283
77 3300013308 Ga0157375_10087624 Ga0157375_100876243 283
78 3300025207 Ga0209760_100027 Ga0209760_100027140 283
79 3300025231 Ga0207427_100006 Ga0207427_100006472 283
80 3300025233 Ga0209437_100013 Ga0209437_100013472 283
81 3300025261 Ga0209233_1000022 Ga0209233_1000022472 283
82 3300041405 Ga0439438_017221 Ga0439438_017221_826_1707 284
83 3300041407 Ga0439447_004769 Ga0439447_004769_826_1707 284
84 3300041411 Ga0439466_0021314 Ga0439466_0021314_1069_1950 284
85 3300042006 Ga0439432_013390 Ga0439432_013390_1572_2453 284
86 3300042010 Ga0439452_003235 Ga0439452_003235_744_1625 284
87 3300042137 Ga0450902_003311 Ga0450902_003311_1422_2303 284
88 3300042137 Ga0450902_010270 Ga0450902_010270_229_1110 284
89 3300042138 Ga0450903_022109 Ga0450903_022109_53_934 284
90 3300042184 Ga0450908_023796 Ga0450908_023796_65_946 284
91 3300049459 Ga0495678_030238 Ga0495678_030238_79_966 284
92 3300009036 Ga0105244_10020950 Ga0105244_100209502 285
93 3300009092 Ga0105250_10052573 Ga0105250_100525732 285
94 3300012498 Ga0157345_1000215 Ga0157345_10002156 285
95 3300025728 Ga0207655_1011995 Ga0207655_10119954 285
96 3300046453 Ga0495627_013416 Ga0495627_013416_743_1630 285
97 3300046513 Ga0495616_0029966 Ga0495616_0029966_1376_2263 285
98 3300046520 Ga0495637_0040565 Ga0495637_0040565_768_1655 285
99 3300046809 Ga0495600_0286010 Ga0495600_0286010_145_1029 285
100 3300046810 Ga0495660_0050464 Ga0495660_0050464_1281_2168 285
101 3300047320 Ga0495672_0010461 Ga0495672_0010461_1918_2835 285
102 3300048091 Ga0495626_0023713 Ga0495626_0023713_466_1383 285
103 3300003781 Ga0055536_1018841 Ga0055536_10188412 286
104 3300003791 Ga0055530_10003441 Ga0055530_100034414 286
105 3300003792 Ga0055540_1000101 Ga0055540_100010190 286
106 3300025292 Ga0209676_1005561 Ga0209676_10055613 286
107 3300025298 Ga0209050_1000028 Ga0209050_100002851 286
108 3300025303 Ga0209051_1000087 Ga0209051_100008751 286
109 3300025304 Ga0209257_1006694 Ga0209257_10066945 286
110 3300046471 Ga0495650_0038282 Ga0495650_0038282_702_1589 286
111 3300046507 Ga0495606_0009480 Ga0495606_0009480_3831_4718 286
112 3300046507 Ga0495606_0045607 Ga0495606_0045607_1914_2801 286
113 3300046515 Ga0495620_0008902 Ga0495620_0008902_804_1691 286
114 3300046519 Ga0495632_0025416 Ga0495632_0025416_561_1448 286
115 3300046520 Ga0495637_0027253 Ga0495637_0027253_1418_2335 286
116 3300046520 Ga0495637_0039044 Ga0495637_0039044_512_1399 286
117 3300046524 Ga0495648_0051724 Ga0495648_0051724_1519_2406 286
118 3300046530 Ga0495654_0011090 Ga0495654_0011090_1356_2243 286
119 3300046538 Ga0495609_0008895 Ga0495609_0008895_1896_2783 286
120 3300046557 Ga0495622_0008208 Ga0495622_0008208_313_1200 286
121 3300046660 Ga0495625_0045114 Ga0495625_0045114_1088_1975 286
122 3300046665 Ga0495661_0027362 Ga0495661_0027362_508_1395 286
123 3300046692 Ga0495671_0031929 Ga0495671_0031929_1300_2187 286
124 3300046794 Ga0495589_0003564 Ga0495589_0003564_3895_4782 286
125 3300046810 Ga0495660_0034716 Ga0495660_0034716_1847_2734 286
126 3300046810 Ga0495660_0047773 Ga0495660_0047773_503_1390 286
127 3300047470 Ga0495681_0020401 Ga0495681_0020401_726_1613 286
128 3300047470 Ga0495681_0099051 Ga0495681_0099051_375_1262 286
129 3300048091 Ga0495626_0004350 Ga0495626_0004350_3521_4408 286
130 3300005289 Ga0065704_10232881 Ga0065704_102328811 287
131 3300042009 Ga0439451_001490 Ga0439451_001490_3593_4483 287
132 3300042010 Ga0439452_007060 Ga0439452_007060_397_1287 287
133 3300042533 Ga0450901_001364 Ga0450901_001364_1495_2412 287
134 3300046474 Ga0495605_0006401 Ga0495605_0006401_2692_3594 287
135 3300046517 Ga0495630_0078261 Ga0495630_0078261_275_1228 287
136 3300047322 Ga0495680_0032391 Ga0495680_0032391_1960_2913 287
137 3300047673 Ga0495593_0067996 Ga0495593_0067996_26_979 287
138 3300048927 Ga0496124_0055326 Ga0496124_0055326_67_969 287
139 iso_pu_bacteria 2599185155 2599331170 287
140 iso_pu_bacteria 8055878733 8055881143 287
141 3300031548 Ga0307408_100481703 Ga0307408_1004817031 288
142 3300031995 Ga0307409_100031333 Ga0307409_1000313334 288
143 3300042993 Ga0439440_0014270 Ga0439440_0014270_339_1250 288
144 iso_pu_bacteria 2623620446 2624494903 288
145 iso_pu_bacteria 2919697872 2919700605 288
146 iso_pu_bacteria 2945961074 2945966817 288
147 iso_pu_bacteria 8019775933 8019777712 288
148 iso_pu_bacteria 8056115690 8056116563 288
149 iso_pu_bacteria 8056120720 8056120993 288
150 3300030744 Ga0316181_1187933 Ga0316181_11879333 289
151 3300046512 Ga0495610_0022552 Ga0495610_0022552_2104_3021 289
152 3300048926 Ga0496123_0033959 Ga0496123_0033959_1617_2525 289
153 iso_pu_bacteria 2554235341 2555672805 289
154 iso_pu_bacteria 2597489888 2597866599 289
155 iso_pu_bacteria 2597489889 2597872456 289
156 iso_pu_bacteria 2599185160 2599355991 289
157 iso_pu_bacteria 2599185161 2599362607 289
158 iso_pu_bacteria 2599185162 2599369087 289
159 iso_pu_bacteria 2599185163 2599375716 289
160 iso_pu_bacteria 2599185164 2599381097 289
161 iso_pu_bacteria 2599185165 2599387387 289
162 iso_pu_bacteria 2599185166 2599394574 289
163 iso_pu_bacteria 2599185167 2599400570 289
164 iso_pu_bacteria 2599185168 2599406339 289
165 iso_pu_bacteria 2599185179 2599449894 289
166 iso_pu_bacteria 2599185181 2599462825 289
167 iso_pu_bacteria 2599185182 2599467752 289
168 iso_pu_bacteria 2599185186 2599491842 289
169 iso_pu_bacteria 2599185189 2599505719 289
170 iso_pu_bacteria 2599185190 2599511968 289
171 iso_pu_bacteria 2599185191 2599516952 289
172 iso_pu_bacteria 2599185290 2599892670 289
173 iso_pu_bacteria 2599185356 2600215451 289
174 iso_pu_bacteria 2600255296 2601693476 289
175 iso_pu_bacteria 2600255313 2601775617 289
176 iso_pu_bacteria 2606217733 2608383158 289
177 iso_pu_bacteria 2643221571 2643872234 289
178 iso_pu_bacteria 2643221650 2644285088 289
179 iso_pu_bacteria 2643221713 2644620136 289
180 iso_pu_bacteria 2667528171 2671099247 289
181 iso_pu_bacteria 2721755607 2723251335 289
182 iso_pu_bacteria 2818991464 2819704369 289
183 iso_pu_bacteria 2842826826 2842831316 289
184 iso_pu_bacteria 2842837860 2842837868 289
185 iso_pu_bacteria 2844665904 2844667058 289
186 iso_pu_bacteria 2860867994 2860872998 289
187 iso_pu_bacteria 2908446538 2908452543 289
188 iso_pu_bacteria 2917070673 2917076701 289
189 iso_pu_bacteria 2929189879 2929195120 289
190 iso_pu_bacteria 2931390751 2931396379 289
191 iso_pu_bacteria 2935353572 2935358332 289
192 iso_pu_bacteria 2946006987 2946013324 289
193 iso_pu_bacteria 2946027586 2946027873 289
194 iso_pu_bacteria 2947233263 2947234393 289
195 iso_pu_bacteria 2988728565 2988732001 289
196 iso_pu_bacteria 637000220 637323242 289
197 iso_pu_bacteria 8011350971 8011351758 289
198 iso_pu_bacteria 8054347763 8054349613 289
199 iso_pu_bacteria 8056148874 8056151526 289
200 3300013102 Ga0157371_10019739 Ga0157371_100197392 290
201 3300014497 Ga0182008_10089215 Ga0182008_100892152 290
202 3300015262 Ga0182007_10069819 Ga0182007_100698191 290
203 3300030731 Ga0316177_1055608 Ga0316177_10556083 290
204 3300041405 Ga0439438_004815 Ga0439438_004815_857_1771 290
205 3300041997 Ga0439431_0001670 Ga0439431_0001670_3131_4045 290
206 3300042004 Ga0439445_0055508 Ga0439445_0055508_116_1030 290
207 3300042006 Ga0439432_005807 Ga0439432_005807_879_1793 290
208 3300042156 Ga0439446_0002695 Ga0439446_0002695_730_1644 290
209 3300042435 Ga0439434_0016586 Ga0439434_0016586_11_925 290
210 iso_pu_bacteria 2511231006 2511269073 290
211 iso_pu_bacteria 2511231024 2511374699 290
212 iso_pu_bacteria 2512047018 2512327189 290
213 iso_pu_bacteria 2554235231 2555247229 290
214 iso_pu_bacteria 2582580891 2583795220 290
215 iso_pu_bacteria 2597489887 2597860851 290
216 iso_pu_bacteria 2599185185 2599485913 290
217 iso_pu_bacteria 2599185257 2599804696 290
218 iso_pu_bacteria 2600254931 2600363577 290
219 iso_pu_bacteria 2671180172 2671771703 290
220 iso_pu_bacteria 2675903515 2678260750 290
221 iso_pu_bacteria 2740892503 2743740393 290
222 iso_pu_bacteria 2744054620 2745006070 290
223 iso_pu_bacteria 2806310737 2807406071 290
224 iso_pu_bacteria 2806310745 2807454423 290
225 iso_pu_bacteria 2808606361 2808858888 290
226 iso_pu_bacteria 2808606376 2808923794 290
227 iso_pu_bacteria 2808606378 2808938969 290
228 iso_pu_bacteria 2808606380 2808945821 290
229 iso_pu_bacteria 2808606383 2808967392 290
230 iso_pu_bacteria 2808606389 2809002214 290
231 iso_pu_bacteria 2912963787 2912963982 290
232 iso_pu_bacteria 2919155634 2919155876 290
233 iso_pu_bacteria 2923153595 2923159486 290
234 iso_pu_bacteria 2939651529 2939655080 290
235 iso_pu_bacteria 2984286254 2984286630 290
236 iso_pu_bacteria 3007803356 3007804268 290
237 iso_pu_bacteria 3007872151 3007873330 290
238 iso_pu_bacteria 8015687852 8015693585 290
239 iso_pu_bacteria 8019769354 8019769799 290
240 iso_pu_bacteria 8052494512 8052494880 290
241 iso_pu_bacteria 8055770955 8055776831 290
242 iso_pu_bacteria 8056137416 8056137661 290
243 iso_pu_bacteria 8057798959 8057801909 290
244 3300003781 Ga0055536_1003161 Ga0055536_10031616 291
245 3300009036 Ga0105244_10002122 Ga0105244_1000212214 291
246 3300009092 Ga0105250_10025184 Ga0105250_100251843 291
247 3300009148 Ga0105243_10005271 Ga0105243_100052713 291
248 3300011119 Ga0105246_10007194 Ga0105246_100071943 291
249 3300013100 Ga0157373_10059873 Ga0157373_100598732 291
250 3300014497 Ga0182008_10019084 Ga0182008_100190844 291
251 3300015261 Ga0182006_1003355 Ga0182006_10033554 291
252 3300025230 Ga0209563_100744 Ga0209563_1007449 291
253 3300025292 Ga0209676_1000041 Ga0209676_1000041202 291
254 3300025292 Ga0209676_1025681 Ga0209676_10256812 291
255 3300025298 Ga0209050_1004799 Ga0209050_10047996 291
256 3300025728 Ga0207655_1003239 Ga0207655_10032393 291
257 3300025935 Ga0207709_10009492 Ga0207709_100094922 291
258 3300027111 Ga0209281_1012084 Ga0209281_10120842 291
259 3300027907 Ga0207428_10068144 Ga0207428_100681443 291
260 3300030734 Ga0316179_1074996 Ga0316179_10749961 291
261 3300030735 Ga0316178_1112082 Ga0316178_111208213 291
262 3300031548 Ga0307408_100011399 Ga0307408_1000113994 291
263 3300031903 Ga0307407_10276100 Ga0307407_102761002 291
264 3300031911 Ga0307412_10044896 Ga0307412_100448962 291
265 3300031911 Ga0307412_10202164 Ga0307412_102021641 291
266 3300031911 Ga0307412_10312557 Ga0307412_103125572 291
267 3300032004 Ga0307414_10054895 Ga0307414_100548952 291
268 3300032005 Ga0307411_10030052 Ga0307411_100300522 291
269 3300041405 Ga0439438_007274 Ga0439438_007274_876_1793 291
270 3300041405 Ga0439438_007651 Ga0439438_007651_740_1657 291
271 3300041407 Ga0439447_033395 Ga0439447_033395_332_1249 291
272 3300041411 Ga0439466_0014290 Ga0439466_0014290_1501_2418 291
273 3300042006 Ga0439432_009772 Ga0439432_009772_744_1661 291
274 3300042010 Ga0439452_000629 Ga0439452_000629_15668_16585 291
275 3300042010 Ga0439452_018907 Ga0439452_018907_456_1373 291
276 3300042013 Ga0439456_001856 Ga0439456_001856_1745_2662 291
277 3300042115 Ga0450911_002373 Ga0450911_002373_1225_2142 291
278 3300042139 Ga0450904_001414 Ga0450904_001414_2422_3339 291
279 3300042145 Ga0450906_001397 Ga0450906_001397_642_1559 291
280 3300042145 Ga0450906_002105 Ga0450906_002105_2111_3028 291
281 3300042146 Ga0450907_006182 Ga0450907_006182_618_1535 291
282 3300046524 Ga0495648_0028927 Ga0495648_0028927_1835_2752 291
283 3300047320 Ga0495672_0012745 Ga0495672_0012745_3733_4650 291
284 3300047469 Ga0495673_0006978 Ga0495673_0006978_3832_4842 291
285 3300050491 nmdc:mga00v17_49445_c1 nmdc:mga00v17_49445_c1_637_1554 291
286 iso_pu_bacteria 2511231020 2511349298 291
287 iso_pu_bacteria 2511231031 2511413496 291
288 iso_pu_bacteria 2511231156 2511822230 291
289 iso_pu_bacteria 2599185188 2599502685 291
290 iso_pu_bacteria 2599185212 2599613188 291
291 iso_pu_bacteria 2599185248 2599769179 291
292 iso_pu_bacteria 2599185288 2599879006 291
293 iso_pu_bacteria 2599185289 2599888423 291
294 iso_pu_bacteria 2599185291 2599900331 291
295 iso_pu_bacteria 2599185300 2599934383 291
296 iso_pu_bacteria 2599185302 2599943838 291
297 iso_pu_bacteria 2599185303 2599951420 291
298 iso_pu_bacteria 2599185304 2599956241 291
299 iso_pu_bacteria 2599185305 2599961657 291
300 iso_pu_bacteria 2599185306 2599965805 291
301 iso_pu_bacteria 2599185308 2599977446 291
302 iso_pu_bacteria 2599185309 2599984913 291
303 iso_pu_bacteria 2599185310 2599990913 291
304 iso_pu_bacteria 2599185311 2599996198 291
305 iso_pu_bacteria 2599185312 2600002161 291
306 iso_pu_bacteria 2599185313 2600004630 291
307 iso_pu_bacteria 2599185314 2600011701 291
308 iso_pu_bacteria 2599185315 2600018871 291
309 iso_pu_bacteria 2599185316 2600024497 291
310 iso_pu_bacteria 2599185317 2600030001 291
311 iso_pu_bacteria 2599185318 2600034903 291
312 iso_pu_bacteria 2599185319 2600043134 291
313 iso_pu_bacteria 2599185320 2600047850 291
314 iso_pu_bacteria 2599185321 2600055127 291
315 iso_pu_bacteria 2599185322 2600060154 291
316 iso_pu_bacteria 2599185323 2600065934 291
317 iso_pu_bacteria 2599185324 2600071550 291
318 iso_pu_bacteria 2599185325 2600079216 291
319 iso_pu_bacteria 2600254930 2600359310 291
320 iso_pu_bacteria 2619619299 2621296877 291
321 iso_pu_bacteria 2651869719 2652548964 291
322 iso_pu_bacteria 2667528170 2671092547 291
323 iso_pu_bacteria 2667528176 2671127118 291
324 iso_pu_bacteria 2675903420 2677897093 291
325 iso_pu_bacteria 2738541265 2738671697 291
326 iso_pu_bacteria 2738541282 2738750091 291
327 iso_pu_bacteria 2738541294 2738807222 291
328 iso_pu_bacteria 2738541303 2738859131 291
329 iso_pu_bacteria 2738541309 2738894582 291
330 iso_pu_bacteria 2765235841 2765581444 291
331 iso_pu_bacteria 2791355520 2794598877 291
332 iso_pu_bacteria 2808606385 2808976115 291
333 iso_pu_bacteria 2808606388 2808993218 291
334 iso_pu_bacteria 2816332298 2817494010 291
335 iso_pu_bacteria 2825651385 2825654490 291
336 iso_pu_bacteria 2834028612 2834030917 291
337 iso_pu_bacteria 2842854478 2842858860 291
338 iso_pu_bacteria 2852612431 2852616320 291
339 iso_pu_bacteria 2852667396 2852671288 291
340 iso_pu_bacteria 2904550169 2904551359 291
341 iso_pu_bacteria 2919481497 2919486364 291
342 iso_pu_bacteria 2923586266 2923589519 291
343 iso_pu_bacteria 2929144301 2929144579 291
344 iso_pu_bacteria 2931369376 2931372068 291
345 iso_pu_bacteria 2945928738 2945930943 291
346 iso_pu_bacteria 3007395558 3007399429 291
347 iso_pu_bacteria 8054285046 8054288509 291
348 iso_pu_bacteria 8054503363 8054508901 291
349 iso_pu_bacteria 8055817908 8055823868 291
350 iso_pu_bacteria 8056131705 8056137279 291
351 iso_pu_bacteria 8056143049 8056143506 291
352 iso_pu_bacteria 8056161164 8056163600 291
353 3300005288 Ga0065714_10069189 Ga0065714_100691892 292
354 3300006058 Ga0075432_10004104 Ga0075432_100041042 292
355 3300006946 Ga0079104_1002683 Ga0079104_10026837 292
356 3300009036 Ga0105244_10044979 Ga0105244_100449792 292
357 3300009036 Ga0105244_10066896 Ga0105244_100668962 292
358 3300013307 Ga0157372_10058524 Ga0157372_100585243 292
359 3300017792 Ga0163161_10044204 Ga0163161_100442043 292
360 3300025728 Ga0207655_1001189 Ga0207655_100118920 292
361 3300025728 Ga0207655_1015437 Ga0207655_10154373 292
362 3300025728 Ga0207655_1037984 Ga0207655_10379841 292
363 3300025728 Ga0207655_1042228 Ga0207655_10422282 292
364 3300025735 Ga0207713_1042159 Ga0207713_10421592 292
365 3300027111 Ga0209281_1000016 Ga0209281_1000016282 292
366 3300038705 Ga0237819_04056 Ga0237819_04056_788_1705 292
367 3300041405 Ga0439438_004433 Ga0439438_004433_1311_2213 292
368 3300046453 Ga0495627_001624 Ga0495627_001624_7321_8232 292
369 3300046458 Ga0495591_011932 Ga0495591_011932_1962_2867 292
370 3300046460 Ga0495638_0015777 Ga0495638_0015777_575_1492 292
371 3300046474 Ga0495605_0006887 Ga0495605_0006887_4359_5276 292
372 3300046492 Ga0495585_0016686 Ga0495585_0016686_2774_3691 292
373 3300046507 Ga0495606_0176458 Ga0495606_0176458_259_1176 292
374 3300046518 Ga0495631_0003546 Ga0495631_0003546_3478_4389 292
375 3300046519 Ga0495632_0015219 Ga0495632_0015219_1267_2178 292
376 3300046519 Ga0495632_0024505 Ga0495632_0024505_356_1261 292
377 3300046520 Ga0495637_0028038 Ga0495637_0028038_1099_2016 292
378 3300046522 Ga0495643_0040577 Ga0495643_0040577_1225_2142 292
379 3300046524 Ga0495648_0042487 Ga0495648_0042487_85_1002 292
380 3300046524 Ga0495648_0048455 Ga0495648_0048455_1614_2531 292
381 3300046530 Ga0495654_0002894 Ga0495654_0002894_4146_5057 292
382 3300046530 Ga0495654_0017047 Ga0495654_0017047_1206_2123 292
383 3300046530 Ga0495654_0083478 Ga0495654_0083478_359_1276 292
384 3300046542 Ga0495597_0045529 Ga0495597_0045529_808_1725 292
385 3300046665 Ga0495661_0016556 Ga0495661_0016556_391_1296 292
386 3300046692 Ga0495671_0031327 Ga0495671_0031327_1251_2168 292
387 3300046694 Ga0495649_0013352 Ga0495649_0013352_3256_4173 292
388 3300047320 Ga0495672_0009010 Ga0495672_0009010_2155_3060 292
389 3300047320 Ga0495672_0038871 Ga0495672_0038871_1796_2707 292
390 3300048091 Ga0495626_0090772 Ga0495626_0090772_348_1265 292
391 3300048927 Ga0496124_0054559 Ga0496124_0054559_2165_3064 292
392 iso_pu_bacteria 2511231004 2511254029 292
393 iso_pu_bacteria 2511231008 2511277625 292
394 iso_pu_bacteria 2511231010 2511289373 292
395 iso_pu_bacteria 2511231011 2511296399 292
396 iso_pu_bacteria 2511231012 2511302846 292
397 iso_pu_bacteria 2511231014 2511312006 292
398 iso_pu_bacteria 2511231015 2511318705 292
399 iso_pu_bacteria 2511231016 2511324866 292
400 iso_pu_bacteria 2511231017 2511329639 292
401 iso_pu_bacteria 2511231018 2511336864 292
402 iso_pu_bacteria 2511231019 2511344828 292
403 iso_pu_bacteria 2511231021 2511359318 292
404 iso_pu_bacteria 2511231022 2511360926 292
405 iso_pu_bacteria 2511231023 2511372470 292
406 iso_pu_bacteria 2600255318 2601798591 292
407 iso_pu_bacteria 2603880185 2606077485 292
408 iso_pu_bacteria 2603880199 2606129269 292
409 iso_pu_bacteria 2623620443 2624483381 292
410 iso_pu_bacteria 2643221565 2643842932 292
411 iso_pu_bacteria 2643221589 2643955665 292
412 iso_pu_bacteria 2643221602 2644020459 292
413 iso_pu_bacteria 2643221633 2644184516 292
414 iso_pu_bacteria 2713897148 2715749862 292
415 iso_pu_bacteria 2713897149 2715754878 292
416 iso_pu_bacteria 2718217725 2718636582 292
417 iso_pu_bacteria 2738543004 2739199027 292
418 iso_pu_bacteria 2738543015 2739258968 292
419 iso_pu_bacteria 2738543025 2739312537 292
420 iso_pu_bacteria 2773857670 2774118409 292
421 iso_pu_bacteria 2773857673 2774135601 292
422 iso_pu_bacteria 2784132063 2784261850 292
423 iso_pu_bacteria 2784132072 2784317914 292
424 iso_pu_bacteria 2808606377 2808928474 292
425 iso_pu_bacteria 2808606381 2808950343 292
426 iso_pu_bacteria 2808606382 2808959875 292
427 iso_pu_bacteria 2808606445 2809217152 292
428 iso_pu_bacteria 2818991456 2819655099 292
429 iso_pu_bacteria 2842832357 2842833431 292
430 iso_pu_bacteria 2842843487 2842845659 292
431 iso_pu_bacteria 2852657418 2852659646 292
432 iso_pu_bacteria 2860339153 2860341682 292
433 iso_pu_bacteria 2878029506 2878035323 292
434 iso_pu_bacteria 2880230671 2880235964 292
435 iso_pu_bacteria 2904518522 2904518988 292
436 iso_pu_bacteria 2919063839 2919065550 292
437 iso_pu_bacteria 2919385768 2919389218 292
438 iso_pu_bacteria 2919456309 2919457516 292
439 iso_pu_bacteria 2919487758 2919488197 292
440 iso_pu_bacteria 2931396565 2931398044 292
441 iso_pu_bacteria 2939636861 2939640836 292
442 iso_pu_bacteria 2969304461 2969310143 292
443 iso_pu_bacteria 2974289157 2974294109 292
444 iso_pu_bacteria 2998139840 2998145366 292
445 iso_pu_bacteria 3007511990 3007517147 292
446 iso_pu_bacteria 3007614139 3007615522 292
447 iso_pu_bacteria 3007619802 3007622490 292
448 iso_pu_bacteria 3007718800 3007720497 292
449 iso_pu_bacteria 3007855910 3007859161 292
450 iso_pu_bacteria 3007861166 3007865133 292
451 iso_pu_bacteria 8029995093 8029995533 292
452 iso_pu_bacteria 8056125926 8056131573 292
453 iso_pu_bacteria 8056155041 8056160820 292
454 iso_pu_bacteria 8056172158 8056177442 292
455 iso_pu_bacteria 8056177738 8056181968 292
456 iso_pu_bacteria 8056569372 8056570434 292
457 3300001915 JGI24741J21665_1004037 JGI24741J21665_10040372 293
458 3300002737 JGI25162J39368_1000505 JGI25162J39368_10005058 293
459 3300002771 JGI25163J39215_1001487 JGI25163J39215_10014874 293
460 3300002772 JGI25164J39214_1000342 JGI25164J39214_100034221 293
461 3300003214 JGI25165J46597_1000629 JGI25165J46597_100062921 293
462 3300003751 Ga0055538_1000032 Ga0055538_1000032105 293
463 3300003752 Ga0055539_1000043 Ga0055539_1000043105 293
464 3300003756 Ga0055533_1000052 Ga0055533_1000052105 293
465 3300003758 Ga0055532_1000047 Ga0055532_100004785 293
466 3300003759 Ga0055525_1000062 Ga0055525_1000062105 293
467 3300003761 Ga0055535_1002417 Ga0055535_10024175 293
468 3300003841 Ga0055541_1000030 Ga0055541_1000030105 293
469 3300005288 Ga0065714_10014633 Ga0065714_100146333 293
470 3300005289 Ga0065704_10007238 Ga0065704_100072382 293
471 3300005353 Ga0070669_100011273 Ga0070669_1000112732 293
472 3300005457 Ga0070662_100002011 Ga0070662_1000020116 293
473 3300005539 Ga0068853_100000187 Ga0068853_10000018741 293
474 3300005564 Ga0070664_100049753 Ga0070664_1000497532 293
475 3300005578 Ga0068854_100016186 Ga0068854_1000161865 293
476 3300005834 Ga0068851_10000007 Ga0068851_100000077 293
477 3300009011 Ga0105251_10005898 Ga0105251_100058984 293
478 3300009011 Ga0105251_10006408 Ga0105251_100064084 293
479 3300009092 Ga0105250_10005377 Ga0105250_100053773 293
480 3300009148 Ga0105243_10004174 Ga0105243_100041745 293
481 3300009148 Ga0105243_10044423 Ga0105243_100444233 293
482 3300009177 Ga0105248_10075305 Ga0105248_100753053 293
483 3300009545 Ga0105237_10098036 Ga0105237_100980363 293
484 3300009553 Ga0105249_10014890 Ga0105249_100148904 293
485 3300011119 Ga0105246_10004966 Ga0105246_100049665 293
486 3300013102 Ga0157371_10019357 Ga0157371_100193574 293
487 3300013104 Ga0157370_10133233 Ga0157370_101332332 293
488 3300013105 Ga0157369_10037609 Ga0157369_100376094 293
489 3300013105 Ga0157369_10075803 Ga0157369_100758034 293
490 3300014497 Ga0182008_10000775 Ga0182008_100007758 293
491 3300014497 Ga0182008_10024642 Ga0182008_100246422 293
492 3300014497 Ga0182008_10030716 Ga0182008_100307162 293
493 3300015261 Ga0182006_1013613 Ga0182006_10136133 293
494 3300017792 Ga0163161_10045458 Ga0163161_100454582 293
495 3300025206 Ga0209435_100677 Ga0209435_1006772 293
496 3300025207 Ga0209760_100197 Ga0209760_10019721 293
497 3300025224 Ga0209784_100007 Ga0209784_100007411 293
498 3300025225 Ga0209566_100009 Ga0209566_100009411 293
499 3300025226 Ga0209674_100021 Ga0209674_100021411 293
500 3300025229 Ga0209147_100009 Ga0209147_100009411 293
501 3300025230 Ga0209563_100018 Ga0209563_100018411 293
502 3300025231 Ga0207427_100005 Ga0207427_100005302 293
503 3300025233 Ga0209437_100018 Ga0209437_100018212 293
504 3300025242 Ga0209258_100169 Ga0209258_10016973 293
505 3300025246 Ga0209646_1000335 Ga0209646_10003358 293
506 3300025253 Ga0209677_100012 Ga0209677_100012411 293
507 3300025256 Ga0209759_1013699 Ga0209759_10136991 293
508 3300025261 Ga0209233_1000021 Ga0209233_1000021302 293
509 3300025321 Ga0207656_10000006 Ga0207656_1000000695 293
510 3300025735 Ga0207713_1003323 Ga0207713_10033239 293
511 3300025735 Ga0207713_1005214 Ga0207713_10052146 293
512 3300025914 Ga0207671_10055355 Ga0207671_100553553 293
513 3300025923 Ga0207681_10000099 Ga0207681_1000009967 293
514 3300025933 Ga0207706_10001069 Ga0207706_1000106922 293
515 3300025935 Ga0207709_10000274 Ga0207709_1000027417 293
516 3300025935 Ga0207709_10278770 Ga0207709_102787702 293
517 3300025941 Ga0207711_10058639 Ga0207711_100586393 293
518 3300025945 Ga0207679_10020286 Ga0207679_100202864 293
519 3300025961 Ga0207712_10022168 Ga0207712_100221684 293
520 3300026041 Ga0207639_10001195 Ga0207639_100011954 293
521 3300027907 Ga0207428_10171354 Ga0207428_101713542 293
522 3300028786 Ga0307517_10054579 Ga0307517_100545793 293
523 3300046491 Ga0495584_0028519 Ga0495584_0028519_1271_2188 293
524 3300046507 Ga0495606_0026067 Ga0495606_0026067_2058_2966 293
525 3300046558 Ga0495633_0027683 Ga0495633_0027683_1504_2409 293
526 3300047320 Ga0495672_0033623 Ga0495672_0033623_293_1198 293
527 3300047446 Ga0495679_013579 Ga0495679_013579_90_1007 293
528 3300047469 Ga0495673_0049966 Ga0495673_0049966_89_1006 293
529 3300047469 Ga0495673_0093202 Ga0495673_0093202_67_975 293
530 3300048091 Ga0495626_0023800 Ga0495626_0023800_442_1359 293
531 3300048919 Ga0496116_0001912 Ga0496116_0001912_5860_6765 293
532 3300048919 Ga0496116_0018064 Ga0496116_0018064_748_1665 293
533 3300048920 Ga0496117_0005699 Ga0496117_0005699_5916_6821 293
534 3300048920 Ga0496117_0012371 Ga0496117_0012371_3742_4650 293
535 3300048920 Ga0496117_0216692 Ga0496117_0216692_66_983 293
536 3300048921 Ga0496118_0026990 Ga0496118_0026990_3779_4684 293
537 3300048921 Ga0496118_0215315 Ga0496118_0215315_127_1044 293
538 3300048922 Ga0496119_0048737 Ga0496119_0048737_1252_2160 293
539 3300048923 Ga0496120_0009188 Ga0496120_0009188_2520_3428 293
540 3300048924 Ga0496121_0003478 Ga0496121_0003478_5846_6751 293
541 3300048925 Ga0496122_0010958 Ga0496122_0010958_2803_3708 293
542 3300048925 Ga0496122_0040475 Ga0496122_0040475_888_1796 293
543 3300048926 Ga0496123_0019192 Ga0496123_0019192_2966_3871 293
544 3300048927 Ga0496124_0016417 Ga0496124_0016417_3623_4531 293
545 3300048927 Ga0496124_0036581 Ga0496124_0036581_1959_2876 293
546 3300048928 Ga0496125_0009363 Ga0496125_0009363_5801_6709 293
547 3300048928 Ga0496125_0015568 Ga0496125_0015568_2696_3604 293
548 3300049459 Ga0495678_012389 Ga0495678_012389_1874_2791 293
549 3300049459 Ga0495678_070472 Ga0495678_070472_126_1031 293
550 2162886007 SwRhRL2b_contig_1421610 SwRhRL2b_0797.00003760 294
551 2162886007 SwRhRL2b_contig_332858 SwRhRL2b_0696.00006700 294
552 3300003781 Ga0055536_1003315 Ga0055536_10033156 294
553 3300003791 Ga0055530_10003585 Ga0055530_100035854 294
554 3300003792 Ga0055540_1002471 Ga0055540_10024716 294
555 3300003794 Ga0055531_10001108 Ga0055531_1000110817 294
556 3300005289 Ga0065704_10002468 Ga0065704_100024683 294
557 3300005289 Ga0065704_10003725 Ga0065704_100037253 294
558 3300005289 Ga0065704_10077802 Ga0065704_100778023 294
559 3300006944 Ga0099823_1000043 Ga0099823_10000433 294
560 3300006944 Ga0099823_1026491 Ga0099823_10264914 294
561 3300009011 Ga0105251_10019472 Ga0105251_100194724 294
562 3300009036 Ga0105244_10005335 Ga0105244_100053356 294
563 3300009036 Ga0105244_10012478 Ga0105244_100124785 294
564 3300009036 Ga0105244_10014699 Ga0105244_100146994 294
565 3300009036 Ga0105244_10031702 Ga0105244_100317023 294
566 3300009036 Ga0105244_10065116 Ga0105244_100651162 294
567 3300009036 Ga0105244_10067608 Ga0105244_100676082 294
568 3300009148 Ga0105243_10008207 Ga0105243_100082075 294
569 3300009148 Ga0105243_10235679 Ga0105243_102356791 294
570 3300009176 Ga0105242_10361181 Ga0105242_103611812 294
571 3300013104 Ga0157370_10332815 Ga0157370_103328152 294
572 3300013307 Ga0157372_10000574 Ga0157372_1000057416 294
573 3300025292 Ga0209676_1000015 Ga0209676_1000015441 294
574 3300025292 Ga0209676_1000638 Ga0209676_100063814 294
575 3300025298 Ga0209050_1000075 Ga0209050_1000075252 294
576 3300025303 Ga0209051_1000012 Ga0209051_1000012239 294
577 3300025304 Ga0209257_1000069 Ga0209257_100006924 294
578 3300025711 Ga0207696_1000050 Ga0207696_1000050135 294
579 3300025711 Ga0207696_1007389 Ga0207696_10073891 294
580 3300025728 Ga0207655_1000429 Ga0207655_100042928 294
581 3300025728 Ga0207655_1000527 Ga0207655_100052722 294
582 3300025728 Ga0207655_1011915 Ga0207655_10119152 294
583 3300025728 Ga0207655_1012337 Ga0207655_10123375 294
584 3300025728 Ga0207655_1020309 Ga0207655_10203093 294
585 3300025728 Ga0207655_1035842 Ga0207655_10358422 294
586 3300025735 Ga0207713_1038786 Ga0207713_10387862 294
587 3300025735 Ga0207713_1042601 Ga0207713_10426012 294
588 3300025934 Ga0207686_10367082 Ga0207686_103670822 294
589 3300025935 Ga0207709_10004585 Ga0207709_100045854 294
590 3300025935 Ga0207709_10006683 Ga0207709_100066835 294
591 3300025935 Ga0207709_10182001 Ga0207709_101820011 294
592 3300027296 Ga0209389_1000017 Ga0209389_100001787 294
593 3300027312 Ga0209371_1000151 Ga0209371_100015130 294
594 3300030500 Ga0268256_1000163 Ga0268256_10001638 294
595 3300030733 Ga0314311_1078403 Ga0314311_10784034 294
596 3300030742 Ga0316183_1010798 Ga0316183_10107981 294
597 3300030742 Ga0316183_1097097 Ga0316183_10970972 294
598 3300031548 Ga0307408_100007007 Ga0307408_1000070077 294
599 3300031731 Ga0307405_10001305 Ga0307405_100013057 294
600 3300031824 Ga0307413_10005853 Ga0307413_100058536 294
601 3300031901 Ga0307406_10005458 Ga0307406_100054587 294
602 3300031911 Ga0307412_10004230 Ga0307412_100042307 294
603 3300032002 Ga0307416_100060653 Ga0307416_1000606532 294
604 3300032004 Ga0307414_10018388 Ga0307414_100183882 294
605 3300032005 Ga0307411_10005924 Ga0307411_100059246 294
606 3300042013 Ga0439456_000053 Ga0439456_000053_37298_38209 294
607 3300042016 Ga0439463_000524 Ga0439463_000524_6280_7191 294
608 3300042016 Ga0439463_007520 Ga0439463_007520_1643_2554 294
609 3300042136 Ga0450900_000816 Ga0450900_000816_1784_2695 294
610 3300042137 Ga0450902_010035 Ga0450902_010035_384_1295 294
611 3300042533 Ga0450901_000659 Ga0450901_000659_1790_2701 294
612 3300042993 Ga0439440_0003420 Ga0439440_0003420_1334_2245 294
613 3300046453 Ga0495627_026110 Ga0495627_026110_305_1222 294
614 3300046458 Ga0495591_004488 Ga0495591_004488_2029_2946 294
615 3300046458 Ga0495591_014957 Ga0495591_014957_424_1341 294
616 3300046460 Ga0495638_0075465 Ga0495638_0075465_691_1608 294
617 3300046474 Ga0495605_0024749 Ga0495605_0024749_1426_2340 294
618 3300046491 Ga0495584_0066306 Ga0495584_0066306_469_1383 294
619 3300046515 Ga0495620_0000024 Ga0495620_0000024_32108_33010 294
620 3300046518 Ga0495631_0050033 Ga0495631_0050033_433_1347 294
621 3300046519 Ga0495632_0012171 Ga0495632_0012171_2780_3682 294
622 3300046519 Ga0495632_0106170 Ga0495632_0106170_270_1187 294
623 3300046520 Ga0495637_0079311 Ga0495637_0079311_104_1018 294
624 3300046522 Ga0495643_0003187 Ga0495643_0003187_3900_4802 294
625 3300046522 Ga0495643_0005296 Ga0495643_0005296_4394_5296 294
626 3300046522 Ga0495643_0017685 Ga0495643_0017685_1061_1975 294
627 3300046524 Ga0495648_0009482 Ga0495648_0009482_2653_3555 294
628 3300046524 Ga0495648_0028226 Ga0495648_0028226_2027_2944 294
629 3300046530 Ga0495654_0031420 Ga0495654_0031420_575_1489 294
630 3300046557 Ga0495622_0003094 Ga0495622_0003094_3899_4858 294
631 3300046615 Ga0495656_0020142 Ga0495656_0020142_1338_2255 294
632 3300046660 Ga0495625_0112568 Ga0495625_0112568_285_1202 294
633 3300046665 Ga0495661_0038675 Ga0495661_0038675_686_1600 294
634 3300046674 Ga0495588_0074846 Ga0495588_0074846_416_1375 294
635 3300046694 Ga0495649_0026148 Ga0495649_0026148_1841_2758 294
636 3300046810 Ga0495660_0072687 Ga0495660_0072687_155_1072 294
637 3300047320 Ga0495672_0031607 Ga0495672_0031607_1476_2390 294
638 3300047469 Ga0495673_0106601 Ga0495673_0106601_11_925 294
639 3300048917 Ga0496114_0304905 Ga0496114_0304905_171_1073 294
640 3300048918 Ga0496115_0035998 Ga0496115_0035998_1213_2130 294
641 3300048919 Ga0496116_0046630 Ga0496116_0046630_1624_2526 294
642 3300048920 Ga0496117_0001687 Ga0496117_0001687_25639_26541 294
643 3300048920 Ga0496117_0009483 Ga0496117_0009483_3704_4606 294
644 3300048920 Ga0496117_0012935 Ga0496117_0012935_3748_4650 294
645 3300048921 Ga0496118_0003034 Ga0496118_0003034_16129_17031 294
646 3300048921 Ga0496118_0043691 Ga0496118_0043691_45_947 294
647 3300048922 Ga0496119_0000082 Ga0496119_0000082_113856_114758 294
648 3300048923 Ga0496120_0002004 Ga0496120_0002004_17443_18345 294
649 3300048924 Ga0496121_0116006 Ga0496121_0116006_1036_1938 294
650 3300048924 Ga0496121_0164377 Ga0496121_0164377_636_1553 294
651 3300048926 Ga0496123_0000850 Ga0496123_0000850_18422_19324 294
652 3300048926 Ga0496123_0175513 Ga0496123_0175513_134_1036 294
653 3300048927 Ga0496124_0011287 Ga0496124_0011287_3718_4620 294
654 3300048927 Ga0496124_0017717 Ga0496124_0017717_2190_3101 294
655 3300048927 Ga0496124_0034123 Ga0496124_0034123_2061_2963 294
656 3300048927 Ga0496124_0249458 Ga0496124_0249458_105_1007 294
657 3300048928 Ga0496125_0000440 Ga0496125_0000440_6211_7113 294
658 3300048928 Ga0496125_0061840 Ga0496125_0061840_1343_2245 294
659 3300049459 Ga0495678_037974 Ga0495678_037974_104_1018 294
660 3300049571 Ga0501034_0000223 Ga0501034_0000223_26701_27603 294
661 3300049662 Ga0501222_002026 Ga0501222_002026_354_1265 294
662 3300050491 nmdc:mga00v17_140830_c1 nmdc:mga00v17_140830_c1_327_1241 294
663 3300053135 Ga0500659_0008307 Ga0500659_0008307_2756_3658 294
664 2162886007 SwRhRL2b_contig_2032209 SwRhRL2b_0912.00006810 295
665 3300003781 Ga0055536_1001893 Ga0055536_10018937 295
666 3300003791 Ga0055530_10002669 Ga0055530_100026697 295
667 3300003792 Ga0055540_1002054 Ga0055540_10020547 295
668 3300005288 Ga0065714_10004326 Ga0065714_100043264 295
669 3300005288 Ga0065714_10018388 Ga0065714_100183881 295
670 3300005288 Ga0065714_10065956 Ga0065714_100659565 295
671 3300005288 Ga0065714_10096637 Ga0065714_100966371 295
672 3300005289 Ga0065704_10003468 Ga0065704_100034684 295
673 3300005290 Ga0065712_10001329 Ga0065712_100013298 295
674 3300005331 Ga0070670_100010511 Ga0070670_1000105114 295
675 3300005331 Ga0070670_100011900 Ga0070670_1000119004 295
676 3300005344 Ga0070661_100005363 Ga0070661_1000053635 295
677 3300005548 Ga0070665_100425541 Ga0070665_1004255412 295
678 3300005564 Ga0070664_100007442 Ga0070664_1000074426 295
679 3300006058 Ga0075432_10010422 Ga0075432_100104222 295
680 3300006946 Ga0079104_1000862 Ga0079104_100086220 295
681 3300006948 Ga0099826_10001943 Ga0099826_1000194311 295
682 3300009011 Ga0105251_10004675 Ga0105251_100046755 295
683 3300009011 Ga0105251_10010091 Ga0105251_100100914 295
684 3300009011 Ga0105251_10052928 Ga0105251_100529282 295
685 3300009036 Ga0105244_10011282 Ga0105244_100112822 295
686 3300009036 Ga0105244_10012116 Ga0105244_100121162 295
687 3300009036 Ga0105244_10093917 Ga0105244_100939172 295
688 3300009092 Ga0105250_10000963 Ga0105250_100009632 295
689 3300009092 Ga0105250_10037059 Ga0105250_100370592 295
690 3300009176 Ga0105242_10012773 Ga0105242_100127732 295
691 3300009545 Ga0105237_10021239 Ga0105237_100212392 295
692 3300013100 Ga0157373_10035307 Ga0157373_100353072 295
693 3300013100 Ga0157373_10047733 Ga0157373_100477333 295
694 3300013100 Ga0157373_10068601 Ga0157373_100686011 295
695 3300013100 Ga0157373_10073151 Ga0157373_100731512 295
696 3300013104 Ga0157370_10064516 Ga0157370_100645163 295
697 3300013104 Ga0157370_10073912 Ga0157370_100739123 295
698 3300013306 Ga0163162_10011142 Ga0163162_100111424 295
699 3300013306 Ga0163162_10079014 Ga0163162_100790143 295
700 3300013308 Ga0157375_10136022 Ga0157375_101360222 295
701 3300013308 Ga0157375_10374403 Ga0157375_103744031 295
702 3300015262 Ga0182007_10010484 Ga0182007_100104842 295
703 3300017792 Ga0163161_10015693 Ga0163161_100156932 295
704 3300017792 Ga0163161_10061922 Ga0163161_100619223 295
705 3300025292 Ga0209676_1000030 Ga0209676_1000030240 295
706 3300025298 Ga0209050_1003263 Ga0209050_10032637 295
707 3300025303 Ga0209051_1000881 Ga0209051_10008818 295
708 3300025711 Ga0207696_1000541 Ga0207696_100054126 295
709 3300025711 Ga0207696_1007521 Ga0207696_10075212 295
710 3300025728 Ga0207655_1001846 Ga0207655_10018466 295
711 3300025728 Ga0207655_1013478 Ga0207655_10134782 295
712 3300025728 Ga0207655_1016829 Ga0207655_10168294 295
713 3300025728 Ga0207655_1021732 Ga0207655_10217323 295
714 3300025735 Ga0207713_1001953 Ga0207713_10019533 295
715 3300025735 Ga0207713_1007283 Ga0207713_10072834 295
716 3300025735 Ga0207713_1008808 Ga0207713_10088084 295
717 3300025735 Ga0207713_1012250 Ga0207713_10122505 295
718 3300025914 Ga0207671_10000131 Ga0207671_1000013111 295
719 3300025920 Ga0207649_10000012 Ga0207649_1000001276 295
720 3300025925 Ga0207650_10000157 Ga0207650_1000015760 295
721 3300025925 Ga0207650_10000185 Ga0207650_1000018546 295
722 3300025934 Ga0207686_10044845 Ga0207686_100448451 295
723 3300025945 Ga0207679_10000015 Ga0207679_1000001576 295
724 3300027111 Ga0209281_1000167 Ga0209281_100016780 295
725 3300027666 Ga0209282_1014513 Ga0209282_10145134 295
726 3300027907 Ga0207428_10044045 Ga0207428_100440454 295
727 3300027907 Ga0207428_10096029 Ga0207428_100960292 295
728 3300027907 Ga0207428_10187588 Ga0207428_101875882 295
729 3300031548 Ga0307408_100012654 Ga0307408_1000126544 295
730 3300031548 Ga0307408_100040013 Ga0307408_1000400131 295
731 3300031731 Ga0307405_10014401 Ga0307405_100144014 295
732 3300031731 Ga0307405_10016997 Ga0307405_100169972 295
733 3300031731 Ga0307405_10215501 Ga0307405_102155011 295
734 3300031824 Ga0307413_10007743 Ga0307413_100077432 295
735 3300031901 Ga0307406_10011171 Ga0307406_100111712 295
736 3300031911 Ga0307412_10008719 Ga0307412_100087194 295
737 3300031911 Ga0307412_10011320 Ga0307412_100113204 295
738 3300032004 Ga0307414_10031486 Ga0307414_100314863 295
739 3300032004 Ga0307414_10156579 Ga0307414_101565792 295
740 3300032005 Ga0307411_10463962 Ga0307411_104639621 295
741 3300033180 Ga0307510_10024760 Ga0307510_100247603 295
742 3300041405 Ga0439438_004340 Ga0439438_004340_3015_3929 295
743 3300041405 Ga0439438_006349 Ga0439438_006349_1497_2411 295
744 3300041405 Ga0439438_040312 Ga0439438_040312_92_1018 295
745 3300041407 Ga0439447_029090 Ga0439447_029090_358_1272 295
746 3300042006 Ga0439432_009019 Ga0439432_009019_1021_1935 295
747 3300042010 Ga0439452_026541 Ga0439452_026541_407_1321 295
748 3300042185 Ga0450909_001322 Ga0450909_001322_1795_2709 295
749 3300046452 Ga0495617_031069 Ga0495617_031069_370_1287 295
750 3300046453 Ga0495627_003510 Ga0495627_003510_3831_4748 295
751 3300046453 Ga0495627_012137 Ga0495627_012137_518_1435 295
752 3300046457 Ga0495590_0062260 Ga0495590_0062260_77_994 295
753 3300046458 Ga0495591_004283 Ga0495591_004283_2276_3193 295
754 3300046458 Ga0495591_006239 Ga0495591_006239_2930_3847 295
755 3300046458 Ga0495591_015501 Ga0495591_015501_1680_2597 295
756 3300046460 Ga0495638_0044266 Ga0495638_0044266_64_981 295
757 3300046460 Ga0495638_0058255 Ga0495638_0058255_121_1035 295
758 3300046471 Ga0495650_0025018 Ga0495650_0025018_425_1339 295
759 3300046471 Ga0495650_0027313 Ga0495650_0027313_505_1422 295
760 3300046474 Ga0495605_0044234 Ga0495605_0044234_724_1638 295
761 3300046474 Ga0495605_0051096 Ga0495605_0051096_522_1439 295
762 3300046491 Ga0495584_0040259 Ga0495584_0040259_1088_2005 295
763 3300046492 Ga0495585_0013861 Ga0495585_0013861_3270_4187 295
764 3300046492 Ga0495585_0037361 Ga0495585_0037361_1270_2187 295
765 3300046492 Ga0495585_0042190 Ga0495585_0042190_1134_2051 295
766 3300046492 Ga0495585_0114349 Ga0495585_0114349_279_1193 295
767 3300046501 Ga0495607_0018420 Ga0495607_0018420_2236_3153 295
768 3300046506 Ga0495583_0034504 Ga0495583_0034504_1175_2089 295
769 3300046507 Ga0495606_0048201 Ga0495606_0048201_1831_2745 295
770 3300046507 Ga0495606_0080632 Ga0495606_0080632_564_1481 295
771 3300046512 Ga0495610_0020284 Ga0495610_0020284_2472_3386 295
772 3300046512 Ga0495610_0140962 Ga0495610_0140962_99_1016 295
773 3300046513 Ga0495616_0009478 Ga0495616_0009478_1178_2095 295
774 3300046513 Ga0495616_0010742 Ga0495616_0010742_1152_2066 295
775 3300046513 Ga0495616_0030061 Ga0495616_0030061_1367_2284 295
776 3300046515 Ga0495620_0009862 Ga0495620_0009862_758_1675 295
777 3300046515 Ga0495620_0025639 Ga0495620_0025639_89_1006 295
778 3300046518 Ga0495631_0004038 Ga0495631_0004038_3441_4358 295
779 3300046519 Ga0495632_0008848 Ga0495632_0008848_4289_5203 295
780 3300046519 Ga0495632_0051196 Ga0495632_0051196_293_1210 295
781 3300046520 Ga0495637_0006679 Ga0495637_0006679_1064_1981 295
782 3300046520 Ga0495637_0031733 Ga0495637_0031733_147_1064 295
783 3300046522 Ga0495643_0010231 Ga0495643_0010231_3591_4508 295
784 3300046522 Ga0495643_0027096 Ga0495643_0027096_487_1404 295
785 3300046523 Ga0495644_0014316 Ga0495644_0014316_1367_2284 295
786 3300046523 Ga0495644_0043522 Ga0495644_0043522_664_1581 295
787 3300046524 Ga0495648_0021367 Ga0495648_0021367_1553_2470 295
788 3300046524 Ga0495648_0034429 Ga0495648_0034429_1064_1981 295
789 3300046530 Ga0495654_0015236 Ga0495654_0015236_2826_3740 295
790 3300046530 Ga0495654_0016508 Ga0495654_0016508_1009_1926 295
791 3300046538 Ga0495609_0010955 Ga0495609_0010955_1349_2266 295
792 3300046557 Ga0495622_0024425 Ga0495622_0024425_1465_2379 295
793 3300046557 Ga0495622_0112442 Ga0495622_0112442_215_1132 295
794 3300046615 Ga0495656_0031179 Ga0495656_0031179_1143_2057 295
795 3300046642 Ga0495634_0008631 Ga0495634_0008631_2544_3461 295
796 3300046648 Ga0495611_0002437 Ga0495611_0002437_3783_4700 295
797 3300046660 Ga0495625_0035793 Ga0495625_0035793_1958_2875 295
798 3300046665 Ga0495661_0107336 Ga0495661_0107336_436_1353 295
799 3300046691 Ga0495670_0007333 Ga0495670_0007333_3737_4654 295
800 3300046691 Ga0495670_0042966 Ga0495670_0042966_79_996 295
801 3300046691 Ga0495670_0098630 Ga0495670_0098630_110_1027 295
802 3300046692 Ga0495671_0192682 Ga0495671_0192682_55_972 295
803 3300046794 Ga0495589_0006341 Ga0495589_0006341_1989_2903 295
804 3300046794 Ga0495589_0104005 Ga0495589_0104005_18_935 295
805 3300046810 Ga0495660_0041564 Ga0495660_0041564_393_1310 295
806 3300046810 Ga0495660_0089589 Ga0495660_0089589_667_1584 295
807 3300047320 Ga0495672_0032736 Ga0495672_0032736_1502_2419 295
808 3300047320 Ga0495672_0128903 Ga0495672_0128903_332_1249 295
809 3300047445 Ga0495677_0002936 Ga0495677_0002936_1650_2564 295
810 3300047446 Ga0495679_012688 Ga0495679_012688_496_1413 295
811 3300047469 Ga0495673_0017632 Ga0495673_0017632_1905_2822 295
812 3300047469 Ga0495673_0019904 Ga0495673_0019904_1681_2598 295
813 3300047470 Ga0495681_0008023 Ga0495681_0008023_1949_2866 295
814 3300047470 Ga0495681_0024142 Ga0495681_0024142_1898_2815 295
815 3300047470 Ga0495681_0025103 Ga0495681_0025103_117_1034 295
816 3300047470 Ga0495681_0071058 Ga0495681_0071058_635_1552 295
817 3300047472 Ga0495686_0012644 Ga0495686_0012644_3710_4627 295
818 3300047472 Ga0495686_0042347 Ga0495686_0042347_698_1615 295
819 3300048091 Ga0495626_0006443 Ga0495626_0006443_3879_4796 295
820 3300048091 Ga0495626_0009233 Ga0495626_0009233_3411_4328 295
821 3300048091 Ga0495626_0028737 Ga0495626_0028737_1252_2169 295
822 3300048913 Ga0496110_0081857 Ga0496110_0081857_1357_2265 295
823 3300048920 Ga0496117_0170849 Ga0496117_0170849_157_1071 295
824 3300048927 Ga0496124_0018126 Ga0496124_0018126_1519_2427 295
825 3300048928 Ga0496125_0025655 Ga0496125_0025655_3955_4863 295
826 3300048928 Ga0496125_0076542 Ga0496125_0076542_1238_2155 295
827 3300048929 Ga0496126_0035392 Ga0496126_0035392_525_1433 295
828 3300049459 Ga0495678_006763 Ga0495678_006763_1359_2276 295
829 3300049460 Ga0495682_0005818 Ga0495682_0005818_643_1560 295
830 3300049758 Ga0501241_019063 Ga0501241_019063_316_1230 295
831 3300049853 Ga0501226_002299 Ga0501226_002299_1169_2083 295
832 2124908027 MRS2a_Contig_100 MRS2a_00002860 296
833 3300005288 Ga0065714_10000338 Ga0065714_100003384 296
834 3300005288 Ga0065714_10003528 Ga0065714_100035284 296
835 3300005288 Ga0065714_10005396 Ga0065714_100053964 296
836 3300005288 Ga0065714_10070624 Ga0065714_100706245 296
837 3300005288 Ga0065714_10078669 Ga0065714_100786692 296
838 3300005353 Ga0070669_100000430 Ga0070669_10000043025 296
839 3300006051 Ga0075364_10037354 Ga0075364_100373542 296
840 3300006051 Ga0075364_10213561 Ga0075364_102135612 296
841 3300006058 Ga0075432_10003629 Ga0075432_100036293 296
842 3300006058 Ga0075432_10018866 Ga0075432_100188662 296
843 3300006177 Ga0075362_10103030 Ga0075362_101030302 296
844 3300006914 Ga0075436_100077685 Ga0075436_1000776852 296
845 3300006914 Ga0075436_100088872 Ga0075436_1000888722 296
846 3300009011 Ga0105251_10006413 Ga0105251_100064136 296
847 3300009011 Ga0105251_10020061 Ga0105251_100200614 296
848 3300009011 Ga0105251_10031084 Ga0105251_100310842 296
849 3300009036 Ga0105244_10020554 Ga0105244_100205542 296
850 3300009036 Ga0105244_10051446 Ga0105244_100514462 296
851 3300009092 Ga0105250_10011357 Ga0105250_100113573 296
852 3300009092 Ga0105250_10028362 Ga0105250_100283621 296
853 3300009148 Ga0105243_10006873 Ga0105243_100068735 296
854 3300012498 Ga0157345_1000830 Ga0157345_10008302 296
855 3300013100 Ga0157373_10053819 Ga0157373_100538193 296
856 3300013100 Ga0157373_10275628 Ga0157373_102756281 296
857 3300013307 Ga0157372_10015655 Ga0157372_100156554 296
858 3300014497 Ga0182008_10016544 Ga0182008_100165442 296
859 3300014497 Ga0182008_10051554 Ga0182008_100515542 296
860 3300015261 Ga0182006_1024909 Ga0182006_10249092 296
861 3300015261 Ga0182006_1067837 Ga0182006_10678372 296
862 3300015262 Ga0182007_10026603 Ga0182007_100266032 296
863 3300015265 Ga0182005_1031348 Ga0182005_10313481 296
864 3300017792 Ga0163161_10008495 Ga0163161_100084954 296
865 3300025711 Ga0207696_1000031 Ga0207696_1000031203 296
866 3300025711 Ga0207696_1000105 Ga0207696_100010523 296
867 3300025711 Ga0207696_1007655 Ga0207696_10076554 296
868 3300025711 Ga0207696_1009850 Ga0207696_10098503 296
869 3300025728 Ga0207655_1000202 Ga0207655_100020272 296
870 3300025728 Ga0207655_1015150 Ga0207655_10151503 296
871 3300025728 Ga0207655_1024141 Ga0207655_10241413 296
872 3300025728 Ga0207655_1025649 Ga0207655_10256492 296
873 3300025735 Ga0207713_1004499 Ga0207713_10044997 296
874 3300025735 Ga0207713_1004911 Ga0207713_10049114 296
875 3300025735 Ga0207713_1008940 Ga0207713_10089402 296
876 3300025735 Ga0207713_1034653 Ga0207713_10346532 296
877 3300025735 Ga0207713_1035446 Ga0207713_10354461 296
878 3300025923 Ga0207681_10002088 Ga0207681_100020883 296
879 3300025933 Ga0207706_10004363 Ga0207706_100043633 296
880 3300025935 Ga0207709_10000071 Ga0207709_1000007153 296
881 3300027907 Ga0207428_10078145 Ga0207428_100781453 296
882 3300027907 Ga0207428_10110020 Ga0207428_101100202 296
883 3300027907 Ga0207428_10130116 Ga0207428_101301162 296
884 3300031730 Ga0307516_10148373 Ga0307516_101483731 296
885 3300032002 Ga0307416_100219098 Ga0307416_1002190982 296
886 3300041405 Ga0439438_009930 Ga0439438_009930_563_1480 296
887 3300041405 Ga0439438_011906 Ga0439438_011906_388_1305 296
888 3300041405 Ga0439438_012356 Ga0439438_012356_1460_2377 296
889 3300041405 Ga0439438_025183 Ga0439438_025183_651_1568 296
890 3300041407 Ga0439447_001339 Ga0439447_001339_3639_4556 296
891 3300041407 Ga0439447_003195 Ga0439447_003195_4147_5064 296
892 3300041407 Ga0439447_010086 Ga0439447_010086_1484_2401 296
893 3300041407 Ga0439447_010369 Ga0439447_010369_1528_2445 296
894 3300041407 Ga0439447_019804 Ga0439447_019804_622_1539 296
895 3300041407 Ga0439447_022891 Ga0439447_022891_496_1413 296
896 3300041411 Ga0439466_0003842 Ga0439466_0003842_4455_5372 296
897 3300041411 Ga0439466_0011563 Ga0439466_0011563_605_1522 296
898 3300041411 Ga0439466_0019483 Ga0439466_0019483_490_1407 296
899 3300041411 Ga0439466_0030038 Ga0439466_0030038_475_1392 296
900 3300041413 Ga0439465_0008277 Ga0439465_0008277_1698_2615 296
901 3300042006 Ga0439432_002579 Ga0439432_002579_4373_5290 296
902 3300042006 Ga0439432_011855 Ga0439432_011855_616_1533 296
903 3300042006 Ga0439432_014816 Ga0439432_014816_1281_2198 296
904 3300042006 Ga0439432_039379 Ga0439432_039379_404_1321 296
905 3300042009 Ga0439451_007318 Ga0439451_007318_400_1317 296
906 3300042010 Ga0439452_001636 Ga0439452_001636_3648_4565 296
907 3300042010 Ga0439452_004618 Ga0439452_004618_3623_4540 296
908 3300042010 Ga0439452_007904 Ga0439452_007904_1508_2425 296
909 3300042010 Ga0439452_011312 Ga0439452_011312_384_1301 296
910 3300042013 Ga0439456_001369 Ga0439456_001369_3651_4568 296
911 3300042013 Ga0439456_023275 Ga0439456_023275_199_1116 296
912 3300042115 Ga0450911_001540 Ga0450911_001540_3948_4865 296
913 3300042115 Ga0450911_002657 Ga0450911_002657_1501_2418 296
914 3300042115 Ga0450911_006569 Ga0450911_006569_97_1014 296
915 3300042121 Ga0450919_002332 Ga0450919_002332_577_1494 296
916 3300042121 Ga0450919_009349 Ga0450919_009349_108_1025 296
917 3300042124 Ga0450922_000335 Ga0450922_000335_1987_2904 296
918 3300042124 Ga0450922_000947 Ga0450922_000947_372_1289 296
919 3300042124 Ga0450922_001656 Ga0450922_001656_790_1707 296
920 3300042125 Ga0450923_000685 Ga0450923_000685_1535_2452 296
921 3300042127 Ga0450890_000839 Ga0450890_000839_1326_2243 296
922 3300042137 Ga0450902_024457 Ga0450902_024457_78_995 296
923 3300042138 Ga0450903_001776 Ga0450903_001776_1441_2358 296
924 3300042138 Ga0450903_005153 Ga0450903_005153_619_1536 296
925 3300042142 Ga0450905_015974 Ga0450905_015974_95_1012 296
926 3300042145 Ga0450906_001083 Ga0450906_001083_4354_5271 296
927 3300042146 Ga0450907_000570 Ga0450907_000570_4690_5607 296
928 3300042146 Ga0450907_001019 Ga0450907_001019_3428_4345 296
929 3300042146 Ga0450907_001083 Ga0450907_001083_4163_5080 296
930 3300042156 Ga0439446_0005912 Ga0439446_0005912_2143_3060 296
931 3300042184 Ga0450908_004786 Ga0450908_004786_1280_2197 296
932 3300042185 Ga0450909_007627 Ga0450909_007627_592_1509 296
933 3300042435 Ga0439434_0002134 Ga0439434_0002134_2406_3323 296
934 3300042435 Ga0439434_0015350 Ga0439434_0015350_667_1584 296
935 3300042439 Ga0439464_0014780 Ga0439464_0014780_780_1697 296
936 3300042531 Ga0450918_008906 Ga0450918_008906_39_956 296
937 3300042532 Ga0450893_0008849 Ga0450893_0008849_111_1028 296
938 3300042532 Ga0450893_0013314 Ga0450893_0013314_94_1011 296
939 3300042993 Ga0439440_0001997 Ga0439440_0001997_1725_2642 296
940 3300042993 Ga0439440_0008496 Ga0439440_0008496_369_1286 296
941 3300046452 Ga0495617_001915 Ga0495617_001915_3522_4439 296
942 3300046452 Ga0495617_010344 Ga0495617_010344_2105_3022 296
943 3300046452 Ga0495617_010677 Ga0495617_010677_171_1088 296
944 3300046452 Ga0495617_012058 Ga0495617_012058_1422_2339 296
945 3300046453 Ga0495627_009174 Ga0495627_009174_740_1657 296
946 3300046455 Ga0495603_0006004 Ga0495603_0006004_2050_2967 296
947 3300046455 Ga0495603_0150634 Ga0495603_0150634_306_1223 296
948 3300046457 Ga0495590_0003127 Ga0495590_0003127_4279_5196 296
949 3300046457 Ga0495590_0003352 Ga0495590_0003352_1877_2794 296
950 3300046457 Ga0495590_0012587 Ga0495590_0012587_2176_3093 296
951 3300046458 Ga0495591_003153 Ga0495591_003153_4162_5079 296
952 3300046458 Ga0495591_010128 Ga0495591_010128_925_1842 296
953 3300046458 Ga0495591_011182 Ga0495591_011182_1239_2162 296
954 3300046458 Ga0495591_015045 Ga0495591_015045_1763_2680 296
955 3300046458 Ga0495591_017673 Ga0495591_017673_114_1031 296
956 3300046458 Ga0495591_034663 Ga0495591_034663_154_1071 296
957 3300046460 Ga0495638_0009475 Ga0495638_0009475_2184_3101 296
958 3300046460 Ga0495638_0011832 Ga0495638_0011832_3905_4822 296
959 3300046460 Ga0495638_0013267 Ga0495638_0013267_1372_2289 296
960 3300046460 Ga0495638_0030199 Ga0495638_0030199_1821_2738 296
961 3300046460 Ga0495638_0082025 Ga0495638_0082025_81_998 296
962 3300046460 Ga0495638_0133599 Ga0495638_0133599_521_1438 296
963 3300046460 Ga0495638_0136825 Ga0495638_0136825_203_1120 296
964 3300046460 Ga0495638_0142404 Ga0495638_0142404_129_1046 296
965 3300046463 Ga0495653_0023527 Ga0495653_0023527_4018_4935 296
966 3300046463 Ga0495653_0059618 Ga0495653_0059618_1265_2182 296
967 3300046463 Ga0495653_0078471 Ga0495653_0078471_645_1562 296
968 3300046471 Ga0495650_0005232 Ga0495650_0005232_3434_4351 296
969 3300046471 Ga0495650_0011643 Ga0495650_0011643_2531_3448 296
970 3300046471 Ga0495650_0025554 Ga0495650_0025554_1809_2726 296
971 3300046474 Ga0495605_0006443 Ga0495605_0006443_3928_4845 296
972 3300046474 Ga0495605_0012694 Ga0495605_0012694_3010_3927 296
973 3300046491 Ga0495584_0004951 Ga0495584_0004951_1649_2566 296
974 3300046491 Ga0495584_0005944 Ga0495584_0005944_3324_4241 296
975 3300046491 Ga0495584_0010791 Ga0495584_0010791_3337_4254 296
976 3300046491 Ga0495584_0015709 Ga0495584_0015709_1251_2168 296
977 3300046491 Ga0495584_0022255 Ga0495584_0022255_676_1593 296
978 3300046491 Ga0495584_0025400 Ga0495584_0025400_528_1445 296
979 3300046491 Ga0495584_0029537 Ga0495584_0029537_507_1424 296
980 3300046491 Ga0495584_0140869 Ga0495584_0140869_90_1007 296
981 3300046492 Ga0495585_0004323 Ga0495585_0004323_4116_5033 296
982 3300046492 Ga0495585_0018674 Ga0495585_0018674_2589_3506 296
983 3300046492 Ga0495585_0047495 Ga0495585_0047495_692_1609 296
984 3300046492 Ga0495585_0126273 Ga0495585_0126273_254_1171 296
985 3300046499 Ga0495594_0035849 Ga0495594_0035849_1744_2661 296
986 3300046500 Ga0495596_0003041 Ga0495596_0003041_4157_5074 296
987 3300046501 Ga0495607_0001950 Ga0495607_0001950_1482_2399 296
988 3300046501 Ga0495607_0004818 Ga0495607_0004818_4389_5306 296
989 3300046501 Ga0495607_0019378 Ga0495607_0019378_1229_2146 296
990 3300046501 Ga0495607_0036325 Ga0495607_0036325_1668_2585 296
991 3300046501 Ga0495607_0041502 Ga0495607_0041502_1171_2088 296
992 3300046501 Ga0495607_0045042 Ga0495607_0045042_99_1016 296
993 3300046501 Ga0495607_0055040 Ga0495607_0055040_160_1077 296
994 3300046501 Ga0495607_0068849 Ga0495607_0068849_475_1392 296
995 3300046501 Ga0495607_0091741 Ga0495607_0091741_314_1231 296
996 3300046506 Ga0495583_0012824 Ga0495583_0012824_1625_2548 296
997 3300046507 Ga0495606_0012126 Ga0495606_0012126_3895_4812 296
998 3300046507 Ga0495606_0025644 Ga0495606_0025644_686_1603 296
999 3300046507 Ga0495606_0075522 Ga0495606_0075522_498_1415 296
1000 3300046512 Ga0495610_0014034 Ga0495610_0014034_2040_2957 296
1001 3300046512 Ga0495610_0020948 Ga0495610_0020948_490_1407 296
1002 3300046512 Ga0495610_0021050 Ga0495610_0021050_480_1397 296
1003 3300046512 Ga0495610_0021782 Ga0495610_0021782_2084_3007 296
1004 3300046512 Ga0495610_0024368 Ga0495610_0024368_557_1474 296
1005 3300046513 Ga0495616_0009098 Ga0495616_0009098_3666_4583 296
1006 3300046513 Ga0495616_0010805 Ga0495616_0010805_2733_3650 296
1007 3300046513 Ga0495616_0017441 Ga0495616_0017441_1752_2669 296
1008 3300046513 Ga0495616_0019496 Ga0495616_0019496_2586_3503 296
1009 3300046513 Ga0495616_0019634 Ga0495616_0019634_1163_2080 296
1010 3300046513 Ga0495616_0035616 Ga0495616_0035616_157_1074 296
1011 3300046513 Ga0495616_0037504 Ga0495616_0037504_1389_2306 296
1012 3300046515 Ga0495620_0003664 Ga0495620_0003664_4194_5111 296
1013 3300046515 Ga0495620_0006093 Ga0495620_0006093_3891_4808 296
1014 3300046515 Ga0495620_0019325 Ga0495620_0019325_2020_2937 296
1015 3300046517 Ga0495630_0060005 Ga0495630_0060005_400_1317 296
1016 3300046518 Ga0495631_0000782 Ga0495631_0000782_4122_5039 296
1017 3300046518 Ga0495631_0018453 Ga0495631_0018453_586_1503 296
1018 3300046519 Ga0495632_0007720 Ga0495632_0007720_1195_2112 296
1019 3300046519 Ga0495632_0012683 Ga0495632_0012683_2277_3194 296
1020 3300046519 Ga0495632_0018672 Ga0495632_0018672_2317_3234 296
1021 3300046519 Ga0495632_0021560 Ga0495632_0021560_226_1143 296
1022 3300046519 Ga0495632_0026402 Ga0495632_0026402_1764_2681 296
1023 3300046519 Ga0495632_0045272 Ga0495632_0045272_852_1769 296
1024 3300046519 Ga0495632_0061990 Ga0495632_0061990_603_1520 296
1025 3300046520 Ga0495637_0003367 Ga0495637_0003367_4157_5074 296
1026 3300046520 Ga0495637_0003640 Ga0495637_0003640_3910_4827 296
1027 3300046520 Ga0495637_0007795 Ga0495637_0007795_3592_4509 296
1028 3300046520 Ga0495637_0021232 Ga0495637_0021232_1671_2588 296
1029 3300046520 Ga0495637_0026416 Ga0495637_0026416_618_1535 296
1030 3300046520 Ga0495637_0027219 Ga0495637_0027219_1273_2190 296
1031 3300046523 Ga0495644_0005333 Ga0495644_0005333_1973_2890 296
1032 3300046523 Ga0495644_0006587 Ga0495644_0006587_3103_4020 296
1033 3300046524 Ga0495648_0008560 Ga0495648_0008560_3654_4571 296
1034 3300046524 Ga0495648_0010142 Ga0495648_0010142_2355_3272 296
1035 3300046524 Ga0495648_0052510 Ga0495648_0052510_1418_2335 296
1036 3300046524 Ga0495648_0086519 Ga0495648_0086519_606_1523 296
1037 3300046526 Ga0495666_0011691 Ga0495666_0011691_2668_3585 296
1038 3300046526 Ga0495666_0023360 Ga0495666_0023360_1249_2166 296
1039 3300046526 Ga0495666_0023961 Ga0495666_0023961_1617_2534 296
1040 3300046528 Ga0495642_0002921 Ga0495642_0002921_3919_4836 296
1041 3300046528 Ga0495642_0007182 Ga0495642_0007182_1161_2078 296
1042 3300046528 Ga0495642_0008299 Ga0495642_0008299_1912_2829 296
1043 3300046530 Ga0495654_0008657 Ga0495654_0008657_2917_3834 296
1044 3300046530 Ga0495654_0012450 Ga0495654_0012450_1544_2461 296
1045 3300046530 Ga0495654_0029012 Ga0495654_0029012_930_1847 296
1046 3300046530 Ga0495654_0029349 Ga0495654_0029349_700_1623 296
1047 3300046530 Ga0495654_0064096 Ga0495654_0064096_731_1648 296
1048 3300046530 Ga0495654_0066380 Ga0495654_0066380_329_1246 296
1049 3300046536 Ga0495587_0020180 Ga0495587_0020180_1028_1945 296
1050 3300046538 Ga0495609_0031441 Ga0495609_0031441_65_982 296
1051 3300046538 Ga0495609_0033112 Ga0495609_0033112_1365_2282 296
1052 3300046542 Ga0495597_0008012 Ga0495597_0008012_715_1632 296
1053 3300046542 Ga0495597_0018848 Ga0495597_0018848_653_1570 296
1054 3300046542 Ga0495597_0019929 Ga0495597_0019929_566_1483 296
1055 3300046542 Ga0495597_0028751 Ga0495597_0028751_1266_2183 296
1056 3300046542 Ga0495597_0030084 Ga0495597_0030084_99_1016 296
1057 3300046542 Ga0495597_0040217 Ga0495597_0040217_73_990 296
1058 3300046557 Ga0495622_0071131 Ga0495622_0071131_518_1441 296
1059 3300046558 Ga0495633_0006730 Ga0495633_0006730_1670_2587 296
1060 3300046558 Ga0495633_0025605 Ga0495633_0025605_1578_2495 296
1061 3300046616 Ga0495668_0005611 Ga0495668_0005611_3359_4276 296
1062 3300046616 Ga0495668_0026738 Ga0495668_0026738_1879_2796 296
1063 3300046616 Ga0495668_0027226 Ga0495668_0027226_556_1473 296
1064 3300046648 Ga0495611_0012912 Ga0495611_0012912_1315_2232 296
1065 3300046648 Ga0495611_0026950 Ga0495611_0026950_323_1240 296
1066 3300046660 Ga0495625_0023608 Ga0495625_0023608_1996_2913 296
1067 3300046660 Ga0495625_0053777 Ga0495625_0053777_1862_2779 296
1068 3300046660 Ga0495625_0059405 Ga0495625_0059405_466_1383 296
1069 3300046660 Ga0495625_0081652 Ga0495625_0081652_101_1018 296
1070 3300046663 Ga0495635_0039955 Ga0495635_0039955_574_1491 296
1071 3300046664 Ga0495659_0003711 Ga0495659_0003711_1825_2742 296
1072 3300046664 Ga0495659_0035213 Ga0495659_0035213_804_1721 296
1073 3300046665 Ga0495661_0036520 Ga0495661_0036520_729_1646 296
1074 3300046665 Ga0495661_0037117 Ga0495661_0037117_812_1729 296
1075 3300046674 Ga0495588_0135172 Ga0495588_0135172_248_1171 296
1076 3300046675 Ga0495657_0084706 Ga0495657_0084706_432_1349 296
1077 3300046679 Ga0495623_0006490 Ga0495623_0006490_3422_4339 296
1078 3300046680 Ga0495646_0022041 Ga0495646_0022041_2076_2993 296
1079 3300046689 Ga0495613_0055279 Ga0495613_0055279_547_1464 296
1080 3300046690 Ga0495624_0006003 Ga0495624_0006003_3718_4635 296
1081 3300046691 Ga0495670_0006430 Ga0495670_0006430_4124_5041 296
1082 3300046691 Ga0495670_0015189 Ga0495670_0015189_1602_2519 296
1083 3300046691 Ga0495670_0055689 Ga0495670_0055689_599_1516 296
1084 3300046691 Ga0495670_0249360 Ga0495670_0249360_19_936 296
1085 3300046692 Ga0495671_0004458 Ga0495671_0004458_3424_4341 296
1086 3300046692 Ga0495671_0010292 Ga0495671_0010292_3470_4387 296
1087 3300046692 Ga0495671_0020410 Ga0495671_0020410_2233_3150 296
1088 3300046692 Ga0495671_0029279 Ga0495671_0029279_1100_2017 296
1089 3300046692 Ga0495671_0043609 Ga0495671_0043609_114_1037 296
1090 3300046692 Ga0495671_0071259 Ga0495671_0071259_59_976 296
1091 3300046692 Ga0495671_0081140 Ga0495671_0081140_393_1310 296
1092 3300046694 Ga0495649_0009968 Ga0495649_0009968_3484_4401 296
1093 3300046694 Ga0495649_0022482 Ga0495649_0022482_1374_2291 296
1094 3300046694 Ga0495649_0037053 Ga0495649_0037053_1678_2595 296
1095 3300046694 Ga0495649_0038218 Ga0495649_0038218_562_1479 296
1096 3300046694 Ga0495649_0043087 Ga0495649_0043087_1399_2316 296
1097 3300046694 Ga0495649_0068080 Ga0495649_0068080_375_1292 296
1098 3300046694 Ga0495649_0071523 Ga0495649_0071523_253_1170 296
1099 3300046694 Ga0495649_0113940 Ga0495649_0113940_97_1014 296
1100 3300046694 Ga0495649_0117054 Ga0495649_0117054_271_1188 296
1101 3300046794 Ga0495589_0004669 Ga0495589_0004669_4376_5293 296
1102 3300046794 Ga0495589_0029137 Ga0495589_0029137_1505_2422 296
1103 3300046794 Ga0495589_0033781 Ga0495589_0033781_322_1239 296
1104 3300046794 Ga0495589_0092582 Ga0495589_0092582_134_1051 296
1105 3300046794 Ga0495589_0100803 Ga0495589_0100803_78_995 296
1106 3300046809 Ga0495600_0053710 Ga0495600_0053710_1234_2151 296
1107 3300046810 Ga0495660_0013816 Ga0495660_0013816_14_931 296
1108 3300046810 Ga0495660_0025416 Ga0495660_0025416_402_1319 296
1109 3300046810 Ga0495660_0026036 Ga0495660_0026036_279_1196 296
1110 3300046810 Ga0495660_0028870 Ga0495660_0028870_977_1894 296
1111 3300046810 Ga0495660_0040239 Ga0495660_0040239_28_945 296
1112 3300047317 Ga0495604_0011519 Ga0495604_0011519_1796_2713 296
1113 3300047317 Ga0495604_0042466 Ga0495604_0042466_1451_2371 296
1114 3300047318 Ga0495636_0001835 Ga0495636_0001835_2800_3717 296
1115 3300047320 Ga0495672_0008442 Ga0495672_0008442_2804_3721 296
1116 3300047320 Ga0495672_0010128 Ga0495672_0010128_3467_4384 296
1117 3300047320 Ga0495672_0011167 Ga0495672_0011167_1365_2282 296
1118 3300047320 Ga0495672_0031188 Ga0495672_0031188_1493_2410 296
1119 3300047320 Ga0495672_0034094 Ga0495672_0034094_122_1039 296
1120 3300047320 Ga0495672_0037737 Ga0495672_0037737_1864_2781 296
1121 3300047320 Ga0495672_0044315 Ga0495672_0044315_1484_2401 296
1122 3300047321 Ga0495676_0025893 Ga0495676_0025893_712_1629 296
1123 3300047321 Ga0495676_0052914 Ga0495676_0052914_67_984 296
1124 3300047322 Ga0495680_0021393 Ga0495680_0021393_4000_4917 296
1125 3300047322 Ga0495680_0022051 Ga0495680_0022051_1826_2743 296
1126 3300047322 Ga0495680_0041037 Ga0495680_0041037_1529_2446 296
1127 3300047323 Ga0495683_0006289 Ga0495683_0006289_3698_4615 296
1128 3300047323 Ga0495683_0016417 Ga0495683_0016417_2185_3102 296
1129 3300047323 Ga0495683_0025315 Ga0495683_0025315_1885_2802 296
1130 3300047323 Ga0495683_0026077 Ga0495683_0026077_1640_2557 296
1131 3300047443 Ga0495687_011443 Ga0495687_011443_384_1301 296
1132 3300047446 Ga0495679_036874 Ga0495679_036874_467_1387 296
1133 3300047469 Ga0495673_0005580 Ga0495673_0005580_3297_4214 296
1134 3300047469 Ga0495673_0006685 Ga0495673_0006685_1939_2856 296
1135 3300047469 Ga0495673_0017520 Ga0495673_0017520_702_1619 296
1136 3300047469 Ga0495673_0019801 Ga0495673_0019801_1244_2161 296
1137 3300047469 Ga0495673_0021537 Ga0495673_0021537_1012_1929 296
1138 3300047469 Ga0495673_0024993 Ga0495673_0024993_1099_2016 296
1139 3300047469 Ga0495673_0028164 Ga0495673_0028164_1225_2148 296
1140 3300047469 Ga0495673_0031106 Ga0495673_0031106_170_1087 296
1141 3300047469 Ga0495673_0033019 Ga0495673_0033019_411_1328 296
1142 3300047470 Ga0495681_0004211 Ga0495681_0004211_7478_8395 296
1143 3300047470 Ga0495681_0006190 Ga0495681_0006190_2231_3148 296
1144 3300047470 Ga0495681_0008909 Ga0495681_0008909_3616_4533 296
1145 3300047470 Ga0495681_0015296 Ga0495681_0015296_2318_3235 296
1146 3300047470 Ga0495681_0019493 Ga0495681_0019493_1207_2124 296
1147 3300047470 Ga0495681_0020098 Ga0495681_0020098_1005_1922 296
1148 3300047470 Ga0495681_0021907 Ga0495681_0021907_526_1443 296
1149 3300047470 Ga0495681_0043100 Ga0495681_0043100_332_1249 296
1150 3300047470 Ga0495681_0067886 Ga0495681_0067886_74_991 296
1151 3300047471 Ga0495684_0050609 Ga0495684_0050609_1419_2339 296
1152 3300047472 Ga0495686_0012839 Ga0495686_0012839_2230_3147 296
1153 3300047472 Ga0495686_0025248 Ga0495686_0025248_1546_2463 296
1154 3300047472 Ga0495686_0039999 Ga0495686_0039999_602_1519 296
1155 3300047472 Ga0495686_0058786 Ga0495686_0058786_334_1251 296
1156 3300047673 Ga0495593_0028342 Ga0495593_0028342_1136_2053 296
1157 3300047673 Ga0495593_0037175 Ga0495593_0037175_1447_2367 296
1158 3300047673 Ga0495593_0071428 Ga0495593_0071428_638_1555 296
1159 3300048088 Ga0495602_0013655 Ga0495602_0013655_3679_4596 296
1160 3300048091 Ga0495626_0004559 Ga0495626_0004559_3345_4262 296
1161 3300048091 Ga0495626_0010576 Ga0495626_0010576_256_1179 296
1162 3300048091 Ga0495626_0012862 Ga0495626_0012862_2257_3174 296
1163 3300048905 Ga0496102_0014431 Ga0496102_0014431_1795_2712 296
1164 3300048906 Ga0496103_0046247 Ga0496103_0046247_1726_2643 296
1165 3300048908 Ga0496105_0234156 Ga0496105_0234156_287_1204 296
1166 3300048913 Ga0496110_0199219 Ga0496110_0199219_412_1329 296
1167 3300048913 Ga0496110_0217912 Ga0496110_0217912_41_958 296
1168 3300048919 Ga0496116_0020968 Ga0496116_0020968_3637_4554 296
1169 3300048919 Ga0496116_0044487 Ga0496116_0044487_490_1407 296
1170 3300048919 Ga0496116_0059604 Ga0496116_0059604_1475_2392 296
1171 3300048920 Ga0496117_0040183 Ga0496117_0040183_2020_2937 296
1172 3300048920 Ga0496117_0059359 Ga0496117_0059359_1394_2311 296
1173 3300048920 Ga0496117_0064470 Ga0496117_0064470_42_959 296
1174 3300048921 Ga0496118_0047760 Ga0496118_0047760_2069_2986 296
1175 3300048921 Ga0496118_0054080 Ga0496118_0054080_389_1306 296
1176 3300048922 Ga0496119_0067006 Ga0496119_0067006_94_1011 296
1177 3300048923 Ga0496120_0076964 Ga0496120_0076964_468_1385 296
1178 3300048924 Ga0496121_0062081 Ga0496121_0062081_1762_2679 296
1179 3300048924 Ga0496121_0067227 Ga0496121_0067227_335_1252 296
1180 3300048925 Ga0496122_0048270 Ga0496122_0048270_186_1103 296
1181 3300048926 Ga0496123_0067584 Ga0496123_0067584_1297_2214 296
1182 3300048927 Ga0496124_0011574 Ga0496124_0011574_4271_5188 296
1183 3300048927 Ga0496124_0153816 Ga0496124_0153816_779_1696 296
1184 3300048927 Ga0496124_0284060 Ga0496124_0284060_192_1109 296
1185 3300048928 Ga0496125_0059459 Ga0496125_0059459_1773_2690 296
1186 3300048928 Ga0496125_0062043 Ga0496125_0062043_412_1329 296
1187 3300048929 Ga0496126_0103250 Ga0496126_0103250_1495_2412 296
1188 3300049459 Ga0495678_005937 Ga0495678_005937_4489_5406 296
1189 3300049459 Ga0495678_009609 Ga0495678_009609_546_1463 296
1190 3300049459 Ga0495678_054261 Ga0495678_054261_369_1286 296
1191 3300049459 Ga0495678_091828 Ga0495678_091828_73_990 296
1192 3300049460 Ga0495682_0013699 Ga0495682_0013699_523_1440 296
1193 3300049460 Ga0495682_0096787 Ga0495682_0096787_104_1021 296
1194 3300050491 nmdc:mga00v17_22823_c1 nmdc:mga00v17_22823_c1_1835_2752 296
1195 3300053111 Ga0500572_002411 Ga0500572_002411_210_1127 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06977

SdiA-regulated

SdiA-regulated

63

315

0.98

PF13449

Phytase-like

Esterase-like activity of phytase

86

204

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qqz-assembly1.cif.gz_A crystal structure of the c-terminal domain of the yjik protein from escherichia coli cft073 0.9191 43 288
3qqz-assembly1.cif.gz_A crystal structure of the c-terminal domain of the yjik protein from escherichia coli cft073 0.9118 43 288
2ylz-assembly1.cif.gz_A-2 snapshots of enzymatic baeyer-villiger catalysis: oxygen activation and intermediate stabilization: met446gly mutant 0.8498 62 86
4c77-assembly1.cif.gz_A phenylacetone monooxygenase: oxidised r337k mutant in complex with apadp 0.8026 62 86
5v36-assembly1.cif.gz_A 1.88 angstrom resolution crystal structure of glutathione reductase from streptococcus mutans ua159 in complex with fad 0.797 259 287
ID Description Score Start End Superfamily
af_P39382_36_281_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9321 47 288 2.120.10.30
af_P39382_36_281_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8988 47 288 2.120.10.30
af_A0A1D6KXL6_69_164_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8205 213 291 2.40.10.480
af_D3ZQG6_660_743_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8125 207 288 2.40.10.500
af_Q03601_890_974_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8026 207 287 2.40.10.500
ID Description Score Start End GO Terms
AF-A0A659PWZ3-F1-model_v4 Uncharacterized protein 0.9822 210 292 GO:0005886
AF-A0A379XWD9-F1-model_v4 Inner membrane protein 0.9788 210 293 GO:0005886
AF-A0A6N8MWV3-F1-model_v4 deleted 0.9709 223 293
AF-A0A352E5W3-F1-model_v4 deleted 0.9705 48 290
AF-A0A2L1KH01-F1-model_v4 Outer membrane protein assembly factor YaeT 0.9692 211 292 GO:0005886

Feature Viewer

pLDDT pTM Quality
85.99 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map