F491302

General Info

Members Datasets Scaffolds Average Seq Length
1181 223 2362 110

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10703083|Ga0070658_107030832
Length 124
Sequence MDPGLPDDLLGASAVNSERIRDGFMPWAGLALGTAGFFLAHQVGSDATFQDCRVGSPWIVVLGTIAALAILGVGALGSWRVYAARSESPARRLVAVVGLLASALYAIAVLLPLIAALVIPRCWA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
222 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.32
Rhizosphere 95.34
Stem 0
Stem Tuber 0
Unclassified 30.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10703083 3300005327 Bacteria 877
2 JGI24741J21665_1013054 3300001915 Unclassified 1416
3 JGI24741J21665_1013905 3300001915 Bacteria 1354
4 JGI24740J21852_10005282 3300001979 Bacteria 5482
5 JGI24740J21852_10013970 3300001979 Bacteria 2976
6 JGI24740J21852_10092168 3300001979 Unclassified 780
7 JGI24739J22299_10075012 3300001989 Unclassified 1046
8 JGI24737J22298_10034707 3300001990 Bacteria 1563
9 JGI24737J22298_10079916 3300001990 Bacteria 973
10 JGI24737J22298_10132646 3300001990 Unclassified 736
11 JGI24743J22301_10117069 3300001991 Unclassified 582
12 JGI24735J21928_10007520 3300002067 Bacteria 3551
13 JGI24735J21928_10028683 3300002067 Unclassified 1661
14 JGI24735J21928_10070409 3300002067 Unclassified 1002
15 JGI24735J21928_10116996 3300002067 Unclassified 767
16 Ga0065715_10613413 3300005293 Unclassified 697
17 Ga0070658_10044445 3300005327 Bacteria 3590
18 Ga0070658_10053063 3300005327 Bacteria 3290
19 Ga0070658_10053578 3300005327 Bacteria 3275
20 Ga0070658_10054865 3300005327 Bacteria 3236
21 Ga0070658_10057219 3300005327 Bacteria 3171
22 Ga0070658_10111756 3300005327 Bacteria 2264
23 Ga0070658_10122773 3300005327 Bacteria 2159
24 Ga0070658_10256321 3300005327 Bacteria 1485
25 Ga0070658_10319640 3300005327 Unclassified 1325
26 Ga0070658_10462893 3300005327 Unclassified 1093
27 Ga0070658_10531702 3300005327 Bacteria 1017
28 Ga0070658_10568609 3300005327 Bacteria 981
29 Ga0070658_11103387 3300005327 Unclassified 690
30 Ga0070658_11427983 3300005327 Unclassified 600
31 Ga0070658_11864039 3300005327 Bacteria 520
32 Ga0070676_10183091 3300005328 Unclassified 1363
33 Ga0070676_10343579 3300005328 Unclassified 1024
34 Ga0070676_11091485 3300005328 Unclassified 603
35 Ga0070683_100029289 3300005329 Bacteria 4982
36 Ga0070683_100045842 3300005329 Bacteria 4036
37 Ga0070683_100058939 3300005329 Bacteria 3567
38 Ga0070683_100379440 3300005329 Unclassified 1347
39 Ga0070683_100600962 3300005329 Unclassified 1053
40 Ga0070683_100950791 3300005329 Unclassified 825
41 Ga0070683_101245746 3300005329 Bacteria 715
42 Ga0070690_100094095 3300005330 Unclassified 1977
43 Ga0070690_100608733 3300005330 Bacteria 830
44 Ga0070670_100117488 3300005331 Bacteria 2294
45 Ga0070670_100246923 3300005331 Bacteria 1554
46 Ga0070670_100375951 3300005331 Bacteria 1251
47 Ga0070670_100452663 3300005331 Bacteria 1138
48 Ga0070670_100580798 3300005331 Unclassified 1001
49 Ga0068869_100025190 3300005334 Bacteria 4128
50 Ga0070666_10093190 3300005335 Bacteria 2071
51 Ga0070666_10122898 3300005335 Unclassified 1801
52 Ga0070666_10148139 3300005335 Bacteria 1637
53 Ga0070666_10157990 3300005335 Unclassified 1584
54 Ga0070666_10202545 3300005335 Bacteria 1396
55 Ga0070666_10219746 3300005335 Unclassified 1340
56 Ga0070666_10264286 3300005335 Bacteria 1220
57 Ga0070666_10456883 3300005335 Unclassified 923
58 Ga0070666_10687962 3300005335 Unclassified 749
59 Ga0070680_100002569 3300005336 Bacteria 13424
60 Ga0070680_100015719 3300005336 Bacteria 5941
61 Ga0070680_100039119 3300005336 Bacteria 3838
62 Ga0070680_100200313 3300005336 Bacteria 1684
63 Ga0070680_100213638 3300005336 Bacteria 1628
64 Ga0070680_100467730 3300005336 Bacteria 1077
65 Ga0070680_100602432 3300005336 Bacteria 943
66 Ga0070680_101467877 3300005336 Bacteria 591
67 Ga0070682_100004425 3300005337 Bacteria 7798
68 Ga0070682_100048175 3300005337 Plasmid 2653
69 Ga0070682_100098513 3300005337 Bacteria 1926
70 Ga0070682_100117185 3300005337 Bacteria 1783
71 Ga0070682_100198133 3300005337 Bacteria 1415
72 Ga0070682_100215729 3300005337 Bacteria 1363
73 Ga0068868_100044286 3300005338 Bacteria 3479
74 Ga0068868_100113064 3300005338 Unclassified 2207
75 Ga0068868_100173930 3300005338 Unclassified 1784
76 Ga0068868_100192637 3300005338 Unclassified 1696
77 Ga0068868_100620101 3300005338 Unclassified 960
78 Ga0068868_101035351 3300005338 Unclassified 752
79 Ga0068868_101058871 3300005338 Unclassified 744
80 Ga0070660_100006487 3300005339 Bacteria 8114
81 Ga0070660_100032890 3300005339 Bacteria 3906
82 Ga0070660_100074074 3300005339 Bacteria 2663
83 Ga0070660_100101460 3300005339 Unclassified 2280
84 Ga0070660_100112059 3300005339 Bacteria 2171
85 Ga0070660_100165120 3300005339 Bacteria 1786
86 Ga0070660_100187281 3300005339 Bacteria 1676
87 Ga0070660_100243431 3300005339 Bacteria 1465
88 Ga0070660_100261025 3300005339 Bacteria 1414
89 Ga0070660_100313994 3300005339 Bacteria 1286
90 Ga0070660_100505171 3300005339 Unclassified 1006
91 Ga0070660_101513646 3300005339 Bacteria 571
92 Ga0070691_10011078 3300005341 Bacteria 4118
93 Ga0070691_10066920 3300005341 Unclassified 1737
94 Ga0070687_101019564 3300005343 Unclassified 601
95 Ga0070661_100007181 3300005344 Bacteria 7675
96 Ga0070661_100028778 3300005344 Bacteria 4009
97 Ga0070661_100033991 3300005344 Bacteria 3696
98 Ga0070661_100055236 3300005344 Bacteria 2908
99 Ga0070661_100064870 3300005344 Bacteria 2684
100 Ga0070661_100105893 3300005344 Unclassified 2097
101 Ga0070661_100131711 3300005344 Bacteria 1879
102 Ga0070661_100146893 3300005344 Bacteria 1780
103 Ga0070661_100189640 3300005344 Bacteria 1567
104 Ga0070661_100258014 3300005344 Bacteria 1347
105 Ga0070661_100452478 3300005344 Bacteria 1022
106 Ga0070661_100709959 3300005344 Unclassified 820
107 Ga0070661_100882017 3300005344 Unclassified 738
108 Ga0070661_100904872 3300005344 Unclassified 728
109 Ga0070661_100997126 3300005344 Unclassified 695
110 Ga0070661_101030449 3300005344 Archaea 683
111 Ga0070661_101215251 3300005344 Bacteria 631
112 Ga0070661_101628213 3300005344 Unclassified 546
113 Ga0070661_101792556 3300005344 Archaea 521
114 Ga0070668_100060647 3300005347 Bacteria 2930
115 Ga0070668_100462556 3300005347 Unclassified 1092
116 Ga0070669_100708785 3300005353 Bacteria 850
117 Ga0070669_100815176 3300005353 Unclassified 794
118 Ga0070675_100647767 3300005354 Bacteria 960
119 Ga0070671_100011258 3300005355 Bacteria 7186
120 Ga0070671_100059181 3300005355 Bacteria 3188
121 Ga0070671_100064036 3300005355 Bacteria 3062
122 Ga0070671_100288882 3300005355 Bacteria 1395
123 Ga0070671_100508573 3300005355 Unclassified 1036
124 Ga0070671_100619478 3300005355 Unclassified 936
125 Ga0070671_100877970 3300005355 Unclassified 783
126 Ga0070671_101000620 3300005355 Unclassified 732
127 Ga0070674_100010556 3300005356 Bacteria 5589
128 Ga0070674_100032436 3300005356 Bacteria 3468
129 Ga0070673_100027334 3300005364 Bacteria 4228
130 Ga0070673_100041779 3300005364 Bacteria 3530
131 Ga0070673_100072672 3300005364 Bacteria 2767
132 Ga0070673_100116568 3300005364 Bacteria 2222
133 Ga0070673_100164522 3300005364 Unclassified 1889
134 Ga0070673_100652239 3300005364 Unclassified 963
135 Ga0070673_100696172 3300005364 Bacteria 933
136 Ga0070688_101188911 3300005365 Bacteria 612
137 Ga0070659_100006363 3300005366 Bacteria 8529
138 Ga0070659_100010221 3300005366 Bacteria 6903
139 Ga0070659_100024893 3300005366 Bacteria 4592
140 Ga0070659_100042573 3300005366 Bacteria 3551
141 Ga0070659_100066222 3300005366 Plasmid 2862
142 Ga0070659_100074050 3300005366 Bacteria 2712
143 Ga0070659_100084695 3300005366 Bacteria 2535
144 Ga0070659_100112215 3300005366 Bacteria 2201
145 Ga0070659_100261923 3300005366 Bacteria 1435
146 Ga0070659_100307863 3300005366 Bacteria 1322
147 Ga0070659_100426540 3300005366 Unclassified 1122
148 Ga0070659_100674506 3300005366 Bacteria 892
149 Ga0070659_100858653 3300005366 Unclassified 791
150 Ga0070659_101041550 3300005366 Unclassified 719
151 Ga0070659_101076667 3300005366 Unclassified 708
152 Ga0070659_101114139 3300005366 Unclassified 696
153 Ga0070659_101531635 3300005366 Bacteria 594
154 Ga0070659_101629066 3300005366 Archaea 576
155 Ga0070659_101874453 3300005366 Bacteria 537
156 Ga0070667_100044243 3300005367 Bacteria 3738
157 Ga0070667_100051887 3300005367 Bacteria 3458
158 Ga0070667_100069657 3300005367 Bacteria 2994
159 Ga0070667_100350481 3300005367 Bacteria 1336
160 Ga0070667_100452037 3300005367 Bacteria 1174
161 Ga0070667_100494620 3300005367 Bacteria 1121
162 Ga0070667_100679135 3300005367 Bacteria 952
163 Ga0070714_100024323 3300005435 Bacteria 4985
164 Ga0070714_100143336 3300005435 Unclassified 2147
165 Ga0070714_100144037 3300005435 Bacteria 2142
166 Ga0070714_100463166 3300005435 Bacteria 1205
167 Ga0070714_100510250 3300005435 Unclassified 1147
168 Ga0070713_100260760 3300005436 Unclassified 1584
169 Ga0070705_101571085 3300005440 Unclassified 553
170 Ga0070663_100015732 3300005455 Bacteria 4894
171 Ga0070663_100045193 3300005455 Unclassified 3110
172 Ga0070663_100060922 3300005455 Bacteria 2716
173 Ga0070663_100096432 3300005455 Bacteria 2200
174 Ga0070663_100102654 3300005455 Bacteria 2136
175 Ga0070663_100111806 3300005455 Bacteria 2053
176 Ga0070663_100326107 3300005455 Bacteria 1236
177 Ga0070663_100389685 3300005455 Bacteria 1136
178 Ga0070663_100484139 3300005455 Bacteria 1025
179 Ga0070663_100782232 3300005455 Unclassified 817
180 Ga0070663_100927740 3300005455 Bacteria 753
181 Ga0070663_101665935 3300005455 Unclassified 570
182 Ga0070678_100002540 3300005456 Bacteria 10011
183 Ga0070662_100192783 3300005457 Bacteria 1613
184 Ga0070662_100275212 3300005457 Unclassified 1360
185 Ga0070662_100314546 3300005457 Bacteria 1275
186 Ga0070662_100416892 3300005457 Bacteria 1110
187 Ga0070662_100430670 3300005457 Bacteria 1092
188 Ga0070662_100466532 3300005457 Unclassified 1050
189 Ga0070662_100741496 3300005457 Bacteria 833
190 Ga0070662_100794890 3300005457 Unclassified 804
191 Ga0070662_100883081 3300005457 Bacteria 762
192 Ga0070662_101283144 3300005457 Unclassified 630
193 Ga0070662_101330070 3300005457 Bacteria 618
194 Ga0070662_101693102 3300005457 Unclassified 546
195 Ga0070681_10037966 3300005458 Bacteria 4830
196 Ga0070681_10082750 3300005458 Bacteria 3164
197 Ga0070681_10215772 3300005458 Bacteria 1835
198 Ga0070681_10322623 3300005458 Bacteria 1454
199 Ga0070681_10756360 3300005458 Unclassified 888
200 Ga0070681_10803870 3300005458 Bacteria 857
201 Ga0070681_11634432 3300005458 Unclassified 570
202 Ga0070681_11724155 3300005458 Bacteria 553
203 Ga0068867_100160310 3300005459 Bacteria 1773
204 Ga0068867_100244989 3300005459 Unclassified 1455
205 Ga0070679_100024325 3300005530 Bacteria 5935
206 Ga0070679_100062927 3300005530 Bacteria 3699
207 Ga0070679_100101746 3300005530 Bacteria 2860
208 Ga0070679_100202668 3300005530 Bacteria 1949
209 Ga0070679_100354860 3300005530 Bacteria 1414
210 Ga0070679_100415344 3300005530 Bacteria 1291
211 Ga0070679_100467060 3300005530 Archaea 1206
212 Ga0070679_100649688 3300005530 Bacteria 997
213 Ga0070679_100868140 3300005530 Bacteria 846
214 Ga0070679_101049089 3300005530 Unclassified 759
215 Ga0070679_102056941 3300005530 Unclassified 520
216 Ga0070684_100015169 3300005535 Bacteria 6266
217 Ga0070684_100064491 3300005535 Bacteria 3213
218 Ga0070684_100132647 3300005535 Bacteria 2248
219 Ga0068853_100005874 3300005539 Bacteria 9676
220 Ga0068853_100072538 3300005539 Bacteria 3000
221 Ga0068853_100138604 3300005539 Bacteria 2183
222 Ga0068853_100147819 3300005539 Bacteria 2113
223 Ga0068853_100281037 3300005539 Bacteria 1535
224 Ga0068853_100297752 3300005539 Unclassified 1490
225 Ga0068853_101163072 3300005539 Bacteria 744
226 Ga0068853_101259346 3300005539 Unclassified 714
227 Ga0070672_100132691 3300005543 Bacteria 2048
228 Ga0070672_100198655 3300005543 Bacteria 1676
229 Ga0070672_100311615 3300005543 Unclassified 1336
230 Ga0070672_100543358 3300005543 Unclassified 1008
231 Ga0070672_101055494 3300005543 Unclassified 721
232 Ga0070672_101555225 3300005543 Bacteria 593
233 Ga0070686_100032012 3300005544 Bacteria 3222
234 Ga0070686_100239219 3300005544 Bacteria 1321
235 Ga0070693_100013503 3300005547 Bacteria 4160
236 Ga0070693_100159387 3300005547 Unclassified 1436
237 Ga0070693_100161822 3300005547 Bacteria 1426
238 Ga0070693_100879540 3300005547 Unclassified 670
239 Ga0070665_100068731 3300005548 Bacteria 3551
240 Ga0070665_100352916 3300005548 Unclassified 1476
241 Ga0070665_101080590 3300005548 Unclassified 814
242 Ga0070665_101114201 3300005548 Bacteria 801
243 Ga0070665_102562371 3300005548 Unclassified 511
244 Ga0068855_100016170 3300005563 Bacteria 8970
245 Ga0068855_100067954 3300005563 Bacteria 4150
246 Ga0068855_100070936 3300005563 Bacteria 4052
247 Ga0068855_100154291 3300005563 Bacteria 2610
248 Ga0068855_100177543 3300005563 Unclassified 2409
249 Ga0068855_100318811 3300005563 Bacteria 1719
250 Ga0068855_100336031 3300005563 Unclassified 1667
251 Ga0068855_100561663 3300005563 Bacteria 1234
252 Ga0068855_100692193 3300005563 Bacteria 1092
253 Ga0068855_100996529 3300005563 Unclassified 880
254 Ga0068855_101393724 3300005563 Unclassified 723
255 Ga0068855_101642438 3300005563 Unclassified 657
256 Ga0068855_102221293 3300005563 Bacteria 550
257 Ga0070664_100002497 3300005564 Bacteria 14828
258 Ga0070664_100006053 3300005564 Bacteria 9781
259 Ga0070664_100007222 3300005564 Bacteria 8962
260 Ga0070664_100011497 3300005564 Bacteria 7185
261 Ga0070664_100034680 3300005564 Bacteria 4233
262 Ga0070664_100042053 3300005564 Bacteria 3858
263 Ga0070664_100080596 3300005564 Bacteria 2804
264 Ga0070664_100128868 3300005564 Bacteria 2221
265 Ga0070664_100278858 3300005564 Unclassified 1507
266 Ga0070664_100432268 3300005564 Bacteria 1207
267 Ga0070664_101077126 3300005564 Bacteria 756
268 Ga0068857_100005219 3300005577 Bacteria 11060
269 Ga0068857_100039463 3300005577 Bacteria 4182
270 Ga0068857_100062940 3300005577 Bacteria 3298
271 Ga0068857_100069188 3300005577 Bacteria 3143
272 Ga0068857_100146000 3300005577 Unclassified 2140
273 Ga0068857_100209043 3300005577 Bacteria 1780
274 Ga0068857_100362340 3300005577 Unclassified 1344
275 Ga0068857_101245882 3300005577 Unclassified 721
276 Ga0068857_101250511 3300005577 Bacteria 720
277 Ga0068857_102066485 3300005577 Unclassified 559
278 Ga0068854_100002843 3300005578 Bacteria 10755
279 Ga0068854_100003443 3300005578 Bacteria 9872
280 Ga0068854_100003689 3300005578 Bacteria 9579
281 Ga0068854_100022982 3300005578 Bacteria 4255
282 Ga0068854_100030744 3300005578 Bacteria 3727
283 Ga0068854_100084722 3300005578 Bacteria 2346
284 Ga0068854_100096133 3300005578 Unclassified 2213
285 Ga0068854_100118208 3300005578 Bacteria 2008
286 Ga0068854_100206117 3300005578 Bacteria 1548
287 Ga0068854_100246574 3300005578 Unclassified 1424
288 Ga0068854_100317360 3300005578 Unclassified 1265
289 Ga0068854_100332637 3300005578 Unclassified 1238
290 Ga0068854_100401230 3300005578 Unclassified 1135
291 Ga0068854_100873732 3300005578 Unclassified 789
292 Ga0068854_101016404 3300005578 Bacteria 735
293 Ga0068854_101254831 3300005578 Unclassified 665
294 Ga0068856_100007468 3300005614 Bacteria 10672
295 Ga0068856_100011171 3300005614 Bacteria 8718
296 Ga0068856_100014417 3300005614 Bacteria 7638
297 Ga0068856_100042269 3300005614 Bacteria 4483
298 Ga0068856_100083925 3300005614 Bacteria 3164
299 Ga0068856_100203120 3300005614 Bacteria 1996
300 Ga0068856_100231574 3300005614 Bacteria 1863
301 Ga0068856_100327777 3300005614 Unclassified 1549
302 Ga0068856_100530870 3300005614 Bacteria 1198
303 Ga0068856_100558729 3300005614 Bacteria 1166
304 Ga0068856_101374944 3300005614 Bacteria 721
305 Ga0068856_101904071 3300005614 Bacteria 606
306 Ga0068856_102072020 3300005614 Bacteria 579
307 Ga0068856_102296425 3300005614 Bacteria 548
308 Ga0070702_100356863 3300005615 Unclassified 1032
309 Ga0068852_100003304 3300005616 Bacteria 11260
310 Ga0068852_100029164 3300005616 Bacteria 4528
311 Ga0068852_100041927 3300005616 Bacteria 3872
312 Ga0068852_100067480 3300005616 Bacteria 3127
313 Ga0068852_100068191 3300005616 Unclassified 3112
314 Ga0068852_100168894 3300005616 Bacteria 2049
315 Ga0068852_100207108 3300005616 Archaea 1859
316 Ga0068852_100280896 3300005616 Bacteria 1605
317 Ga0068852_100346786 3300005616 Unclassified 1449
318 Ga0068852_100403128 3300005616 Unclassified 1346
319 Ga0068852_100440078 3300005616 Unclassified 1289
320 Ga0068852_100542354 3300005616 Archaea 1163
321 Ga0068852_100689765 3300005616 Unclassified 1031
322 Ga0068852_100931439 3300005616 Unclassified 886
323 Ga0068852_100941305 3300005616 Bacteria 882
324 Ga0068852_100984433 3300005616 Unclassified 862
325 Ga0068852_101002063 3300005616 Bacteria 854
326 Ga0068852_101022175 3300005616 Bacteria 845
327 Ga0068852_101081866 3300005616 Unclassified 822
328 Ga0068852_101135550 3300005616 Bacteria 802
329 Ga0068852_101593068 3300005616 Unclassified 675
330 Ga0068859_100177785 3300005617 Bacteria 2210
331 Ga0068859_101318464 3300005617 Unclassified 796
332 Ga0068859_101763098 3300005617 Unclassified 684
333 Ga0068859_101908924 3300005617 Bacteria 656
334 Ga0068864_100001847 3300005618 Bacteria 17419
335 Ga0068864_100004870 3300005618 Bacteria 10991
336 Ga0068864_100357158 3300005618 Bacteria 1380
337 Ga0068866_10010145 3300005718 Bacteria 4027
338 Ga0068866_10088122 3300005718 Unclassified 1684
339 Ga0068851_10003906 3300005834 Bacteria 6675
340 Ga0068851_10013192 3300005834 Bacteria 3910
341 Ga0068851_10191236 3300005834 Bacteria 1138
342 Ga0068851_10215170 3300005834 Unclassified 1078
343 Ga0068851_10229276 3300005834 Unclassified 1046
344 Ga0068851_10510957 3300005834 Bacteria 722
345 Ga0068851_10742168 3300005834 Bacteria 607
346 Ga0068863_100002387 3300005841 Bacteria 18669
347 Ga0068863_100008161 3300005841 Bacteria 10227
348 Ga0068863_100375757 3300005841 Bacteria 1387
349 Ga0068858_100031045 3300005842 Bacteria 4962
350 Ga0068858_100063135 3300005842 Bacteria 3427
351 Ga0068858_100302852 3300005842 Bacteria 1525
352 Ga0068858_100307664 3300005842 Bacteria 1513
353 Ga0068858_101555073 3300005842 Bacteria 653
354 Ga0068860_100180744 3300005843 Bacteria 2039
355 Ga0068860_100316505 3300005843 Unclassified 1531
356 Ga0068862_100122787 3300005844 Bacteria 2291
357 Ga0081539_10079619 3300005985 Bacteria 1726
358 Ga0070716_101656091 3300006173 Unclassified 527
359 Ga0070712_100160038 3300006175 Bacteria 1738
360 Ga0097621_100025560 3300006237 Bacteria 4621
361 Ga0097621_100331621 3300006237 Unclassified 1349
362 Ga0097621_100586142 3300006237 Unclassified 1018
363 Ga0068871_100178822 3300006358 Unclassified 1822
364 Ga0068871_100344990 3300006358 Bacteria 1316
365 Ga0075434_100260250 3300006871 Unclassified 1754
366 Ga0097620_100165136 3300006931 Bacteria 2294
367 Ga0097620_100177790 3300006931 Bacteria 2210
368 Ga0097620_101318451 3300006931 Unclassified 796
369 Ga0097620_101763247 3300006931 Unclassified 684
370 Ga0097620_101909543 3300006931 Bacteria 656
371 Ga0105251_10039779 3300009011 Unclassified 2295
372 Ga0105240_10016062 3300009093 Bacteria 10146
373 Ga0105240_10052504 3300009093 Bacteria 5124
374 Ga0105240_10147139 3300009093 Bacteria 2810
375 Ga0105240_10415595 3300009093 Bacteria 1512
376 Ga0105240_12613494 3300009093 Unclassified 522
377 Ga0105245_10119034 3300009098 Bacteria 2465
378 Ga0105245_10128975 3300009098 Bacteria 2370
379 Ga0105241_10662238 3300009174 Unclassified 949
380 Ga0105241_10694492 3300009174 Unclassified 928
381 Ga0105241_10942665 3300009174 Unclassified 804
382 Ga0105241_11249371 3300009174 Bacteria 705
383 Ga0105241_12145856 3300009174 Unclassified 553
384 Ga0105242_10056685 3300009176 Bacteria 3206
385 Ga0105248_10047303 3300009177 Bacteria 4824
386 Ga0105248_10296533 3300009177 Bacteria 1820
387 Ga0105248_10752393 3300009177 Bacteria 1100
388 Ga0105248_11047945 3300009177 Unclassified 921
389 Ga0105237_10007969 3300009545 Bacteria 11537
390 Ga0105237_10010945 3300009545 Bacteria 9625
391 Ga0105237_11068964 3300009545 Unclassified 814
392 Ga0105238_10006524 3300009551 Bacteria 11613
393 Ga0105238_10010338 3300009551 Bacteria 9364
394 Ga0105238_10069422 3300009551 Bacteria 3524
395 Ga0105238_10096455 3300009551 Bacteria 2943
396 Ga0105238_10183306 3300009551 Bacteria 2070
397 Ga0105238_10189057 3300009551 Bacteria 2036
398 Ga0105238_10699573 3300009551 Archaea 1025
399 Ga0105239_10012441 3300010375 Bacteria 9479
400 Ga0105239_10117833 3300010375 Unclassified 2947
401 Ga0105239_10786270 3300010375 Bacteria 1090
402 Ga0105239_10932896 3300010375 Bacteria 997
403 Ga0105239_12819064 3300010375 Unclassified 567
404 Ga0105246_10044601 3300011119 Bacteria 3014
405 Ga0105246_10227306 3300011119 Bacteria 1467
406 Ga0105246_12062734 3300011119 Unclassified 552
407 Ga0105246_12342454 3300011119 Unclassified 522
408 Ga0157373_10001257 3300013100 Bacteria 19369
409 Ga0157373_10010607 3300013100 Bacteria 6781
410 Ga0157373_10034737 3300013100 Bacteria 3621
411 Ga0157373_10037013 3300013100 Bacteria 3501
412 Ga0157373_10054356 3300013100 Bacteria 2845
413 Ga0157373_10056427 3300013100 Unclassified 2789
414 Ga0157373_10056965 3300013100 Bacteria 2773
415 Ga0157373_10092410 3300013100 Unclassified 2131
416 Ga0157373_10166461 3300013100 Bacteria 1551
417 Ga0157373_10208182 3300013100 Bacteria 1379
418 Ga0157373_10230667 3300013100 Bacteria 1307
419 Ga0157373_10270789 3300013100 Unclassified 1202
420 Ga0157373_10290567 3300013100 Unclassified 1159
421 Ga0157373_10359510 3300013100 Bacteria 1039
422 Ga0157373_10429515 3300013100 Bacteria 949
423 Ga0157373_10501870 3300013100 Bacteria 876
424 Ga0157373_11079257 3300013100 Unclassified 602
425 Ga0157371_10062503 3300013102 Bacteria 2640
426 Ga0157371_10065945 3300013102 Bacteria 2564
427 Ga0157371_10085113 3300013102 Bacteria 2240
428 Ga0157371_10118263 3300013102 Bacteria 1884
429 Ga0157371_10124124 3300013102 Bacteria 1836
430 Ga0157371_10129874 3300013102 Bacteria 1792
431 Ga0157371_10225608 3300013102 Bacteria 1346
432 Ga0157371_10266491 3300013102 Bacteria 1236
433 Ga0157371_10309571 3300013102 Bacteria 1144
434 Ga0157371_10315933 3300013102 Unclassified 1133
435 Ga0157371_10334692 3300013102 Unclassified 1100
436 Ga0157371_10609601 3300013102 Unclassified 812
437 Ga0157371_10680086 3300013102 Unclassified 769
438 Ga0157371_11101967 3300013102 Bacteria 609
439 Ga0157370_10016192 3300013104 Bacteria 7557
440 Ga0157370_10052496 3300013104 Unclassified 3892
441 Ga0157370_10151341 3300013104 Unclassified 2159
442 Ga0157370_10156542 3300013104 Bacteria 2120
443 Ga0157370_10254811 3300013104 Bacteria 1623
444 Ga0157370_10338952 3300013104 Unclassified 1386
445 Ga0157370_10379146 3300013104 Bacteria 1303
446 Ga0157369_10004147 3300013105 Bacteria 17165
447 Ga0157369_10040375 3300013105 Bacteria 5094
448 Ga0157369_10082269 3300013105 Bacteria 3445
449 Ga0157369_10354511 3300013105 Unclassified 1524
450 Ga0157369_10415650 3300013105 Bacteria 1394
451 Ga0157369_10430693 3300013105 Bacteria 1367
452 Ga0157369_11048758 3300013105 Unclassified 834
453 Ga0157369_11107449 3300013105 Unclassified 809
454 Ga0157369_11138482 3300013105 Unclassified 797
455 Ga0157374_10058154 3300013296 Bacteria 3613
456 Ga0157374_10211720 3300013296 Bacteria 1900
457 Ga0157374_10320254 3300013296 Bacteria 1536
458 Ga0157374_11014402 3300013296 Bacteria 849
459 Ga0157378_10024042 3300013297 Bacteria 5360
460 Ga0157378_10207945 3300013297 Unclassified 1854
461 Ga0157378_11682028 3300013297 Unclassified 681
462 Ga0163162_10006085 3300013306 Bacteria 11680
463 Ga0163162_10203935 3300013306 Bacteria 2107
464 Ga0163162_11735963 3300013306 Unclassified 713
465 Ga0157372_10003603 3300013307 Bacteria 16671
466 Ga0157372_10032904 3300013307 Bacteria 5690
467 Ga0157372_10212239 3300013307 Bacteria 2243
468 Ga0157372_10294274 3300013307 Bacteria 1888
469 Ga0157372_10380559 3300013307 Bacteria 1645
470 Ga0157372_10422379 3300013307 Bacteria 1554
471 Ga0157372_10506809 3300013307 Unclassified 1407
472 Ga0157372_10688289 3300013307 Unclassified 1190
473 Ga0157372_10710322 3300013307 Unclassified 1169
474 Ga0157372_10787791 3300013307 Bacteria 1105
475 Ga0157372_10939700 3300013307 Bacteria 1002
476 Ga0157372_11343421 3300013307 Bacteria 824
477 Ga0157372_11805044 3300013307 Unclassified 703
478 Ga0157375_10108277 3300013308 Bacteria 2873
479 Ga0157375_11022410 3300013308 Unclassified 965
480 Ga0157375_11668403 3300013308 Unclassified 754
481 Ga0157375_11668404 3300013308 Unclassified 754
482 Ga0163163_10163522 3300014325 Bacteria 2272
483 Ga0163163_10404443 3300014325 Unclassified 1423
484 Ga0163163_10670616 3300014325 Bacteria 1100
485 Ga0157380_10867556 3300014326 Bacteria 926
486 Ga0182008_10076853 3300014497 Unclassified 1643
487 Ga0182008_10400330 3300014497 Unclassified 737
488 Ga0182008_10409540 3300014497 Unclassified 730
489 Ga0157377_10286789 3300014745 Unclassified 1081
490 Ga0157379_11173859 3300014968 Unclassified 738
491 Ga0157379_11173988 3300014968 Unclassified 738
492 Ga0157376_10065316 3300014969 Bacteria 3072
493 Ga0157376_11007654 3300014969 Unclassified 856
494 Ga0163161_10527982 3300017792 Bacteria 964
495 Ga0206354_10065452 3300020081 Bacteria 952
496 Ga0206354_10104527 3300020081 Bacteria 637
497 Ga0206353_11031190 3300020082 Bacteria 1968
498 Ga0206353_11257509 3300020082 Bacteria 3648
499 Ga0213876_10038126 3300021384 Bacteria 2535
500 Ga0207697_10005443 3300025315 Bacteria 5919
501 Ga0207656_10014421 3300025321 Bacteria 3044
502 Ga0207656_10019951 3300025321 Bacteria 2657
503 Ga0207656_10183362 3300025321 Bacteria 1005
504 Ga0207656_10744476 3300025321 Unclassified 502
505 Ga0207682_10056438 3300025893 Bacteria 1635
506 Ga0207642_10032863 3300025899 Unclassified 2189
507 Ga0207642_10079390 3300025899 Unclassified 1589
508 Ga0207688_10010918 3300025901 Bacteria 4942
509 Ga0207688_10878252 3300025901 Unclassified 568
510 Ga0207680_10124496 3300025903 Unclassified 1690
511 Ga0207680_10125175 3300025903 Unclassified 1686
512 Ga0207680_10380438 3300025903 Bacteria 995
513 Ga0207680_10843197 3300025903 Unclassified 657
514 Ga0207680_11160675 3300025903 Bacteria 551
515 Ga0207647_10000435 3300025904 Bacteria 34176
516 Ga0207647_10001347 3300025904 Bacteria 18861
517 Ga0207647_10002106 3300025904 Bacteria 15234
518 Ga0207647_10048145 3300025904 Plasmid 2648
519 Ga0207647_10087849 3300025904 Bacteria 1857
520 Ga0207647_10169591 3300025904 Bacteria 1271
521 Ga0207647_10400623 3300025904 Bacteria 773
522 Ga0207699_11078345 3300025906 Bacteria 594
523 Ga0207645_10087340 3300025907 Bacteria 2004
524 Ga0207645_10114513 3300025907 Bacteria 1747
525 Ga0207645_10303718 3300025907 Bacteria 1063
526 Ga0207645_10365119 3300025907 Unclassified 967
527 Ga0207645_10887141 3300025907 Bacteria 606
528 Ga0207643_10033467 3300025908 Bacteria 2876
529 Ga0207705_10002105 3300025909 Bacteria 15478
530 Ga0207705_10014553 3300025909 Bacteria 5660
531 Ga0207705_10016874 3300025909 Bacteria 5230
532 Ga0207705_10018993 3300025909 Bacteria 4915
533 Ga0207705_10020381 3300025909 Bacteria 4740
534 Ga0207705_10039541 3300025909 Bacteria 3381
535 Ga0207705_10050675 3300025909 Bacteria 2989
536 Ga0207705_10053383 3300025909 Bacteria 2911
537 Ga0207705_10091477 3300025909 Unclassified 2228
538 Ga0207705_10110744 3300025909 Bacteria 2028
539 Ga0207705_10234949 3300025909 Bacteria 1395
540 Ga0207705_10322436 3300025909 Bacteria 1187
541 Ga0207705_10339502 3300025909 Bacteria 1156
542 Ga0207705_10342778 3300025909 Unclassified 1150
543 Ga0207705_10355473 3300025909 Unclassified 1129
544 Ga0207705_10367604 3300025909 Unclassified 1110
545 Ga0207705_10579336 3300025909 Bacteria 872
546 Ga0207705_11013785 3300025909 Unclassified 641
547 Ga0207705_11076738 3300025909 Unclassified 620
548 Ga0207705_11292261 3300025909 Unclassified 557
549 Ga0207654_10195363 3300025911 Unclassified 1329
550 Ga0207654_10607007 3300025911 Unclassified 781
551 Ga0207707_10082021 3300025912 Bacteria 2815
552 Ga0207707_10092926 3300025912 Bacteria 2635
553 Ga0207707_10120605 3300025912 Bacteria 2293
554 Ga0207707_10123418 3300025912 Bacteria 2265
555 Ga0207707_10301534 3300025912 Bacteria 1385
556 Ga0207707_10352276 3300025912 Bacteria 1268
557 Ga0207707_10397182 3300025912 Unclassified 1184
558 Ga0207707_10713835 3300025912 Unclassified 841
559 Ga0207707_10868170 3300025912 Bacteria 748
560 Ga0207707_11006231 3300025912 Unclassified 684
561 Ga0207695_10024528 3300025913 Bacteria 6780
562 Ga0207695_10030276 3300025913 Bacteria 5961
563 Ga0207695_10111184 3300025913 Bacteria 2719
564 Ga0207695_10183431 3300025913 Unclassified 2013
565 Ga0207695_10896291 3300025913 Unclassified 767
566 Ga0207671_10021426 3300025914 Bacteria 4904
567 Ga0207671_10206167 3300025914 Bacteria 1537
568 Ga0207671_11543087 3300025914 Unclassified 512
569 Ga0207660_10000329 3300025917 Bacteria 30623
570 Ga0207660_10009260 3300025917 Bacteria 6374
571 Ga0207660_10021068 3300025917 Bacteria 4380
572 Ga0207660_10107172 3300025917 Bacteria 2096
573 Ga0207660_10164132 3300025917 Bacteria 1716
574 Ga0207660_10669665 3300025917 Bacteria 846
575 Ga0207660_11201367 3300025917 Bacteria 617
576 Ga0207657_10003144 3300025919 Bacteria 17663
577 Ga0207657_10006364 3300025919 Bacteria 12264
578 Ga0207657_10013074 3300025919 Bacteria 8158
579 Ga0207657_10015698 3300025919 Bacteria 7325
580 Ga0207657_10028999 3300025919 Bacteria 5043
581 Ga0207657_10030562 3300025919 Bacteria 4888
582 Ga0207657_10048954 3300025919 Bacteria 3686
583 Ga0207657_10053608 3300025919 Bacteria 3493
584 Ga0207657_10056347 3300025919 Bacteria 3392
585 Ga0207657_10082685 3300025919 Bacteria 2695
586 Ga0207657_10104571 3300025919 Bacteria 2345
587 Ga0207657_10110183 3300025919 Bacteria 2274
588 Ga0207657_10120744 3300025919 Bacteria 2156
589 Ga0207657_10147966 3300025919 Bacteria 1914
590 Ga0207657_10301804 3300025919 Bacteria 1268
591 Ga0207657_10461133 3300025919 Bacteria 997
592 Ga0207657_10943621 3300025919 Unclassified 663
593 Ga0207657_11319486 3300025919 Unclassified 544
594 Ga0207649_10004561 3300025920 Bacteria 7518
595 Ga0207649_10016272 3300025920 Bacteria 4190
596 Ga0207649_10022843 3300025920 Bacteria 3615
597 Ga0207649_10036418 3300025920 Bacteria 2963
598 Ga0207649_10078432 3300025920 Bacteria 2131
599 Ga0207649_10298373 3300025920 Bacteria 1177
600 Ga0207649_10321818 3300025920 Unclassified 1136
601 Ga0207649_10346353 3300025920 Unclassified 1098
602 Ga0207649_10409543 3300025920 Bacteria 1016
603 Ga0207649_10446237 3300025920 Unclassified 976
604 Ga0207649_10532788 3300025920 Bacteria 897
605 Ga0207649_10657428 3300025920 Unclassified 810
606 Ga0207649_10889043 3300025920 Bacteria 698
607 Ga0207649_10933221 3300025920 Bacteria 681
608 Ga0207652_10032223 3300025921 Bacteria 4403
609 Ga0207652_10076713 3300025921 Bacteria 2915
610 Ga0207652_10173468 3300025921 Bacteria 1936
611 Ga0207652_10252406 3300025921 Bacteria 1591
612 Ga0207652_10533426 3300025921 Bacteria 1055
613 Ga0207652_10814333 3300025921 Unclassified 829
614 Ga0207652_10936082 3300025921 Unclassified 764
615 Ga0207652_11135763 3300025921 Unclassified 682
616 Ga0207652_11676737 3300025921 Bacteria 540
617 Ga0207681_10431198 3300025923 Bacteria 1070
618 Ga0207681_10692355 3300025923 Unclassified 847
619 Ga0207681_11139628 3300025923 Bacteria 655
620 Ga0207694_10004535 3300025924 Bacteria 10830
621 Ga0207694_10011778 3300025924 Bacteria 6597
622 Ga0207694_10112040 3300025924 Bacteria 2171
623 Ga0207694_10284218 3300025924 Unclassified 1359
624 Ga0207694_10771560 3300025924 Bacteria 812
625 Ga0207650_10024371 3300025925 Bacteria 4301
626 Ga0207650_10347083 3300025925 Bacteria 1220
627 Ga0207650_10661239 3300025925 Bacteria 881
628 Ga0207687_10071230 3300025927 Bacteria 2483
629 Ga0207700_10568401 3300025928 Unclassified 1007
630 Ga0207664_10076982 3300025929 Bacteria 2702
631 Ga0207664_10077410 3300025929 Bacteria 2695
632 Ga0207664_10125158 3300025929 Unclassified 2157
633 Ga0207664_10137347 3300025929 Bacteria 2064
634 Ga0207644_10003796 3300025931 Bacteria 9786
635 Ga0207644_10025658 3300025931 Unclassified 4053
636 Ga0207644_10191100 3300025931 Unclassified 1610
637 Ga0207644_10566215 3300025931 Unclassified 941
638 Ga0207690_10003155 3300025932 Bacteria 9899
639 Ga0207690_10012506 3300025932 Bacteria 5079
640 Ga0207690_10030391 3300025932 Bacteria 3445
641 Ga0207690_10117617 3300025932 Bacteria 1925
642 Ga0207690_10146955 3300025932 Bacteria 1744
643 Ga0207690_10264960 3300025932 Bacteria 1333
644 Ga0207690_10350103 3300025932 Unclassified 1168
645 Ga0207690_10394601 3300025932 Bacteria 1102
646 Ga0207690_10395126 3300025932 Bacteria 1101
647 Ga0207690_10424371 3300025932 Unclassified 1064
648 Ga0207690_10684660 3300025932 Bacteria 842
649 Ga0207690_10833896 3300025932 Bacteria 763
650 Ga0207690_10882739 3300025932 Archaea 741
651 Ga0207706_10002427 3300025933 Bacteria 18186
652 Ga0207706_10040783 3300025933 Bacteria 4115
653 Ga0207706_10077908 3300025933 Bacteria 2915
654 Ga0207706_10092798 3300025933 Bacteria 2655
655 Ga0207706_10092860 3300025933 Bacteria 2654
656 Ga0207706_10151767 3300025933 Bacteria 2037
657 Ga0207706_10184058 3300025933 Unclassified 1834
658 Ga0207706_10410719 3300025933 Bacteria 1173
659 Ga0207706_10513699 3300025933 Bacteria 1033
660 Ga0207706_10514856 3300025933 Unclassified 1032
661 Ga0207706_10550417 3300025933 Bacteria 993
662 Ga0207706_10777762 3300025933 Unclassified 814
663 Ga0207706_11651133 3300025933 Unclassified 518
664 Ga0207686_10013322 3300025934 Bacteria 4548
665 Ga0207669_10087994 3300025937 Bacteria 2013
666 Ga0207704_10058514 3300025938 Unclassified 2373
667 Ga0207704_10088462 3300025938 Unclassified 2026
668 Ga0207691_10128958 3300025940 Bacteria 2235
669 Ga0207691_10149564 3300025940 Bacteria 2053
670 Ga0207691_10166518 3300025940 Unclassified 1931
671 Ga0207691_10461616 3300025940 Unclassified 1080
672 Ga0207711_10011791 3300025941 Bacteria 7262
673 Ga0207711_10136820 3300025941 Unclassified 2201
674 Ga0207711_10359525 3300025941 Bacteria 1349
675 Ga0207711_10754112 3300025941 Bacteria 907
676 Ga0207661_10050476 3300025944 Bacteria 3314
677 Ga0207661_10051801 3300025944 Bacteria 3276
678 Ga0207661_10070331 3300025944 Unclassified 2857
679 Ga0207661_10142329 3300025944 Bacteria 2065
680 Ga0207661_10249439 3300025944 Bacteria 1577
681 Ga0207661_10353079 3300025944 Unclassified 1327
682 Ga0207661_11046820 3300025944 Unclassified 751
683 Ga0207679_10117870 3300025945 Bacteria 2108
684 Ga0207679_10269327 3300025945 Unclassified 1456
685 Ga0207679_10274321 3300025945 Unclassified 1443
686 Ga0207679_10314185 3300025945 Unclassified 1355
687 Ga0207679_10474964 3300025945 Unclassified 1112
688 Ga0207679_10537193 3300025945 Bacteria 1047
689 Ga0207679_11276113 3300025945 Unclassified 674
690 Ga0207679_11297389 3300025945 Unclassified 668
691 Ga0207679_11717854 3300025945 Unclassified 574
692 Ga0207667_10022295 3300025949 Bacteria 6999
693 Ga0207667_10032969 3300025949 Bacteria 5575
694 Ga0207667_10050040 3300025949 Bacteria 4410
695 Ga0207667_10193544 3300025949 Bacteria 2086
696 Ga0207667_10205388 3300025949 Bacteria 2020
697 Ga0207667_10263826 3300025949 Bacteria 1761
698 Ga0207667_10370656 3300025949 Unclassified 1459
699 Ga0207667_10586293 3300025949 Bacteria 1125
700 Ga0207667_10621040 3300025949 Bacteria 1088
701 Ga0207667_11128664 3300025949 Unclassified 766
702 Ga0207667_11669768 3300025949 Unclassified 604
703 Ga0207651_10016827 3300025960 Bacteria 4299
704 Ga0207651_10076528 3300025960 Bacteria 2393
705 Ga0207651_10186394 3300025960 Unclassified 1651
706 Ga0207651_10266211 3300025960 Bacteria 1409
707 Ga0207651_10717720 3300025960 Bacteria 882
708 Ga0207651_10953410 3300025960 Unclassified 765
709 Ga0207712_10153816 3300025961 Bacteria 1779
710 Ga0207668_10191894 3300025972 Bacteria 1620
711 Ga0207640_10008246 3300025981 Bacteria 5778
712 Ga0207640_10014560 3300025981 Bacteria 4532
713 Ga0207640_10015328 3300025981 Bacteria 4435
714 Ga0207640_10025850 3300025981 Bacteria 3559
715 Ga0207640_10078440 3300025981 Bacteria 2248
716 Ga0207640_10117494 3300025981 Bacteria 1898
717 Ga0207640_10209327 3300025981 Bacteria 1484
718 Ga0207640_10212645 3300025981 Unclassified 1474
719 Ga0207640_10462228 3300025981 Bacteria 1048
720 Ga0207640_10550672 3300025981 Bacteria 969
721 Ga0207640_11702549 3300025981 Bacteria 569
722 Ga0207640_12100718 3300025981 Unclassified 512
723 Ga0207658_10093050 3300025986 Bacteria 2343
724 Ga0207658_10143721 3300025986 Unclassified 1934
725 Ga0207658_10728380 3300025986 Bacteria 897
726 Ga0207658_10738748 3300025986 Unclassified 891
727 Ga0207658_10778088 3300025986 Bacteria 868
728 Ga0207677_10260184 3300026023 Bacteria 1414
729 Ga0207677_10605238 3300026023 Unclassified 962
730 Ga0207677_11838403 3300026023 Unclassified 562
731 Ga0207703_10040289 3300026035 Bacteria 3738
732 Ga0207703_10065019 3300026035 Bacteria 2996
733 Ga0207703_10254203 3300026035 Unclassified 1585
734 Ga0207703_10324007 3300026035 Unclassified 1412
735 Ga0207639_10000136 3300026041 Bacteria 54387
736 Ga0207639_10049409 3300026041 Bacteria 3189
737 Ga0207639_10086373 3300026041 Unclassified 2498
738 Ga0207639_10237495 3300026041 Bacteria 1583
739 Ga0207639_10302396 3300026041 Unclassified 1414
740 Ga0207639_10411768 3300026041 Bacteria 1220
741 Ga0207639_10476255 3300026041 Unclassified 1137
742 Ga0207639_10512738 3300026041 Bacteria 1097
743 Ga0207639_10549748 3300026041 Bacteria 1060
744 Ga0207639_10657659 3300026041 Bacteria 970
745 Ga0207639_10662878 3300026041 Bacteria 966
746 Ga0207678_10005791 3300026067 Bacteria 11018
747 Ga0207678_10009194 3300026067 Bacteria 8699
748 Ga0207678_10010228 3300026067 Bacteria 8236
749 Ga0207678_10019220 3300026067 Bacteria 5999
750 Ga0207678_10034912 3300026067 Bacteria 4379
751 Ga0207678_10035824 3300026067 Bacteria 4320
752 Ga0207678_10151644 3300026067 Bacteria 1979
753 Ga0207678_10308339 3300026067 Unclassified 1361
754 Ga0207678_10393400 3300026067 Bacteria 1199
755 Ga0207678_10441696 3300026067 Bacteria 1130
756 Ga0207678_10683217 3300026067 Unclassified 903
757 Ga0207702_10011047 3300026078 Bacteria 7537
758 Ga0207702_10046294 3300026078 Bacteria 3661
759 Ga0207702_10051017 3300026078 Bacteria 3494
760 Ga0207702_10055089 3300026078 Bacteria 3372
761 Ga0207702_10103326 3300026078 Unclassified 2520
762 Ga0207702_10167126 3300026078 Unclassified 2014
763 Ga0207702_10283265 3300026078 Bacteria 1568
764 Ga0207702_10373577 3300026078 Bacteria 1369
765 Ga0207702_10461816 3300026078 Bacteria 1233
766 Ga0207702_10603373 3300026078 Bacteria 1077
767 Ga0207702_11930519 3300026078 Unclassified 581
768 Ga0207641_10010934 3300026088 Bacteria 7437
769 Ga0207641_10020798 3300026088 Bacteria 5393
770 Ga0207641_10319203 3300026088 Bacteria 1473
771 Ga0207648_10001590 3300026089 Bacteria 24892
772 Ga0207648_10021766 3300026089 Bacteria 5760
773 Ga0207648_10047618 3300026089 Bacteria 3757
774 Ga0207648_10887721 3300026089 Unclassified 832
775 Ga0207676_10074688 3300026095 Bacteria 2732
776 Ga0207676_10201095 3300026095 Unclassified 1760
777 Ga0207676_10416932 3300026095 Unclassified 1258
778 Ga0207676_12478436 3300026095 Unclassified 515
779 Ga0207674_10000060 3300026116 Bacteria 112806
780 Ga0207674_10001045 3300026116 Bacteria 36002
781 Ga0207674_10003719 3300026116 Bacteria 18629
782 Ga0207674_10007483 3300026116 Bacteria 12729
783 Ga0207674_10028962 3300026116 Bacteria 5838
784 Ga0207674_10030442 3300026116 Bacteria 5673
785 Ga0207674_10031140 3300026116 Bacteria 5605
786 Ga0207674_10061056 3300026116 Bacteria 3809
787 Ga0207674_10249289 3300026116 Bacteria 1723
788 Ga0207674_10403205 3300026116 Bacteria 1321
789 Ga0207674_10877137 3300026116 Bacteria 865
790 Ga0207674_10892659 3300026116 Unclassified 857
791 Ga0207674_11377367 3300026116 Unclassified 675
792 Ga0207675_100328829 3300026118 Bacteria 1494
793 Ga0207675_100483515 3300026118 Bacteria 1231
794 Ga0207683_10001298 3300026121 Bacteria 22583
795 Ga0207683_10013086 3300026121 Bacteria 7077
796 Ga0207683_10039824 3300026121 Bacteria 4100
797 Ga0207698_10001262 3300026142 Bacteria 14777
798 Ga0207698_10002123 3300026142 Bacteria 11689
799 Ga0207698_10010523 3300026142 Bacteria 5952
800 Ga0207698_10013579 3300026142 Bacteria 5382
801 Ga0207698_10075843 3300026142 Bacteria 2689
802 Ga0207698_10136124 3300026142 Archaea 2108
803 Ga0207698_10349975 3300026142 Unclassified 1395
804 Ga0207698_10433728 3300026142 Bacteria 1264
805 Ga0207698_10485323 3300026142 Unclassified 1199
806 Ga0207698_10595299 3300026142 Bacteria 1089
807 Ga0207698_10599310 3300026142 Bacteria 1086
808 Ga0207698_10654831 3300026142 Unclassified 1041
809 Ga0207698_10826622 3300026142 Bacteria 930
810 Ga0207698_10849753 3300026142 Unclassified 918
811 Ga0207698_10946198 3300026142 Bacteria 870
812 Ga0207698_11001538 3300026142 Unclassified 846
813 Ga0207698_11125362 3300026142 Unclassified 798
814 Ga0207698_11384857 3300026142 Bacteria 718
815 Ga0207698_12301297 3300026142 Unclassified 551
816 Ga0207698_12418589 3300026142 Archaea 536
817 Ga0268266_10023288 3300028379 Bacteria 5273
818 Ga0268266_10211299 3300028379 Bacteria 1780
819 Ga0268266_10784070 3300028379 Unclassified 920
820 Ga0268266_11072106 3300028379 Unclassified 780
821 Ga0268265_10054539 3300028380 Bacteria 3034
822 Ga0307408_100159796 3300031548 Unclassified 1789
823 Ga0307405_10078836 3300031731 Bacteria 2145
824 Ga0307405_10735239 3300031731 Unclassified 821
825 Ga0307413_10079744 3300031824 Unclassified 2094
826 Ga0307409_100024402 3300031995 Bacteria 4217
827 Ga0307409_100724732 3300031995 Bacteria 996
828 Ga0307414_10936621 3300032004 Unclassified 795
829 Ga0307415_100001570 3300032126 Bacteria 11012
830 Ga0373930_0086937 3300034816 Bacteria 729
831 Ga0373936_0113544 3300035113 Bacteria 1152
832 Ga0373941_0200978 3300035115 Bacteria 757
833 Ga0373943_0005760 3300035170 Bacteria 5563
834 Ga0373942_0055592 3300035207 Bacteria 1121
835 Ga0373931_0161264 3300035691 Bacteria 1315
836 Ga0373935_0067849 3300035692 Bacteria 2294
837 Ga0373935_0235457 3300035692 Bacteria 1276
838 Ga0373927_0027849 3300035695 Bacteria 3690
839 Ga0373947_0045254 3300035725 Plasmid 2633
840 Ga0373925_0108896 3300037068 Unclassified 2138
841 Ga0395899_0007176 3300037312 Bacteria 8628
842 Ga0395899_0011485 3300037312 Bacteria 6779
843 Ga0395899_0028968 3300037312 Bacteria 4166
844 Ga0395899_0041307 3300037312 Bacteria 3446
845 Ga0395899_0048245 3300037312 Bacteria 3169
846 Ga0395899_0060615 3300037312 Bacteria 2787
847 Ga0395899_0162733 3300037312 Bacteria 1575
848 Ga0395899_0166656 3300037312 Bacteria 1554
849 Ga0395899_0188925 3300037312 Bacteria 1442
850 Ga0395899_0198354 3300037312 Bacteria 1401
851 Ga0395899_0289704 3300037312 Bacteria 1111
852 Ga0395899_0289778 3300037312 Bacteria 1111
853 Ga0395899_0534923 3300037312 Bacteria 755
854 Ga0395899_0579217 3300037312 Bacteria 718
855 Ga0395899_0634894 3300037312 Unclassified 676
856 Ga0395899_0778312 3300037312 Bacteria 593
857 Ga0395900_0001394 3300037418 Bacteria 28915
858 Ga0395900_0008469 3300037418 Bacteria 10576
859 Ga0395900_0010426 3300037418 Bacteria 9503
860 Ga0395900_0030033 3300037418 Bacteria 5578
861 Ga0395900_0032876 3300037418 Bacteria 5336
862 Ga0395900_0050492 3300037418 Bacteria 4284
863 Ga0395900_0052102 3300037418 Bacteria 4213
864 Ga0395900_0062387 3300037418 Bacteria 3831
865 Ga0395900_0077109 3300037418 Bacteria 3424
866 Ga0395900_0089904 3300037418 Bacteria 3156
867 Ga0395900_0105747 3300037418 Bacteria 2891
868 Ga0395900_0126300 3300037418 Bacteria 2623
869 Ga0395900_0163867 3300037418 Bacteria 2266
870 Ga0395900_0230756 3300037418 Bacteria 1861
871 Ga0395900_0234653 3300037418 Unclassified 1843
872 Ga0395900_0249016 3300037418 Bacteria 1779
873 Ga0395900_0288714 3300037418 Unclassified 1630
874 Ga0395900_0356664 3300037418 Bacteria 1434
875 Ga0395900_0362485 3300037418 Bacteria 1420
876 Ga0395900_0362494 3300037418 Bacteria 1420
877 Ga0395900_0385103 3300037418 Bacteria 1369
878 Ga0395900_0387076 3300037418 Bacteria 1365
879 Ga0395900_0417831 3300037418 Unclassified 1302
880 Ga0395900_0493040 3300037418 Bacteria 1176
881 Ga0395900_0544519 3300037418 Bacteria 1106
882 Ga0395900_0652225 3300037418 Bacteria 989
883 Ga0395900_0781778 3300037418 Bacteria 883
884 Ga0395900_0846033 3300037418 Bacteria 840
885 Ga0395900_0870704 3300037418 Bacteria 825
886 Ga0395900_0899413 3300037418 Bacteria 809
887 Ga0395900_0944048 3300037418 Bacteria 784
888 Ga0395900_0964745 3300037418 Unclassified 773
889 Ga0395900_1032351 3300037418 Unclassified 741
890 Ga0395900_1064233 3300037418 Unclassified 727
891 Ga0395900_1232172 3300037418 Bacteria 663
892 Ga0395900_1488730 3300037418 Bacteria 589
893 Ga0395900_1529328 3300037418 Bacteria 579
894 Ga0395900_1543227 3300037418 Bacteria 576
895 Ga0395900_1922681 3300037418 Unclassified 502
896 Ga0395898_0001185 3300037466 Bacteria 39681
897 Ga0395898_0020458 3300037466 Bacteria 6721
898 Ga0395898_0021682 3300037466 Bacteria 6511
899 Ga0395898_0028633 3300037466 Bacteria 5582
900 Ga0395898_0059285 3300037466 Bacteria 3724
901 Ga0395898_0076497 3300037466 Bacteria 3232
902 Ga0395898_0092031 3300037466 Bacteria 2917
903 Ga0395898_0106321 3300037466 Bacteria 2692
904 Ga0395898_0107720 3300037466 Bacteria 2672
905 Ga0395898_0117210 3300037466 Unclassified 2551
906 Ga0395898_0117953 3300037466 Bacteria 2542
907 Ga0395898_0183993 3300037466 Bacteria 1996
908 Ga0395898_0204455 3300037466 Bacteria 1884
909 Ga0395898_0356728 3300037466 Unclassified 1394
910 Ga0395898_0445476 3300037466 Bacteria 1233
911 Ga0395898_0498012 3300037466 Bacteria 1159
912 Ga0395898_0527479 3300037466 Bacteria 1122
913 Ga0395898_0568508 3300037466 Bacteria 1076
914 Ga0395898_0662130 3300037466 Unclassified 986
915 Ga0395898_0959677 3300037466 Unclassified 792
916 Ga0395898_1518654 3300037466 Unclassified 595
917 Ga0395905_0001106 3300037471 Bacteria 33891
918 Ga0395905_0010576 3300037471 Bacteria 8962
919 Ga0395905_0014304 3300037471 Bacteria 7584
920 Ga0395905_0016298 3300037471 Bacteria 7061
921 Ga0395905_0031856 3300037471 Bacteria 4961
922 Ga0395905_0032788 3300037471 Bacteria 4884
923 Ga0395905_0036038 3300037471 Bacteria 4646
924 Ga0395905_0038261 3300037471 Bacteria 4501
925 Ga0395905_0052633 3300037471 Bacteria 3811
926 Ga0395905_0053348 3300037471 Bacteria 3784
927 Ga0395905_0062751 3300037471 Bacteria 3475
928 Ga0395905_0072984 3300037471 Bacteria 3217
929 Ga0395905_0074226 3300037471 Unclassified 3187
930 Ga0395905_0076337 3300037471 Bacteria 3140
931 Ga0395905_0098783 3300037471 Unclassified 2742
932 Ga0395905_0103052 3300037471 Bacteria 2679
933 Ga0395905_0108175 3300037471 Bacteria 2610
934 Ga0395905_0119008 3300037471 Bacteria 2482
935 Ga0395905_0120488 3300037471 Bacteria 2466
936 Ga0395905_0131695 3300037471 Bacteria 2352
937 Ga0395905_0138196 3300037471 Bacteria 2293
938 Ga0395905_0144948 3300037471 Bacteria 2234
939 Ga0395905_0182500 3300037471 Bacteria 1970
940 Ga0395905_0225481 3300037471 Bacteria 1753
941 Ga0395905_0228058 3300037471 Bacteria 1742
942 Ga0395905_0273366 3300037471 Bacteria 1575
943 Ga0395905_0280800 3300037471 Bacteria 1551
944 Ga0395905_0303029 3300037471 Unclassified 1485
945 Ga0395905_0357253 3300037471 Bacteria 1353
946 Ga0395905_0384232 3300037471 Bacteria 1298
947 Ga0395905_0388187 3300037471 Bacteria 1290
948 Ga0395905_0392463 3300037471 Bacteria 1282
949 Ga0395905_0423506 3300037471 Unclassified 1227
950 Ga0395905_0424110 3300037471 Bacteria 1226
951 Ga0395905_0427279 3300037471 Bacteria 1221
952 Ga0395905_0440465 3300037471 Bacteria 1200
953 Ga0395905_0441742 3300037471 Bacteria 1198
954 Ga0395905_0444228 3300037471 Bacteria 1194
955 Ga0395905_0553863 3300037471 Bacteria 1051
956 Ga0395905_0560226 3300037471 Unclassified 1044
957 Ga0395905_0612801 3300037471 Unclassified 990
958 Ga0395905_0676216 3300037471 Unclassified 934
959 Ga0395905_0741953 3300037471 Unclassified 884
960 Ga0395905_0801251 3300037471 Bacteria 845
961 Ga0395905_0858665 3300037471 Bacteria 811
962 Ga0395905_0862866 3300037471 Bacteria 808
963 Ga0395905_0875123 3300037471 Unclassified 801
964 Ga0395905_0881948 3300037471 Unclassified 798
965 Ga0395905_0959312 3300037471 Unclassified 758
966 Ga0395905_1042050 3300037471 Bacteria 721
967 Ga0395905_1236403 3300037471 Bacteria 650
968 Ga0395905_1274942 3300037471 Unclassified 638
969 Ga0395901_0001061 3300038443 Bacteria 29546
970 Ga0395901_0001163 3300038443 Bacteria 27959
971 Ga0395901_0020488 3300038443 Bacteria 6768
972 Ga0395901_0023391 3300038443 Bacteria 6333
973 Ga0395901_0030902 3300038443 Bacteria 5519
974 Ga0395901_0036445 3300038443 Bacteria 5084
975 Ga0395901_0047208 3300038443 Bacteria 4471
976 Ga0395901_0048224 3300038443 Bacteria 4423
977 Ga0395901_0058387 3300038443 Bacteria 4013
978 Ga0395901_0083658 3300038443 Bacteria 3335
979 Ga0395901_0108802 3300038443 Bacteria 2909
980 Ga0395901_0109032 3300038443 Bacteria 2906
981 Ga0395901_0137818 3300038443 Unclassified 2564
982 Ga0395901_0163103 3300038443 Bacteria 2340
983 Ga0395901_0217738 3300038443 Bacteria 1996
984 Ga0395901_0221989 3300038443 Bacteria 1975
985 Ga0395901_0232981 3300038443 Bacteria 1922
986 Ga0395901_0235765 3300038443 Unclassified 1909
987 Ga0395901_0243877 3300038443 Bacteria 1873
988 Ga0395901_0249652 3300038443 Unclassified 1849
989 Ga0395901_0286832 3300038443 Bacteria 1709
990 Ga0395901_0306317 3300038443 Unclassified 1646
991 Ga0395901_0484895 3300038443 Bacteria 1260
992 Ga0395901_0512652 3300038443 Bacteria 1219
993 Ga0395901_0526357 3300038443 Unclassified 1200
994 Ga0395901_0638789 3300038443 Unclassified 1069
995 Ga0395901_0669103 3300038443 Unclassified 1039
996 Ga0395901_0677574 3300038443 Bacteria 1031
997 Ga0395901_0700726 3300038443 Unclassified 1010
998 Ga0395901_0704142 3300038443 Bacteria 1007
999 Ga0395901_0820975 3300038443 Bacteria 917
1000 Ga0395901_0855763 3300038443 Unclassified 894
1001 Ga0395901_0961663 3300038443 Bacteria 832
1002 Ga0395901_0972153 3300038443 Bacteria 826
1003 Ga0395901_1122761 3300038443 Bacteria 755
1004 Ga0395901_1148312 3300038443 Bacteria 745
1005 Ga0395901_1561287 3300038443 Bacteria 614
1006 Ga0436365_0782179 3300039437 Bacteria 37690
1007 Ga0436363_1101143 3300039450 Bacteria 2469
1008 Ga0451833_1137545 3300041491 Unclassified 527
1009 Ga0439448_0004818 3300042005 Bacteria 3822
1010 Ga0439455_0007660 3300042012 Viruses 2291
1011 Ga0439458_0001158 3300042157 Bacteria 6681
1012 Ga0439458_0002397 3300042157 Bacteria 4580
1013 Ga0466969_0002083 3300044656 Bacteria 10679
1014 Ga0466969_0290935 3300044656 Bacteria 739
1015 Ga0466969_0448194 3300044656 Bacteria 587
1016 Ga0466972_0186083 3300044658 Bacteria 973
1017 Ga0466972_0210210 3300044658 Bacteria 911
1018 Ga0466972_0215908 3300044658 Bacteria 897
1019 Ga0466965_0054675 3300044683 Bacteria 1986
1020 Ga0466965_0221794 3300044683 Bacteria 1008
1021 Ga0466965_0361391 3300044683 Bacteria 797
1022 Ga0466965_0431489 3300044683 Bacteria 732
1023 Ga0466966_0011598 3300044684 Bacteria 5842
1024 Ga0466966_0051282 3300044684 Bacteria 2623
1025 Ga0466966_0061319 3300044684 Bacteria 2372
1026 Ga0466966_0066066 3300044684 Bacteria 2273
1027 Ga0466966_0090027 3300044684 Bacteria 1905
1028 Ga0466966_0211528 3300044684 Bacteria 1172
1029 Ga0466966_0239076 3300044684 Bacteria 1095
1030 Ga0466966_0756004 3300044684 Bacteria 586
1031 Ga0466961_0010281 3300044693 Bacteria 5964
1032 Ga0466961_0080430 3300044693 Bacteria 2063
1033 Ga0466961_0080884 3300044693 Bacteria 2056
1034 Ga0466961_0419055 3300044693 Unclassified 811
1035 Ga0466961_0706071 3300044693 Bacteria 604
1036 Ga0466961_0741010 3300044693 Unclassified 588
1037 Ga0466961_0902049 3300044693 Unclassified 526
1038 Ga0466963_0009505 3300044694 Bacteria 5855
1039 Ga0466963_0032247 3300044694 Bacteria 3391
1040 Ga0466963_0047261 3300044694 Bacteria 2840
1041 Ga0466963_0054072 3300044694 Unclassified 2668
1042 Ga0466963_0091743 3300044694 Bacteria 2069
1043 Ga0466963_0106172 3300044694 Bacteria 1925
1044 Ga0466963_0116869 3300044694 Unclassified 1833
1045 Ga0466963_0155478 3300044694 Bacteria 1589
1046 Ga0466963_0277581 3300044694 Bacteria 1177
1047 Ga0466964_0041650 3300044706 Unclassified 1859
1048 Ga0466964_0387949 3300044706 Unclassified 727
1049 Ga0466971_0115332 3300044719 Bacteria 1241
1050 Ga0466971_0203693 3300044719 Unclassified 934
1051 Ga0466970_0231605 3300044765 Unclassified 1032
1052 Ga0466970_0413123 3300044765 Viruses 771
1053 Ga0466957_0001719 3300044842 Bacteria 11513
1054 Ga0466957_0013241 3300044842 Bacteria 4784
1055 Ga0466957_0014687 3300044842 Bacteria 4563
1056 Ga0466957_0082779 3300044842 Bacteria 2001
1057 Ga0466957_0213806 3300044842 Bacteria 1271
1058 Ga0466957_0227569 3300044842 Bacteria 1233
1059 Ga0466957_0371761 3300044842 Unclassified 973
1060 Ga0466957_0680879 3300044842 Unclassified 725
1061 Ga0466960_0086474 3300044901 Bacteria 1590
1062 Ga0466960_0098857 3300044901 Unclassified 1499
1063 Ga0466960_0142410 3300044901 Unclassified 1274
1064 Ga0466960_0459758 3300044901 Bacteria 741
1065 Ga0466959_0017690 3300045049 Bacteria 5228
1066 Ga0466959_0160720 3300045049 Bacteria 1580
1067 Ga0466959_0176301 3300045049 Unclassified 1497
1068 Ga0466959_0183145 3300045049 Bacteria 1464
1069 Ga0466959_0246788 3300045049 Unclassified 1232
1070 Ga0466959_0253412 3300045049 Bacteria 1213
1071 Ga0466959_0355493 3300045049 Unclassified 998
1072 Ga0466959_0362362 3300045049 Unclassified 988
1073 Ga0466959_0502149 3300045049 Bacteria 820
1074 Ga0466958_0019636 3300045836 Bacteria 3934
1075 Ga0466958_0070951 3300045836 Bacteria 2133
1076 Ga0466958_0123938 3300045836 Unclassified 1619
1077 Ga0466958_0156375 3300045836 Bacteria 1439
1078 Ga0466958_0238589 3300045836 Bacteria 1161
1079 Ga0466958_0302158 3300045836 Bacteria 1027
1080 Ga0466958_0359426 3300045836 Unclassified 938
1081 Ga0466967_0004351 3300045976 Bacteria 9534
1082 Ga0466967_0006660 3300045976 Bacteria 8213
1083 Ga0466967_0044291 3300045976 Bacteria 3859
1084 Ga0466967_0057541 3300045976 Bacteria 3433
1085 Ga0466967_0094909 3300045976 Bacteria 2717
1086 Ga0466967_0124917 3300045976 Bacteria 2382
1087 Ga0466967_0151722 3300045976 Bacteria 2166
1088 Ga0466967_0173258 3300045976 Bacteria 2031
1089 Ga0466967_0174154 3300045976 Bacteria 2026
1090 Ga0466967_0228094 3300045976 Unclassified 1772
1091 Ga0466967_0263513 3300045976 Bacteria 1649
1092 Ga0466967_0301163 3300045976 Unclassified 1542
1093 Ga0466967_0363541 3300045976 Bacteria 1402
1094 Ga0466967_0384863 3300045976 Bacteria 1362
1095 Ga0466967_0595311 3300045976 Unclassified 1091
1096 Ga0466967_0893509 3300045976 Unclassified 883
1097 Ga0466967_1273524 3300045976 Unclassified 732
1098 Ga0466967_1504135 3300045976 Unclassified 670
1099 Ga0466967_1900475 3300045976 Bacteria 592
1100 Ga0466967_2210044 3300045976 Unclassified 546
1101 Ga0495610_0171939 3300046512 Unclassified 908
1102 Ga0495643_0232867 3300046522 Unclassified 868
1103 Ga0495663_0006214 3300046525 Unclassified 3298
1104 Ga0495642_0217615 3300046528 Unclassified 834
1105 Ga0495668_0010412 3300046616 Bacteria 5626
1106 Ga0495669_0000119 3300046684 Bacteria 50758
1107 Ga0495669_0010895 3300046684 Bacteria 3849
1108 Ga0495669_0023305 3300046684 Bacteria 2694
1109 Ga0495669_0125188 3300046684 Bacteria 1207
1110 Ga0495669_0156128 3300046684 Unclassified 1081
1111 Ga0495669_0494072 3300046684 Unclassified 595
1112 Ga0495600_0776801 3300046809 Bacteria 572
1113 Ga0495677_0031713 3300047445 Bacteria 1924
1114 Ga0496100_0062051 3300048903 Bacteria 2465
1115 Ga0496101_0151018 3300048904 Bacteria 1777
1116 Ga0496101_0178459 3300048904 Bacteria 1635
1117 Ga0496101_0188141 3300048904 Bacteria 1592
1118 Ga0496101_0378573 3300048904 Unclassified 1113
1119 Ga0496101_0425945 3300048904 Unclassified 1046
1120 Ga0496102_0054392 3300048905 Bacteria 3650
1121 Ga0496102_0173186 3300048905 Unclassified 2032
1122 Ga0496102_0795211 3300048905 Bacteria 868
1123 Ga0496102_1872314 3300048905 Unclassified 517
1124 Ga0496103_0672443 3300048906 Bacteria 657
1125 Ga0496104_0565201 3300048907 Bacteria 1048
1126 Ga0496104_0793894 3300048907 Unclassified 853
1127 Ga0496104_1441164 3300048907 Unclassified 592
1128 Ga0496105_0164931 3300048908 Bacteria 1818
1129 Ga0496106_0614659 3300048909 Bacteria 870
1130 Ga0496106_0951890 3300048909 Bacteria 677
1131 Ga0496107_0056655 3300048910 Bacteria 2832
1132 Ga0496107_0084052 3300048910 Bacteria 2322
1133 Ga0496107_0134480 3300048910 Bacteria 1827
1134 Ga0496107_0340462 3300048910 Bacteria 1116
1135 Ga0496107_1336910 3300048910 Bacteria 512
1136 Ga0496108_0039210 3300048911 Unclassified 3949
1137 Ga0496108_0142175 3300048911 Unclassified 2067
1138 Ga0496109_0369747 3300048912 Unclassified 1354
1139 Ga0496109_0535874 3300048912 Bacteria 1104
1140 Ga0496109_0554142 3300048912 Bacteria 1084
1141 Ga0496109_0927580 3300048912 Unclassified 809
1142 Ga0496109_1135116 3300048912 Unclassified 718
1143 Ga0496110_0036598 3300048913 Bacteria 4262
1144 Ga0496110_0048084 3300048913 Bacteria 3738
1145 Ga0496110_0058050 3300048913 Bacteria 3408
1146 Ga0496110_0091694 3300048913 Bacteria 2718
1147 Ga0496110_0091986 3300048913 Bacteria 2714
1148 Ga0496110_0210809 3300048913 Unclassified 1766
1149 Ga0496111_0017004 3300048914 Bacteria 5020
1150 Ga0496111_0048239 3300048914 Bacteria 3068
1151 Ga0496111_0644684 3300048914 Bacteria 773
1152 Ga0496111_1031320 3300048914 Bacteria 588
1153 Ga0496112_0005611 3300048915 Bacteria 10883
1154 Ga0496112_0006998 3300048915 Bacteria 9958
1155 Ga0496112_0020968 3300048915 Bacteria 6206
1156 Ga0496112_0026749 3300048915 Bacteria 5557
1157 Ga0496112_0038409 3300048915 Bacteria 4674
1158 Ga0496112_0186641 3300048915 Bacteria 2036
1159 Ga0496112_0403305 3300048915 Bacteria 1307
1160 Ga0496112_1197434 3300048915 Unclassified 676
1161 Ga0496113_0056778 3300048916 Bacteria 2940
1162 Ga0496113_0066812 3300048916 Bacteria 2724
1163 Ga0496113_0210884 3300048916 Bacteria 1546
1164 Ga0496113_0211392 3300048916 Unclassified 1544
1165 Ga0501067_0248786 3300049583 Bacteria 989
1166 Ga0501067_0650534 3300049583 Unclassified 592
1167 Ga0501067_0670497 3300049583 Unclassified 582
1168 Ga0501067_0847476 3300049583 Unclassified 515
1169 Ga0501070_0217149 3300049586 Bacteria 1569
1170 Ga0501080_0072631 3300049742 Bacteria 3201
1171 Ga0501081_1172241 3300049743 Bacteria 582
1172 Ga0501241_121567 3300049758 Bacteria 580
1173 nmdc:mga0n895_1726203_c1 3300050512 Unclassified 588
1174 Ga0495655_0107526 3300053083 Bacteria 834
1175 Ga0495655_0110957 3300053083 Bacteria 824
1176 Ga0587082_095928 3300059504 Unclassified 640
1177 Ga0466962_0014948 3300061719 Bacteria 3742
1178 Ga0466962_0020149 3300061719 Bacteria 3205
1179 Ga0466962_0031522 3300061719 Bacteria 2538
1180 Ga0466962_0035945 3300061719 Bacteria 2371
1181 Ga0466962_0059354 3300061719 Unclassified 1826
1182 Ga0070658_10703083
1183 JGI24741J21665_1013054
1184 JGI24741J21665_1013905
1185 JGI24740J21852_10005282
1186 JGI24740J21852_10013970
1187 JGI24740J21852_10092168
1188 JGI24739J22299_10075012
1189 JGI24737J22298_10034707
1190 JGI24737J22298_10079916
1191 JGI24737J22298_10132646
1192 JGI24743J22301_10117069
1193 JGI24735J21928_10007520
1194 JGI24735J21928_10028683
1195 JGI24735J21928_10070409
1196 JGI24735J21928_10116996
1197 Ga0065715_10613413
1198 Ga0070658_10044445
1199 Ga0070658_10053063
1200 Ga0070658_10053578
1201 Ga0070658_10054865
1202 Ga0070658_10057219
1203 Ga0070658_10111756
1204 Ga0070658_10122773
1205 Ga0070658_10256321
1206 Ga0070658_10319640
1207 Ga0070658_10462893
1208 Ga0070658_10531702
1209 Ga0070658_10568609
1210 Ga0070658_11103387
1211 Ga0070658_11427983
1212 Ga0070658_11864039
1213 Ga0070676_10183091
1214 Ga0070676_10343579
1215 Ga0070676_11091485
1216 Ga0070683_100029289
1217 Ga0070683_100045842
1218 Ga0070683_100058939
1219 Ga0070683_100379440
1220 Ga0070683_100600962
1221 Ga0070683_100950791
1222 Ga0070683_101245746
1223 Ga0070690_100094095
1224 Ga0070690_100608733
1225 Ga0070670_100117488
1226 Ga0070670_100246923
1227 Ga0070670_100375951
1228 Ga0070670_100452663
1229 Ga0070670_100580798
1230 Ga0068869_100025190
1231 Ga0070666_10093190
1232 Ga0070666_10122898
1233 Ga0070666_10148139
1234 Ga0070666_10157990
1235 Ga0070666_10202545
1236 Ga0070666_10219746
1237 Ga0070666_10264286
1238 Ga0070666_10456883
1239 Ga0070666_10687962
1240 Ga0070680_100002569
1241 Ga0070680_100015719
1242 Ga0070680_100039119
1243 Ga0070680_100200313
1244 Ga0070680_100213638
1245 Ga0070680_100467730
1246 Ga0070680_100602432
1247 Ga0070680_101467877
1248 Ga0070682_100004425
1249 Ga0070682_100048175
1250 Ga0070682_100098513
1251 Ga0070682_100117185
1252 Ga0070682_100198133
1253 Ga0070682_100215729
1254 Ga0068868_100044286
1255 Ga0068868_100113064
1256 Ga0068868_100173930
1257 Ga0068868_100192637
1258 Ga0068868_100620101
1259 Ga0068868_101035351
1260 Ga0068868_101058871
1261 Ga0070660_100006487
1262 Ga0070660_100032890
1263 Ga0070660_100074074
1264 Ga0070660_100101460
1265 Ga0070660_100112059
1266 Ga0070660_100165120
1267 Ga0070660_100187281
1268 Ga0070660_100243431
1269 Ga0070660_100261025
1270 Ga0070660_100313994
1271 Ga0070660_100505171
1272 Ga0070660_101513646
1273 Ga0070691_10011078
1274 Ga0070691_10066920
1275 Ga0070687_101019564
1276 Ga0070661_100007181
1277 Ga0070661_100028778
1278 Ga0070661_100033991
1279 Ga0070661_100055236
1280 Ga0070661_100064870
1281 Ga0070661_100105893
1282 Ga0070661_100131711
1283 Ga0070661_100146893
1284 Ga0070661_100189640
1285 Ga0070661_100258014
1286 Ga0070661_100452478
1287 Ga0070661_100709959
1288 Ga0070661_100882017
1289 Ga0070661_100904872
1290 Ga0070661_100997126
1291 Ga0070661_101030449
1292 Ga0070661_101215251
1293 Ga0070661_101628213
1294 Ga0070661_101792556
1295 Ga0070668_100060647
1296 Ga0070668_100462556
1297 Ga0070669_100708785
1298 Ga0070669_100815176
1299 Ga0070675_100647767
1300 Ga0070671_100011258
1301 Ga0070671_100059181
1302 Ga0070671_100064036
1303 Ga0070671_100288882
1304 Ga0070671_100508573
1305 Ga0070671_100619478
1306 Ga0070671_100877970
1307 Ga0070671_101000620
1308 Ga0070674_100010556
1309 Ga0070674_100032436
1310 Ga0070673_100027334
1311 Ga0070673_100041779
1312 Ga0070673_100072672
1313 Ga0070673_100116568
1314 Ga0070673_100164522
1315 Ga0070673_100652239
1316 Ga0070673_100696172
1317 Ga0070688_101188911
1318 Ga0070659_100006363
1319 Ga0070659_100010221
1320 Ga0070659_100024893
1321 Ga0070659_100042573
1322 Ga0070659_100066222
1323 Ga0070659_100074050
1324 Ga0070659_100084695
1325 Ga0070659_100112215
1326 Ga0070659_100261923
1327 Ga0070659_100307863
1328 Ga0070659_100426540
1329 Ga0070659_100674506
1330 Ga0070659_100858653
1331 Ga0070659_101041550
1332 Ga0070659_101076667
1333 Ga0070659_101114139
1334 Ga0070659_101531635
1335 Ga0070659_101629066
1336 Ga0070659_101874453
1337 Ga0070667_100044243
1338 Ga0070667_100051887
1339 Ga0070667_100069657
1340 Ga0070667_100350481
1341 Ga0070667_100452037
1342 Ga0070667_100494620
1343 Ga0070667_100679135
1344 Ga0070714_100024323
1345 Ga0070714_100143336
1346 Ga0070714_100144037
1347 Ga0070714_100463166
1348 Ga0070714_100510250
1349 Ga0070713_100260760
1350 Ga0070705_101571085
1351 Ga0070663_100015732
1352 Ga0070663_100045193
1353 Ga0070663_100060922
1354 Ga0070663_100096432
1355 Ga0070663_100102654
1356 Ga0070663_100111806
1357 Ga0070663_100326107
1358 Ga0070663_100389685
1359 Ga0070663_100484139
1360 Ga0070663_100782232
1361 Ga0070663_100927740
1362 Ga0070663_101665935
1363 Ga0070678_100002540
1364 Ga0070662_100192783
1365 Ga0070662_100275212
1366 Ga0070662_100314546
1367 Ga0070662_100416892
1368 Ga0070662_100430670
1369 Ga0070662_100466532
1370 Ga0070662_100741496
1371 Ga0070662_100794890
1372 Ga0070662_100883081
1373 Ga0070662_101283144
1374 Ga0070662_101330070
1375 Ga0070662_101693102
1376 Ga0070681_10037966
1377 Ga0070681_10082750
1378 Ga0070681_10215772
1379 Ga0070681_10322623
1380 Ga0070681_10756360
1381 Ga0070681_10803870
1382 Ga0070681_11634432
1383 Ga0070681_11724155
1384 Ga0068867_100160310
1385 Ga0068867_100244989
1386 Ga0070679_100024325
1387 Ga0070679_100062927
1388 Ga0070679_100101746
1389 Ga0070679_100202668
1390 Ga0070679_100354860
1391 Ga0070679_100415344
1392 Ga0070679_100467060
1393 Ga0070679_100649688
1394 Ga0070679_100868140
1395 Ga0070679_101049089
1396 Ga0070679_102056941
1397 Ga0070684_100015169
1398 Ga0070684_100064491
1399 Ga0070684_100132647
1400 Ga0068853_100005874
1401 Ga0068853_100072538
1402 Ga0068853_100138604
1403 Ga0068853_100147819
1404 Ga0068853_100281037
1405 Ga0068853_100297752
1406 Ga0068853_101163072
1407 Ga0068853_101259346
1408 Ga0070672_100132691
1409 Ga0070672_100198655
1410 Ga0070672_100311615
1411 Ga0070672_100543358
1412 Ga0070672_101055494
1413 Ga0070672_101555225
1414 Ga0070686_100032012
1415 Ga0070686_100239219
1416 Ga0070693_100013503
1417 Ga0070693_100159387
1418 Ga0070693_100161822
1419 Ga0070693_100879540
1420 Ga0070665_100068731
1421 Ga0070665_100352916
1422 Ga0070665_101080590
1423 Ga0070665_101114201
1424 Ga0070665_102562371
1425 Ga0068855_100016170
1426 Ga0068855_100067954
1427 Ga0068855_100070936
1428 Ga0068855_100154291
1429 Ga0068855_100177543
1430 Ga0068855_100318811
1431 Ga0068855_100336031
1432 Ga0068855_100561663
1433 Ga0068855_100692193
1434 Ga0068855_100996529
1435 Ga0068855_101393724
1436 Ga0068855_101642438
1437 Ga0068855_102221293
1438 Ga0070664_100002497
1439 Ga0070664_100006053
1440 Ga0070664_100007222
1441 Ga0070664_100011497
1442 Ga0070664_100034680
1443 Ga0070664_100042053
1444 Ga0070664_100080596
1445 Ga0070664_100128868
1446 Ga0070664_100278858
1447 Ga0070664_100432268
1448 Ga0070664_101077126
1449 Ga0068857_100005219
1450 Ga0068857_100039463
1451 Ga0068857_100062940
1452 Ga0068857_100069188
1453 Ga0068857_100146000
1454 Ga0068857_100209043
1455 Ga0068857_100362340
1456 Ga0068857_101245882
1457 Ga0068857_101250511
1458 Ga0068857_102066485
1459 Ga0068854_100002843
1460 Ga0068854_100003443
1461 Ga0068854_100003689
1462 Ga0068854_100022982
1463 Ga0068854_100030744
1464 Ga0068854_100084722
1465 Ga0068854_100096133
1466 Ga0068854_100118208
1467 Ga0068854_100206117
1468 Ga0068854_100246574
1469 Ga0068854_100317360
1470 Ga0068854_100332637
1471 Ga0068854_100401230
1472 Ga0068854_100873732
1473 Ga0068854_101016404
1474 Ga0068854_101254831
1475 Ga0068856_100007468
1476 Ga0068856_100011171
1477 Ga0068856_100014417
1478 Ga0068856_100042269
1479 Ga0068856_100083925
1480 Ga0068856_100203120
1481 Ga0068856_100231574
1482 Ga0068856_100327777
1483 Ga0068856_100530870
1484 Ga0068856_100558729
1485 Ga0068856_101374944
1486 Ga0068856_101904071
1487 Ga0068856_102072020
1488 Ga0068856_102296425
1489 Ga0070702_100356863
1490 Ga0068852_100003304
1491 Ga0068852_100029164
1492 Ga0068852_100041927
1493 Ga0068852_100067480
1494 Ga0068852_100068191
1495 Ga0068852_100168894
1496 Ga0068852_100207108
1497 Ga0068852_100280896
1498 Ga0068852_100346786
1499 Ga0068852_100403128
1500 Ga0068852_100440078
1501 Ga0068852_100542354
1502 Ga0068852_100689765
1503 Ga0068852_100931439
1504 Ga0068852_100941305
1505 Ga0068852_100984433
1506 Ga0068852_101002063
1507 Ga0068852_101022175
1508 Ga0068852_101081866
1509 Ga0068852_101135550
1510 Ga0068852_101593068
1511 Ga0068859_100177785
1512 Ga0068859_101318464
1513 Ga0068859_101763098
1514 Ga0068859_101908924
1515 Ga0068864_100001847
1516 Ga0068864_100004870
1517 Ga0068864_100357158
1518 Ga0068866_10010145
1519 Ga0068866_10088122
1520 Ga0068851_10003906
1521 Ga0068851_10013192
1522 Ga0068851_10191236
1523 Ga0068851_10215170
1524 Ga0068851_10229276
1525 Ga0068851_10510957
1526 Ga0068851_10742168
1527 Ga0068863_100002387
1528 Ga0068863_100008161
1529 Ga0068863_100375757
1530 Ga0068858_100031045
1531 Ga0068858_100063135
1532 Ga0068858_100302852
1533 Ga0068858_100307664
1534 Ga0068858_101555073
1535 Ga0068860_100180744
1536 Ga0068860_100316505
1537 Ga0068862_100122787
1538 Ga0081539_10079619
1539 Ga0070716_101656091
1540 Ga0070712_100160038
1541 Ga0097621_100025560
1542 Ga0097621_100331621
1543 Ga0097621_100586142
1544 Ga0068871_100178822
1545 Ga0068871_100344990
1546 Ga0075434_100260250
1547 Ga0097620_100165136
1548 Ga0097620_100177790
1549 Ga0097620_101318451
1550 Ga0097620_101763247
1551 Ga0097620_101909543
1552 Ga0105251_10039779
1553 Ga0105240_10016062
1554 Ga0105240_10052504
1555 Ga0105240_10147139
1556 Ga0105240_10415595
1557 Ga0105240_12613494
1558 Ga0105245_10119034
1559 Ga0105245_10128975
1560 Ga0105241_10662238
1561 Ga0105241_10694492
1562 Ga0105241_10942665
1563 Ga0105241_11249371
1564 Ga0105241_12145856
1565 Ga0105242_10056685
1566 Ga0105248_10047303
1567 Ga0105248_10296533
1568 Ga0105248_10752393
1569 Ga0105248_11047945
1570 Ga0105237_10007969
1571 Ga0105237_10010945
1572 Ga0105237_11068964
1573 Ga0105238_10006524
1574 Ga0105238_10010338
1575 Ga0105238_10069422
1576 Ga0105238_10096455
1577 Ga0105238_10183306
1578 Ga0105238_10189057
1579 Ga0105238_10699573
1580 Ga0105239_10012441
1581 Ga0105239_10117833
1582 Ga0105239_10786270
1583 Ga0105239_10932896
1584 Ga0105239_12819064
1585 Ga0105246_10044601
1586 Ga0105246_10227306
1587 Ga0105246_12062734
1588 Ga0105246_12342454
1589 Ga0157373_10001257
1590 Ga0157373_10010607
1591 Ga0157373_10034737
1592 Ga0157373_10037013
1593 Ga0157373_10054356
1594 Ga0157373_10056427
1595 Ga0157373_10056965
1596 Ga0157373_10092410
1597 Ga0157373_10166461
1598 Ga0157373_10208182
1599 Ga0157373_10230667
1600 Ga0157373_10270789
1601 Ga0157373_10290567
1602 Ga0157373_10359510
1603 Ga0157373_10429515
1604 Ga0157373_10501870
1605 Ga0157373_11079257
1606 Ga0157371_10062503
1607 Ga0157371_10065945
1608 Ga0157371_10085113
1609 Ga0157371_10118263
1610 Ga0157371_10124124
1611 Ga0157371_10129874
1612 Ga0157371_10225608
1613 Ga0157371_10266491
1614 Ga0157371_10309571
1615 Ga0157371_10315933
1616 Ga0157371_10334692
1617 Ga0157371_10609601
1618 Ga0157371_10680086
1619 Ga0157371_11101967
1620 Ga0157370_10016192
1621 Ga0157370_10052496
1622 Ga0157370_10151341
1623 Ga0157370_10156542
1624 Ga0157370_10254811
1625 Ga0157370_10338952
1626 Ga0157370_10379146
1627 Ga0157369_10004147
1628 Ga0157369_10040375
1629 Ga0157369_10082269
1630 Ga0157369_10354511
1631 Ga0157369_10415650
1632 Ga0157369_10430693
1633 Ga0157369_11048758
1634 Ga0157369_11107449
1635 Ga0157369_11138482
1636 Ga0157374_10058154
1637 Ga0157374_10211720
1638 Ga0157374_10320254
1639 Ga0157374_11014402
1640 Ga0157378_10024042
1641 Ga0157378_10207945
1642 Ga0157378_11682028
1643 Ga0163162_10006085
1644 Ga0163162_10203935
1645 Ga0163162_11735963
1646 Ga0157372_10003603
1647 Ga0157372_10032904
1648 Ga0157372_10212239
1649 Ga0157372_10294274
1650 Ga0157372_10380559
1651 Ga0157372_10422379
1652 Ga0157372_10506809
1653 Ga0157372_10688289
1654 Ga0157372_10710322
1655 Ga0157372_10787791
1656 Ga0157372_10939700
1657 Ga0157372_11343421
1658 Ga0157372_11805044
1659 Ga0157375_10108277
1660 Ga0157375_11022410
1661 Ga0157375_11668403
1662 Ga0157375_11668404
1663 Ga0163163_10163522
1664 Ga0163163_10404443
1665 Ga0163163_10670616
1666 Ga0157380_10867556
1667 Ga0182008_10076853
1668 Ga0182008_10400330
1669 Ga0182008_10409540
1670 Ga0157377_10286789
1671 Ga0157379_11173859
1672 Ga0157379_11173988
1673 Ga0157376_10065316
1674 Ga0157376_11007654
1675 Ga0163161_10527982
1676 Ga0206354_10065452
1677 Ga0206354_10104527
1678 Ga0206353_11031190
1679 Ga0206353_11257509
1680 Ga0213876_10038126
1681 Ga0207697_10005443
1682 Ga0207656_10014421
1683 Ga0207656_10019951
1684 Ga0207656_10183362
1685 Ga0207656_10744476
1686 Ga0207682_10056438
1687 Ga0207642_10032863
1688 Ga0207642_10079390
1689 Ga0207688_10010918
1690 Ga0207688_10878252
1691 Ga0207680_10124496
1692 Ga0207680_10125175
1693 Ga0207680_10380438
1694 Ga0207680_10843197
1695 Ga0207680_11160675
1696 Ga0207647_10000435
1697 Ga0207647_10001347
1698 Ga0207647_10002106
1699 Ga0207647_10048145
1700 Ga0207647_10087849
1701 Ga0207647_10169591
1702 Ga0207647_10400623
1703 Ga0207699_11078345
1704 Ga0207645_10087340
1705 Ga0207645_10114513
1706 Ga0207645_10303718
1707 Ga0207645_10365119
1708 Ga0207645_10887141
1709 Ga0207643_10033467
1710 Ga0207705_10002105
1711 Ga0207705_10014553
1712 Ga0207705_10016874
1713 Ga0207705_10018993
1714 Ga0207705_10020381
1715 Ga0207705_10039541
1716 Ga0207705_10050675
1717 Ga0207705_10053383
1718 Ga0207705_10091477
1719 Ga0207705_10110744
1720 Ga0207705_10234949
1721 Ga0207705_10322436
1722 Ga0207705_10339502
1723 Ga0207705_10342778
1724 Ga0207705_10355473
1725 Ga0207705_10367604
1726 Ga0207705_10579336
1727 Ga0207705_11013785
1728 Ga0207705_11076738
1729 Ga0207705_11292261
1730 Ga0207654_10195363
1731 Ga0207654_10607007
1732 Ga0207707_10082021
1733 Ga0207707_10092926
1734 Ga0207707_10120605
1735 Ga0207707_10123418
1736 Ga0207707_10301534
1737 Ga0207707_10352276
1738 Ga0207707_10397182
1739 Ga0207707_10713835
1740 Ga0207707_10868170
1741 Ga0207707_11006231
1742 Ga0207695_10024528
1743 Ga0207695_10030276
1744 Ga0207695_10111184
1745 Ga0207695_10183431
1746 Ga0207695_10896291
1747 Ga0207671_10021426
1748 Ga0207671_10206167
1749 Ga0207671_11543087
1750 Ga0207660_10000329
1751 Ga0207660_10009260
1752 Ga0207660_10021068
1753 Ga0207660_10107172
1754 Ga0207660_10164132
1755 Ga0207660_10669665
1756 Ga0207660_11201367
1757 Ga0207657_10003144
1758 Ga0207657_10006364
1759 Ga0207657_10013074
1760 Ga0207657_10015698
1761 Ga0207657_10028999
1762 Ga0207657_10030562
1763 Ga0207657_10048954
1764 Ga0207657_10053608
1765 Ga0207657_10056347
1766 Ga0207657_10082685
1767 Ga0207657_10104571
1768 Ga0207657_10110183
1769 Ga0207657_10120744
1770 Ga0207657_10147966
1771 Ga0207657_10301804
1772 Ga0207657_10461133
1773 Ga0207657_10943621
1774 Ga0207657_11319486
1775 Ga0207649_10004561
1776 Ga0207649_10016272
1777 Ga0207649_10022843
1778 Ga0207649_10036418
1779 Ga0207649_10078432
1780 Ga0207649_10298373
1781 Ga0207649_10321818
1782 Ga0207649_10346353
1783 Ga0207649_10409543
1784 Ga0207649_10446237
1785 Ga0207649_10532788
1786 Ga0207649_10657428
1787 Ga0207649_10889043
1788 Ga0207649_10933221
1789 Ga0207652_10032223
1790 Ga0207652_10076713
1791 Ga0207652_10173468
1792 Ga0207652_10252406
1793 Ga0207652_10533426
1794 Ga0207652_10814333
1795 Ga0207652_10936082
1796 Ga0207652_11135763
1797 Ga0207652_11676737
1798 Ga0207681_10431198
1799 Ga0207681_10692355
1800 Ga0207681_11139628
1801 Ga0207694_10004535
1802 Ga0207694_10011778
1803 Ga0207694_10112040
1804 Ga0207694_10284218
1805 Ga0207694_10771560
1806 Ga0207650_10024371
1807 Ga0207650_10347083
1808 Ga0207650_10661239
1809 Ga0207687_10071230
1810 Ga0207700_10568401
1811 Ga0207664_10076982
1812 Ga0207664_10077410
1813 Ga0207664_10125158
1814 Ga0207664_10137347
1815 Ga0207644_10003796
1816 Ga0207644_10025658
1817 Ga0207644_10191100
1818 Ga0207644_10566215
1819 Ga0207690_10003155
1820 Ga0207690_10012506
1821 Ga0207690_10030391
1822 Ga0207690_10117617
1823 Ga0207690_10146955
1824 Ga0207690_10264960
1825 Ga0207690_10350103
1826 Ga0207690_10394601
1827 Ga0207690_10395126
1828 Ga0207690_10424371
1829 Ga0207690_10684660
1830 Ga0207690_10833896
1831 Ga0207690_10882739
1832 Ga0207706_10002427
1833 Ga0207706_10040783
1834 Ga0207706_10077908
1835 Ga0207706_10092798
1836 Ga0207706_10092860
1837 Ga0207706_10151767
1838 Ga0207706_10184058
1839 Ga0207706_10410719
1840 Ga0207706_10513699
1841 Ga0207706_10514856
1842 Ga0207706_10550417
1843 Ga0207706_10777762
1844 Ga0207706_11651133
1845 Ga0207686_10013322
1846 Ga0207669_10087994
1847 Ga0207704_10058514
1848 Ga0207704_10088462
1849 Ga0207691_10128958
1850 Ga0207691_10149564
1851 Ga0207691_10166518
1852 Ga0207691_10461616
1853 Ga0207711_10011791
1854 Ga0207711_10136820
1855 Ga0207711_10359525
1856 Ga0207711_10754112
1857 Ga0207661_10050476
1858 Ga0207661_10051801
1859 Ga0207661_10070331
1860 Ga0207661_10142329
1861 Ga0207661_10249439
1862 Ga0207661_10353079
1863 Ga0207661_11046820
1864 Ga0207679_10117870
1865 Ga0207679_10269327
1866 Ga0207679_10274321
1867 Ga0207679_10314185
1868 Ga0207679_10474964
1869 Ga0207679_10537193
1870 Ga0207679_11276113
1871 Ga0207679_11297389
1872 Ga0207679_11717854
1873 Ga0207667_10022295
1874 Ga0207667_10032969
1875 Ga0207667_10050040
1876 Ga0207667_10193544
1877 Ga0207667_10205388
1878 Ga0207667_10263826
1879 Ga0207667_10370656
1880 Ga0207667_10586293
1881 Ga0207667_10621040
1882 Ga0207667_11128664
1883 Ga0207667_11669768
1884 Ga0207651_10016827
1885 Ga0207651_10076528
1886 Ga0207651_10186394
1887 Ga0207651_10266211
1888 Ga0207651_10717720
1889 Ga0207651_10953410
1890 Ga0207712_10153816
1891 Ga0207668_10191894
1892 Ga0207640_10008246
1893 Ga0207640_10014560
1894 Ga0207640_10015328
1895 Ga0207640_10025850
1896 Ga0207640_10078440
1897 Ga0207640_10117494
1898 Ga0207640_10209327
1899 Ga0207640_10212645
1900 Ga0207640_10462228
1901 Ga0207640_10550672
1902 Ga0207640_11702549
1903 Ga0207640_12100718
1904 Ga0207658_10093050
1905 Ga0207658_10143721
1906 Ga0207658_10728380
1907 Ga0207658_10738748
1908 Ga0207658_10778088
1909 Ga0207677_10260184
1910 Ga0207677_10605238
1911 Ga0207677_11838403
1912 Ga0207703_10040289
1913 Ga0207703_10065019
1914 Ga0207703_10254203
1915 Ga0207703_10324007
1916 Ga0207639_10000136
1917 Ga0207639_10049409
1918 Ga0207639_10086373
1919 Ga0207639_10237495
1920 Ga0207639_10302396
1921 Ga0207639_10411768
1922 Ga0207639_10476255
1923 Ga0207639_10512738
1924 Ga0207639_10549748
1925 Ga0207639_10657659
1926 Ga0207639_10662878
1927 Ga0207678_10005791
1928 Ga0207678_10009194
1929 Ga0207678_10010228
1930 Ga0207678_10019220
1931 Ga0207678_10034912
1932 Ga0207678_10035824
1933 Ga0207678_10151644
1934 Ga0207678_10308339
1935 Ga0207678_10393400
1936 Ga0207678_10441696
1937 Ga0207678_10683217
1938 Ga0207702_10011047
1939 Ga0207702_10046294
1940 Ga0207702_10051017
1941 Ga0207702_10055089
1942 Ga0207702_10103326
1943 Ga0207702_10167126
1944 Ga0207702_10283265
1945 Ga0207702_10373577
1946 Ga0207702_10461816
1947 Ga0207702_10603373
1948 Ga0207702_11930519
1949 Ga0207641_10010934
1950 Ga0207641_10020798
1951 Ga0207641_10319203
1952 Ga0207648_10001590
1953 Ga0207648_10021766
1954 Ga0207648_10047618
1955 Ga0207648_10887721
1956 Ga0207676_10074688
1957 Ga0207676_10201095
1958 Ga0207676_10416932
1959 Ga0207676_12478436
1960 Ga0207674_10000060
1961 Ga0207674_10001045
1962 Ga0207674_10003719
1963 Ga0207674_10007483
1964 Ga0207674_10028962
1965 Ga0207674_10030442
1966 Ga0207674_10031140
1967 Ga0207674_10061056
1968 Ga0207674_10249289
1969 Ga0207674_10403205
1970 Ga0207674_10877137
1971 Ga0207674_10892659
1972 Ga0207674_11377367
1973 Ga0207675_100328829
1974 Ga0207675_100483515
1975 Ga0207683_10001298
1976 Ga0207683_10013086
1977 Ga0207683_10039824
1978 Ga0207698_10001262
1979 Ga0207698_10002123
1980 Ga0207698_10010523
1981 Ga0207698_10013579
1982 Ga0207698_10075843
1983 Ga0207698_10136124
1984 Ga0207698_10349975
1985 Ga0207698_10433728
1986 Ga0207698_10485323
1987 Ga0207698_10595299
1988 Ga0207698_10599310
1989 Ga0207698_10654831
1990 Ga0207698_10826622
1991 Ga0207698_10849753
1992 Ga0207698_10946198
1993 Ga0207698_11001538
1994 Ga0207698_11125362
1995 Ga0207698_11384857
1996 Ga0207698_12301297
1997 Ga0207698_12418589
1998 Ga0268266_10023288
1999 Ga0268266_10211299
2000 Ga0268266_10784070
2001 Ga0268266_11072106
2002 Ga0268265_10054539
2003 Ga0307408_100159796
2004 Ga0307405_10078836
2005 Ga0307405_10735239
2006 Ga0307413_10079744
2007 Ga0307409_100024402
2008 Ga0307409_100724732
2009 Ga0307414_10936621
2010 Ga0307415_100001570
2011 Ga0373930_0086937
2012 Ga0373936_0113544
2013 Ga0373941_0200978
2014 Ga0373943_0005760
2015 Ga0373942_0055592
2016 Ga0373931_0161264
2017 Ga0373935_0067849
2018 Ga0373935_0235457
2019 Ga0373927_0027849
2020 Ga0373947_0045254
2021 Ga0373925_0108896
2022 Ga0395899_0007176
2023 Ga0395899_0011485
2024 Ga0395899_0028968
2025 Ga0395899_0041307
2026 Ga0395899_0048245
2027 Ga0395899_0060615
2028 Ga0395899_0162733
2029 Ga0395899_0166656
2030 Ga0395899_0188925
2031 Ga0395899_0198354
2032 Ga0395899_0289704
2033 Ga0395899_0289778
2034 Ga0395899_0534923
2035 Ga0395899_0579217
2036 Ga0395899_0634894
2037 Ga0395899_0778312
2038 Ga0395900_0001394
2039 Ga0395900_0008469
2040 Ga0395900_0010426
2041 Ga0395900_0030033
2042 Ga0395900_0032876
2043 Ga0395900_0050492
2044 Ga0395900_0052102
2045 Ga0395900_0062387
2046 Ga0395900_0077109
2047 Ga0395900_0089904
2048 Ga0395900_0105747
2049 Ga0395900_0126300
2050 Ga0395900_0163867
2051 Ga0395900_0230756
2052 Ga0395900_0234653
2053 Ga0395900_0249016
2054 Ga0395900_0288714
2055 Ga0395900_0356664
2056 Ga0395900_0362485
2057 Ga0395900_0362494
2058 Ga0395900_0385103
2059 Ga0395900_0387076
2060 Ga0395900_0417831
2061 Ga0395900_0493040
2062 Ga0395900_0544519
2063 Ga0395900_0652225
2064 Ga0395900_0781778
2065 Ga0395900_0846033
2066 Ga0395900_0870704
2067 Ga0395900_0899413
2068 Ga0395900_0944048
2069 Ga0395900_0964745
2070 Ga0395900_1032351
2071 Ga0395900_1064233
2072 Ga0395900_1232172
2073 Ga0395900_1488730
2074 Ga0395900_1529328
2075 Ga0395900_1543227
2076 Ga0395900_1922681
2077 Ga0395898_0001185
2078 Ga0395898_0020458
2079 Ga0395898_0021682
2080 Ga0395898_0028633
2081 Ga0395898_0059285
2082 Ga0395898_0076497
2083 Ga0395898_0092031
2084 Ga0395898_0106321
2085 Ga0395898_0107720
2086 Ga0395898_0117210
2087 Ga0395898_0117953
2088 Ga0395898_0183993
2089 Ga0395898_0204455
2090 Ga0395898_0356728
2091 Ga0395898_0445476
2092 Ga0395898_0498012
2093 Ga0395898_0527479
2094 Ga0395898_0568508
2095 Ga0395898_0662130
2096 Ga0395898_0959677
2097 Ga0395898_1518654
2098 Ga0395905_0001106
2099 Ga0395905_0010576
2100 Ga0395905_0014304
2101 Ga0395905_0016298
2102 Ga0395905_0031856
2103 Ga0395905_0032788
2104 Ga0395905_0036038
2105 Ga0395905_0038261
2106 Ga0395905_0052633
2107 Ga0395905_0053348
2108 Ga0395905_0062751
2109 Ga0395905_0072984
2110 Ga0395905_0074226
2111 Ga0395905_0076337
2112 Ga0395905_0098783
2113 Ga0395905_0103052
2114 Ga0395905_0108175
2115 Ga0395905_0119008
2116 Ga0395905_0120488
2117 Ga0395905_0131695
2118 Ga0395905_0138196
2119 Ga0395905_0144948
2120 Ga0395905_0182500
2121 Ga0395905_0225481
2122 Ga0395905_0228058
2123 Ga0395905_0273366
2124 Ga0395905_0280800
2125 Ga0395905_0303029
2126 Ga0395905_0357253
2127 Ga0395905_0384232
2128 Ga0395905_0388187
2129 Ga0395905_0392463
2130 Ga0395905_0423506
2131 Ga0395905_0424110
2132 Ga0395905_0427279
2133 Ga0395905_0440465
2134 Ga0395905_0441742
2135 Ga0395905_0444228
2136 Ga0395905_0553863
2137 Ga0395905_0560226
2138 Ga0395905_0612801
2139 Ga0395905_0676216
2140 Ga0395905_0741953
2141 Ga0395905_0801251
2142 Ga0395905_0858665
2143 Ga0395905_0862866
2144 Ga0395905_0875123
2145 Ga0395905_0881948
2146 Ga0395905_0959312
2147 Ga0395905_1042050
2148 Ga0395905_1236403
2149 Ga0395905_1274942
2150 Ga0395901_0001061
2151 Ga0395901_0001163
2152 Ga0395901_0020488
2153 Ga0395901_0023391
2154 Ga0395901_0030902
2155 Ga0395901_0036445
2156 Ga0395901_0047208
2157 Ga0395901_0048224
2158 Ga0395901_0058387
2159 Ga0395901_0083658
2160 Ga0395901_0108802
2161 Ga0395901_0109032
2162 Ga0395901_0137818
2163 Ga0395901_0163103
2164 Ga0395901_0217738
2165 Ga0395901_0221989
2166 Ga0395901_0232981
2167 Ga0395901_0235765
2168 Ga0395901_0243877
2169 Ga0395901_0249652
2170 Ga0395901_0286832
2171 Ga0395901_0306317
2172 Ga0395901_0484895
2173 Ga0395901_0512652
2174 Ga0395901_0526357
2175 Ga0395901_0638789
2176 Ga0395901_0669103
2177 Ga0395901_0677574
2178 Ga0395901_0700726
2179 Ga0395901_0704142
2180 Ga0395901_0820975
2181 Ga0395901_0855763
2182 Ga0395901_0961663
2183 Ga0395901_0972153
2184 Ga0395901_1122761
2185 Ga0395901_1148312
2186 Ga0395901_1561287
2187 Ga0436365_0782179
2188 Ga0436363_1101143
2189 Ga0451833_1137545
2190 Ga0439448_0004818
2191 Ga0439455_0007660
2192 Ga0439458_0001158
2193 Ga0439458_0002397
2194 Ga0466969_0002083
2195 Ga0466969_0290935
2196 Ga0466969_0448194
2197 Ga0466972_0186083
2198 Ga0466972_0210210
2199 Ga0466972_0215908
2200 Ga0466965_0054675
2201 Ga0466965_0221794
2202 Ga0466965_0361391
2203 Ga0466965_0431489
2204 Ga0466966_0011598
2205 Ga0466966_0051282
2206 Ga0466966_0061319
2207 Ga0466966_0066066
2208 Ga0466966_0090027
2209 Ga0466966_0211528
2210 Ga0466966_0239076
2211 Ga0466966_0756004
2212 Ga0466961_0010281
2213 Ga0466961_0080430
2214 Ga0466961_0080884
2215 Ga0466961_0419055
2216 Ga0466961_0706071
2217 Ga0466961_0741010
2218 Ga0466961_0902049
2219 Ga0466963_0009505
2220 Ga0466963_0032247
2221 Ga0466963_0047261
2222 Ga0466963_0054072
2223 Ga0466963_0091743
2224 Ga0466963_0106172
2225 Ga0466963_0116869
2226 Ga0466963_0155478
2227 Ga0466963_0277581
2228 Ga0466964_0041650
2229 Ga0466964_0387949
2230 Ga0466971_0115332
2231 Ga0466971_0203693
2232 Ga0466970_0231605
2233 Ga0466970_0413123
2234 Ga0466957_0001719
2235 Ga0466957_0013241
2236 Ga0466957_0014687
2237 Ga0466957_0082779
2238 Ga0466957_0213806
2239 Ga0466957_0227569
2240 Ga0466957_0371761
2241 Ga0466957_0680879
2242 Ga0466960_0086474
2243 Ga0466960_0098857
2244 Ga0466960_0142410
2245 Ga0466960_0459758
2246 Ga0466959_0017690
2247 Ga0466959_0160720
2248 Ga0466959_0176301
2249 Ga0466959_0183145
2250 Ga0466959_0246788
2251 Ga0466959_0253412
2252 Ga0466959_0355493
2253 Ga0466959_0362362
2254 Ga0466959_0502149
2255 Ga0466958_0019636
2256 Ga0466958_0070951
2257 Ga0466958_0123938
2258 Ga0466958_0156375
2259 Ga0466958_0238589
2260 Ga0466958_0302158
2261 Ga0466958_0359426
2262 Ga0466967_0004351
2263 Ga0466967_0006660
2264 Ga0466967_0044291
2265 Ga0466967_0057541
2266 Ga0466967_0094909
2267 Ga0466967_0124917
2268 Ga0466967_0151722
2269 Ga0466967_0173258
2270 Ga0466967_0174154
2271 Ga0466967_0228094
2272 Ga0466967_0263513
2273 Ga0466967_0301163
2274 Ga0466967_0363541
2275 Ga0466967_0384863
2276 Ga0466967_0595311
2277 Ga0466967_0893509
2278 Ga0466967_1273524
2279 Ga0466967_1504135
2280 Ga0466967_1900475
2281 Ga0466967_2210044
2282 Ga0495610_0171939
2283 Ga0495643_0232867
2284 Ga0495663_0006214
2285 Ga0495642_0217615
2286 Ga0495668_0010412
2287 Ga0495669_0000119
2288 Ga0495669_0010895
2289 Ga0495669_0023305
2290 Ga0495669_0125188
2291 Ga0495669_0156128
2292 Ga0495669_0494072
2293 Ga0495600_0776801
2294 Ga0495677_0031713
2295 Ga0496100_0062051
2296 Ga0496101_0151018
2297 Ga0496101_0178459
2298 Ga0496101_0188141
2299 Ga0496101_0378573
2300 Ga0496101_0425945
2301 Ga0496102_0054392
2302 Ga0496102_0173186
2303 Ga0496102_0795211
2304 Ga0496102_1872314
2305 Ga0496103_0672443
2306 Ga0496104_0565201
2307 Ga0496104_0793894
2308 Ga0496104_1441164
2309 Ga0496105_0164931
2310 Ga0496106_0614659
2311 Ga0496106_0951890
2312 Ga0496107_0056655
2313 Ga0496107_0084052
2314 Ga0496107_0134480
2315 Ga0496107_0340462
2316 Ga0496107_1336910
2317 Ga0496108_0039210
2318 Ga0496108_0142175
2319 Ga0496109_0369747
2320 Ga0496109_0535874
2321 Ga0496109_0554142
2322 Ga0496109_0927580
2323 Ga0496109_1135116
2324 Ga0496110_0036598
2325 Ga0496110_0048084
2326 Ga0496110_0058050
2327 Ga0496110_0091694
2328 Ga0496110_0091986
2329 Ga0496110_0210809
2330 Ga0496111_0017004
2331 Ga0496111_0048239
2332 Ga0496111_0644684
2333 Ga0496111_1031320
2334 Ga0496112_0005611
2335 Ga0496112_0006998
2336 Ga0496112_0020968
2337 Ga0496112_0026749
2338 Ga0496112_0038409
2339 Ga0496112_0186641
2340 Ga0496112_0403305
2341 Ga0496112_1197434
2342 Ga0496113_0056778
2343 Ga0496113_0066812
2344 Ga0496113_0210884
2345 Ga0496113_0211392
2346 Ga0501067_0248786
2347 Ga0501067_0650534
2348 Ga0501067_0670497
2349 Ga0501067_0847476
2350 Ga0501070_0217149
2351 Ga0501080_0072631
2352 Ga0501081_1172241
2353 Ga0501241_121567
2354 nmdc:mga0n895_1726203_c1
2355 Ga0495655_0107526
2356 Ga0495655_0110957
2357 Ga0587082_095928
2358 Ga0466962_0014948
2359 Ga0466962_0020149
2360 Ga0466962_0031522
2361 Ga0466962_0035945
2362 Ga0466962_0059354

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gom-assembly1.cif.gz_A truncated mitofusin-1, transition-like state 0.8974 43 102
5yew-assembly2.cif.gz_C-2 structural basis for gtp hydrolysis and conformational change of mitofusin 1 in mediating mitochondrial fusion 0.8841 39 102
5yew-assembly1.cif.gz_A structural basis for gtp hydrolysis and conformational change of mitofusin 1 in mediating mitochondrial fusion 0.8774 39 102
6rn5-assembly1.cif.gz_A-2 ppta from streptomyces chartreusis 0.7762 45 103
5yny-assembly1.cif.gz_A structure of house dust mite allergen der f 21 in peg2kmme 0.7719 19 106
ID Description Score Start End Superfamily
af_Q54XF9_6_149_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8743 49 95 1.20.1260.10
3mq1A01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8706 43 106 1.20.58.970
3mq1C01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8558 43 106 1.20.58.970
3mq1F01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8518 43 106 1.20.58.970
af_Q20410_5_311_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8406 43 102 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A537MAY9-F1-model_v4 Uncharacterized protein 0.8979 8 110 GO:0016020
AF-A0A2U1FWS9-F1-model_v4 deleted 0.8883 2 110
AF-W6W510-F1-model_v4 RHS repeat-associated core domain containing protein-containing protein 0.8824 46 101
AF-A0A7S4EBW8-F1-model_v4 Peptidylprolyl isomerase 0.8802 15 96
AF-A0A2U1FWS9-F1-model_v4 deleted 0.8734 2 110

Map