F491302
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1181 | 223 | 2362 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10703083|Ga0070658_107030832 |
| Length | 124 |
| Sequence | MDPGLPDDLLGASAVNSERIRDGFMPWAGLALGTAGFFLAHQVGSDATFQDCRVGSPWIVVLGTIAALAILGVGALGSWRVYAARSESPARRLVAVVGLLASALYAIAVLLPLIAALVIPRCWA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 158 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 159 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 160 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 167 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 174 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 175 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 176 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 177 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 178 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 179 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 180 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 181 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 182 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 183 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 184 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 185 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 186 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 187 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 188 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 189 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 190 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 191 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 207 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 208 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 212 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 220 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.32 |
| Rhizosphere | 95.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 30.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10703083 | 3300005327 | Bacteria | 877 |
| 2 | JGI24741J21665_1013054 | 3300001915 | Unclassified | 1416 |
| 3 | JGI24741J21665_1013905 | 3300001915 | Bacteria | 1354 |
| 4 | JGI24740J21852_10005282 | 3300001979 | Bacteria | 5482 |
| 5 | JGI24740J21852_10013970 | 3300001979 | Bacteria | 2976 |
| 6 | JGI24740J21852_10092168 | 3300001979 | Unclassified | 780 |
| 7 | JGI24739J22299_10075012 | 3300001989 | Unclassified | 1046 |
| 8 | JGI24737J22298_10034707 | 3300001990 | Bacteria | 1563 |
| 9 | JGI24737J22298_10079916 | 3300001990 | Bacteria | 973 |
| 10 | JGI24737J22298_10132646 | 3300001990 | Unclassified | 736 |
| 11 | JGI24743J22301_10117069 | 3300001991 | Unclassified | 582 |
| 12 | JGI24735J21928_10007520 | 3300002067 | Bacteria | 3551 |
| 13 | JGI24735J21928_10028683 | 3300002067 | Unclassified | 1661 |
| 14 | JGI24735J21928_10070409 | 3300002067 | Unclassified | 1002 |
| 15 | JGI24735J21928_10116996 | 3300002067 | Unclassified | 767 |
| 16 | Ga0065715_10613413 | 3300005293 | Unclassified | 697 |
| 17 | Ga0070658_10044445 | 3300005327 | Bacteria | 3590 |
| 18 | Ga0070658_10053063 | 3300005327 | Bacteria | 3290 |
| 19 | Ga0070658_10053578 | 3300005327 | Bacteria | 3275 |
| 20 | Ga0070658_10054865 | 3300005327 | Bacteria | 3236 |
| 21 | Ga0070658_10057219 | 3300005327 | Bacteria | 3171 |
| 22 | Ga0070658_10111756 | 3300005327 | Bacteria | 2264 |
| 23 | Ga0070658_10122773 | 3300005327 | Bacteria | 2159 |
| 24 | Ga0070658_10256321 | 3300005327 | Bacteria | 1485 |
| 25 | Ga0070658_10319640 | 3300005327 | Unclassified | 1325 |
| 26 | Ga0070658_10462893 | 3300005327 | Unclassified | 1093 |
| 27 | Ga0070658_10531702 | 3300005327 | Bacteria | 1017 |
| 28 | Ga0070658_10568609 | 3300005327 | Bacteria | 981 |
| 29 | Ga0070658_11103387 | 3300005327 | Unclassified | 690 |
| 30 | Ga0070658_11427983 | 3300005327 | Unclassified | 600 |
| 31 | Ga0070658_11864039 | 3300005327 | Bacteria | 520 |
| 32 | Ga0070676_10183091 | 3300005328 | Unclassified | 1363 |
| 33 | Ga0070676_10343579 | 3300005328 | Unclassified | 1024 |
| 34 | Ga0070676_11091485 | 3300005328 | Unclassified | 603 |
| 35 | Ga0070683_100029289 | 3300005329 | Bacteria | 4982 |
| 36 | Ga0070683_100045842 | 3300005329 | Bacteria | 4036 |
| 37 | Ga0070683_100058939 | 3300005329 | Bacteria | 3567 |
| 38 | Ga0070683_100379440 | 3300005329 | Unclassified | 1347 |
| 39 | Ga0070683_100600962 | 3300005329 | Unclassified | 1053 |
| 40 | Ga0070683_100950791 | 3300005329 | Unclassified | 825 |
| 41 | Ga0070683_101245746 | 3300005329 | Bacteria | 715 |
| 42 | Ga0070690_100094095 | 3300005330 | Unclassified | 1977 |
| 43 | Ga0070690_100608733 | 3300005330 | Bacteria | 830 |
| 44 | Ga0070670_100117488 | 3300005331 | Bacteria | 2294 |
| 45 | Ga0070670_100246923 | 3300005331 | Bacteria | 1554 |
| 46 | Ga0070670_100375951 | 3300005331 | Bacteria | 1251 |
| 47 | Ga0070670_100452663 | 3300005331 | Bacteria | 1138 |
| 48 | Ga0070670_100580798 | 3300005331 | Unclassified | 1001 |
| 49 | Ga0068869_100025190 | 3300005334 | Bacteria | 4128 |
| 50 | Ga0070666_10093190 | 3300005335 | Bacteria | 2071 |
| 51 | Ga0070666_10122898 | 3300005335 | Unclassified | 1801 |
| 52 | Ga0070666_10148139 | 3300005335 | Bacteria | 1637 |
| 53 | Ga0070666_10157990 | 3300005335 | Unclassified | 1584 |
| 54 | Ga0070666_10202545 | 3300005335 | Bacteria | 1396 |
| 55 | Ga0070666_10219746 | 3300005335 | Unclassified | 1340 |
| 56 | Ga0070666_10264286 | 3300005335 | Bacteria | 1220 |
| 57 | Ga0070666_10456883 | 3300005335 | Unclassified | 923 |
| 58 | Ga0070666_10687962 | 3300005335 | Unclassified | 749 |
| 59 | Ga0070680_100002569 | 3300005336 | Bacteria | 13424 |
| 60 | Ga0070680_100015719 | 3300005336 | Bacteria | 5941 |
| 61 | Ga0070680_100039119 | 3300005336 | Bacteria | 3838 |
| 62 | Ga0070680_100200313 | 3300005336 | Bacteria | 1684 |
| 63 | Ga0070680_100213638 | 3300005336 | Bacteria | 1628 |
| 64 | Ga0070680_100467730 | 3300005336 | Bacteria | 1077 |
| 65 | Ga0070680_100602432 | 3300005336 | Bacteria | 943 |
| 66 | Ga0070680_101467877 | 3300005336 | Bacteria | 591 |
| 67 | Ga0070682_100004425 | 3300005337 | Bacteria | 7798 |
| 68 | Ga0070682_100048175 | 3300005337 | Plasmid | 2653 |
| 69 | Ga0070682_100098513 | 3300005337 | Bacteria | 1926 |
| 70 | Ga0070682_100117185 | 3300005337 | Bacteria | 1783 |
| 71 | Ga0070682_100198133 | 3300005337 | Bacteria | 1415 |
| 72 | Ga0070682_100215729 | 3300005337 | Bacteria | 1363 |
| 73 | Ga0068868_100044286 | 3300005338 | Bacteria | 3479 |
| 74 | Ga0068868_100113064 | 3300005338 | Unclassified | 2207 |
| 75 | Ga0068868_100173930 | 3300005338 | Unclassified | 1784 |
| 76 | Ga0068868_100192637 | 3300005338 | Unclassified | 1696 |
| 77 | Ga0068868_100620101 | 3300005338 | Unclassified | 960 |
| 78 | Ga0068868_101035351 | 3300005338 | Unclassified | 752 |
| 79 | Ga0068868_101058871 | 3300005338 | Unclassified | 744 |
| 80 | Ga0070660_100006487 | 3300005339 | Bacteria | 8114 |
| 81 | Ga0070660_100032890 | 3300005339 | Bacteria | 3906 |
| 82 | Ga0070660_100074074 | 3300005339 | Bacteria | 2663 |
| 83 | Ga0070660_100101460 | 3300005339 | Unclassified | 2280 |
| 84 | Ga0070660_100112059 | 3300005339 | Bacteria | 2171 |
| 85 | Ga0070660_100165120 | 3300005339 | Bacteria | 1786 |
| 86 | Ga0070660_100187281 | 3300005339 | Bacteria | 1676 |
| 87 | Ga0070660_100243431 | 3300005339 | Bacteria | 1465 |
| 88 | Ga0070660_100261025 | 3300005339 | Bacteria | 1414 |
| 89 | Ga0070660_100313994 | 3300005339 | Bacteria | 1286 |
| 90 | Ga0070660_100505171 | 3300005339 | Unclassified | 1006 |
| 91 | Ga0070660_101513646 | 3300005339 | Bacteria | 571 |
| 92 | Ga0070691_10011078 | 3300005341 | Bacteria | 4118 |
| 93 | Ga0070691_10066920 | 3300005341 | Unclassified | 1737 |
| 94 | Ga0070687_101019564 | 3300005343 | Unclassified | 601 |
| 95 | Ga0070661_100007181 | 3300005344 | Bacteria | 7675 |
| 96 | Ga0070661_100028778 | 3300005344 | Bacteria | 4009 |
| 97 | Ga0070661_100033991 | 3300005344 | Bacteria | 3696 |
| 98 | Ga0070661_100055236 | 3300005344 | Bacteria | 2908 |
| 99 | Ga0070661_100064870 | 3300005344 | Bacteria | 2684 |
| 100 | Ga0070661_100105893 | 3300005344 | Unclassified | 2097 |
| 101 | Ga0070661_100131711 | 3300005344 | Bacteria | 1879 |
| 102 | Ga0070661_100146893 | 3300005344 | Bacteria | 1780 |
| 103 | Ga0070661_100189640 | 3300005344 | Bacteria | 1567 |
| 104 | Ga0070661_100258014 | 3300005344 | Bacteria | 1347 |
| 105 | Ga0070661_100452478 | 3300005344 | Bacteria | 1022 |
| 106 | Ga0070661_100709959 | 3300005344 | Unclassified | 820 |
| 107 | Ga0070661_100882017 | 3300005344 | Unclassified | 738 |
| 108 | Ga0070661_100904872 | 3300005344 | Unclassified | 728 |
| 109 | Ga0070661_100997126 | 3300005344 | Unclassified | 695 |
| 110 | Ga0070661_101030449 | 3300005344 | Archaea | 683 |
| 111 | Ga0070661_101215251 | 3300005344 | Bacteria | 631 |
| 112 | Ga0070661_101628213 | 3300005344 | Unclassified | 546 |
| 113 | Ga0070661_101792556 | 3300005344 | Archaea | 521 |
| 114 | Ga0070668_100060647 | 3300005347 | Bacteria | 2930 |
| 115 | Ga0070668_100462556 | 3300005347 | Unclassified | 1092 |
| 116 | Ga0070669_100708785 | 3300005353 | Bacteria | 850 |
| 117 | Ga0070669_100815176 | 3300005353 | Unclassified | 794 |
| 118 | Ga0070675_100647767 | 3300005354 | Bacteria | 960 |
| 119 | Ga0070671_100011258 | 3300005355 | Bacteria | 7186 |
| 120 | Ga0070671_100059181 | 3300005355 | Bacteria | 3188 |
| 121 | Ga0070671_100064036 | 3300005355 | Bacteria | 3062 |
| 122 | Ga0070671_100288882 | 3300005355 | Bacteria | 1395 |
| 123 | Ga0070671_100508573 | 3300005355 | Unclassified | 1036 |
| 124 | Ga0070671_100619478 | 3300005355 | Unclassified | 936 |
| 125 | Ga0070671_100877970 | 3300005355 | Unclassified | 783 |
| 126 | Ga0070671_101000620 | 3300005355 | Unclassified | 732 |
| 127 | Ga0070674_100010556 | 3300005356 | Bacteria | 5589 |
| 128 | Ga0070674_100032436 | 3300005356 | Bacteria | 3468 |
| 129 | Ga0070673_100027334 | 3300005364 | Bacteria | 4228 |
| 130 | Ga0070673_100041779 | 3300005364 | Bacteria | 3530 |
| 131 | Ga0070673_100072672 | 3300005364 | Bacteria | 2767 |
| 132 | Ga0070673_100116568 | 3300005364 | Bacteria | 2222 |
| 133 | Ga0070673_100164522 | 3300005364 | Unclassified | 1889 |
| 134 | Ga0070673_100652239 | 3300005364 | Unclassified | 963 |
| 135 | Ga0070673_100696172 | 3300005364 | Bacteria | 933 |
| 136 | Ga0070688_101188911 | 3300005365 | Bacteria | 612 |
| 137 | Ga0070659_100006363 | 3300005366 | Bacteria | 8529 |
| 138 | Ga0070659_100010221 | 3300005366 | Bacteria | 6903 |
| 139 | Ga0070659_100024893 | 3300005366 | Bacteria | 4592 |
| 140 | Ga0070659_100042573 | 3300005366 | Bacteria | 3551 |
| 141 | Ga0070659_100066222 | 3300005366 | Plasmid | 2862 |
| 142 | Ga0070659_100074050 | 3300005366 | Bacteria | 2712 |
| 143 | Ga0070659_100084695 | 3300005366 | Bacteria | 2535 |
| 144 | Ga0070659_100112215 | 3300005366 | Bacteria | 2201 |
| 145 | Ga0070659_100261923 | 3300005366 | Bacteria | 1435 |
| 146 | Ga0070659_100307863 | 3300005366 | Bacteria | 1322 |
| 147 | Ga0070659_100426540 | 3300005366 | Unclassified | 1122 |
| 148 | Ga0070659_100674506 | 3300005366 | Bacteria | 892 |
| 149 | Ga0070659_100858653 | 3300005366 | Unclassified | 791 |
| 150 | Ga0070659_101041550 | 3300005366 | Unclassified | 719 |
| 151 | Ga0070659_101076667 | 3300005366 | Unclassified | 708 |
| 152 | Ga0070659_101114139 | 3300005366 | Unclassified | 696 |
| 153 | Ga0070659_101531635 | 3300005366 | Bacteria | 594 |
| 154 | Ga0070659_101629066 | 3300005366 | Archaea | 576 |
| 155 | Ga0070659_101874453 | 3300005366 | Bacteria | 537 |
| 156 | Ga0070667_100044243 | 3300005367 | Bacteria | 3738 |
| 157 | Ga0070667_100051887 | 3300005367 | Bacteria | 3458 |
| 158 | Ga0070667_100069657 | 3300005367 | Bacteria | 2994 |
| 159 | Ga0070667_100350481 | 3300005367 | Bacteria | 1336 |
| 160 | Ga0070667_100452037 | 3300005367 | Bacteria | 1174 |
| 161 | Ga0070667_100494620 | 3300005367 | Bacteria | 1121 |
| 162 | Ga0070667_100679135 | 3300005367 | Bacteria | 952 |
| 163 | Ga0070714_100024323 | 3300005435 | Bacteria | 4985 |
| 164 | Ga0070714_100143336 | 3300005435 | Unclassified | 2147 |
| 165 | Ga0070714_100144037 | 3300005435 | Bacteria | 2142 |
| 166 | Ga0070714_100463166 | 3300005435 | Bacteria | 1205 |
| 167 | Ga0070714_100510250 | 3300005435 | Unclassified | 1147 |
| 168 | Ga0070713_100260760 | 3300005436 | Unclassified | 1584 |
| 169 | Ga0070705_101571085 | 3300005440 | Unclassified | 553 |
| 170 | Ga0070663_100015732 | 3300005455 | Bacteria | 4894 |
| 171 | Ga0070663_100045193 | 3300005455 | Unclassified | 3110 |
| 172 | Ga0070663_100060922 | 3300005455 | Bacteria | 2716 |
| 173 | Ga0070663_100096432 | 3300005455 | Bacteria | 2200 |
| 174 | Ga0070663_100102654 | 3300005455 | Bacteria | 2136 |
| 175 | Ga0070663_100111806 | 3300005455 | Bacteria | 2053 |
| 176 | Ga0070663_100326107 | 3300005455 | Bacteria | 1236 |
| 177 | Ga0070663_100389685 | 3300005455 | Bacteria | 1136 |
| 178 | Ga0070663_100484139 | 3300005455 | Bacteria | 1025 |
| 179 | Ga0070663_100782232 | 3300005455 | Unclassified | 817 |
| 180 | Ga0070663_100927740 | 3300005455 | Bacteria | 753 |
| 181 | Ga0070663_101665935 | 3300005455 | Unclassified | 570 |
| 182 | Ga0070678_100002540 | 3300005456 | Bacteria | 10011 |
| 183 | Ga0070662_100192783 | 3300005457 | Bacteria | 1613 |
| 184 | Ga0070662_100275212 | 3300005457 | Unclassified | 1360 |
| 185 | Ga0070662_100314546 | 3300005457 | Bacteria | 1275 |
| 186 | Ga0070662_100416892 | 3300005457 | Bacteria | 1110 |
| 187 | Ga0070662_100430670 | 3300005457 | Bacteria | 1092 |
| 188 | Ga0070662_100466532 | 3300005457 | Unclassified | 1050 |
| 189 | Ga0070662_100741496 | 3300005457 | Bacteria | 833 |
| 190 | Ga0070662_100794890 | 3300005457 | Unclassified | 804 |
| 191 | Ga0070662_100883081 | 3300005457 | Bacteria | 762 |
| 192 | Ga0070662_101283144 | 3300005457 | Unclassified | 630 |
| 193 | Ga0070662_101330070 | 3300005457 | Bacteria | 618 |
| 194 | Ga0070662_101693102 | 3300005457 | Unclassified | 546 |
| 195 | Ga0070681_10037966 | 3300005458 | Bacteria | 4830 |
| 196 | Ga0070681_10082750 | 3300005458 | Bacteria | 3164 |
| 197 | Ga0070681_10215772 | 3300005458 | Bacteria | 1835 |
| 198 | Ga0070681_10322623 | 3300005458 | Bacteria | 1454 |
| 199 | Ga0070681_10756360 | 3300005458 | Unclassified | 888 |
| 200 | Ga0070681_10803870 | 3300005458 | Bacteria | 857 |
| 201 | Ga0070681_11634432 | 3300005458 | Unclassified | 570 |
| 202 | Ga0070681_11724155 | 3300005458 | Bacteria | 553 |
| 203 | Ga0068867_100160310 | 3300005459 | Bacteria | 1773 |
| 204 | Ga0068867_100244989 | 3300005459 | Unclassified | 1455 |
| 205 | Ga0070679_100024325 | 3300005530 | Bacteria | 5935 |
| 206 | Ga0070679_100062927 | 3300005530 | Bacteria | 3699 |
| 207 | Ga0070679_100101746 | 3300005530 | Bacteria | 2860 |
| 208 | Ga0070679_100202668 | 3300005530 | Bacteria | 1949 |
| 209 | Ga0070679_100354860 | 3300005530 | Bacteria | 1414 |
| 210 | Ga0070679_100415344 | 3300005530 | Bacteria | 1291 |
| 211 | Ga0070679_100467060 | 3300005530 | Archaea | 1206 |
| 212 | Ga0070679_100649688 | 3300005530 | Bacteria | 997 |
| 213 | Ga0070679_100868140 | 3300005530 | Bacteria | 846 |
| 214 | Ga0070679_101049089 | 3300005530 | Unclassified | 759 |
| 215 | Ga0070679_102056941 | 3300005530 | Unclassified | 520 |
| 216 | Ga0070684_100015169 | 3300005535 | Bacteria | 6266 |
| 217 | Ga0070684_100064491 | 3300005535 | Bacteria | 3213 |
| 218 | Ga0070684_100132647 | 3300005535 | Bacteria | 2248 |
| 219 | Ga0068853_100005874 | 3300005539 | Bacteria | 9676 |
| 220 | Ga0068853_100072538 | 3300005539 | Bacteria | 3000 |
| 221 | Ga0068853_100138604 | 3300005539 | Bacteria | 2183 |
| 222 | Ga0068853_100147819 | 3300005539 | Bacteria | 2113 |
| 223 | Ga0068853_100281037 | 3300005539 | Bacteria | 1535 |
| 224 | Ga0068853_100297752 | 3300005539 | Unclassified | 1490 |
| 225 | Ga0068853_101163072 | 3300005539 | Bacteria | 744 |
| 226 | Ga0068853_101259346 | 3300005539 | Unclassified | 714 |
| 227 | Ga0070672_100132691 | 3300005543 | Bacteria | 2048 |
| 228 | Ga0070672_100198655 | 3300005543 | Bacteria | 1676 |
| 229 | Ga0070672_100311615 | 3300005543 | Unclassified | 1336 |
| 230 | Ga0070672_100543358 | 3300005543 | Unclassified | 1008 |
| 231 | Ga0070672_101055494 | 3300005543 | Unclassified | 721 |
| 232 | Ga0070672_101555225 | 3300005543 | Bacteria | 593 |
| 233 | Ga0070686_100032012 | 3300005544 | Bacteria | 3222 |
| 234 | Ga0070686_100239219 | 3300005544 | Bacteria | 1321 |
| 235 | Ga0070693_100013503 | 3300005547 | Bacteria | 4160 |
| 236 | Ga0070693_100159387 | 3300005547 | Unclassified | 1436 |
| 237 | Ga0070693_100161822 | 3300005547 | Bacteria | 1426 |
| 238 | Ga0070693_100879540 | 3300005547 | Unclassified | 670 |
| 239 | Ga0070665_100068731 | 3300005548 | Bacteria | 3551 |
| 240 | Ga0070665_100352916 | 3300005548 | Unclassified | 1476 |
| 241 | Ga0070665_101080590 | 3300005548 | Unclassified | 814 |
| 242 | Ga0070665_101114201 | 3300005548 | Bacteria | 801 |
| 243 | Ga0070665_102562371 | 3300005548 | Unclassified | 511 |
| 244 | Ga0068855_100016170 | 3300005563 | Bacteria | 8970 |
| 245 | Ga0068855_100067954 | 3300005563 | Bacteria | 4150 |
| 246 | Ga0068855_100070936 | 3300005563 | Bacteria | 4052 |
| 247 | Ga0068855_100154291 | 3300005563 | Bacteria | 2610 |
| 248 | Ga0068855_100177543 | 3300005563 | Unclassified | 2409 |
| 249 | Ga0068855_100318811 | 3300005563 | Bacteria | 1719 |
| 250 | Ga0068855_100336031 | 3300005563 | Unclassified | 1667 |
| 251 | Ga0068855_100561663 | 3300005563 | Bacteria | 1234 |
| 252 | Ga0068855_100692193 | 3300005563 | Bacteria | 1092 |
| 253 | Ga0068855_100996529 | 3300005563 | Unclassified | 880 |
| 254 | Ga0068855_101393724 | 3300005563 | Unclassified | 723 |
| 255 | Ga0068855_101642438 | 3300005563 | Unclassified | 657 |
| 256 | Ga0068855_102221293 | 3300005563 | Bacteria | 550 |
| 257 | Ga0070664_100002497 | 3300005564 | Bacteria | 14828 |
| 258 | Ga0070664_100006053 | 3300005564 | Bacteria | 9781 |
| 259 | Ga0070664_100007222 | 3300005564 | Bacteria | 8962 |
| 260 | Ga0070664_100011497 | 3300005564 | Bacteria | 7185 |
| 261 | Ga0070664_100034680 | 3300005564 | Bacteria | 4233 |
| 262 | Ga0070664_100042053 | 3300005564 | Bacteria | 3858 |
| 263 | Ga0070664_100080596 | 3300005564 | Bacteria | 2804 |
| 264 | Ga0070664_100128868 | 3300005564 | Bacteria | 2221 |
| 265 | Ga0070664_100278858 | 3300005564 | Unclassified | 1507 |
| 266 | Ga0070664_100432268 | 3300005564 | Bacteria | 1207 |
| 267 | Ga0070664_101077126 | 3300005564 | Bacteria | 756 |
| 268 | Ga0068857_100005219 | 3300005577 | Bacteria | 11060 |
| 269 | Ga0068857_100039463 | 3300005577 | Bacteria | 4182 |
| 270 | Ga0068857_100062940 | 3300005577 | Bacteria | 3298 |
| 271 | Ga0068857_100069188 | 3300005577 | Bacteria | 3143 |
| 272 | Ga0068857_100146000 | 3300005577 | Unclassified | 2140 |
| 273 | Ga0068857_100209043 | 3300005577 | Bacteria | 1780 |
| 274 | Ga0068857_100362340 | 3300005577 | Unclassified | 1344 |
| 275 | Ga0068857_101245882 | 3300005577 | Unclassified | 721 |
| 276 | Ga0068857_101250511 | 3300005577 | Bacteria | 720 |
| 277 | Ga0068857_102066485 | 3300005577 | Unclassified | 559 |
| 278 | Ga0068854_100002843 | 3300005578 | Bacteria | 10755 |
| 279 | Ga0068854_100003443 | 3300005578 | Bacteria | 9872 |
| 280 | Ga0068854_100003689 | 3300005578 | Bacteria | 9579 |
| 281 | Ga0068854_100022982 | 3300005578 | Bacteria | 4255 |
| 282 | Ga0068854_100030744 | 3300005578 | Bacteria | 3727 |
| 283 | Ga0068854_100084722 | 3300005578 | Bacteria | 2346 |
| 284 | Ga0068854_100096133 | 3300005578 | Unclassified | 2213 |
| 285 | Ga0068854_100118208 | 3300005578 | Bacteria | 2008 |
| 286 | Ga0068854_100206117 | 3300005578 | Bacteria | 1548 |
| 287 | Ga0068854_100246574 | 3300005578 | Unclassified | 1424 |
| 288 | Ga0068854_100317360 | 3300005578 | Unclassified | 1265 |
| 289 | Ga0068854_100332637 | 3300005578 | Unclassified | 1238 |
| 290 | Ga0068854_100401230 | 3300005578 | Unclassified | 1135 |
| 291 | Ga0068854_100873732 | 3300005578 | Unclassified | 789 |
| 292 | Ga0068854_101016404 | 3300005578 | Bacteria | 735 |
| 293 | Ga0068854_101254831 | 3300005578 | Unclassified | 665 |
| 294 | Ga0068856_100007468 | 3300005614 | Bacteria | 10672 |
| 295 | Ga0068856_100011171 | 3300005614 | Bacteria | 8718 |
| 296 | Ga0068856_100014417 | 3300005614 | Bacteria | 7638 |
| 297 | Ga0068856_100042269 | 3300005614 | Bacteria | 4483 |
| 298 | Ga0068856_100083925 | 3300005614 | Bacteria | 3164 |
| 299 | Ga0068856_100203120 | 3300005614 | Bacteria | 1996 |
| 300 | Ga0068856_100231574 | 3300005614 | Bacteria | 1863 |
| 301 | Ga0068856_100327777 | 3300005614 | Unclassified | 1549 |
| 302 | Ga0068856_100530870 | 3300005614 | Bacteria | 1198 |
| 303 | Ga0068856_100558729 | 3300005614 | Bacteria | 1166 |
| 304 | Ga0068856_101374944 | 3300005614 | Bacteria | 721 |
| 305 | Ga0068856_101904071 | 3300005614 | Bacteria | 606 |
| 306 | Ga0068856_102072020 | 3300005614 | Bacteria | 579 |
| 307 | Ga0068856_102296425 | 3300005614 | Bacteria | 548 |
| 308 | Ga0070702_100356863 | 3300005615 | Unclassified | 1032 |
| 309 | Ga0068852_100003304 | 3300005616 | Bacteria | 11260 |
| 310 | Ga0068852_100029164 | 3300005616 | Bacteria | 4528 |
| 311 | Ga0068852_100041927 | 3300005616 | Bacteria | 3872 |
| 312 | Ga0068852_100067480 | 3300005616 | Bacteria | 3127 |
| 313 | Ga0068852_100068191 | 3300005616 | Unclassified | 3112 |
| 314 | Ga0068852_100168894 | 3300005616 | Bacteria | 2049 |
| 315 | Ga0068852_100207108 | 3300005616 | Archaea | 1859 |
| 316 | Ga0068852_100280896 | 3300005616 | Bacteria | 1605 |
| 317 | Ga0068852_100346786 | 3300005616 | Unclassified | 1449 |
| 318 | Ga0068852_100403128 | 3300005616 | Unclassified | 1346 |
| 319 | Ga0068852_100440078 | 3300005616 | Unclassified | 1289 |
| 320 | Ga0068852_100542354 | 3300005616 | Archaea | 1163 |
| 321 | Ga0068852_100689765 | 3300005616 | Unclassified | 1031 |
| 322 | Ga0068852_100931439 | 3300005616 | Unclassified | 886 |
| 323 | Ga0068852_100941305 | 3300005616 | Bacteria | 882 |
| 324 | Ga0068852_100984433 | 3300005616 | Unclassified | 862 |
| 325 | Ga0068852_101002063 | 3300005616 | Bacteria | 854 |
| 326 | Ga0068852_101022175 | 3300005616 | Bacteria | 845 |
| 327 | Ga0068852_101081866 | 3300005616 | Unclassified | 822 |
| 328 | Ga0068852_101135550 | 3300005616 | Bacteria | 802 |
| 329 | Ga0068852_101593068 | 3300005616 | Unclassified | 675 |
| 330 | Ga0068859_100177785 | 3300005617 | Bacteria | 2210 |
| 331 | Ga0068859_101318464 | 3300005617 | Unclassified | 796 |
| 332 | Ga0068859_101763098 | 3300005617 | Unclassified | 684 |
| 333 | Ga0068859_101908924 | 3300005617 | Bacteria | 656 |
| 334 | Ga0068864_100001847 | 3300005618 | Bacteria | 17419 |
| 335 | Ga0068864_100004870 | 3300005618 | Bacteria | 10991 |
| 336 | Ga0068864_100357158 | 3300005618 | Bacteria | 1380 |
| 337 | Ga0068866_10010145 | 3300005718 | Bacteria | 4027 |
| 338 | Ga0068866_10088122 | 3300005718 | Unclassified | 1684 |
| 339 | Ga0068851_10003906 | 3300005834 | Bacteria | 6675 |
| 340 | Ga0068851_10013192 | 3300005834 | Bacteria | 3910 |
| 341 | Ga0068851_10191236 | 3300005834 | Bacteria | 1138 |
| 342 | Ga0068851_10215170 | 3300005834 | Unclassified | 1078 |
| 343 | Ga0068851_10229276 | 3300005834 | Unclassified | 1046 |
| 344 | Ga0068851_10510957 | 3300005834 | Bacteria | 722 |
| 345 | Ga0068851_10742168 | 3300005834 | Bacteria | 607 |
| 346 | Ga0068863_100002387 | 3300005841 | Bacteria | 18669 |
| 347 | Ga0068863_100008161 | 3300005841 | Bacteria | 10227 |
| 348 | Ga0068863_100375757 | 3300005841 | Bacteria | 1387 |
| 349 | Ga0068858_100031045 | 3300005842 | Bacteria | 4962 |
| 350 | Ga0068858_100063135 | 3300005842 | Bacteria | 3427 |
| 351 | Ga0068858_100302852 | 3300005842 | Bacteria | 1525 |
| 352 | Ga0068858_100307664 | 3300005842 | Bacteria | 1513 |
| 353 | Ga0068858_101555073 | 3300005842 | Bacteria | 653 |
| 354 | Ga0068860_100180744 | 3300005843 | Bacteria | 2039 |
| 355 | Ga0068860_100316505 | 3300005843 | Unclassified | 1531 |
| 356 | Ga0068862_100122787 | 3300005844 | Bacteria | 2291 |
| 357 | Ga0081539_10079619 | 3300005985 | Bacteria | 1726 |
| 358 | Ga0070716_101656091 | 3300006173 | Unclassified | 527 |
| 359 | Ga0070712_100160038 | 3300006175 | Bacteria | 1738 |
| 360 | Ga0097621_100025560 | 3300006237 | Bacteria | 4621 |
| 361 | Ga0097621_100331621 | 3300006237 | Unclassified | 1349 |
| 362 | Ga0097621_100586142 | 3300006237 | Unclassified | 1018 |
| 363 | Ga0068871_100178822 | 3300006358 | Unclassified | 1822 |
| 364 | Ga0068871_100344990 | 3300006358 | Bacteria | 1316 |
| 365 | Ga0075434_100260250 | 3300006871 | Unclassified | 1754 |
| 366 | Ga0097620_100165136 | 3300006931 | Bacteria | 2294 |
| 367 | Ga0097620_100177790 | 3300006931 | Bacteria | 2210 |
| 368 | Ga0097620_101318451 | 3300006931 | Unclassified | 796 |
| 369 | Ga0097620_101763247 | 3300006931 | Unclassified | 684 |
| 370 | Ga0097620_101909543 | 3300006931 | Bacteria | 656 |
| 371 | Ga0105251_10039779 | 3300009011 | Unclassified | 2295 |
| 372 | Ga0105240_10016062 | 3300009093 | Bacteria | 10146 |
| 373 | Ga0105240_10052504 | 3300009093 | Bacteria | 5124 |
| 374 | Ga0105240_10147139 | 3300009093 | Bacteria | 2810 |
| 375 | Ga0105240_10415595 | 3300009093 | Bacteria | 1512 |
| 376 | Ga0105240_12613494 | 3300009093 | Unclassified | 522 |
| 377 | Ga0105245_10119034 | 3300009098 | Bacteria | 2465 |
| 378 | Ga0105245_10128975 | 3300009098 | Bacteria | 2370 |
| 379 | Ga0105241_10662238 | 3300009174 | Unclassified | 949 |
| 380 | Ga0105241_10694492 | 3300009174 | Unclassified | 928 |
| 381 | Ga0105241_10942665 | 3300009174 | Unclassified | 804 |
| 382 | Ga0105241_11249371 | 3300009174 | Bacteria | 705 |
| 383 | Ga0105241_12145856 | 3300009174 | Unclassified | 553 |
| 384 | Ga0105242_10056685 | 3300009176 | Bacteria | 3206 |
| 385 | Ga0105248_10047303 | 3300009177 | Bacteria | 4824 |
| 386 | Ga0105248_10296533 | 3300009177 | Bacteria | 1820 |
| 387 | Ga0105248_10752393 | 3300009177 | Bacteria | 1100 |
| 388 | Ga0105248_11047945 | 3300009177 | Unclassified | 921 |
| 389 | Ga0105237_10007969 | 3300009545 | Bacteria | 11537 |
| 390 | Ga0105237_10010945 | 3300009545 | Bacteria | 9625 |
| 391 | Ga0105237_11068964 | 3300009545 | Unclassified | 814 |
| 392 | Ga0105238_10006524 | 3300009551 | Bacteria | 11613 |
| 393 | Ga0105238_10010338 | 3300009551 | Bacteria | 9364 |
| 394 | Ga0105238_10069422 | 3300009551 | Bacteria | 3524 |
| 395 | Ga0105238_10096455 | 3300009551 | Bacteria | 2943 |
| 396 | Ga0105238_10183306 | 3300009551 | Bacteria | 2070 |
| 397 | Ga0105238_10189057 | 3300009551 | Bacteria | 2036 |
| 398 | Ga0105238_10699573 | 3300009551 | Archaea | 1025 |
| 399 | Ga0105239_10012441 | 3300010375 | Bacteria | 9479 |
| 400 | Ga0105239_10117833 | 3300010375 | Unclassified | 2947 |
| 401 | Ga0105239_10786270 | 3300010375 | Bacteria | 1090 |
| 402 | Ga0105239_10932896 | 3300010375 | Bacteria | 997 |
| 403 | Ga0105239_12819064 | 3300010375 | Unclassified | 567 |
| 404 | Ga0105246_10044601 | 3300011119 | Bacteria | 3014 |
| 405 | Ga0105246_10227306 | 3300011119 | Bacteria | 1467 |
| 406 | Ga0105246_12062734 | 3300011119 | Unclassified | 552 |
| 407 | Ga0105246_12342454 | 3300011119 | Unclassified | 522 |
| 408 | Ga0157373_10001257 | 3300013100 | Bacteria | 19369 |
| 409 | Ga0157373_10010607 | 3300013100 | Bacteria | 6781 |
| 410 | Ga0157373_10034737 | 3300013100 | Bacteria | 3621 |
| 411 | Ga0157373_10037013 | 3300013100 | Bacteria | 3501 |
| 412 | Ga0157373_10054356 | 3300013100 | Bacteria | 2845 |
| 413 | Ga0157373_10056427 | 3300013100 | Unclassified | 2789 |
| 414 | Ga0157373_10056965 | 3300013100 | Bacteria | 2773 |
| 415 | Ga0157373_10092410 | 3300013100 | Unclassified | 2131 |
| 416 | Ga0157373_10166461 | 3300013100 | Bacteria | 1551 |
| 417 | Ga0157373_10208182 | 3300013100 | Bacteria | 1379 |
| 418 | Ga0157373_10230667 | 3300013100 | Bacteria | 1307 |
| 419 | Ga0157373_10270789 | 3300013100 | Unclassified | 1202 |
| 420 | Ga0157373_10290567 | 3300013100 | Unclassified | 1159 |
| 421 | Ga0157373_10359510 | 3300013100 | Bacteria | 1039 |
| 422 | Ga0157373_10429515 | 3300013100 | Bacteria | 949 |
| 423 | Ga0157373_10501870 | 3300013100 | Bacteria | 876 |
| 424 | Ga0157373_11079257 | 3300013100 | Unclassified | 602 |
| 425 | Ga0157371_10062503 | 3300013102 | Bacteria | 2640 |
| 426 | Ga0157371_10065945 | 3300013102 | Bacteria | 2564 |
| 427 | Ga0157371_10085113 | 3300013102 | Bacteria | 2240 |
| 428 | Ga0157371_10118263 | 3300013102 | Bacteria | 1884 |
| 429 | Ga0157371_10124124 | 3300013102 | Bacteria | 1836 |
| 430 | Ga0157371_10129874 | 3300013102 | Bacteria | 1792 |
| 431 | Ga0157371_10225608 | 3300013102 | Bacteria | 1346 |
| 432 | Ga0157371_10266491 | 3300013102 | Bacteria | 1236 |
| 433 | Ga0157371_10309571 | 3300013102 | Bacteria | 1144 |
| 434 | Ga0157371_10315933 | 3300013102 | Unclassified | 1133 |
| 435 | Ga0157371_10334692 | 3300013102 | Unclassified | 1100 |
| 436 | Ga0157371_10609601 | 3300013102 | Unclassified | 812 |
| 437 | Ga0157371_10680086 | 3300013102 | Unclassified | 769 |
| 438 | Ga0157371_11101967 | 3300013102 | Bacteria | 609 |
| 439 | Ga0157370_10016192 | 3300013104 | Bacteria | 7557 |
| 440 | Ga0157370_10052496 | 3300013104 | Unclassified | 3892 |
| 441 | Ga0157370_10151341 | 3300013104 | Unclassified | 2159 |
| 442 | Ga0157370_10156542 | 3300013104 | Bacteria | 2120 |
| 443 | Ga0157370_10254811 | 3300013104 | Bacteria | 1623 |
| 444 | Ga0157370_10338952 | 3300013104 | Unclassified | 1386 |
| 445 | Ga0157370_10379146 | 3300013104 | Bacteria | 1303 |
| 446 | Ga0157369_10004147 | 3300013105 | Bacteria | 17165 |
| 447 | Ga0157369_10040375 | 3300013105 | Bacteria | 5094 |
| 448 | Ga0157369_10082269 | 3300013105 | Bacteria | 3445 |
| 449 | Ga0157369_10354511 | 3300013105 | Unclassified | 1524 |
| 450 | Ga0157369_10415650 | 3300013105 | Bacteria | 1394 |
| 451 | Ga0157369_10430693 | 3300013105 | Bacteria | 1367 |
| 452 | Ga0157369_11048758 | 3300013105 | Unclassified | 834 |
| 453 | Ga0157369_11107449 | 3300013105 | Unclassified | 809 |
| 454 | Ga0157369_11138482 | 3300013105 | Unclassified | 797 |
| 455 | Ga0157374_10058154 | 3300013296 | Bacteria | 3613 |
| 456 | Ga0157374_10211720 | 3300013296 | Bacteria | 1900 |
| 457 | Ga0157374_10320254 | 3300013296 | Bacteria | 1536 |
| 458 | Ga0157374_11014402 | 3300013296 | Bacteria | 849 |
| 459 | Ga0157378_10024042 | 3300013297 | Bacteria | 5360 |
| 460 | Ga0157378_10207945 | 3300013297 | Unclassified | 1854 |
| 461 | Ga0157378_11682028 | 3300013297 | Unclassified | 681 |
| 462 | Ga0163162_10006085 | 3300013306 | Bacteria | 11680 |
| 463 | Ga0163162_10203935 | 3300013306 | Bacteria | 2107 |
| 464 | Ga0163162_11735963 | 3300013306 | Unclassified | 713 |
| 465 | Ga0157372_10003603 | 3300013307 | Bacteria | 16671 |
| 466 | Ga0157372_10032904 | 3300013307 | Bacteria | 5690 |
| 467 | Ga0157372_10212239 | 3300013307 | Bacteria | 2243 |
| 468 | Ga0157372_10294274 | 3300013307 | Bacteria | 1888 |
| 469 | Ga0157372_10380559 | 3300013307 | Bacteria | 1645 |
| 470 | Ga0157372_10422379 | 3300013307 | Bacteria | 1554 |
| 471 | Ga0157372_10506809 | 3300013307 | Unclassified | 1407 |
| 472 | Ga0157372_10688289 | 3300013307 | Unclassified | 1190 |
| 473 | Ga0157372_10710322 | 3300013307 | Unclassified | 1169 |
| 474 | Ga0157372_10787791 | 3300013307 | Bacteria | 1105 |
| 475 | Ga0157372_10939700 | 3300013307 | Bacteria | 1002 |
| 476 | Ga0157372_11343421 | 3300013307 | Bacteria | 824 |
| 477 | Ga0157372_11805044 | 3300013307 | Unclassified | 703 |
| 478 | Ga0157375_10108277 | 3300013308 | Bacteria | 2873 |
| 479 | Ga0157375_11022410 | 3300013308 | Unclassified | 965 |
| 480 | Ga0157375_11668403 | 3300013308 | Unclassified | 754 |
| 481 | Ga0157375_11668404 | 3300013308 | Unclassified | 754 |
| 482 | Ga0163163_10163522 | 3300014325 | Bacteria | 2272 |
| 483 | Ga0163163_10404443 | 3300014325 | Unclassified | 1423 |
| 484 | Ga0163163_10670616 | 3300014325 | Bacteria | 1100 |
| 485 | Ga0157380_10867556 | 3300014326 | Bacteria | 926 |
| 486 | Ga0182008_10076853 | 3300014497 | Unclassified | 1643 |
| 487 | Ga0182008_10400330 | 3300014497 | Unclassified | 737 |
| 488 | Ga0182008_10409540 | 3300014497 | Unclassified | 730 |
| 489 | Ga0157377_10286789 | 3300014745 | Unclassified | 1081 |
| 490 | Ga0157379_11173859 | 3300014968 | Unclassified | 738 |
| 491 | Ga0157379_11173988 | 3300014968 | Unclassified | 738 |
| 492 | Ga0157376_10065316 | 3300014969 | Bacteria | 3072 |
| 493 | Ga0157376_11007654 | 3300014969 | Unclassified | 856 |
| 494 | Ga0163161_10527982 | 3300017792 | Bacteria | 964 |
| 495 | Ga0206354_10065452 | 3300020081 | Bacteria | 952 |
| 496 | Ga0206354_10104527 | 3300020081 | Bacteria | 637 |
| 497 | Ga0206353_11031190 | 3300020082 | Bacteria | 1968 |
| 498 | Ga0206353_11257509 | 3300020082 | Bacteria | 3648 |
| 499 | Ga0213876_10038126 | 3300021384 | Bacteria | 2535 |
| 500 | Ga0207697_10005443 | 3300025315 | Bacteria | 5919 |
| 501 | Ga0207656_10014421 | 3300025321 | Bacteria | 3044 |
| 502 | Ga0207656_10019951 | 3300025321 | Bacteria | 2657 |
| 503 | Ga0207656_10183362 | 3300025321 | Bacteria | 1005 |
| 504 | Ga0207656_10744476 | 3300025321 | Unclassified | 502 |
| 505 | Ga0207682_10056438 | 3300025893 | Bacteria | 1635 |
| 506 | Ga0207642_10032863 | 3300025899 | Unclassified | 2189 |
| 507 | Ga0207642_10079390 | 3300025899 | Unclassified | 1589 |
| 508 | Ga0207688_10010918 | 3300025901 | Bacteria | 4942 |
| 509 | Ga0207688_10878252 | 3300025901 | Unclassified | 568 |
| 510 | Ga0207680_10124496 | 3300025903 | Unclassified | 1690 |
| 511 | Ga0207680_10125175 | 3300025903 | Unclassified | 1686 |
| 512 | Ga0207680_10380438 | 3300025903 | Bacteria | 995 |
| 513 | Ga0207680_10843197 | 3300025903 | Unclassified | 657 |
| 514 | Ga0207680_11160675 | 3300025903 | Bacteria | 551 |
| 515 | Ga0207647_10000435 | 3300025904 | Bacteria | 34176 |
| 516 | Ga0207647_10001347 | 3300025904 | Bacteria | 18861 |
| 517 | Ga0207647_10002106 | 3300025904 | Bacteria | 15234 |
| 518 | Ga0207647_10048145 | 3300025904 | Plasmid | 2648 |
| 519 | Ga0207647_10087849 | 3300025904 | Bacteria | 1857 |
| 520 | Ga0207647_10169591 | 3300025904 | Bacteria | 1271 |
| 521 | Ga0207647_10400623 | 3300025904 | Bacteria | 773 |
| 522 | Ga0207699_11078345 | 3300025906 | Bacteria | 594 |
| 523 | Ga0207645_10087340 | 3300025907 | Bacteria | 2004 |
| 524 | Ga0207645_10114513 | 3300025907 | Bacteria | 1747 |
| 525 | Ga0207645_10303718 | 3300025907 | Bacteria | 1063 |
| 526 | Ga0207645_10365119 | 3300025907 | Unclassified | 967 |
| 527 | Ga0207645_10887141 | 3300025907 | Bacteria | 606 |
| 528 | Ga0207643_10033467 | 3300025908 | Bacteria | 2876 |
| 529 | Ga0207705_10002105 | 3300025909 | Bacteria | 15478 |
| 530 | Ga0207705_10014553 | 3300025909 | Bacteria | 5660 |
| 531 | Ga0207705_10016874 | 3300025909 | Bacteria | 5230 |
| 532 | Ga0207705_10018993 | 3300025909 | Bacteria | 4915 |
| 533 | Ga0207705_10020381 | 3300025909 | Bacteria | 4740 |
| 534 | Ga0207705_10039541 | 3300025909 | Bacteria | 3381 |
| 535 | Ga0207705_10050675 | 3300025909 | Bacteria | 2989 |
| 536 | Ga0207705_10053383 | 3300025909 | Bacteria | 2911 |
| 537 | Ga0207705_10091477 | 3300025909 | Unclassified | 2228 |
| 538 | Ga0207705_10110744 | 3300025909 | Bacteria | 2028 |
| 539 | Ga0207705_10234949 | 3300025909 | Bacteria | 1395 |
| 540 | Ga0207705_10322436 | 3300025909 | Bacteria | 1187 |
| 541 | Ga0207705_10339502 | 3300025909 | Bacteria | 1156 |
| 542 | Ga0207705_10342778 | 3300025909 | Unclassified | 1150 |
| 543 | Ga0207705_10355473 | 3300025909 | Unclassified | 1129 |
| 544 | Ga0207705_10367604 | 3300025909 | Unclassified | 1110 |
| 545 | Ga0207705_10579336 | 3300025909 | Bacteria | 872 |
| 546 | Ga0207705_11013785 | 3300025909 | Unclassified | 641 |
| 547 | Ga0207705_11076738 | 3300025909 | Unclassified | 620 |
| 548 | Ga0207705_11292261 | 3300025909 | Unclassified | 557 |
| 549 | Ga0207654_10195363 | 3300025911 | Unclassified | 1329 |
| 550 | Ga0207654_10607007 | 3300025911 | Unclassified | 781 |
| 551 | Ga0207707_10082021 | 3300025912 | Bacteria | 2815 |
| 552 | Ga0207707_10092926 | 3300025912 | Bacteria | 2635 |
| 553 | Ga0207707_10120605 | 3300025912 | Bacteria | 2293 |
| 554 | Ga0207707_10123418 | 3300025912 | Bacteria | 2265 |
| 555 | Ga0207707_10301534 | 3300025912 | Bacteria | 1385 |
| 556 | Ga0207707_10352276 | 3300025912 | Bacteria | 1268 |
| 557 | Ga0207707_10397182 | 3300025912 | Unclassified | 1184 |
| 558 | Ga0207707_10713835 | 3300025912 | Unclassified | 841 |
| 559 | Ga0207707_10868170 | 3300025912 | Bacteria | 748 |
| 560 | Ga0207707_11006231 | 3300025912 | Unclassified | 684 |
| 561 | Ga0207695_10024528 | 3300025913 | Bacteria | 6780 |
| 562 | Ga0207695_10030276 | 3300025913 | Bacteria | 5961 |
| 563 | Ga0207695_10111184 | 3300025913 | Bacteria | 2719 |
| 564 | Ga0207695_10183431 | 3300025913 | Unclassified | 2013 |
| 565 | Ga0207695_10896291 | 3300025913 | Unclassified | 767 |
| 566 | Ga0207671_10021426 | 3300025914 | Bacteria | 4904 |
| 567 | Ga0207671_10206167 | 3300025914 | Bacteria | 1537 |
| 568 | Ga0207671_11543087 | 3300025914 | Unclassified | 512 |
| 569 | Ga0207660_10000329 | 3300025917 | Bacteria | 30623 |
| 570 | Ga0207660_10009260 | 3300025917 | Bacteria | 6374 |
| 571 | Ga0207660_10021068 | 3300025917 | Bacteria | 4380 |
| 572 | Ga0207660_10107172 | 3300025917 | Bacteria | 2096 |
| 573 | Ga0207660_10164132 | 3300025917 | Bacteria | 1716 |
| 574 | Ga0207660_10669665 | 3300025917 | Bacteria | 846 |
| 575 | Ga0207660_11201367 | 3300025917 | Bacteria | 617 |
| 576 | Ga0207657_10003144 | 3300025919 | Bacteria | 17663 |
| 577 | Ga0207657_10006364 | 3300025919 | Bacteria | 12264 |
| 578 | Ga0207657_10013074 | 3300025919 | Bacteria | 8158 |
| 579 | Ga0207657_10015698 | 3300025919 | Bacteria | 7325 |
| 580 | Ga0207657_10028999 | 3300025919 | Bacteria | 5043 |
| 581 | Ga0207657_10030562 | 3300025919 | Bacteria | 4888 |
| 582 | Ga0207657_10048954 | 3300025919 | Bacteria | 3686 |
| 583 | Ga0207657_10053608 | 3300025919 | Bacteria | 3493 |
| 584 | Ga0207657_10056347 | 3300025919 | Bacteria | 3392 |
| 585 | Ga0207657_10082685 | 3300025919 | Bacteria | 2695 |
| 586 | Ga0207657_10104571 | 3300025919 | Bacteria | 2345 |
| 587 | Ga0207657_10110183 | 3300025919 | Bacteria | 2274 |
| 588 | Ga0207657_10120744 | 3300025919 | Bacteria | 2156 |
| 589 | Ga0207657_10147966 | 3300025919 | Bacteria | 1914 |
| 590 | Ga0207657_10301804 | 3300025919 | Bacteria | 1268 |
| 591 | Ga0207657_10461133 | 3300025919 | Bacteria | 997 |
| 592 | Ga0207657_10943621 | 3300025919 | Unclassified | 663 |
| 593 | Ga0207657_11319486 | 3300025919 | Unclassified | 544 |
| 594 | Ga0207649_10004561 | 3300025920 | Bacteria | 7518 |
| 595 | Ga0207649_10016272 | 3300025920 | Bacteria | 4190 |
| 596 | Ga0207649_10022843 | 3300025920 | Bacteria | 3615 |
| 597 | Ga0207649_10036418 | 3300025920 | Bacteria | 2963 |
| 598 | Ga0207649_10078432 | 3300025920 | Bacteria | 2131 |
| 599 | Ga0207649_10298373 | 3300025920 | Bacteria | 1177 |
| 600 | Ga0207649_10321818 | 3300025920 | Unclassified | 1136 |
| 601 | Ga0207649_10346353 | 3300025920 | Unclassified | 1098 |
| 602 | Ga0207649_10409543 | 3300025920 | Bacteria | 1016 |
| 603 | Ga0207649_10446237 | 3300025920 | Unclassified | 976 |
| 604 | Ga0207649_10532788 | 3300025920 | Bacteria | 897 |
| 605 | Ga0207649_10657428 | 3300025920 | Unclassified | 810 |
| 606 | Ga0207649_10889043 | 3300025920 | Bacteria | 698 |
| 607 | Ga0207649_10933221 | 3300025920 | Bacteria | 681 |
| 608 | Ga0207652_10032223 | 3300025921 | Bacteria | 4403 |
| 609 | Ga0207652_10076713 | 3300025921 | Bacteria | 2915 |
| 610 | Ga0207652_10173468 | 3300025921 | Bacteria | 1936 |
| 611 | Ga0207652_10252406 | 3300025921 | Bacteria | 1591 |
| 612 | Ga0207652_10533426 | 3300025921 | Bacteria | 1055 |
| 613 | Ga0207652_10814333 | 3300025921 | Unclassified | 829 |
| 614 | Ga0207652_10936082 | 3300025921 | Unclassified | 764 |
| 615 | Ga0207652_11135763 | 3300025921 | Unclassified | 682 |
| 616 | Ga0207652_11676737 | 3300025921 | Bacteria | 540 |
| 617 | Ga0207681_10431198 | 3300025923 | Bacteria | 1070 |
| 618 | Ga0207681_10692355 | 3300025923 | Unclassified | 847 |
| 619 | Ga0207681_11139628 | 3300025923 | Bacteria | 655 |
| 620 | Ga0207694_10004535 | 3300025924 | Bacteria | 10830 |
| 621 | Ga0207694_10011778 | 3300025924 | Bacteria | 6597 |
| 622 | Ga0207694_10112040 | 3300025924 | Bacteria | 2171 |
| 623 | Ga0207694_10284218 | 3300025924 | Unclassified | 1359 |
| 624 | Ga0207694_10771560 | 3300025924 | Bacteria | 812 |
| 625 | Ga0207650_10024371 | 3300025925 | Bacteria | 4301 |
| 626 | Ga0207650_10347083 | 3300025925 | Bacteria | 1220 |
| 627 | Ga0207650_10661239 | 3300025925 | Bacteria | 881 |
| 628 | Ga0207687_10071230 | 3300025927 | Bacteria | 2483 |
| 629 | Ga0207700_10568401 | 3300025928 | Unclassified | 1007 |
| 630 | Ga0207664_10076982 | 3300025929 | Bacteria | 2702 |
| 631 | Ga0207664_10077410 | 3300025929 | Bacteria | 2695 |
| 632 | Ga0207664_10125158 | 3300025929 | Unclassified | 2157 |
| 633 | Ga0207664_10137347 | 3300025929 | Bacteria | 2064 |
| 634 | Ga0207644_10003796 | 3300025931 | Bacteria | 9786 |
| 635 | Ga0207644_10025658 | 3300025931 | Unclassified | 4053 |
| 636 | Ga0207644_10191100 | 3300025931 | Unclassified | 1610 |
| 637 | Ga0207644_10566215 | 3300025931 | Unclassified | 941 |
| 638 | Ga0207690_10003155 | 3300025932 | Bacteria | 9899 |
| 639 | Ga0207690_10012506 | 3300025932 | Bacteria | 5079 |
| 640 | Ga0207690_10030391 | 3300025932 | Bacteria | 3445 |
| 641 | Ga0207690_10117617 | 3300025932 | Bacteria | 1925 |
| 642 | Ga0207690_10146955 | 3300025932 | Bacteria | 1744 |
| 643 | Ga0207690_10264960 | 3300025932 | Bacteria | 1333 |
| 644 | Ga0207690_10350103 | 3300025932 | Unclassified | 1168 |
| 645 | Ga0207690_10394601 | 3300025932 | Bacteria | 1102 |
| 646 | Ga0207690_10395126 | 3300025932 | Bacteria | 1101 |
| 647 | Ga0207690_10424371 | 3300025932 | Unclassified | 1064 |
| 648 | Ga0207690_10684660 | 3300025932 | Bacteria | 842 |
| 649 | Ga0207690_10833896 | 3300025932 | Bacteria | 763 |
| 650 | Ga0207690_10882739 | 3300025932 | Archaea | 741 |
| 651 | Ga0207706_10002427 | 3300025933 | Bacteria | 18186 |
| 652 | Ga0207706_10040783 | 3300025933 | Bacteria | 4115 |
| 653 | Ga0207706_10077908 | 3300025933 | Bacteria | 2915 |
| 654 | Ga0207706_10092798 | 3300025933 | Bacteria | 2655 |
| 655 | Ga0207706_10092860 | 3300025933 | Bacteria | 2654 |
| 656 | Ga0207706_10151767 | 3300025933 | Bacteria | 2037 |
| 657 | Ga0207706_10184058 | 3300025933 | Unclassified | 1834 |
| 658 | Ga0207706_10410719 | 3300025933 | Bacteria | 1173 |
| 659 | Ga0207706_10513699 | 3300025933 | Bacteria | 1033 |
| 660 | Ga0207706_10514856 | 3300025933 | Unclassified | 1032 |
| 661 | Ga0207706_10550417 | 3300025933 | Bacteria | 993 |
| 662 | Ga0207706_10777762 | 3300025933 | Unclassified | 814 |
| 663 | Ga0207706_11651133 | 3300025933 | Unclassified | 518 |
| 664 | Ga0207686_10013322 | 3300025934 | Bacteria | 4548 |
| 665 | Ga0207669_10087994 | 3300025937 | Bacteria | 2013 |
| 666 | Ga0207704_10058514 | 3300025938 | Unclassified | 2373 |
| 667 | Ga0207704_10088462 | 3300025938 | Unclassified | 2026 |
| 668 | Ga0207691_10128958 | 3300025940 | Bacteria | 2235 |
| 669 | Ga0207691_10149564 | 3300025940 | Bacteria | 2053 |
| 670 | Ga0207691_10166518 | 3300025940 | Unclassified | 1931 |
| 671 | Ga0207691_10461616 | 3300025940 | Unclassified | 1080 |
| 672 | Ga0207711_10011791 | 3300025941 | Bacteria | 7262 |
| 673 | Ga0207711_10136820 | 3300025941 | Unclassified | 2201 |
| 674 | Ga0207711_10359525 | 3300025941 | Bacteria | 1349 |
| 675 | Ga0207711_10754112 | 3300025941 | Bacteria | 907 |
| 676 | Ga0207661_10050476 | 3300025944 | Bacteria | 3314 |
| 677 | Ga0207661_10051801 | 3300025944 | Bacteria | 3276 |
| 678 | Ga0207661_10070331 | 3300025944 | Unclassified | 2857 |
| 679 | Ga0207661_10142329 | 3300025944 | Bacteria | 2065 |
| 680 | Ga0207661_10249439 | 3300025944 | Bacteria | 1577 |
| 681 | Ga0207661_10353079 | 3300025944 | Unclassified | 1327 |
| 682 | Ga0207661_11046820 | 3300025944 | Unclassified | 751 |
| 683 | Ga0207679_10117870 | 3300025945 | Bacteria | 2108 |
| 684 | Ga0207679_10269327 | 3300025945 | Unclassified | 1456 |
| 685 | Ga0207679_10274321 | 3300025945 | Unclassified | 1443 |
| 686 | Ga0207679_10314185 | 3300025945 | Unclassified | 1355 |
| 687 | Ga0207679_10474964 | 3300025945 | Unclassified | 1112 |
| 688 | Ga0207679_10537193 | 3300025945 | Bacteria | 1047 |
| 689 | Ga0207679_11276113 | 3300025945 | Unclassified | 674 |
| 690 | Ga0207679_11297389 | 3300025945 | Unclassified | 668 |
| 691 | Ga0207679_11717854 | 3300025945 | Unclassified | 574 |
| 692 | Ga0207667_10022295 | 3300025949 | Bacteria | 6999 |
| 693 | Ga0207667_10032969 | 3300025949 | Bacteria | 5575 |
| 694 | Ga0207667_10050040 | 3300025949 | Bacteria | 4410 |
| 695 | Ga0207667_10193544 | 3300025949 | Bacteria | 2086 |
| 696 | Ga0207667_10205388 | 3300025949 | Bacteria | 2020 |
| 697 | Ga0207667_10263826 | 3300025949 | Bacteria | 1761 |
| 698 | Ga0207667_10370656 | 3300025949 | Unclassified | 1459 |
| 699 | Ga0207667_10586293 | 3300025949 | Bacteria | 1125 |
| 700 | Ga0207667_10621040 | 3300025949 | Bacteria | 1088 |
| 701 | Ga0207667_11128664 | 3300025949 | Unclassified | 766 |
| 702 | Ga0207667_11669768 | 3300025949 | Unclassified | 604 |
| 703 | Ga0207651_10016827 | 3300025960 | Bacteria | 4299 |
| 704 | Ga0207651_10076528 | 3300025960 | Bacteria | 2393 |
| 705 | Ga0207651_10186394 | 3300025960 | Unclassified | 1651 |
| 706 | Ga0207651_10266211 | 3300025960 | Bacteria | 1409 |
| 707 | Ga0207651_10717720 | 3300025960 | Bacteria | 882 |
| 708 | Ga0207651_10953410 | 3300025960 | Unclassified | 765 |
| 709 | Ga0207712_10153816 | 3300025961 | Bacteria | 1779 |
| 710 | Ga0207668_10191894 | 3300025972 | Bacteria | 1620 |
| 711 | Ga0207640_10008246 | 3300025981 | Bacteria | 5778 |
| 712 | Ga0207640_10014560 | 3300025981 | Bacteria | 4532 |
| 713 | Ga0207640_10015328 | 3300025981 | Bacteria | 4435 |
| 714 | Ga0207640_10025850 | 3300025981 | Bacteria | 3559 |
| 715 | Ga0207640_10078440 | 3300025981 | Bacteria | 2248 |
| 716 | Ga0207640_10117494 | 3300025981 | Bacteria | 1898 |
| 717 | Ga0207640_10209327 | 3300025981 | Bacteria | 1484 |
| 718 | Ga0207640_10212645 | 3300025981 | Unclassified | 1474 |
| 719 | Ga0207640_10462228 | 3300025981 | Bacteria | 1048 |
| 720 | Ga0207640_10550672 | 3300025981 | Bacteria | 969 |
| 721 | Ga0207640_11702549 | 3300025981 | Bacteria | 569 |
| 722 | Ga0207640_12100718 | 3300025981 | Unclassified | 512 |
| 723 | Ga0207658_10093050 | 3300025986 | Bacteria | 2343 |
| 724 | Ga0207658_10143721 | 3300025986 | Unclassified | 1934 |
| 725 | Ga0207658_10728380 | 3300025986 | Bacteria | 897 |
| 726 | Ga0207658_10738748 | 3300025986 | Unclassified | 891 |
| 727 | Ga0207658_10778088 | 3300025986 | Bacteria | 868 |
| 728 | Ga0207677_10260184 | 3300026023 | Bacteria | 1414 |
| 729 | Ga0207677_10605238 | 3300026023 | Unclassified | 962 |
| 730 | Ga0207677_11838403 | 3300026023 | Unclassified | 562 |
| 731 | Ga0207703_10040289 | 3300026035 | Bacteria | 3738 |
| 732 | Ga0207703_10065019 | 3300026035 | Bacteria | 2996 |
| 733 | Ga0207703_10254203 | 3300026035 | Unclassified | 1585 |
| 734 | Ga0207703_10324007 | 3300026035 | Unclassified | 1412 |
| 735 | Ga0207639_10000136 | 3300026041 | Bacteria | 54387 |
| 736 | Ga0207639_10049409 | 3300026041 | Bacteria | 3189 |
| 737 | Ga0207639_10086373 | 3300026041 | Unclassified | 2498 |
| 738 | Ga0207639_10237495 | 3300026041 | Bacteria | 1583 |
| 739 | Ga0207639_10302396 | 3300026041 | Unclassified | 1414 |
| 740 | Ga0207639_10411768 | 3300026041 | Bacteria | 1220 |
| 741 | Ga0207639_10476255 | 3300026041 | Unclassified | 1137 |
| 742 | Ga0207639_10512738 | 3300026041 | Bacteria | 1097 |
| 743 | Ga0207639_10549748 | 3300026041 | Bacteria | 1060 |
| 744 | Ga0207639_10657659 | 3300026041 | Bacteria | 970 |
| 745 | Ga0207639_10662878 | 3300026041 | Bacteria | 966 |
| 746 | Ga0207678_10005791 | 3300026067 | Bacteria | 11018 |
| 747 | Ga0207678_10009194 | 3300026067 | Bacteria | 8699 |
| 748 | Ga0207678_10010228 | 3300026067 | Bacteria | 8236 |
| 749 | Ga0207678_10019220 | 3300026067 | Bacteria | 5999 |
| 750 | Ga0207678_10034912 | 3300026067 | Bacteria | 4379 |
| 751 | Ga0207678_10035824 | 3300026067 | Bacteria | 4320 |
| 752 | Ga0207678_10151644 | 3300026067 | Bacteria | 1979 |
| 753 | Ga0207678_10308339 | 3300026067 | Unclassified | 1361 |
| 754 | Ga0207678_10393400 | 3300026067 | Bacteria | 1199 |
| 755 | Ga0207678_10441696 | 3300026067 | Bacteria | 1130 |
| 756 | Ga0207678_10683217 | 3300026067 | Unclassified | 903 |
| 757 | Ga0207702_10011047 | 3300026078 | Bacteria | 7537 |
| 758 | Ga0207702_10046294 | 3300026078 | Bacteria | 3661 |
| 759 | Ga0207702_10051017 | 3300026078 | Bacteria | 3494 |
| 760 | Ga0207702_10055089 | 3300026078 | Bacteria | 3372 |
| 761 | Ga0207702_10103326 | 3300026078 | Unclassified | 2520 |
| 762 | Ga0207702_10167126 | 3300026078 | Unclassified | 2014 |
| 763 | Ga0207702_10283265 | 3300026078 | Bacteria | 1568 |
| 764 | Ga0207702_10373577 | 3300026078 | Bacteria | 1369 |
| 765 | Ga0207702_10461816 | 3300026078 | Bacteria | 1233 |
| 766 | Ga0207702_10603373 | 3300026078 | Bacteria | 1077 |
| 767 | Ga0207702_11930519 | 3300026078 | Unclassified | 581 |
| 768 | Ga0207641_10010934 | 3300026088 | Bacteria | 7437 |
| 769 | Ga0207641_10020798 | 3300026088 | Bacteria | 5393 |
| 770 | Ga0207641_10319203 | 3300026088 | Bacteria | 1473 |
| 771 | Ga0207648_10001590 | 3300026089 | Bacteria | 24892 |
| 772 | Ga0207648_10021766 | 3300026089 | Bacteria | 5760 |
| 773 | Ga0207648_10047618 | 3300026089 | Bacteria | 3757 |
| 774 | Ga0207648_10887721 | 3300026089 | Unclassified | 832 |
| 775 | Ga0207676_10074688 | 3300026095 | Bacteria | 2732 |
| 776 | Ga0207676_10201095 | 3300026095 | Unclassified | 1760 |
| 777 | Ga0207676_10416932 | 3300026095 | Unclassified | 1258 |
| 778 | Ga0207676_12478436 | 3300026095 | Unclassified | 515 |
| 779 | Ga0207674_10000060 | 3300026116 | Bacteria | 112806 |
| 780 | Ga0207674_10001045 | 3300026116 | Bacteria | 36002 |
| 781 | Ga0207674_10003719 | 3300026116 | Bacteria | 18629 |
| 782 | Ga0207674_10007483 | 3300026116 | Bacteria | 12729 |
| 783 | Ga0207674_10028962 | 3300026116 | Bacteria | 5838 |
| 784 | Ga0207674_10030442 | 3300026116 | Bacteria | 5673 |
| 785 | Ga0207674_10031140 | 3300026116 | Bacteria | 5605 |
| 786 | Ga0207674_10061056 | 3300026116 | Bacteria | 3809 |
| 787 | Ga0207674_10249289 | 3300026116 | Bacteria | 1723 |
| 788 | Ga0207674_10403205 | 3300026116 | Bacteria | 1321 |
| 789 | Ga0207674_10877137 | 3300026116 | Bacteria | 865 |
| 790 | Ga0207674_10892659 | 3300026116 | Unclassified | 857 |
| 791 | Ga0207674_11377367 | 3300026116 | Unclassified | 675 |
| 792 | Ga0207675_100328829 | 3300026118 | Bacteria | 1494 |
| 793 | Ga0207675_100483515 | 3300026118 | Bacteria | 1231 |
| 794 | Ga0207683_10001298 | 3300026121 | Bacteria | 22583 |
| 795 | Ga0207683_10013086 | 3300026121 | Bacteria | 7077 |
| 796 | Ga0207683_10039824 | 3300026121 | Bacteria | 4100 |
| 797 | Ga0207698_10001262 | 3300026142 | Bacteria | 14777 |
| 798 | Ga0207698_10002123 | 3300026142 | Bacteria | 11689 |
| 799 | Ga0207698_10010523 | 3300026142 | Bacteria | 5952 |
| 800 | Ga0207698_10013579 | 3300026142 | Bacteria | 5382 |
| 801 | Ga0207698_10075843 | 3300026142 | Bacteria | 2689 |
| 802 | Ga0207698_10136124 | 3300026142 | Archaea | 2108 |
| 803 | Ga0207698_10349975 | 3300026142 | Unclassified | 1395 |
| 804 | Ga0207698_10433728 | 3300026142 | Bacteria | 1264 |
| 805 | Ga0207698_10485323 | 3300026142 | Unclassified | 1199 |
| 806 | Ga0207698_10595299 | 3300026142 | Bacteria | 1089 |
| 807 | Ga0207698_10599310 | 3300026142 | Bacteria | 1086 |
| 808 | Ga0207698_10654831 | 3300026142 | Unclassified | 1041 |
| 809 | Ga0207698_10826622 | 3300026142 | Bacteria | 930 |
| 810 | Ga0207698_10849753 | 3300026142 | Unclassified | 918 |
| 811 | Ga0207698_10946198 | 3300026142 | Bacteria | 870 |
| 812 | Ga0207698_11001538 | 3300026142 | Unclassified | 846 |
| 813 | Ga0207698_11125362 | 3300026142 | Unclassified | 798 |
| 814 | Ga0207698_11384857 | 3300026142 | Bacteria | 718 |
| 815 | Ga0207698_12301297 | 3300026142 | Unclassified | 551 |
| 816 | Ga0207698_12418589 | 3300026142 | Archaea | 536 |
| 817 | Ga0268266_10023288 | 3300028379 | Bacteria | 5273 |
| 818 | Ga0268266_10211299 | 3300028379 | Bacteria | 1780 |
| 819 | Ga0268266_10784070 | 3300028379 | Unclassified | 920 |
| 820 | Ga0268266_11072106 | 3300028379 | Unclassified | 780 |
| 821 | Ga0268265_10054539 | 3300028380 | Bacteria | 3034 |
| 822 | Ga0307408_100159796 | 3300031548 | Unclassified | 1789 |
| 823 | Ga0307405_10078836 | 3300031731 | Bacteria | 2145 |
| 824 | Ga0307405_10735239 | 3300031731 | Unclassified | 821 |
| 825 | Ga0307413_10079744 | 3300031824 | Unclassified | 2094 |
| 826 | Ga0307409_100024402 | 3300031995 | Bacteria | 4217 |
| 827 | Ga0307409_100724732 | 3300031995 | Bacteria | 996 |
| 828 | Ga0307414_10936621 | 3300032004 | Unclassified | 795 |
| 829 | Ga0307415_100001570 | 3300032126 | Bacteria | 11012 |
| 830 | Ga0373930_0086937 | 3300034816 | Bacteria | 729 |
| 831 | Ga0373936_0113544 | 3300035113 | Bacteria | 1152 |
| 832 | Ga0373941_0200978 | 3300035115 | Bacteria | 757 |
| 833 | Ga0373943_0005760 | 3300035170 | Bacteria | 5563 |
| 834 | Ga0373942_0055592 | 3300035207 | Bacteria | 1121 |
| 835 | Ga0373931_0161264 | 3300035691 | Bacteria | 1315 |
| 836 | Ga0373935_0067849 | 3300035692 | Bacteria | 2294 |
| 837 | Ga0373935_0235457 | 3300035692 | Bacteria | 1276 |
| 838 | Ga0373927_0027849 | 3300035695 | Bacteria | 3690 |
| 839 | Ga0373947_0045254 | 3300035725 | Plasmid | 2633 |
| 840 | Ga0373925_0108896 | 3300037068 | Unclassified | 2138 |
| 841 | Ga0395899_0007176 | 3300037312 | Bacteria | 8628 |
| 842 | Ga0395899_0011485 | 3300037312 | Bacteria | 6779 |
| 843 | Ga0395899_0028968 | 3300037312 | Bacteria | 4166 |
| 844 | Ga0395899_0041307 | 3300037312 | Bacteria | 3446 |
| 845 | Ga0395899_0048245 | 3300037312 | Bacteria | 3169 |
| 846 | Ga0395899_0060615 | 3300037312 | Bacteria | 2787 |
| 847 | Ga0395899_0162733 | 3300037312 | Bacteria | 1575 |
| 848 | Ga0395899_0166656 | 3300037312 | Bacteria | 1554 |
| 849 | Ga0395899_0188925 | 3300037312 | Bacteria | 1442 |
| 850 | Ga0395899_0198354 | 3300037312 | Bacteria | 1401 |
| 851 | Ga0395899_0289704 | 3300037312 | Bacteria | 1111 |
| 852 | Ga0395899_0289778 | 3300037312 | Bacteria | 1111 |
| 853 | Ga0395899_0534923 | 3300037312 | Bacteria | 755 |
| 854 | Ga0395899_0579217 | 3300037312 | Bacteria | 718 |
| 855 | Ga0395899_0634894 | 3300037312 | Unclassified | 676 |
| 856 | Ga0395899_0778312 | 3300037312 | Bacteria | 593 |
| 857 | Ga0395900_0001394 | 3300037418 | Bacteria | 28915 |
| 858 | Ga0395900_0008469 | 3300037418 | Bacteria | 10576 |
| 859 | Ga0395900_0010426 | 3300037418 | Bacteria | 9503 |
| 860 | Ga0395900_0030033 | 3300037418 | Bacteria | 5578 |
| 861 | Ga0395900_0032876 | 3300037418 | Bacteria | 5336 |
| 862 | Ga0395900_0050492 | 3300037418 | Bacteria | 4284 |
| 863 | Ga0395900_0052102 | 3300037418 | Bacteria | 4213 |
| 864 | Ga0395900_0062387 | 3300037418 | Bacteria | 3831 |
| 865 | Ga0395900_0077109 | 3300037418 | Bacteria | 3424 |
| 866 | Ga0395900_0089904 | 3300037418 | Bacteria | 3156 |
| 867 | Ga0395900_0105747 | 3300037418 | Bacteria | 2891 |
| 868 | Ga0395900_0126300 | 3300037418 | Bacteria | 2623 |
| 869 | Ga0395900_0163867 | 3300037418 | Bacteria | 2266 |
| 870 | Ga0395900_0230756 | 3300037418 | Bacteria | 1861 |
| 871 | Ga0395900_0234653 | 3300037418 | Unclassified | 1843 |
| 872 | Ga0395900_0249016 | 3300037418 | Bacteria | 1779 |
| 873 | Ga0395900_0288714 | 3300037418 | Unclassified | 1630 |
| 874 | Ga0395900_0356664 | 3300037418 | Bacteria | 1434 |
| 875 | Ga0395900_0362485 | 3300037418 | Bacteria | 1420 |
| 876 | Ga0395900_0362494 | 3300037418 | Bacteria | 1420 |
| 877 | Ga0395900_0385103 | 3300037418 | Bacteria | 1369 |
| 878 | Ga0395900_0387076 | 3300037418 | Bacteria | 1365 |
| 879 | Ga0395900_0417831 | 3300037418 | Unclassified | 1302 |
| 880 | Ga0395900_0493040 | 3300037418 | Bacteria | 1176 |
| 881 | Ga0395900_0544519 | 3300037418 | Bacteria | 1106 |
| 882 | Ga0395900_0652225 | 3300037418 | Bacteria | 989 |
| 883 | Ga0395900_0781778 | 3300037418 | Bacteria | 883 |
| 884 | Ga0395900_0846033 | 3300037418 | Bacteria | 840 |
| 885 | Ga0395900_0870704 | 3300037418 | Bacteria | 825 |
| 886 | Ga0395900_0899413 | 3300037418 | Bacteria | 809 |
| 887 | Ga0395900_0944048 | 3300037418 | Bacteria | 784 |
| 888 | Ga0395900_0964745 | 3300037418 | Unclassified | 773 |
| 889 | Ga0395900_1032351 | 3300037418 | Unclassified | 741 |
| 890 | Ga0395900_1064233 | 3300037418 | Unclassified | 727 |
| 891 | Ga0395900_1232172 | 3300037418 | Bacteria | 663 |
| 892 | Ga0395900_1488730 | 3300037418 | Bacteria | 589 |
| 893 | Ga0395900_1529328 | 3300037418 | Bacteria | 579 |
| 894 | Ga0395900_1543227 | 3300037418 | Bacteria | 576 |
| 895 | Ga0395900_1922681 | 3300037418 | Unclassified | 502 |
| 896 | Ga0395898_0001185 | 3300037466 | Bacteria | 39681 |
| 897 | Ga0395898_0020458 | 3300037466 | Bacteria | 6721 |
| 898 | Ga0395898_0021682 | 3300037466 | Bacteria | 6511 |
| 899 | Ga0395898_0028633 | 3300037466 | Bacteria | 5582 |
| 900 | Ga0395898_0059285 | 3300037466 | Bacteria | 3724 |
| 901 | Ga0395898_0076497 | 3300037466 | Bacteria | 3232 |
| 902 | Ga0395898_0092031 | 3300037466 | Bacteria | 2917 |
| 903 | Ga0395898_0106321 | 3300037466 | Bacteria | 2692 |
| 904 | Ga0395898_0107720 | 3300037466 | Bacteria | 2672 |
| 905 | Ga0395898_0117210 | 3300037466 | Unclassified | 2551 |
| 906 | Ga0395898_0117953 | 3300037466 | Bacteria | 2542 |
| 907 | Ga0395898_0183993 | 3300037466 | Bacteria | 1996 |
| 908 | Ga0395898_0204455 | 3300037466 | Bacteria | 1884 |
| 909 | Ga0395898_0356728 | 3300037466 | Unclassified | 1394 |
| 910 | Ga0395898_0445476 | 3300037466 | Bacteria | 1233 |
| 911 | Ga0395898_0498012 | 3300037466 | Bacteria | 1159 |
| 912 | Ga0395898_0527479 | 3300037466 | Bacteria | 1122 |
| 913 | Ga0395898_0568508 | 3300037466 | Bacteria | 1076 |
| 914 | Ga0395898_0662130 | 3300037466 | Unclassified | 986 |
| 915 | Ga0395898_0959677 | 3300037466 | Unclassified | 792 |
| 916 | Ga0395898_1518654 | 3300037466 | Unclassified | 595 |
| 917 | Ga0395905_0001106 | 3300037471 | Bacteria | 33891 |
| 918 | Ga0395905_0010576 | 3300037471 | Bacteria | 8962 |
| 919 | Ga0395905_0014304 | 3300037471 | Bacteria | 7584 |
| 920 | Ga0395905_0016298 | 3300037471 | Bacteria | 7061 |
| 921 | Ga0395905_0031856 | 3300037471 | Bacteria | 4961 |
| 922 | Ga0395905_0032788 | 3300037471 | Bacteria | 4884 |
| 923 | Ga0395905_0036038 | 3300037471 | Bacteria | 4646 |
| 924 | Ga0395905_0038261 | 3300037471 | Bacteria | 4501 |
| 925 | Ga0395905_0052633 | 3300037471 | Bacteria | 3811 |
| 926 | Ga0395905_0053348 | 3300037471 | Bacteria | 3784 |
| 927 | Ga0395905_0062751 | 3300037471 | Bacteria | 3475 |
| 928 | Ga0395905_0072984 | 3300037471 | Bacteria | 3217 |
| 929 | Ga0395905_0074226 | 3300037471 | Unclassified | 3187 |
| 930 | Ga0395905_0076337 | 3300037471 | Bacteria | 3140 |
| 931 | Ga0395905_0098783 | 3300037471 | Unclassified | 2742 |
| 932 | Ga0395905_0103052 | 3300037471 | Bacteria | 2679 |
| 933 | Ga0395905_0108175 | 3300037471 | Bacteria | 2610 |
| 934 | Ga0395905_0119008 | 3300037471 | Bacteria | 2482 |
| 935 | Ga0395905_0120488 | 3300037471 | Bacteria | 2466 |
| 936 | Ga0395905_0131695 | 3300037471 | Bacteria | 2352 |
| 937 | Ga0395905_0138196 | 3300037471 | Bacteria | 2293 |
| 938 | Ga0395905_0144948 | 3300037471 | Bacteria | 2234 |
| 939 | Ga0395905_0182500 | 3300037471 | Bacteria | 1970 |
| 940 | Ga0395905_0225481 | 3300037471 | Bacteria | 1753 |
| 941 | Ga0395905_0228058 | 3300037471 | Bacteria | 1742 |
| 942 | Ga0395905_0273366 | 3300037471 | Bacteria | 1575 |
| 943 | Ga0395905_0280800 | 3300037471 | Bacteria | 1551 |
| 944 | Ga0395905_0303029 | 3300037471 | Unclassified | 1485 |
| 945 | Ga0395905_0357253 | 3300037471 | Bacteria | 1353 |
| 946 | Ga0395905_0384232 | 3300037471 | Bacteria | 1298 |
| 947 | Ga0395905_0388187 | 3300037471 | Bacteria | 1290 |
| 948 | Ga0395905_0392463 | 3300037471 | Bacteria | 1282 |
| 949 | Ga0395905_0423506 | 3300037471 | Unclassified | 1227 |
| 950 | Ga0395905_0424110 | 3300037471 | Bacteria | 1226 |
| 951 | Ga0395905_0427279 | 3300037471 | Bacteria | 1221 |
| 952 | Ga0395905_0440465 | 3300037471 | Bacteria | 1200 |
| 953 | Ga0395905_0441742 | 3300037471 | Bacteria | 1198 |
| 954 | Ga0395905_0444228 | 3300037471 | Bacteria | 1194 |
| 955 | Ga0395905_0553863 | 3300037471 | Bacteria | 1051 |
| 956 | Ga0395905_0560226 | 3300037471 | Unclassified | 1044 |
| 957 | Ga0395905_0612801 | 3300037471 | Unclassified | 990 |
| 958 | Ga0395905_0676216 | 3300037471 | Unclassified | 934 |
| 959 | Ga0395905_0741953 | 3300037471 | Unclassified | 884 |
| 960 | Ga0395905_0801251 | 3300037471 | Bacteria | 845 |
| 961 | Ga0395905_0858665 | 3300037471 | Bacteria | 811 |
| 962 | Ga0395905_0862866 | 3300037471 | Bacteria | 808 |
| 963 | Ga0395905_0875123 | 3300037471 | Unclassified | 801 |
| 964 | Ga0395905_0881948 | 3300037471 | Unclassified | 798 |
| 965 | Ga0395905_0959312 | 3300037471 | Unclassified | 758 |
| 966 | Ga0395905_1042050 | 3300037471 | Bacteria | 721 |
| 967 | Ga0395905_1236403 | 3300037471 | Bacteria | 650 |
| 968 | Ga0395905_1274942 | 3300037471 | Unclassified | 638 |
| 969 | Ga0395901_0001061 | 3300038443 | Bacteria | 29546 |
| 970 | Ga0395901_0001163 | 3300038443 | Bacteria | 27959 |
| 971 | Ga0395901_0020488 | 3300038443 | Bacteria | 6768 |
| 972 | Ga0395901_0023391 | 3300038443 | Bacteria | 6333 |
| 973 | Ga0395901_0030902 | 3300038443 | Bacteria | 5519 |
| 974 | Ga0395901_0036445 | 3300038443 | Bacteria | 5084 |
| 975 | Ga0395901_0047208 | 3300038443 | Bacteria | 4471 |
| 976 | Ga0395901_0048224 | 3300038443 | Bacteria | 4423 |
| 977 | Ga0395901_0058387 | 3300038443 | Bacteria | 4013 |
| 978 | Ga0395901_0083658 | 3300038443 | Bacteria | 3335 |
| 979 | Ga0395901_0108802 | 3300038443 | Bacteria | 2909 |
| 980 | Ga0395901_0109032 | 3300038443 | Bacteria | 2906 |
| 981 | Ga0395901_0137818 | 3300038443 | Unclassified | 2564 |
| 982 | Ga0395901_0163103 | 3300038443 | Bacteria | 2340 |
| 983 | Ga0395901_0217738 | 3300038443 | Bacteria | 1996 |
| 984 | Ga0395901_0221989 | 3300038443 | Bacteria | 1975 |
| 985 | Ga0395901_0232981 | 3300038443 | Bacteria | 1922 |
| 986 | Ga0395901_0235765 | 3300038443 | Unclassified | 1909 |
| 987 | Ga0395901_0243877 | 3300038443 | Bacteria | 1873 |
| 988 | Ga0395901_0249652 | 3300038443 | Unclassified | 1849 |
| 989 | Ga0395901_0286832 | 3300038443 | Bacteria | 1709 |
| 990 | Ga0395901_0306317 | 3300038443 | Unclassified | 1646 |
| 991 | Ga0395901_0484895 | 3300038443 | Bacteria | 1260 |
| 992 | Ga0395901_0512652 | 3300038443 | Bacteria | 1219 |
| 993 | Ga0395901_0526357 | 3300038443 | Unclassified | 1200 |
| 994 | Ga0395901_0638789 | 3300038443 | Unclassified | 1069 |
| 995 | Ga0395901_0669103 | 3300038443 | Unclassified | 1039 |
| 996 | Ga0395901_0677574 | 3300038443 | Bacteria | 1031 |
| 997 | Ga0395901_0700726 | 3300038443 | Unclassified | 1010 |
| 998 | Ga0395901_0704142 | 3300038443 | Bacteria | 1007 |
| 999 | Ga0395901_0820975 | 3300038443 | Bacteria | 917 |
| 1000 | Ga0395901_0855763 | 3300038443 | Unclassified | 894 |
| 1001 | Ga0395901_0961663 | 3300038443 | Bacteria | 832 |
| 1002 | Ga0395901_0972153 | 3300038443 | Bacteria | 826 |
| 1003 | Ga0395901_1122761 | 3300038443 | Bacteria | 755 |
| 1004 | Ga0395901_1148312 | 3300038443 | Bacteria | 745 |
| 1005 | Ga0395901_1561287 | 3300038443 | Bacteria | 614 |
| 1006 | Ga0436365_0782179 | 3300039437 | Bacteria | 37690 |
| 1007 | Ga0436363_1101143 | 3300039450 | Bacteria | 2469 |
| 1008 | Ga0451833_1137545 | 3300041491 | Unclassified | 527 |
| 1009 | Ga0439448_0004818 | 3300042005 | Bacteria | 3822 |
| 1010 | Ga0439455_0007660 | 3300042012 | Viruses | 2291 |
| 1011 | Ga0439458_0001158 | 3300042157 | Bacteria | 6681 |
| 1012 | Ga0439458_0002397 | 3300042157 | Bacteria | 4580 |
| 1013 | Ga0466969_0002083 | 3300044656 | Bacteria | 10679 |
| 1014 | Ga0466969_0290935 | 3300044656 | Bacteria | 739 |
| 1015 | Ga0466969_0448194 | 3300044656 | Bacteria | 587 |
| 1016 | Ga0466972_0186083 | 3300044658 | Bacteria | 973 |
| 1017 | Ga0466972_0210210 | 3300044658 | Bacteria | 911 |
| 1018 | Ga0466972_0215908 | 3300044658 | Bacteria | 897 |
| 1019 | Ga0466965_0054675 | 3300044683 | Bacteria | 1986 |
| 1020 | Ga0466965_0221794 | 3300044683 | Bacteria | 1008 |
| 1021 | Ga0466965_0361391 | 3300044683 | Bacteria | 797 |
| 1022 | Ga0466965_0431489 | 3300044683 | Bacteria | 732 |
| 1023 | Ga0466966_0011598 | 3300044684 | Bacteria | 5842 |
| 1024 | Ga0466966_0051282 | 3300044684 | Bacteria | 2623 |
| 1025 | Ga0466966_0061319 | 3300044684 | Bacteria | 2372 |
| 1026 | Ga0466966_0066066 | 3300044684 | Bacteria | 2273 |
| 1027 | Ga0466966_0090027 | 3300044684 | Bacteria | 1905 |
| 1028 | Ga0466966_0211528 | 3300044684 | Bacteria | 1172 |
| 1029 | Ga0466966_0239076 | 3300044684 | Bacteria | 1095 |
| 1030 | Ga0466966_0756004 | 3300044684 | Bacteria | 586 |
| 1031 | Ga0466961_0010281 | 3300044693 | Bacteria | 5964 |
| 1032 | Ga0466961_0080430 | 3300044693 | Bacteria | 2063 |
| 1033 | Ga0466961_0080884 | 3300044693 | Bacteria | 2056 |
| 1034 | Ga0466961_0419055 | 3300044693 | Unclassified | 811 |
| 1035 | Ga0466961_0706071 | 3300044693 | Bacteria | 604 |
| 1036 | Ga0466961_0741010 | 3300044693 | Unclassified | 588 |
| 1037 | Ga0466961_0902049 | 3300044693 | Unclassified | 526 |
| 1038 | Ga0466963_0009505 | 3300044694 | Bacteria | 5855 |
| 1039 | Ga0466963_0032247 | 3300044694 | Bacteria | 3391 |
| 1040 | Ga0466963_0047261 | 3300044694 | Bacteria | 2840 |
| 1041 | Ga0466963_0054072 | 3300044694 | Unclassified | 2668 |
| 1042 | Ga0466963_0091743 | 3300044694 | Bacteria | 2069 |
| 1043 | Ga0466963_0106172 | 3300044694 | Bacteria | 1925 |
| 1044 | Ga0466963_0116869 | 3300044694 | Unclassified | 1833 |
| 1045 | Ga0466963_0155478 | 3300044694 | Bacteria | 1589 |
| 1046 | Ga0466963_0277581 | 3300044694 | Bacteria | 1177 |
| 1047 | Ga0466964_0041650 | 3300044706 | Unclassified | 1859 |
| 1048 | Ga0466964_0387949 | 3300044706 | Unclassified | 727 |
| 1049 | Ga0466971_0115332 | 3300044719 | Bacteria | 1241 |
| 1050 | Ga0466971_0203693 | 3300044719 | Unclassified | 934 |
| 1051 | Ga0466970_0231605 | 3300044765 | Unclassified | 1032 |
| 1052 | Ga0466970_0413123 | 3300044765 | Viruses | 771 |
| 1053 | Ga0466957_0001719 | 3300044842 | Bacteria | 11513 |
| 1054 | Ga0466957_0013241 | 3300044842 | Bacteria | 4784 |
| 1055 | Ga0466957_0014687 | 3300044842 | Bacteria | 4563 |
| 1056 | Ga0466957_0082779 | 3300044842 | Bacteria | 2001 |
| 1057 | Ga0466957_0213806 | 3300044842 | Bacteria | 1271 |
| 1058 | Ga0466957_0227569 | 3300044842 | Bacteria | 1233 |
| 1059 | Ga0466957_0371761 | 3300044842 | Unclassified | 973 |
| 1060 | Ga0466957_0680879 | 3300044842 | Unclassified | 725 |
| 1061 | Ga0466960_0086474 | 3300044901 | Bacteria | 1590 |
| 1062 | Ga0466960_0098857 | 3300044901 | Unclassified | 1499 |
| 1063 | Ga0466960_0142410 | 3300044901 | Unclassified | 1274 |
| 1064 | Ga0466960_0459758 | 3300044901 | Bacteria | 741 |
| 1065 | Ga0466959_0017690 | 3300045049 | Bacteria | 5228 |
| 1066 | Ga0466959_0160720 | 3300045049 | Bacteria | 1580 |
| 1067 | Ga0466959_0176301 | 3300045049 | Unclassified | 1497 |
| 1068 | Ga0466959_0183145 | 3300045049 | Bacteria | 1464 |
| 1069 | Ga0466959_0246788 | 3300045049 | Unclassified | 1232 |
| 1070 | Ga0466959_0253412 | 3300045049 | Bacteria | 1213 |
| 1071 | Ga0466959_0355493 | 3300045049 | Unclassified | 998 |
| 1072 | Ga0466959_0362362 | 3300045049 | Unclassified | 988 |
| 1073 | Ga0466959_0502149 | 3300045049 | Bacteria | 820 |
| 1074 | Ga0466958_0019636 | 3300045836 | Bacteria | 3934 |
| 1075 | Ga0466958_0070951 | 3300045836 | Bacteria | 2133 |
| 1076 | Ga0466958_0123938 | 3300045836 | Unclassified | 1619 |
| 1077 | Ga0466958_0156375 | 3300045836 | Bacteria | 1439 |
| 1078 | Ga0466958_0238589 | 3300045836 | Bacteria | 1161 |
| 1079 | Ga0466958_0302158 | 3300045836 | Bacteria | 1027 |
| 1080 | Ga0466958_0359426 | 3300045836 | Unclassified | 938 |
| 1081 | Ga0466967_0004351 | 3300045976 | Bacteria | 9534 |
| 1082 | Ga0466967_0006660 | 3300045976 | Bacteria | 8213 |
| 1083 | Ga0466967_0044291 | 3300045976 | Bacteria | 3859 |
| 1084 | Ga0466967_0057541 | 3300045976 | Bacteria | 3433 |
| 1085 | Ga0466967_0094909 | 3300045976 | Bacteria | 2717 |
| 1086 | Ga0466967_0124917 | 3300045976 | Bacteria | 2382 |
| 1087 | Ga0466967_0151722 | 3300045976 | Bacteria | 2166 |
| 1088 | Ga0466967_0173258 | 3300045976 | Bacteria | 2031 |
| 1089 | Ga0466967_0174154 | 3300045976 | Bacteria | 2026 |
| 1090 | Ga0466967_0228094 | 3300045976 | Unclassified | 1772 |
| 1091 | Ga0466967_0263513 | 3300045976 | Bacteria | 1649 |
| 1092 | Ga0466967_0301163 | 3300045976 | Unclassified | 1542 |
| 1093 | Ga0466967_0363541 | 3300045976 | Bacteria | 1402 |
| 1094 | Ga0466967_0384863 | 3300045976 | Bacteria | 1362 |
| 1095 | Ga0466967_0595311 | 3300045976 | Unclassified | 1091 |
| 1096 | Ga0466967_0893509 | 3300045976 | Unclassified | 883 |
| 1097 | Ga0466967_1273524 | 3300045976 | Unclassified | 732 |
| 1098 | Ga0466967_1504135 | 3300045976 | Unclassified | 670 |
| 1099 | Ga0466967_1900475 | 3300045976 | Bacteria | 592 |
| 1100 | Ga0466967_2210044 | 3300045976 | Unclassified | 546 |
| 1101 | Ga0495610_0171939 | 3300046512 | Unclassified | 908 |
| 1102 | Ga0495643_0232867 | 3300046522 | Unclassified | 868 |
| 1103 | Ga0495663_0006214 | 3300046525 | Unclassified | 3298 |
| 1104 | Ga0495642_0217615 | 3300046528 | Unclassified | 834 |
| 1105 | Ga0495668_0010412 | 3300046616 | Bacteria | 5626 |
| 1106 | Ga0495669_0000119 | 3300046684 | Bacteria | 50758 |
| 1107 | Ga0495669_0010895 | 3300046684 | Bacteria | 3849 |
| 1108 | Ga0495669_0023305 | 3300046684 | Bacteria | 2694 |
| 1109 | Ga0495669_0125188 | 3300046684 | Bacteria | 1207 |
| 1110 | Ga0495669_0156128 | 3300046684 | Unclassified | 1081 |
| 1111 | Ga0495669_0494072 | 3300046684 | Unclassified | 595 |
| 1112 | Ga0495600_0776801 | 3300046809 | Bacteria | 572 |
| 1113 | Ga0495677_0031713 | 3300047445 | Bacteria | 1924 |
| 1114 | Ga0496100_0062051 | 3300048903 | Bacteria | 2465 |
| 1115 | Ga0496101_0151018 | 3300048904 | Bacteria | 1777 |
| 1116 | Ga0496101_0178459 | 3300048904 | Bacteria | 1635 |
| 1117 | Ga0496101_0188141 | 3300048904 | Bacteria | 1592 |
| 1118 | Ga0496101_0378573 | 3300048904 | Unclassified | 1113 |
| 1119 | Ga0496101_0425945 | 3300048904 | Unclassified | 1046 |
| 1120 | Ga0496102_0054392 | 3300048905 | Bacteria | 3650 |
| 1121 | Ga0496102_0173186 | 3300048905 | Unclassified | 2032 |
| 1122 | Ga0496102_0795211 | 3300048905 | Bacteria | 868 |
| 1123 | Ga0496102_1872314 | 3300048905 | Unclassified | 517 |
| 1124 | Ga0496103_0672443 | 3300048906 | Bacteria | 657 |
| 1125 | Ga0496104_0565201 | 3300048907 | Bacteria | 1048 |
| 1126 | Ga0496104_0793894 | 3300048907 | Unclassified | 853 |
| 1127 | Ga0496104_1441164 | 3300048907 | Unclassified | 592 |
| 1128 | Ga0496105_0164931 | 3300048908 | Bacteria | 1818 |
| 1129 | Ga0496106_0614659 | 3300048909 | Bacteria | 870 |
| 1130 | Ga0496106_0951890 | 3300048909 | Bacteria | 677 |
| 1131 | Ga0496107_0056655 | 3300048910 | Bacteria | 2832 |
| 1132 | Ga0496107_0084052 | 3300048910 | Bacteria | 2322 |
| 1133 | Ga0496107_0134480 | 3300048910 | Bacteria | 1827 |
| 1134 | Ga0496107_0340462 | 3300048910 | Bacteria | 1116 |
| 1135 | Ga0496107_1336910 | 3300048910 | Bacteria | 512 |
| 1136 | Ga0496108_0039210 | 3300048911 | Unclassified | 3949 |
| 1137 | Ga0496108_0142175 | 3300048911 | Unclassified | 2067 |
| 1138 | Ga0496109_0369747 | 3300048912 | Unclassified | 1354 |
| 1139 | Ga0496109_0535874 | 3300048912 | Bacteria | 1104 |
| 1140 | Ga0496109_0554142 | 3300048912 | Bacteria | 1084 |
| 1141 | Ga0496109_0927580 | 3300048912 | Unclassified | 809 |
| 1142 | Ga0496109_1135116 | 3300048912 | Unclassified | 718 |
| 1143 | Ga0496110_0036598 | 3300048913 | Bacteria | 4262 |
| 1144 | Ga0496110_0048084 | 3300048913 | Bacteria | 3738 |
| 1145 | Ga0496110_0058050 | 3300048913 | Bacteria | 3408 |
| 1146 | Ga0496110_0091694 | 3300048913 | Bacteria | 2718 |
| 1147 | Ga0496110_0091986 | 3300048913 | Bacteria | 2714 |
| 1148 | Ga0496110_0210809 | 3300048913 | Unclassified | 1766 |
| 1149 | Ga0496111_0017004 | 3300048914 | Bacteria | 5020 |
| 1150 | Ga0496111_0048239 | 3300048914 | Bacteria | 3068 |
| 1151 | Ga0496111_0644684 | 3300048914 | Bacteria | 773 |
| 1152 | Ga0496111_1031320 | 3300048914 | Bacteria | 588 |
| 1153 | Ga0496112_0005611 | 3300048915 | Bacteria | 10883 |
| 1154 | Ga0496112_0006998 | 3300048915 | Bacteria | 9958 |
| 1155 | Ga0496112_0020968 | 3300048915 | Bacteria | 6206 |
| 1156 | Ga0496112_0026749 | 3300048915 | Bacteria | 5557 |
| 1157 | Ga0496112_0038409 | 3300048915 | Bacteria | 4674 |
| 1158 | Ga0496112_0186641 | 3300048915 | Bacteria | 2036 |
| 1159 | Ga0496112_0403305 | 3300048915 | Bacteria | 1307 |
| 1160 | Ga0496112_1197434 | 3300048915 | Unclassified | 676 |
| 1161 | Ga0496113_0056778 | 3300048916 | Bacteria | 2940 |
| 1162 | Ga0496113_0066812 | 3300048916 | Bacteria | 2724 |
| 1163 | Ga0496113_0210884 | 3300048916 | Bacteria | 1546 |
| 1164 | Ga0496113_0211392 | 3300048916 | Unclassified | 1544 |
| 1165 | Ga0501067_0248786 | 3300049583 | Bacteria | 989 |
| 1166 | Ga0501067_0650534 | 3300049583 | Unclassified | 592 |
| 1167 | Ga0501067_0670497 | 3300049583 | Unclassified | 582 |
| 1168 | Ga0501067_0847476 | 3300049583 | Unclassified | 515 |
| 1169 | Ga0501070_0217149 | 3300049586 | Bacteria | 1569 |
| 1170 | Ga0501080_0072631 | 3300049742 | Bacteria | 3201 |
| 1171 | Ga0501081_1172241 | 3300049743 | Bacteria | 582 |
| 1172 | Ga0501241_121567 | 3300049758 | Bacteria | 580 |
| 1173 | nmdc:mga0n895_1726203_c1 | 3300050512 | Unclassified | 588 |
| 1174 | Ga0495655_0107526 | 3300053083 | Bacteria | 834 |
| 1175 | Ga0495655_0110957 | 3300053083 | Bacteria | 824 |
| 1176 | Ga0587082_095928 | 3300059504 | Unclassified | 640 |
| 1177 | Ga0466962_0014948 | 3300061719 | Bacteria | 3742 |
| 1178 | Ga0466962_0020149 | 3300061719 | Bacteria | 3205 |
| 1179 | Ga0466962_0031522 | 3300061719 | Bacteria | 2538 |
| 1180 | Ga0466962_0035945 | 3300061719 | Bacteria | 2371 |
| 1181 | Ga0466962_0059354 | 3300061719 | Unclassified | 1826 |
| 1182 | Ga0070658_10703083 | |||
| 1183 | JGI24741J21665_1013054 | |||
| 1184 | JGI24741J21665_1013905 | |||
| 1185 | JGI24740J21852_10005282 | |||
| 1186 | JGI24740J21852_10013970 | |||
| 1187 | JGI24740J21852_10092168 | |||
| 1188 | JGI24739J22299_10075012 | |||
| 1189 | JGI24737J22298_10034707 | |||
| 1190 | JGI24737J22298_10079916 | |||
| 1191 | JGI24737J22298_10132646 | |||
| 1192 | JGI24743J22301_10117069 | |||
| 1193 | JGI24735J21928_10007520 | |||
| 1194 | JGI24735J21928_10028683 | |||
| 1195 | JGI24735J21928_10070409 | |||
| 1196 | JGI24735J21928_10116996 | |||
| 1197 | Ga0065715_10613413 | |||
| 1198 | Ga0070658_10044445 | |||
| 1199 | Ga0070658_10053063 | |||
| 1200 | Ga0070658_10053578 | |||
| 1201 | Ga0070658_10054865 | |||
| 1202 | Ga0070658_10057219 | |||
| 1203 | Ga0070658_10111756 | |||
| 1204 | Ga0070658_10122773 | |||
| 1205 | Ga0070658_10256321 | |||
| 1206 | Ga0070658_10319640 | |||
| 1207 | Ga0070658_10462893 | |||
| 1208 | Ga0070658_10531702 | |||
| 1209 | Ga0070658_10568609 | |||
| 1210 | Ga0070658_11103387 | |||
| 1211 | Ga0070658_11427983 | |||
| 1212 | Ga0070658_11864039 | |||
| 1213 | Ga0070676_10183091 | |||
| 1214 | Ga0070676_10343579 | |||
| 1215 | Ga0070676_11091485 | |||
| 1216 | Ga0070683_100029289 | |||
| 1217 | Ga0070683_100045842 | |||
| 1218 | Ga0070683_100058939 | |||
| 1219 | Ga0070683_100379440 | |||
| 1220 | Ga0070683_100600962 | |||
| 1221 | Ga0070683_100950791 | |||
| 1222 | Ga0070683_101245746 | |||
| 1223 | Ga0070690_100094095 | |||
| 1224 | Ga0070690_100608733 | |||
| 1225 | Ga0070670_100117488 | |||
| 1226 | Ga0070670_100246923 | |||
| 1227 | Ga0070670_100375951 | |||
| 1228 | Ga0070670_100452663 | |||
| 1229 | Ga0070670_100580798 | |||
| 1230 | Ga0068869_100025190 | |||
| 1231 | Ga0070666_10093190 | |||
| 1232 | Ga0070666_10122898 | |||
| 1233 | Ga0070666_10148139 | |||
| 1234 | Ga0070666_10157990 | |||
| 1235 | Ga0070666_10202545 | |||
| 1236 | Ga0070666_10219746 | |||
| 1237 | Ga0070666_10264286 | |||
| 1238 | Ga0070666_10456883 | |||
| 1239 | Ga0070666_10687962 | |||
| 1240 | Ga0070680_100002569 | |||
| 1241 | Ga0070680_100015719 | |||
| 1242 | Ga0070680_100039119 | |||
| 1243 | Ga0070680_100200313 | |||
| 1244 | Ga0070680_100213638 | |||
| 1245 | Ga0070680_100467730 | |||
| 1246 | Ga0070680_100602432 | |||
| 1247 | Ga0070680_101467877 | |||
| 1248 | Ga0070682_100004425 | |||
| 1249 | Ga0070682_100048175 | |||
| 1250 | Ga0070682_100098513 | |||
| 1251 | Ga0070682_100117185 | |||
| 1252 | Ga0070682_100198133 | |||
| 1253 | Ga0070682_100215729 | |||
| 1254 | Ga0068868_100044286 | |||
| 1255 | Ga0068868_100113064 | |||
| 1256 | Ga0068868_100173930 | |||
| 1257 | Ga0068868_100192637 | |||
| 1258 | Ga0068868_100620101 | |||
| 1259 | Ga0068868_101035351 | |||
| 1260 | Ga0068868_101058871 | |||
| 1261 | Ga0070660_100006487 | |||
| 1262 | Ga0070660_100032890 | |||
| 1263 | Ga0070660_100074074 | |||
| 1264 | Ga0070660_100101460 | |||
| 1265 | Ga0070660_100112059 | |||
| 1266 | Ga0070660_100165120 | |||
| 1267 | Ga0070660_100187281 | |||
| 1268 | Ga0070660_100243431 | |||
| 1269 | Ga0070660_100261025 | |||
| 1270 | Ga0070660_100313994 | |||
| 1271 | Ga0070660_100505171 | |||
| 1272 | Ga0070660_101513646 | |||
| 1273 | Ga0070691_10011078 | |||
| 1274 | Ga0070691_10066920 | |||
| 1275 | Ga0070687_101019564 | |||
| 1276 | Ga0070661_100007181 | |||
| 1277 | Ga0070661_100028778 | |||
| 1278 | Ga0070661_100033991 | |||
| 1279 | Ga0070661_100055236 | |||
| 1280 | Ga0070661_100064870 | |||
| 1281 | Ga0070661_100105893 | |||
| 1282 | Ga0070661_100131711 | |||
| 1283 | Ga0070661_100146893 | |||
| 1284 | Ga0070661_100189640 | |||
| 1285 | Ga0070661_100258014 | |||
| 1286 | Ga0070661_100452478 | |||
| 1287 | Ga0070661_100709959 | |||
| 1288 | Ga0070661_100882017 | |||
| 1289 | Ga0070661_100904872 | |||
| 1290 | Ga0070661_100997126 | |||
| 1291 | Ga0070661_101030449 | |||
| 1292 | Ga0070661_101215251 | |||
| 1293 | Ga0070661_101628213 | |||
| 1294 | Ga0070661_101792556 | |||
| 1295 | Ga0070668_100060647 | |||
| 1296 | Ga0070668_100462556 | |||
| 1297 | Ga0070669_100708785 | |||
| 1298 | Ga0070669_100815176 | |||
| 1299 | Ga0070675_100647767 | |||
| 1300 | Ga0070671_100011258 | |||
| 1301 | Ga0070671_100059181 | |||
| 1302 | Ga0070671_100064036 | |||
| 1303 | Ga0070671_100288882 | |||
| 1304 | Ga0070671_100508573 | |||
| 1305 | Ga0070671_100619478 | |||
| 1306 | Ga0070671_100877970 | |||
| 1307 | Ga0070671_101000620 | |||
| 1308 | Ga0070674_100010556 | |||
| 1309 | Ga0070674_100032436 | |||
| 1310 | Ga0070673_100027334 | |||
| 1311 | Ga0070673_100041779 | |||
| 1312 | Ga0070673_100072672 | |||
| 1313 | Ga0070673_100116568 | |||
| 1314 | Ga0070673_100164522 | |||
| 1315 | Ga0070673_100652239 | |||
| 1316 | Ga0070673_100696172 | |||
| 1317 | Ga0070688_101188911 | |||
| 1318 | Ga0070659_100006363 | |||
| 1319 | Ga0070659_100010221 | |||
| 1320 | Ga0070659_100024893 | |||
| 1321 | Ga0070659_100042573 | |||
| 1322 | Ga0070659_100066222 | |||
| 1323 | Ga0070659_100074050 | |||
| 1324 | Ga0070659_100084695 | |||
| 1325 | Ga0070659_100112215 | |||
| 1326 | Ga0070659_100261923 | |||
| 1327 | Ga0070659_100307863 | |||
| 1328 | Ga0070659_100426540 | |||
| 1329 | Ga0070659_100674506 | |||
| 1330 | Ga0070659_100858653 | |||
| 1331 | Ga0070659_101041550 | |||
| 1332 | Ga0070659_101076667 | |||
| 1333 | Ga0070659_101114139 | |||
| 1334 | Ga0070659_101531635 | |||
| 1335 | Ga0070659_101629066 | |||
| 1336 | Ga0070659_101874453 | |||
| 1337 | Ga0070667_100044243 | |||
| 1338 | Ga0070667_100051887 | |||
| 1339 | Ga0070667_100069657 | |||
| 1340 | Ga0070667_100350481 | |||
| 1341 | Ga0070667_100452037 | |||
| 1342 | Ga0070667_100494620 | |||
| 1343 | Ga0070667_100679135 | |||
| 1344 | Ga0070714_100024323 | |||
| 1345 | Ga0070714_100143336 | |||
| 1346 | Ga0070714_100144037 | |||
| 1347 | Ga0070714_100463166 | |||
| 1348 | Ga0070714_100510250 | |||
| 1349 | Ga0070713_100260760 | |||
| 1350 | Ga0070705_101571085 | |||
| 1351 | Ga0070663_100015732 | |||
| 1352 | Ga0070663_100045193 | |||
| 1353 | Ga0070663_100060922 | |||
| 1354 | Ga0070663_100096432 | |||
| 1355 | Ga0070663_100102654 | |||
| 1356 | Ga0070663_100111806 | |||
| 1357 | Ga0070663_100326107 | |||
| 1358 | Ga0070663_100389685 | |||
| 1359 | Ga0070663_100484139 | |||
| 1360 | Ga0070663_100782232 | |||
| 1361 | Ga0070663_100927740 | |||
| 1362 | Ga0070663_101665935 | |||
| 1363 | Ga0070678_100002540 | |||
| 1364 | Ga0070662_100192783 | |||
| 1365 | Ga0070662_100275212 | |||
| 1366 | Ga0070662_100314546 | |||
| 1367 | Ga0070662_100416892 | |||
| 1368 | Ga0070662_100430670 | |||
| 1369 | Ga0070662_100466532 | |||
| 1370 | Ga0070662_100741496 | |||
| 1371 | Ga0070662_100794890 | |||
| 1372 | Ga0070662_100883081 | |||
| 1373 | Ga0070662_101283144 | |||
| 1374 | Ga0070662_101330070 | |||
| 1375 | Ga0070662_101693102 | |||
| 1376 | Ga0070681_10037966 | |||
| 1377 | Ga0070681_10082750 | |||
| 1378 | Ga0070681_10215772 | |||
| 1379 | Ga0070681_10322623 | |||
| 1380 | Ga0070681_10756360 | |||
| 1381 | Ga0070681_10803870 | |||
| 1382 | Ga0070681_11634432 | |||
| 1383 | Ga0070681_11724155 | |||
| 1384 | Ga0068867_100160310 | |||
| 1385 | Ga0068867_100244989 | |||
| 1386 | Ga0070679_100024325 | |||
| 1387 | Ga0070679_100062927 | |||
| 1388 | Ga0070679_100101746 | |||
| 1389 | Ga0070679_100202668 | |||
| 1390 | Ga0070679_100354860 | |||
| 1391 | Ga0070679_100415344 | |||
| 1392 | Ga0070679_100467060 | |||
| 1393 | Ga0070679_100649688 | |||
| 1394 | Ga0070679_100868140 | |||
| 1395 | Ga0070679_101049089 | |||
| 1396 | Ga0070679_102056941 | |||
| 1397 | Ga0070684_100015169 | |||
| 1398 | Ga0070684_100064491 | |||
| 1399 | Ga0070684_100132647 | |||
| 1400 | Ga0068853_100005874 | |||
| 1401 | Ga0068853_100072538 | |||
| 1402 | Ga0068853_100138604 | |||
| 1403 | Ga0068853_100147819 | |||
| 1404 | Ga0068853_100281037 | |||
| 1405 | Ga0068853_100297752 | |||
| 1406 | Ga0068853_101163072 | |||
| 1407 | Ga0068853_101259346 | |||
| 1408 | Ga0070672_100132691 | |||
| 1409 | Ga0070672_100198655 | |||
| 1410 | Ga0070672_100311615 | |||
| 1411 | Ga0070672_100543358 | |||
| 1412 | Ga0070672_101055494 | |||
| 1413 | Ga0070672_101555225 | |||
| 1414 | Ga0070686_100032012 | |||
| 1415 | Ga0070686_100239219 | |||
| 1416 | Ga0070693_100013503 | |||
| 1417 | Ga0070693_100159387 | |||
| 1418 | Ga0070693_100161822 | |||
| 1419 | Ga0070693_100879540 | |||
| 1420 | Ga0070665_100068731 | |||
| 1421 | Ga0070665_100352916 | |||
| 1422 | Ga0070665_101080590 | |||
| 1423 | Ga0070665_101114201 | |||
| 1424 | Ga0070665_102562371 | |||
| 1425 | Ga0068855_100016170 | |||
| 1426 | Ga0068855_100067954 | |||
| 1427 | Ga0068855_100070936 | |||
| 1428 | Ga0068855_100154291 | |||
| 1429 | Ga0068855_100177543 | |||
| 1430 | Ga0068855_100318811 | |||
| 1431 | Ga0068855_100336031 | |||
| 1432 | Ga0068855_100561663 | |||
| 1433 | Ga0068855_100692193 | |||
| 1434 | Ga0068855_100996529 | |||
| 1435 | Ga0068855_101393724 | |||
| 1436 | Ga0068855_101642438 | |||
| 1437 | Ga0068855_102221293 | |||
| 1438 | Ga0070664_100002497 | |||
| 1439 | Ga0070664_100006053 | |||
| 1440 | Ga0070664_100007222 | |||
| 1441 | Ga0070664_100011497 | |||
| 1442 | Ga0070664_100034680 | |||
| 1443 | Ga0070664_100042053 | |||
| 1444 | Ga0070664_100080596 | |||
| 1445 | Ga0070664_100128868 | |||
| 1446 | Ga0070664_100278858 | |||
| 1447 | Ga0070664_100432268 | |||
| 1448 | Ga0070664_101077126 | |||
| 1449 | Ga0068857_100005219 | |||
| 1450 | Ga0068857_100039463 | |||
| 1451 | Ga0068857_100062940 | |||
| 1452 | Ga0068857_100069188 | |||
| 1453 | Ga0068857_100146000 | |||
| 1454 | Ga0068857_100209043 | |||
| 1455 | Ga0068857_100362340 | |||
| 1456 | Ga0068857_101245882 | |||
| 1457 | Ga0068857_101250511 | |||
| 1458 | Ga0068857_102066485 | |||
| 1459 | Ga0068854_100002843 | |||
| 1460 | Ga0068854_100003443 | |||
| 1461 | Ga0068854_100003689 | |||
| 1462 | Ga0068854_100022982 | |||
| 1463 | Ga0068854_100030744 | |||
| 1464 | Ga0068854_100084722 | |||
| 1465 | Ga0068854_100096133 | |||
| 1466 | Ga0068854_100118208 | |||
| 1467 | Ga0068854_100206117 | |||
| 1468 | Ga0068854_100246574 | |||
| 1469 | Ga0068854_100317360 | |||
| 1470 | Ga0068854_100332637 | |||
| 1471 | Ga0068854_100401230 | |||
| 1472 | Ga0068854_100873732 | |||
| 1473 | Ga0068854_101016404 | |||
| 1474 | Ga0068854_101254831 | |||
| 1475 | Ga0068856_100007468 | |||
| 1476 | Ga0068856_100011171 | |||
| 1477 | Ga0068856_100014417 | |||
| 1478 | Ga0068856_100042269 | |||
| 1479 | Ga0068856_100083925 | |||
| 1480 | Ga0068856_100203120 | |||
| 1481 | Ga0068856_100231574 | |||
| 1482 | Ga0068856_100327777 | |||
| 1483 | Ga0068856_100530870 | |||
| 1484 | Ga0068856_100558729 | |||
| 1485 | Ga0068856_101374944 | |||
| 1486 | Ga0068856_101904071 | |||
| 1487 | Ga0068856_102072020 | |||
| 1488 | Ga0068856_102296425 | |||
| 1489 | Ga0070702_100356863 | |||
| 1490 | Ga0068852_100003304 | |||
| 1491 | Ga0068852_100029164 | |||
| 1492 | Ga0068852_100041927 | |||
| 1493 | Ga0068852_100067480 | |||
| 1494 | Ga0068852_100068191 | |||
| 1495 | Ga0068852_100168894 | |||
| 1496 | Ga0068852_100207108 | |||
| 1497 | Ga0068852_100280896 | |||
| 1498 | Ga0068852_100346786 | |||
| 1499 | Ga0068852_100403128 | |||
| 1500 | Ga0068852_100440078 | |||
| 1501 | Ga0068852_100542354 | |||
| 1502 | Ga0068852_100689765 | |||
| 1503 | Ga0068852_100931439 | |||
| 1504 | Ga0068852_100941305 | |||
| 1505 | Ga0068852_100984433 | |||
| 1506 | Ga0068852_101002063 | |||
| 1507 | Ga0068852_101022175 | |||
| 1508 | Ga0068852_101081866 | |||
| 1509 | Ga0068852_101135550 | |||
| 1510 | Ga0068852_101593068 | |||
| 1511 | Ga0068859_100177785 | |||
| 1512 | Ga0068859_101318464 | |||
| 1513 | Ga0068859_101763098 | |||
| 1514 | Ga0068859_101908924 | |||
| 1515 | Ga0068864_100001847 | |||
| 1516 | Ga0068864_100004870 | |||
| 1517 | Ga0068864_100357158 | |||
| 1518 | Ga0068866_10010145 | |||
| 1519 | Ga0068866_10088122 | |||
| 1520 | Ga0068851_10003906 | |||
| 1521 | Ga0068851_10013192 | |||
| 1522 | Ga0068851_10191236 | |||
| 1523 | Ga0068851_10215170 | |||
| 1524 | Ga0068851_10229276 | |||
| 1525 | Ga0068851_10510957 | |||
| 1526 | Ga0068851_10742168 | |||
| 1527 | Ga0068863_100002387 | |||
| 1528 | Ga0068863_100008161 | |||
| 1529 | Ga0068863_100375757 | |||
| 1530 | Ga0068858_100031045 | |||
| 1531 | Ga0068858_100063135 | |||
| 1532 | Ga0068858_100302852 | |||
| 1533 | Ga0068858_100307664 | |||
| 1534 | Ga0068858_101555073 | |||
| 1535 | Ga0068860_100180744 | |||
| 1536 | Ga0068860_100316505 | |||
| 1537 | Ga0068862_100122787 | |||
| 1538 | Ga0081539_10079619 | |||
| 1539 | Ga0070716_101656091 | |||
| 1540 | Ga0070712_100160038 | |||
| 1541 | Ga0097621_100025560 | |||
| 1542 | Ga0097621_100331621 | |||
| 1543 | Ga0097621_100586142 | |||
| 1544 | Ga0068871_100178822 | |||
| 1545 | Ga0068871_100344990 | |||
| 1546 | Ga0075434_100260250 | |||
| 1547 | Ga0097620_100165136 | |||
| 1548 | Ga0097620_100177790 | |||
| 1549 | Ga0097620_101318451 | |||
| 1550 | Ga0097620_101763247 | |||
| 1551 | Ga0097620_101909543 | |||
| 1552 | Ga0105251_10039779 | |||
| 1553 | Ga0105240_10016062 | |||
| 1554 | Ga0105240_10052504 | |||
| 1555 | Ga0105240_10147139 | |||
| 1556 | Ga0105240_10415595 | |||
| 1557 | Ga0105240_12613494 | |||
| 1558 | Ga0105245_10119034 | |||
| 1559 | Ga0105245_10128975 | |||
| 1560 | Ga0105241_10662238 | |||
| 1561 | Ga0105241_10694492 | |||
| 1562 | Ga0105241_10942665 | |||
| 1563 | Ga0105241_11249371 | |||
| 1564 | Ga0105241_12145856 | |||
| 1565 | Ga0105242_10056685 | |||
| 1566 | Ga0105248_10047303 | |||
| 1567 | Ga0105248_10296533 | |||
| 1568 | Ga0105248_10752393 | |||
| 1569 | Ga0105248_11047945 | |||
| 1570 | Ga0105237_10007969 | |||
| 1571 | Ga0105237_10010945 | |||
| 1572 | Ga0105237_11068964 | |||
| 1573 | Ga0105238_10006524 | |||
| 1574 | Ga0105238_10010338 | |||
| 1575 | Ga0105238_10069422 | |||
| 1576 | Ga0105238_10096455 | |||
| 1577 | Ga0105238_10183306 | |||
| 1578 | Ga0105238_10189057 | |||
| 1579 | Ga0105238_10699573 | |||
| 1580 | Ga0105239_10012441 | |||
| 1581 | Ga0105239_10117833 | |||
| 1582 | Ga0105239_10786270 | |||
| 1583 | Ga0105239_10932896 | |||
| 1584 | Ga0105239_12819064 | |||
| 1585 | Ga0105246_10044601 | |||
| 1586 | Ga0105246_10227306 | |||
| 1587 | Ga0105246_12062734 | |||
| 1588 | Ga0105246_12342454 | |||
| 1589 | Ga0157373_10001257 | |||
| 1590 | Ga0157373_10010607 | |||
| 1591 | Ga0157373_10034737 | |||
| 1592 | Ga0157373_10037013 | |||
| 1593 | Ga0157373_10054356 | |||
| 1594 | Ga0157373_10056427 | |||
| 1595 | Ga0157373_10056965 | |||
| 1596 | Ga0157373_10092410 | |||
| 1597 | Ga0157373_10166461 | |||
| 1598 | Ga0157373_10208182 | |||
| 1599 | Ga0157373_10230667 | |||
| 1600 | Ga0157373_10270789 | |||
| 1601 | Ga0157373_10290567 | |||
| 1602 | Ga0157373_10359510 | |||
| 1603 | Ga0157373_10429515 | |||
| 1604 | Ga0157373_10501870 | |||
| 1605 | Ga0157373_11079257 | |||
| 1606 | Ga0157371_10062503 | |||
| 1607 | Ga0157371_10065945 | |||
| 1608 | Ga0157371_10085113 | |||
| 1609 | Ga0157371_10118263 | |||
| 1610 | Ga0157371_10124124 | |||
| 1611 | Ga0157371_10129874 | |||
| 1612 | Ga0157371_10225608 | |||
| 1613 | Ga0157371_10266491 | |||
| 1614 | Ga0157371_10309571 | |||
| 1615 | Ga0157371_10315933 | |||
| 1616 | Ga0157371_10334692 | |||
| 1617 | Ga0157371_10609601 | |||
| 1618 | Ga0157371_10680086 | |||
| 1619 | Ga0157371_11101967 | |||
| 1620 | Ga0157370_10016192 | |||
| 1621 | Ga0157370_10052496 | |||
| 1622 | Ga0157370_10151341 | |||
| 1623 | Ga0157370_10156542 | |||
| 1624 | Ga0157370_10254811 | |||
| 1625 | Ga0157370_10338952 | |||
| 1626 | Ga0157370_10379146 | |||
| 1627 | Ga0157369_10004147 | |||
| 1628 | Ga0157369_10040375 | |||
| 1629 | Ga0157369_10082269 | |||
| 1630 | Ga0157369_10354511 | |||
| 1631 | Ga0157369_10415650 | |||
| 1632 | Ga0157369_10430693 | |||
| 1633 | Ga0157369_11048758 | |||
| 1634 | Ga0157369_11107449 | |||
| 1635 | Ga0157369_11138482 | |||
| 1636 | Ga0157374_10058154 | |||
| 1637 | Ga0157374_10211720 | |||
| 1638 | Ga0157374_10320254 | |||
| 1639 | Ga0157374_11014402 | |||
| 1640 | Ga0157378_10024042 | |||
| 1641 | Ga0157378_10207945 | |||
| 1642 | Ga0157378_11682028 | |||
| 1643 | Ga0163162_10006085 | |||
| 1644 | Ga0163162_10203935 | |||
| 1645 | Ga0163162_11735963 | |||
| 1646 | Ga0157372_10003603 | |||
| 1647 | Ga0157372_10032904 | |||
| 1648 | Ga0157372_10212239 | |||
| 1649 | Ga0157372_10294274 | |||
| 1650 | Ga0157372_10380559 | |||
| 1651 | Ga0157372_10422379 | |||
| 1652 | Ga0157372_10506809 | |||
| 1653 | Ga0157372_10688289 | |||
| 1654 | Ga0157372_10710322 | |||
| 1655 | Ga0157372_10787791 | |||
| 1656 | Ga0157372_10939700 | |||
| 1657 | Ga0157372_11343421 | |||
| 1658 | Ga0157372_11805044 | |||
| 1659 | Ga0157375_10108277 | |||
| 1660 | Ga0157375_11022410 | |||
| 1661 | Ga0157375_11668403 | |||
| 1662 | Ga0157375_11668404 | |||
| 1663 | Ga0163163_10163522 | |||
| 1664 | Ga0163163_10404443 | |||
| 1665 | Ga0163163_10670616 | |||
| 1666 | Ga0157380_10867556 | |||
| 1667 | Ga0182008_10076853 | |||
| 1668 | Ga0182008_10400330 | |||
| 1669 | Ga0182008_10409540 | |||
| 1670 | Ga0157377_10286789 | |||
| 1671 | Ga0157379_11173859 | |||
| 1672 | Ga0157379_11173988 | |||
| 1673 | Ga0157376_10065316 | |||
| 1674 | Ga0157376_11007654 | |||
| 1675 | Ga0163161_10527982 | |||
| 1676 | Ga0206354_10065452 | |||
| 1677 | Ga0206354_10104527 | |||
| 1678 | Ga0206353_11031190 | |||
| 1679 | Ga0206353_11257509 | |||
| 1680 | Ga0213876_10038126 | |||
| 1681 | Ga0207697_10005443 | |||
| 1682 | Ga0207656_10014421 | |||
| 1683 | Ga0207656_10019951 | |||
| 1684 | Ga0207656_10183362 | |||
| 1685 | Ga0207656_10744476 | |||
| 1686 | Ga0207682_10056438 | |||
| 1687 | Ga0207642_10032863 | |||
| 1688 | Ga0207642_10079390 | |||
| 1689 | Ga0207688_10010918 | |||
| 1690 | Ga0207688_10878252 | |||
| 1691 | Ga0207680_10124496 | |||
| 1692 | Ga0207680_10125175 | |||
| 1693 | Ga0207680_10380438 | |||
| 1694 | Ga0207680_10843197 | |||
| 1695 | Ga0207680_11160675 | |||
| 1696 | Ga0207647_10000435 | |||
| 1697 | Ga0207647_10001347 | |||
| 1698 | Ga0207647_10002106 | |||
| 1699 | Ga0207647_10048145 | |||
| 1700 | Ga0207647_10087849 | |||
| 1701 | Ga0207647_10169591 | |||
| 1702 | Ga0207647_10400623 | |||
| 1703 | Ga0207699_11078345 | |||
| 1704 | Ga0207645_10087340 | |||
| 1705 | Ga0207645_10114513 | |||
| 1706 | Ga0207645_10303718 | |||
| 1707 | Ga0207645_10365119 | |||
| 1708 | Ga0207645_10887141 | |||
| 1709 | Ga0207643_10033467 | |||
| 1710 | Ga0207705_10002105 | |||
| 1711 | Ga0207705_10014553 | |||
| 1712 | Ga0207705_10016874 | |||
| 1713 | Ga0207705_10018993 | |||
| 1714 | Ga0207705_10020381 | |||
| 1715 | Ga0207705_10039541 | |||
| 1716 | Ga0207705_10050675 | |||
| 1717 | Ga0207705_10053383 | |||
| 1718 | Ga0207705_10091477 | |||
| 1719 | Ga0207705_10110744 | |||
| 1720 | Ga0207705_10234949 | |||
| 1721 | Ga0207705_10322436 | |||
| 1722 | Ga0207705_10339502 | |||
| 1723 | Ga0207705_10342778 | |||
| 1724 | Ga0207705_10355473 | |||
| 1725 | Ga0207705_10367604 | |||
| 1726 | Ga0207705_10579336 | |||
| 1727 | Ga0207705_11013785 | |||
| 1728 | Ga0207705_11076738 | |||
| 1729 | Ga0207705_11292261 | |||
| 1730 | Ga0207654_10195363 | |||
| 1731 | Ga0207654_10607007 | |||
| 1732 | Ga0207707_10082021 | |||
| 1733 | Ga0207707_10092926 | |||
| 1734 | Ga0207707_10120605 | |||
| 1735 | Ga0207707_10123418 | |||
| 1736 | Ga0207707_10301534 | |||
| 1737 | Ga0207707_10352276 | |||
| 1738 | Ga0207707_10397182 | |||
| 1739 | Ga0207707_10713835 | |||
| 1740 | Ga0207707_10868170 | |||
| 1741 | Ga0207707_11006231 | |||
| 1742 | Ga0207695_10024528 | |||
| 1743 | Ga0207695_10030276 | |||
| 1744 | Ga0207695_10111184 | |||
| 1745 | Ga0207695_10183431 | |||
| 1746 | Ga0207695_10896291 | |||
| 1747 | Ga0207671_10021426 | |||
| 1748 | Ga0207671_10206167 | |||
| 1749 | Ga0207671_11543087 | |||
| 1750 | Ga0207660_10000329 | |||
| 1751 | Ga0207660_10009260 | |||
| 1752 | Ga0207660_10021068 | |||
| 1753 | Ga0207660_10107172 | |||
| 1754 | Ga0207660_10164132 | |||
| 1755 | Ga0207660_10669665 | |||
| 1756 | Ga0207660_11201367 | |||
| 1757 | Ga0207657_10003144 | |||
| 1758 | Ga0207657_10006364 | |||
| 1759 | Ga0207657_10013074 | |||
| 1760 | Ga0207657_10015698 | |||
| 1761 | Ga0207657_10028999 | |||
| 1762 | Ga0207657_10030562 | |||
| 1763 | Ga0207657_10048954 | |||
| 1764 | Ga0207657_10053608 | |||
| 1765 | Ga0207657_10056347 | |||
| 1766 | Ga0207657_10082685 | |||
| 1767 | Ga0207657_10104571 | |||
| 1768 | Ga0207657_10110183 | |||
| 1769 | Ga0207657_10120744 | |||
| 1770 | Ga0207657_10147966 | |||
| 1771 | Ga0207657_10301804 | |||
| 1772 | Ga0207657_10461133 | |||
| 1773 | Ga0207657_10943621 | |||
| 1774 | Ga0207657_11319486 | |||
| 1775 | Ga0207649_10004561 | |||
| 1776 | Ga0207649_10016272 | |||
| 1777 | Ga0207649_10022843 | |||
| 1778 | Ga0207649_10036418 | |||
| 1779 | Ga0207649_10078432 | |||
| 1780 | Ga0207649_10298373 | |||
| 1781 | Ga0207649_10321818 | |||
| 1782 | Ga0207649_10346353 | |||
| 1783 | Ga0207649_10409543 | |||
| 1784 | Ga0207649_10446237 | |||
| 1785 | Ga0207649_10532788 | |||
| 1786 | Ga0207649_10657428 | |||
| 1787 | Ga0207649_10889043 | |||
| 1788 | Ga0207649_10933221 | |||
| 1789 | Ga0207652_10032223 | |||
| 1790 | Ga0207652_10076713 | |||
| 1791 | Ga0207652_10173468 | |||
| 1792 | Ga0207652_10252406 | |||
| 1793 | Ga0207652_10533426 | |||
| 1794 | Ga0207652_10814333 | |||
| 1795 | Ga0207652_10936082 | |||
| 1796 | Ga0207652_11135763 | |||
| 1797 | Ga0207652_11676737 | |||
| 1798 | Ga0207681_10431198 | |||
| 1799 | Ga0207681_10692355 | |||
| 1800 | Ga0207681_11139628 | |||
| 1801 | Ga0207694_10004535 | |||
| 1802 | Ga0207694_10011778 | |||
| 1803 | Ga0207694_10112040 | |||
| 1804 | Ga0207694_10284218 | |||
| 1805 | Ga0207694_10771560 | |||
| 1806 | Ga0207650_10024371 | |||
| 1807 | Ga0207650_10347083 | |||
| 1808 | Ga0207650_10661239 | |||
| 1809 | Ga0207687_10071230 | |||
| 1810 | Ga0207700_10568401 | |||
| 1811 | Ga0207664_10076982 | |||
| 1812 | Ga0207664_10077410 | |||
| 1813 | Ga0207664_10125158 | |||
| 1814 | Ga0207664_10137347 | |||
| 1815 | Ga0207644_10003796 | |||
| 1816 | Ga0207644_10025658 | |||
| 1817 | Ga0207644_10191100 | |||
| 1818 | Ga0207644_10566215 | |||
| 1819 | Ga0207690_10003155 | |||
| 1820 | Ga0207690_10012506 | |||
| 1821 | Ga0207690_10030391 | |||
| 1822 | Ga0207690_10117617 | |||
| 1823 | Ga0207690_10146955 | |||
| 1824 | Ga0207690_10264960 | |||
| 1825 | Ga0207690_10350103 | |||
| 1826 | Ga0207690_10394601 | |||
| 1827 | Ga0207690_10395126 | |||
| 1828 | Ga0207690_10424371 | |||
| 1829 | Ga0207690_10684660 | |||
| 1830 | Ga0207690_10833896 | |||
| 1831 | Ga0207690_10882739 | |||
| 1832 | Ga0207706_10002427 | |||
| 1833 | Ga0207706_10040783 | |||
| 1834 | Ga0207706_10077908 | |||
| 1835 | Ga0207706_10092798 | |||
| 1836 | Ga0207706_10092860 | |||
| 1837 | Ga0207706_10151767 | |||
| 1838 | Ga0207706_10184058 | |||
| 1839 | Ga0207706_10410719 | |||
| 1840 | Ga0207706_10513699 | |||
| 1841 | Ga0207706_10514856 | |||
| 1842 | Ga0207706_10550417 | |||
| 1843 | Ga0207706_10777762 | |||
| 1844 | Ga0207706_11651133 | |||
| 1845 | Ga0207686_10013322 | |||
| 1846 | Ga0207669_10087994 | |||
| 1847 | Ga0207704_10058514 | |||
| 1848 | Ga0207704_10088462 | |||
| 1849 | Ga0207691_10128958 | |||
| 1850 | Ga0207691_10149564 | |||
| 1851 | Ga0207691_10166518 | |||
| 1852 | Ga0207691_10461616 | |||
| 1853 | Ga0207711_10011791 | |||
| 1854 | Ga0207711_10136820 | |||
| 1855 | Ga0207711_10359525 | |||
| 1856 | Ga0207711_10754112 | |||
| 1857 | Ga0207661_10050476 | |||
| 1858 | Ga0207661_10051801 | |||
| 1859 | Ga0207661_10070331 | |||
| 1860 | Ga0207661_10142329 | |||
| 1861 | Ga0207661_10249439 | |||
| 1862 | Ga0207661_10353079 | |||
| 1863 | Ga0207661_11046820 | |||
| 1864 | Ga0207679_10117870 | |||
| 1865 | Ga0207679_10269327 | |||
| 1866 | Ga0207679_10274321 | |||
| 1867 | Ga0207679_10314185 | |||
| 1868 | Ga0207679_10474964 | |||
| 1869 | Ga0207679_10537193 | |||
| 1870 | Ga0207679_11276113 | |||
| 1871 | Ga0207679_11297389 | |||
| 1872 | Ga0207679_11717854 | |||
| 1873 | Ga0207667_10022295 | |||
| 1874 | Ga0207667_10032969 | |||
| 1875 | Ga0207667_10050040 | |||
| 1876 | Ga0207667_10193544 | |||
| 1877 | Ga0207667_10205388 | |||
| 1878 | Ga0207667_10263826 | |||
| 1879 | Ga0207667_10370656 | |||
| 1880 | Ga0207667_10586293 | |||
| 1881 | Ga0207667_10621040 | |||
| 1882 | Ga0207667_11128664 | |||
| 1883 | Ga0207667_11669768 | |||
| 1884 | Ga0207651_10016827 | |||
| 1885 | Ga0207651_10076528 | |||
| 1886 | Ga0207651_10186394 | |||
| 1887 | Ga0207651_10266211 | |||
| 1888 | Ga0207651_10717720 | |||
| 1889 | Ga0207651_10953410 | |||
| 1890 | Ga0207712_10153816 | |||
| 1891 | Ga0207668_10191894 | |||
| 1892 | Ga0207640_10008246 | |||
| 1893 | Ga0207640_10014560 | |||
| 1894 | Ga0207640_10015328 | |||
| 1895 | Ga0207640_10025850 | |||
| 1896 | Ga0207640_10078440 | |||
| 1897 | Ga0207640_10117494 | |||
| 1898 | Ga0207640_10209327 | |||
| 1899 | Ga0207640_10212645 | |||
| 1900 | Ga0207640_10462228 | |||
| 1901 | Ga0207640_10550672 | |||
| 1902 | Ga0207640_11702549 | |||
| 1903 | Ga0207640_12100718 | |||
| 1904 | Ga0207658_10093050 | |||
| 1905 | Ga0207658_10143721 | |||
| 1906 | Ga0207658_10728380 | |||
| 1907 | Ga0207658_10738748 | |||
| 1908 | Ga0207658_10778088 | |||
| 1909 | Ga0207677_10260184 | |||
| 1910 | Ga0207677_10605238 | |||
| 1911 | Ga0207677_11838403 | |||
| 1912 | Ga0207703_10040289 | |||
| 1913 | Ga0207703_10065019 | |||
| 1914 | Ga0207703_10254203 | |||
| 1915 | Ga0207703_10324007 | |||
| 1916 | Ga0207639_10000136 | |||
| 1917 | Ga0207639_10049409 | |||
| 1918 | Ga0207639_10086373 | |||
| 1919 | Ga0207639_10237495 | |||
| 1920 | Ga0207639_10302396 | |||
| 1921 | Ga0207639_10411768 | |||
| 1922 | Ga0207639_10476255 | |||
| 1923 | Ga0207639_10512738 | |||
| 1924 | Ga0207639_10549748 | |||
| 1925 | Ga0207639_10657659 | |||
| 1926 | Ga0207639_10662878 | |||
| 1927 | Ga0207678_10005791 | |||
| 1928 | Ga0207678_10009194 | |||
| 1929 | Ga0207678_10010228 | |||
| 1930 | Ga0207678_10019220 | |||
| 1931 | Ga0207678_10034912 | |||
| 1932 | Ga0207678_10035824 | |||
| 1933 | Ga0207678_10151644 | |||
| 1934 | Ga0207678_10308339 | |||
| 1935 | Ga0207678_10393400 | |||
| 1936 | Ga0207678_10441696 | |||
| 1937 | Ga0207678_10683217 | |||
| 1938 | Ga0207702_10011047 | |||
| 1939 | Ga0207702_10046294 | |||
| 1940 | Ga0207702_10051017 | |||
| 1941 | Ga0207702_10055089 | |||
| 1942 | Ga0207702_10103326 | |||
| 1943 | Ga0207702_10167126 | |||
| 1944 | Ga0207702_10283265 | |||
| 1945 | Ga0207702_10373577 | |||
| 1946 | Ga0207702_10461816 | |||
| 1947 | Ga0207702_10603373 | |||
| 1948 | Ga0207702_11930519 | |||
| 1949 | Ga0207641_10010934 | |||
| 1950 | Ga0207641_10020798 | |||
| 1951 | Ga0207641_10319203 | |||
| 1952 | Ga0207648_10001590 | |||
| 1953 | Ga0207648_10021766 | |||
| 1954 | Ga0207648_10047618 | |||
| 1955 | Ga0207648_10887721 | |||
| 1956 | Ga0207676_10074688 | |||
| 1957 | Ga0207676_10201095 | |||
| 1958 | Ga0207676_10416932 | |||
| 1959 | Ga0207676_12478436 | |||
| 1960 | Ga0207674_10000060 | |||
| 1961 | Ga0207674_10001045 | |||
| 1962 | Ga0207674_10003719 | |||
| 1963 | Ga0207674_10007483 | |||
| 1964 | Ga0207674_10028962 | |||
| 1965 | Ga0207674_10030442 | |||
| 1966 | Ga0207674_10031140 | |||
| 1967 | Ga0207674_10061056 | |||
| 1968 | Ga0207674_10249289 | |||
| 1969 | Ga0207674_10403205 | |||
| 1970 | Ga0207674_10877137 | |||
| 1971 | Ga0207674_10892659 | |||
| 1972 | Ga0207674_11377367 | |||
| 1973 | Ga0207675_100328829 | |||
| 1974 | Ga0207675_100483515 | |||
| 1975 | Ga0207683_10001298 | |||
| 1976 | Ga0207683_10013086 | |||
| 1977 | Ga0207683_10039824 | |||
| 1978 | Ga0207698_10001262 | |||
| 1979 | Ga0207698_10002123 | |||
| 1980 | Ga0207698_10010523 | |||
| 1981 | Ga0207698_10013579 | |||
| 1982 | Ga0207698_10075843 | |||
| 1983 | Ga0207698_10136124 | |||
| 1984 | Ga0207698_10349975 | |||
| 1985 | Ga0207698_10433728 | |||
| 1986 | Ga0207698_10485323 | |||
| 1987 | Ga0207698_10595299 | |||
| 1988 | Ga0207698_10599310 | |||
| 1989 | Ga0207698_10654831 | |||
| 1990 | Ga0207698_10826622 | |||
| 1991 | Ga0207698_10849753 | |||
| 1992 | Ga0207698_10946198 | |||
| 1993 | Ga0207698_11001538 | |||
| 1994 | Ga0207698_11125362 | |||
| 1995 | Ga0207698_11384857 | |||
| 1996 | Ga0207698_12301297 | |||
| 1997 | Ga0207698_12418589 | |||
| 1998 | Ga0268266_10023288 | |||
| 1999 | Ga0268266_10211299 | |||
| 2000 | Ga0268266_10784070 | |||
| 2001 | Ga0268266_11072106 | |||
| 2002 | Ga0268265_10054539 | |||
| 2003 | Ga0307408_100159796 | |||
| 2004 | Ga0307405_10078836 | |||
| 2005 | Ga0307405_10735239 | |||
| 2006 | Ga0307413_10079744 | |||
| 2007 | Ga0307409_100024402 | |||
| 2008 | Ga0307409_100724732 | |||
| 2009 | Ga0307414_10936621 | |||
| 2010 | Ga0307415_100001570 | |||
| 2011 | Ga0373930_0086937 | |||
| 2012 | Ga0373936_0113544 | |||
| 2013 | Ga0373941_0200978 | |||
| 2014 | Ga0373943_0005760 | |||
| 2015 | Ga0373942_0055592 | |||
| 2016 | Ga0373931_0161264 | |||
| 2017 | Ga0373935_0067849 | |||
| 2018 | Ga0373935_0235457 | |||
| 2019 | Ga0373927_0027849 | |||
| 2020 | Ga0373947_0045254 | |||
| 2021 | Ga0373925_0108896 | |||
| 2022 | Ga0395899_0007176 | |||
| 2023 | Ga0395899_0011485 | |||
| 2024 | Ga0395899_0028968 | |||
| 2025 | Ga0395899_0041307 | |||
| 2026 | Ga0395899_0048245 | |||
| 2027 | Ga0395899_0060615 | |||
| 2028 | Ga0395899_0162733 | |||
| 2029 | Ga0395899_0166656 | |||
| 2030 | Ga0395899_0188925 | |||
| 2031 | Ga0395899_0198354 | |||
| 2032 | Ga0395899_0289704 | |||
| 2033 | Ga0395899_0289778 | |||
| 2034 | Ga0395899_0534923 | |||
| 2035 | Ga0395899_0579217 | |||
| 2036 | Ga0395899_0634894 | |||
| 2037 | Ga0395899_0778312 | |||
| 2038 | Ga0395900_0001394 | |||
| 2039 | Ga0395900_0008469 | |||
| 2040 | Ga0395900_0010426 | |||
| 2041 | Ga0395900_0030033 | |||
| 2042 | Ga0395900_0032876 | |||
| 2043 | Ga0395900_0050492 | |||
| 2044 | Ga0395900_0052102 | |||
| 2045 | Ga0395900_0062387 | |||
| 2046 | Ga0395900_0077109 | |||
| 2047 | Ga0395900_0089904 | |||
| 2048 | Ga0395900_0105747 | |||
| 2049 | Ga0395900_0126300 | |||
| 2050 | Ga0395900_0163867 | |||
| 2051 | Ga0395900_0230756 | |||
| 2052 | Ga0395900_0234653 | |||
| 2053 | Ga0395900_0249016 | |||
| 2054 | Ga0395900_0288714 | |||
| 2055 | Ga0395900_0356664 | |||
| 2056 | Ga0395900_0362485 | |||
| 2057 | Ga0395900_0362494 | |||
| 2058 | Ga0395900_0385103 | |||
| 2059 | Ga0395900_0387076 | |||
| 2060 | Ga0395900_0417831 | |||
| 2061 | Ga0395900_0493040 | |||
| 2062 | Ga0395900_0544519 | |||
| 2063 | Ga0395900_0652225 | |||
| 2064 | Ga0395900_0781778 | |||
| 2065 | Ga0395900_0846033 | |||
| 2066 | Ga0395900_0870704 | |||
| 2067 | Ga0395900_0899413 | |||
| 2068 | Ga0395900_0944048 | |||
| 2069 | Ga0395900_0964745 | |||
| 2070 | Ga0395900_1032351 | |||
| 2071 | Ga0395900_1064233 | |||
| 2072 | Ga0395900_1232172 | |||
| 2073 | Ga0395900_1488730 | |||
| 2074 | Ga0395900_1529328 | |||
| 2075 | Ga0395900_1543227 | |||
| 2076 | Ga0395900_1922681 | |||
| 2077 | Ga0395898_0001185 | |||
| 2078 | Ga0395898_0020458 | |||
| 2079 | Ga0395898_0021682 | |||
| 2080 | Ga0395898_0028633 | |||
| 2081 | Ga0395898_0059285 | |||
| 2082 | Ga0395898_0076497 | |||
| 2083 | Ga0395898_0092031 | |||
| 2084 | Ga0395898_0106321 | |||
| 2085 | Ga0395898_0107720 | |||
| 2086 | Ga0395898_0117210 | |||
| 2087 | Ga0395898_0117953 | |||
| 2088 | Ga0395898_0183993 | |||
| 2089 | Ga0395898_0204455 | |||
| 2090 | Ga0395898_0356728 | |||
| 2091 | Ga0395898_0445476 | |||
| 2092 | Ga0395898_0498012 | |||
| 2093 | Ga0395898_0527479 | |||
| 2094 | Ga0395898_0568508 | |||
| 2095 | Ga0395898_0662130 | |||
| 2096 | Ga0395898_0959677 | |||
| 2097 | Ga0395898_1518654 | |||
| 2098 | Ga0395905_0001106 | |||
| 2099 | Ga0395905_0010576 | |||
| 2100 | Ga0395905_0014304 | |||
| 2101 | Ga0395905_0016298 | |||
| 2102 | Ga0395905_0031856 | |||
| 2103 | Ga0395905_0032788 | |||
| 2104 | Ga0395905_0036038 | |||
| 2105 | Ga0395905_0038261 | |||
| 2106 | Ga0395905_0052633 | |||
| 2107 | Ga0395905_0053348 | |||
| 2108 | Ga0395905_0062751 | |||
| 2109 | Ga0395905_0072984 | |||
| 2110 | Ga0395905_0074226 | |||
| 2111 | Ga0395905_0076337 | |||
| 2112 | Ga0395905_0098783 | |||
| 2113 | Ga0395905_0103052 | |||
| 2114 | Ga0395905_0108175 | |||
| 2115 | Ga0395905_0119008 | |||
| 2116 | Ga0395905_0120488 | |||
| 2117 | Ga0395905_0131695 | |||
| 2118 | Ga0395905_0138196 | |||
| 2119 | Ga0395905_0144948 | |||
| 2120 | Ga0395905_0182500 | |||
| 2121 | Ga0395905_0225481 | |||
| 2122 | Ga0395905_0228058 | |||
| 2123 | Ga0395905_0273366 | |||
| 2124 | Ga0395905_0280800 | |||
| 2125 | Ga0395905_0303029 | |||
| 2126 | Ga0395905_0357253 | |||
| 2127 | Ga0395905_0384232 | |||
| 2128 | Ga0395905_0388187 | |||
| 2129 | Ga0395905_0392463 | |||
| 2130 | Ga0395905_0423506 | |||
| 2131 | Ga0395905_0424110 | |||
| 2132 | Ga0395905_0427279 | |||
| 2133 | Ga0395905_0440465 | |||
| 2134 | Ga0395905_0441742 | |||
| 2135 | Ga0395905_0444228 | |||
| 2136 | Ga0395905_0553863 | |||
| 2137 | Ga0395905_0560226 | |||
| 2138 | Ga0395905_0612801 | |||
| 2139 | Ga0395905_0676216 | |||
| 2140 | Ga0395905_0741953 | |||
| 2141 | Ga0395905_0801251 | |||
| 2142 | Ga0395905_0858665 | |||
| 2143 | Ga0395905_0862866 | |||
| 2144 | Ga0395905_0875123 | |||
| 2145 | Ga0395905_0881948 | |||
| 2146 | Ga0395905_0959312 | |||
| 2147 | Ga0395905_1042050 | |||
| 2148 | Ga0395905_1236403 | |||
| 2149 | Ga0395905_1274942 | |||
| 2150 | Ga0395901_0001061 | |||
| 2151 | Ga0395901_0001163 | |||
| 2152 | Ga0395901_0020488 | |||
| 2153 | Ga0395901_0023391 | |||
| 2154 | Ga0395901_0030902 | |||
| 2155 | Ga0395901_0036445 | |||
| 2156 | Ga0395901_0047208 | |||
| 2157 | Ga0395901_0048224 | |||
| 2158 | Ga0395901_0058387 | |||
| 2159 | Ga0395901_0083658 | |||
| 2160 | Ga0395901_0108802 | |||
| 2161 | Ga0395901_0109032 | |||
| 2162 | Ga0395901_0137818 | |||
| 2163 | Ga0395901_0163103 | |||
| 2164 | Ga0395901_0217738 | |||
| 2165 | Ga0395901_0221989 | |||
| 2166 | Ga0395901_0232981 | |||
| 2167 | Ga0395901_0235765 | |||
| 2168 | Ga0395901_0243877 | |||
| 2169 | Ga0395901_0249652 | |||
| 2170 | Ga0395901_0286832 | |||
| 2171 | Ga0395901_0306317 | |||
| 2172 | Ga0395901_0484895 | |||
| 2173 | Ga0395901_0512652 | |||
| 2174 | Ga0395901_0526357 | |||
| 2175 | Ga0395901_0638789 | |||
| 2176 | Ga0395901_0669103 | |||
| 2177 | Ga0395901_0677574 | |||
| 2178 | Ga0395901_0700726 | |||
| 2179 | Ga0395901_0704142 | |||
| 2180 | Ga0395901_0820975 | |||
| 2181 | Ga0395901_0855763 | |||
| 2182 | Ga0395901_0961663 | |||
| 2183 | Ga0395901_0972153 | |||
| 2184 | Ga0395901_1122761 | |||
| 2185 | Ga0395901_1148312 | |||
| 2186 | Ga0395901_1561287 | |||
| 2187 | Ga0436365_0782179 | |||
| 2188 | Ga0436363_1101143 | |||
| 2189 | Ga0451833_1137545 | |||
| 2190 | Ga0439448_0004818 | |||
| 2191 | Ga0439455_0007660 | |||
| 2192 | Ga0439458_0001158 | |||
| 2193 | Ga0439458_0002397 | |||
| 2194 | Ga0466969_0002083 | |||
| 2195 | Ga0466969_0290935 | |||
| 2196 | Ga0466969_0448194 | |||
| 2197 | Ga0466972_0186083 | |||
| 2198 | Ga0466972_0210210 | |||
| 2199 | Ga0466972_0215908 | |||
| 2200 | Ga0466965_0054675 | |||
| 2201 | Ga0466965_0221794 | |||
| 2202 | Ga0466965_0361391 | |||
| 2203 | Ga0466965_0431489 | |||
| 2204 | Ga0466966_0011598 | |||
| 2205 | Ga0466966_0051282 | |||
| 2206 | Ga0466966_0061319 | |||
| 2207 | Ga0466966_0066066 | |||
| 2208 | Ga0466966_0090027 | |||
| 2209 | Ga0466966_0211528 | |||
| 2210 | Ga0466966_0239076 | |||
| 2211 | Ga0466966_0756004 | |||
| 2212 | Ga0466961_0010281 | |||
| 2213 | Ga0466961_0080430 | |||
| 2214 | Ga0466961_0080884 | |||
| 2215 | Ga0466961_0419055 | |||
| 2216 | Ga0466961_0706071 | |||
| 2217 | Ga0466961_0741010 | |||
| 2218 | Ga0466961_0902049 | |||
| 2219 | Ga0466963_0009505 | |||
| 2220 | Ga0466963_0032247 | |||
| 2221 | Ga0466963_0047261 | |||
| 2222 | Ga0466963_0054072 | |||
| 2223 | Ga0466963_0091743 | |||
| 2224 | Ga0466963_0106172 | |||
| 2225 | Ga0466963_0116869 | |||
| 2226 | Ga0466963_0155478 | |||
| 2227 | Ga0466963_0277581 | |||
| 2228 | Ga0466964_0041650 | |||
| 2229 | Ga0466964_0387949 | |||
| 2230 | Ga0466971_0115332 | |||
| 2231 | Ga0466971_0203693 | |||
| 2232 | Ga0466970_0231605 | |||
| 2233 | Ga0466970_0413123 | |||
| 2234 | Ga0466957_0001719 | |||
| 2235 | Ga0466957_0013241 | |||
| 2236 | Ga0466957_0014687 | |||
| 2237 | Ga0466957_0082779 | |||
| 2238 | Ga0466957_0213806 | |||
| 2239 | Ga0466957_0227569 | |||
| 2240 | Ga0466957_0371761 | |||
| 2241 | Ga0466957_0680879 | |||
| 2242 | Ga0466960_0086474 | |||
| 2243 | Ga0466960_0098857 | |||
| 2244 | Ga0466960_0142410 | |||
| 2245 | Ga0466960_0459758 | |||
| 2246 | Ga0466959_0017690 | |||
| 2247 | Ga0466959_0160720 | |||
| 2248 | Ga0466959_0176301 | |||
| 2249 | Ga0466959_0183145 | |||
| 2250 | Ga0466959_0246788 | |||
| 2251 | Ga0466959_0253412 | |||
| 2252 | Ga0466959_0355493 | |||
| 2253 | Ga0466959_0362362 | |||
| 2254 | Ga0466959_0502149 | |||
| 2255 | Ga0466958_0019636 | |||
| 2256 | Ga0466958_0070951 | |||
| 2257 | Ga0466958_0123938 | |||
| 2258 | Ga0466958_0156375 | |||
| 2259 | Ga0466958_0238589 | |||
| 2260 | Ga0466958_0302158 | |||
| 2261 | Ga0466958_0359426 | |||
| 2262 | Ga0466967_0004351 | |||
| 2263 | Ga0466967_0006660 | |||
| 2264 | Ga0466967_0044291 | |||
| 2265 | Ga0466967_0057541 | |||
| 2266 | Ga0466967_0094909 | |||
| 2267 | Ga0466967_0124917 | |||
| 2268 | Ga0466967_0151722 | |||
| 2269 | Ga0466967_0173258 | |||
| 2270 | Ga0466967_0174154 | |||
| 2271 | Ga0466967_0228094 | |||
| 2272 | Ga0466967_0263513 | |||
| 2273 | Ga0466967_0301163 | |||
| 2274 | Ga0466967_0363541 | |||
| 2275 | Ga0466967_0384863 | |||
| 2276 | Ga0466967_0595311 | |||
| 2277 | Ga0466967_0893509 | |||
| 2278 | Ga0466967_1273524 | |||
| 2279 | Ga0466967_1504135 | |||
| 2280 | Ga0466967_1900475 | |||
| 2281 | Ga0466967_2210044 | |||
| 2282 | Ga0495610_0171939 | |||
| 2283 | Ga0495643_0232867 | |||
| 2284 | Ga0495663_0006214 | |||
| 2285 | Ga0495642_0217615 | |||
| 2286 | Ga0495668_0010412 | |||
| 2287 | Ga0495669_0000119 | |||
| 2288 | Ga0495669_0010895 | |||
| 2289 | Ga0495669_0023305 | |||
| 2290 | Ga0495669_0125188 | |||
| 2291 | Ga0495669_0156128 | |||
| 2292 | Ga0495669_0494072 | |||
| 2293 | Ga0495600_0776801 | |||
| 2294 | Ga0495677_0031713 | |||
| 2295 | Ga0496100_0062051 | |||
| 2296 | Ga0496101_0151018 | |||
| 2297 | Ga0496101_0178459 | |||
| 2298 | Ga0496101_0188141 | |||
| 2299 | Ga0496101_0378573 | |||
| 2300 | Ga0496101_0425945 | |||
| 2301 | Ga0496102_0054392 | |||
| 2302 | Ga0496102_0173186 | |||
| 2303 | Ga0496102_0795211 | |||
| 2304 | Ga0496102_1872314 | |||
| 2305 | Ga0496103_0672443 | |||
| 2306 | Ga0496104_0565201 | |||
| 2307 | Ga0496104_0793894 | |||
| 2308 | Ga0496104_1441164 | |||
| 2309 | Ga0496105_0164931 | |||
| 2310 | Ga0496106_0614659 | |||
| 2311 | Ga0496106_0951890 | |||
| 2312 | Ga0496107_0056655 | |||
| 2313 | Ga0496107_0084052 | |||
| 2314 | Ga0496107_0134480 | |||
| 2315 | Ga0496107_0340462 | |||
| 2316 | Ga0496107_1336910 | |||
| 2317 | Ga0496108_0039210 | |||
| 2318 | Ga0496108_0142175 | |||
| 2319 | Ga0496109_0369747 | |||
| 2320 | Ga0496109_0535874 | |||
| 2321 | Ga0496109_0554142 | |||
| 2322 | Ga0496109_0927580 | |||
| 2323 | Ga0496109_1135116 | |||
| 2324 | Ga0496110_0036598 | |||
| 2325 | Ga0496110_0048084 | |||
| 2326 | Ga0496110_0058050 | |||
| 2327 | Ga0496110_0091694 | |||
| 2328 | Ga0496110_0091986 | |||
| 2329 | Ga0496110_0210809 | |||
| 2330 | Ga0496111_0017004 | |||
| 2331 | Ga0496111_0048239 | |||
| 2332 | Ga0496111_0644684 | |||
| 2333 | Ga0496111_1031320 | |||
| 2334 | Ga0496112_0005611 | |||
| 2335 | Ga0496112_0006998 | |||
| 2336 | Ga0496112_0020968 | |||
| 2337 | Ga0496112_0026749 | |||
| 2338 | Ga0496112_0038409 | |||
| 2339 | Ga0496112_0186641 | |||
| 2340 | Ga0496112_0403305 | |||
| 2341 | Ga0496112_1197434 | |||
| 2342 | Ga0496113_0056778 | |||
| 2343 | Ga0496113_0066812 | |||
| 2344 | Ga0496113_0210884 | |||
| 2345 | Ga0496113_0211392 | |||
| 2346 | Ga0501067_0248786 | |||
| 2347 | Ga0501067_0650534 | |||
| 2348 | Ga0501067_0670497 | |||
| 2349 | Ga0501067_0847476 | |||
| 2350 | Ga0501070_0217149 | |||
| 2351 | Ga0501080_0072631 | |||
| 2352 | Ga0501081_1172241 | |||
| 2353 | Ga0501241_121567 | |||
| 2354 | nmdc:mga0n895_1726203_c1 | |||
| 2355 | Ga0495655_0107526 | |||
| 2356 | Ga0495655_0110957 | |||
| 2357 | Ga0587082_095928 | |||
| 2358 | Ga0466962_0014948 | |||
| 2359 | Ga0466962_0020149 | |||
| 2360 | Ga0466962_0031522 | |||
| 2361 | Ga0466962_0035945 | |||
| 2362 | Ga0466962_0059354 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gom-assembly1.cif.gz_A | truncated mitofusin-1, transition-like state | 0.8974 | 43 | 102 |
| 5yew-assembly2.cif.gz_C-2 | structural basis for gtp hydrolysis and conformational change of mitofusin 1 in mediating mitochondrial fusion | 0.8841 | 39 | 102 |
| 5yew-assembly1.cif.gz_A | structural basis for gtp hydrolysis and conformational change of mitofusin 1 in mediating mitochondrial fusion | 0.8774 | 39 | 102 |
| 6rn5-assembly1.cif.gz_A-2 | ppta from streptomyces chartreusis | 0.7762 | 45 | 103 |
| 5yny-assembly1.cif.gz_A | structure of house dust mite allergen der f 21 in peg2kmme | 0.7719 | 19 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54XF9_6_149_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8743 | 49 | 95 | 1.20.1260.10 |
| 3mq1A01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8706 | 43 | 106 | 1.20.58.970 |
| 3mq1C01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8558 | 43 | 106 | 1.20.58.970 |
| 3mq1F01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8518 | 43 | 106 | 1.20.58.970 |
| af_Q20410_5_311_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.8406 | 43 | 102 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537MAY9-F1-model_v4 | Uncharacterized protein | 0.8979 | 8 | 110 |
GO:0016020
|
| AF-A0A2U1FWS9-F1-model_v4 | deleted | 0.8883 | 2 | 110 |
|
| AF-W6W510-F1-model_v4 | RHS repeat-associated core domain containing protein-containing protein | 0.8824 | 46 | 101 |
|
| AF-A0A7S4EBW8-F1-model_v4 | Peptidylprolyl isomerase | 0.8802 | 15 | 96 |
|
| AF-A0A2U1FWS9-F1-model_v4 | deleted | 0.8734 | 2 | 110 |
|