F491223
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1174 | 469 | 948 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300041405|Ga0439438_005214|Ga0439438_005214_584_1630 |
| Length | 348 |
| Sequence | VVENVGASLLAIAMFQSTLMLTVLPQSRAGSLPQGTVFHLFFARFHRMRTLGILCLLLTLSGCSSLLFYPERGLPFTPERAKLDYRDVTLTTADGIRLHGWWLPVKPGVEVKGTVLHLHGNGGNLAWHLGGSWWLPEQGYQVLMVDYRGYGRSEGEPSLPAIYQDIDAAFKWLDQAPQVQGKPLVLLGQSLGGALAVHYLADHPERQPQLKALVLDGVPASYRDVGRFALSTSWLTWALQVPLSWLVPDGDSAIGSVAQLKGVPKLIYHSLDDPIVPLSNGIRLYQAAPPPRVLQLTRGGHVQTFADPVWRTVMLRYLDDPWHFDGLRRLGEIPNYPKSSVESSESPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 4 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 5 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 6 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 7 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 8 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 9 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 10 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 11 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 12 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 13 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 14 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 15 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 16 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 17 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 18 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 19 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 20 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 21 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 22 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 23 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 24 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 25 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 26 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 27 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 28 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 29 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 30 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 31 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 32 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 33 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 34 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 35 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 36 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 37 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 38 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 39 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 40 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 41 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 42 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 43 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 44 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 45 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 46 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 47 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 48 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 49 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 50 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 51 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 52 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 53 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 54 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 55 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 56 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 57 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 58 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 59 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 60 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 61 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 62 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 63 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 64 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 65 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 66 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 67 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 68 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 69 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 70 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 71 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 72 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 73 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 74 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 75 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 76 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 77 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 78 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 79 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 80 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 81 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 82 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 83 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 84 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 85 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 86 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 87 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 88 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 89 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 90 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 91 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 92 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 93 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 94 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 95 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 96 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 97 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 98 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 99 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 100 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 101 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 102 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 103 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 104 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 105 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 106 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 107 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 108 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 109 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 110 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 111 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 112 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 113 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 114 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 115 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 116 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 117 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 118 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 119 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 120 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 121 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 122 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 123 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 124 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 125 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 126 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 127 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 128 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 129 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 130 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 131 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 132 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 133 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 134 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 135 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 136 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 137 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 138 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 139 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 140 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 141 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 142 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 143 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 144 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 145 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 146 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 147 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 148 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 149 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 150 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 151 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 152 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 153 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 154 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 155 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 156 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 157 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 158 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 159 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 160 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 161 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 162 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 163 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 164 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 165 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 166 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 167 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 168 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 169 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 170 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 171 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 172 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 173 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 174 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 175 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 176 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 177 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 178 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 179 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 180 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 181 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 182 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 183 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 184 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 185 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 186 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 187 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 188 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 189 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 190 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 191 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 192 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 193 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 194 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 195 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 196 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 197 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 198 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 199 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 200 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 201 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 202 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 203 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 204 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 205 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 206 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 207 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 208 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 209 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 210 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 211 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 212 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 213 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 214 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 215 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 216 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 217 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 218 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 219 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 220 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 221 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 222 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 223 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 224 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 225 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 226 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 227 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 228 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 234 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 237 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 238 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 239 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 240 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 241 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 242 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 243 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 244 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 245 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 255 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 263 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 264 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 265 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 266 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 268 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 278 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 280 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 301 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 302 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 304 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 305 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 306 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 307 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 308 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 309 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 310 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 311 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 312 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 313 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 314 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 315 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 316 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 317 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 318 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 319 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 320 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 321 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 322 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 323 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 324 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 325 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 326 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 327 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 328 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 329 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 330 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 331 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 332 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 333 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 334 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 335 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 336 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 337 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 338 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 339 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 340 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 341 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 342 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 343 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 344 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 345 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 346 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 347 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 348 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 423 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 424 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 425 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 426 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 427 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 428 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 429 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 430 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 431 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 432 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 433 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 434 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 435 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 436 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 437 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 442 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 443 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 444 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 445 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 446 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 447 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 448 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 449 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 450 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 451 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 452 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 453 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 454 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 455 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 456 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 457 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 458 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 459 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 460 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 461 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 462 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 463 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 464 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 465 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 466 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 467 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 468 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 469 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.66 |
| Metatranscriptomes | 0.09 |
| Isolates | 19.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.79 |
| Nodule | 2.21 |
| Rhizoplane | 6.39 |
| Rhizosphere | 73.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_9445 | 2124908027 | Bacteria | 4397 |
| 2 | SwRhRL2b_contig_992609 | 2162886007 | Bacteria | 1203 |
| 3 | JGI25162J39368_1000103 | 3300002737 | Bacteria | 93730 |
| 4 | JGI25162J39368_1000318 | 3300002737 | Bacteria | 42741 |
| 5 | JGI25154J39366_1003627 | 3300002738 | Bacteria | 3152 |
| 6 | JGI25163J39215_1000809 | 3300002771 | Bacteria | 7533 |
| 7 | JGI25163J39215_1001291 | 3300002771 | Bacteria | 4460 |
| 8 | JGI25164J39214_1000082 | 3300002772 | Bacteria | 93730 |
| 9 | JGI25164J39214_1000227 | 3300002772 | Bacteria | 43917 |
| 10 | JGI25165J46597_1000185 | 3300003214 | Bacteria | 93730 |
| 11 | JGI25165J46597_1000423 | 3300003214 | Bacteria | 43917 |
| 12 | Ga0006562J51391_1043775 | 3300003578 | Bacteria | 1270 |
| 13 | Ga0055538_1000073 | 3300003751 | Bacteria | 90843 |
| 14 | Ga0055539_1000109 | 3300003752 | Bacteria | 90843 |
| 15 | Ga0055533_1000117 | 3300003756 | Bacteria | 90843 |
| 16 | Ga0055532_1000120 | 3300003758 | Bacteria | 81088 |
| 17 | Ga0055525_1000156 | 3300003759 | Bacteria | 90843 |
| 18 | Ga0055535_1005421 | 3300003761 | Bacteria | 2802 |
| 19 | Ga0055536_1000331 | 3300003781 | Bacteria | 34950 |
| 20 | Ga0055536_1000454 | 3300003781 | Bacteria | 28777 |
| 21 | Ga0055536_1005665 | 3300003781 | Bacteria | 6042 |
| 22 | Ga0055530_10000176 | 3300003791 | Bacteria | 58667 |
| 23 | Ga0055530_10000351 | 3300003791 | Bacteria | 41661 |
| 24 | Ga0055530_10000511 | 3300003791 | Bacteria | 33798 |
| 25 | Ga0055530_10001302 | 3300003791 | Bacteria | 18793 |
| 26 | Ga0055540_1000193 | 3300003792 | Bacteria | 58670 |
| 27 | Ga0055540_1000385 | 3300003792 | Bacteria | 36787 |
| 28 | Ga0055531_10001143 | 3300003794 | Bacteria | 20543 |
| 29 | Ga0055531_10001439 | 3300003794 | Bacteria | 17565 |
| 30 | Ga0055541_1000074 | 3300003841 | Bacteria | 90843 |
| 31 | Ga0065714_10001142 | 3300005288 | Bacteria | 1468 |
| 32 | Ga0065714_10003823 | 3300005288 | Bacteria | 7961 |
| 33 | Ga0065714_10007206 | 3300005288 | Bacteria | 5613 |
| 34 | Ga0065714_10009092 | 3300005288 | Bacteria | 2387 |
| 35 | Ga0065714_10067449 | 3300005288 | Bacteria | 5504 |
| 36 | Ga0065714_10071416 | 3300005288 | Bacteria | 3584 |
| 37 | Ga0065714_10076792 | 3300005288 | Bacteria | 2753 |
| 38 | Ga0065714_10153673 | 3300005288 | Bacteria | 1090 |
| 39 | Ga0065704_10076135 | 3300005289 | Bacteria | 5248 |
| 40 | Ga0065704_10083727 | 3300005289 | Bacteria | 3426 |
| 41 | Ga0065712_10002535 | 3300005290 | Bacteria | 5757 |
| 42 | Ga0065712_10068159 | 3300005290 | Bacteria | 13672 |
| 43 | Ga0065712_10071669 | 3300005290 | Bacteria | 5121 |
| 44 | Ga0065715_10143679 | 3300005293 | Bacteria | 1817 |
| 45 | Ga0070670_100000780 | 3300005331 | Bacteria | 24782 |
| 46 | Ga0070670_100011171 | 3300005331 | Bacteria | 7674 |
| 47 | Ga0070661_100000514 | 3300005344 | Bacteria | 29713 |
| 48 | Ga0070669_100004365 | 3300005353 | Bacteria | 10208 |
| 49 | Ga0070669_100321648 | 3300005353 | Bacteria | 1249 |
| 50 | Ga0070714_100260082 | 3300005435 | Bacteria | 1607 |
| 51 | Ga0070662_100000301 | 3300005457 | Bacteria | 29323 |
| 52 | Ga0068853_100006538 | 3300005539 | Bacteria | 9279 |
| 53 | Ga0070665_100035692 | 3300005548 | Bacteria | 5000 |
| 54 | Ga0070664_100000130 | 3300005564 | Bacteria | 50283 |
| 55 | Ga0068854_100003695 | 3300005578 | Bacteria | 9572 |
| 56 | Ga0068851_10000037 | 3300005834 | Bacteria | 97386 |
| 57 | Ga0075364_10129193 | 3300006051 | Bacteria | 1695 |
| 58 | Ga0075364_10165866 | 3300006051 | Bacteria | 1492 |
| 59 | Ga0075432_10002236 | 3300006058 | Bacteria | 6442 |
| 60 | Ga0075432_10067350 | 3300006058 | Bacteria | 1282 |
| 61 | Ga0075362_10055845 | 3300006177 | Bacteria | 1776 |
| 62 | Ga0075369_10005197 | 3300006186 | Bacteria | 4848 |
| 63 | Ga0075436_100042714 | 3300006914 | Bacteria | 3127 |
| 64 | Ga0075436_100293387 | 3300006914 | Bacteria | 1164 |
| 65 | Ga0079104_1000414 | 3300006946 | Bacteria | 49214 |
| 66 | Ga0079104_1000467 | 3300006946 | Bacteria | 45232 |
| 67 | Ga0079104_1008166 | 3300006946 | Bacteria | 3700 |
| 68 | Ga0099826_10023577 | 3300006948 | Bacteria | 4584 |
| 69 | Ga0105251_10000061 | 3300009011 | Bacteria | 102789 |
| 70 | Ga0105251_10001136 | 3300009011 | Bacteria | 23150 |
| 71 | Ga0105251_10003445 | 3300009011 | Bacteria | 11479 |
| 72 | Ga0105251_10004028 | 3300009011 | Bacteria | 10356 |
| 73 | Ga0105251_10007385 | 3300009011 | Bacteria | 6786 |
| 74 | Ga0105251_10010616 | 3300009011 | Bacteria | 5324 |
| 75 | Ga0105251_10024748 | 3300009011 | Bacteria | 3080 |
| 76 | Ga0105251_10029477 | 3300009011 | Bacteria | 2764 |
| 77 | Ga0105251_10073962 | 3300009011 | Bacteria | 1583 |
| 78 | Ga0105251_10077247 | 3300009011 | Bacteria | 1544 |
| 79 | Ga0105251_10094193 | 3300009011 | Bacteria | 1373 |
| 80 | Ga0105251_10152839 | 3300009011 | Bacteria | 1042 |
| 81 | Ga0105244_10000272 | 3300009036 | Bacteria | 52218 |
| 82 | Ga0105244_10003044 | 3300009036 | Bacteria | 12301 |
| 83 | Ga0105244_10007527 | 3300009036 | Bacteria | 6911 |
| 84 | Ga0105244_10008012 | 3300009036 | Bacteria | 6647 |
| 85 | Ga0105244_10011554 | 3300009036 | Bacteria | 5280 |
| 86 | Ga0105244_10018989 | 3300009036 | Bacteria | 3847 |
| 87 | Ga0105244_10019308 | 3300009036 | Bacteria | 3810 |
| 88 | Ga0105244_10027162 | 3300009036 | Bacteria | 3088 |
| 89 | Ga0105244_10046236 | 3300009036 | Bacteria | 2237 |
| 90 | Ga0105244_10096103 | 3300009036 | Bacteria | 1453 |
| 91 | Ga0105244_10121360 | 3300009036 | Bacteria | 1265 |
| 92 | Ga0105250_10000299 | 3300009092 | Bacteria | 39028 |
| 93 | Ga0105250_10000332 | 3300009092 | Bacteria | 36415 |
| 94 | Ga0105250_10005536 | 3300009092 | Bacteria | 5651 |
| 95 | Ga0105250_10009461 | 3300009092 | Bacteria | 4100 |
| 96 | Ga0105250_10063323 | 3300009092 | Bacteria | 1488 |
| 97 | Ga0105243_10000647 | 3300009148 | Bacteria | 34468 |
| 98 | Ga0105243_10004177 | 3300009148 | Bacteria | 11451 |
| 99 | Ga0105243_10051884 | 3300009148 | Bacteria | 3246 |
| 100 | Ga0105243_10078692 | 3300009148 | Bacteria | 2685 |
| 101 | Ga0105243_10184199 | 3300009148 | Bacteria | 1818 |
| 102 | Ga0105243_10444603 | 3300009148 | Bacteria | 1215 |
| 103 | Ga0105242_10000367 | 3300009176 | Bacteria | 36044 |
| 104 | Ga0105242_10184150 | 3300009176 | Bacteria | 1844 |
| 105 | Ga0105248_10134319 | 3300009177 | Bacteria | 2792 |
| 106 | Ga0105237_10000196 | 3300009545 | Bacteria | 85826 |
| 107 | Ga0105249_10107793 | 3300009553 | Bacteria | 2629 |
| 108 | Ga0105246_10002077 | 3300011119 | Bacteria | 12065 |
| 109 | Ga0105246_10002807 | 3300011119 | Bacteria | 10543 |
| 110 | Ga0105246_10005375 | 3300011119 | Bacteria | 7797 |
| 111 | Ga0157345_1000166 | 3300012498 | Bacteria | 10979 |
| 112 | Ga0157373_10001582 | 3300013100 | Bacteria | 17385 |
| 113 | Ga0157373_10006202 | 3300013100 | Bacteria | 8933 |
| 114 | Ga0157373_10033665 | 3300013100 | Bacteria | 3685 |
| 115 | Ga0157373_10033815 | 3300013100 | Bacteria | 3674 |
| 116 | Ga0157373_10057708 | 3300013100 | Bacteria | 2753 |
| 117 | Ga0157373_10169447 | 3300013100 | Bacteria | 1536 |
| 118 | Ga0157373_10176590 | 3300013100 | Bacteria | 1503 |
| 119 | Ga0157371_10000329 | 3300013102 | Bacteria | 61218 |
| 120 | Ga0157371_10001507 | 3300013102 | Bacteria | 24071 |
| 121 | Ga0157371_10006271 | 3300013102 | Bacteria | 9850 |
| 122 | Ga0157371_10016205 | 3300013102 | Bacteria | 5568 |
| 123 | Ga0157370_10000846 | 3300013104 | Bacteria | 38839 |
| 124 | Ga0157370_10010838 | 3300013104 | Bacteria | 9576 |
| 125 | Ga0157370_10056348 | 3300013104 | Bacteria | 3741 |
| 126 | Ga0157370_10084574 | 3300013104 | Bacteria | 2982 |
| 127 | Ga0157370_10153170 | 3300013104 | Bacteria | 2145 |
| 128 | Ga0157370_10533888 | 3300013104 | Bacteria | 1076 |
| 129 | Ga0157369_10015829 | 3300013105 | Bacteria | 8495 |
| 130 | Ga0157369_10017783 | 3300013105 | Bacteria | 7982 |
| 131 | Ga0157369_10079337 | 3300013105 | Bacteria | 3516 |
| 132 | Ga0163162_10012886 | 3300013306 | Bacteria | 8165 |
| 133 | Ga0163162_10019611 | 3300013306 | Bacteria | 6638 |
| 134 | Ga0163162_10097608 | 3300013306 | Bacteria | 3027 |
| 135 | Ga0157372_10001549 | 3300013307 | Bacteria | 25023 |
| 136 | Ga0157375_10023768 | 3300013308 | Bacteria | 5662 |
| 137 | Ga0157375_10437742 | 3300013308 | Bacteria | 1473 |
| 138 | Ga0182008_10001933 | 3300014497 | Bacteria | 13365 |
| 139 | Ga0182008_10005701 | 3300014497 | Bacteria | 7050 |
| 140 | Ga0182008_10005795 | 3300014497 | Bacteria | 6986 |
| 141 | Ga0182008_10008549 | 3300014497 | Bacteria | 5587 |
| 142 | Ga0182008_10014390 | 3300014497 | Bacteria | 4143 |
| 143 | Ga0182008_10021905 | 3300014497 | Bacteria | 3278 |
| 144 | Ga0182008_10022905 | 3300014497 | Bacteria | 3196 |
| 145 | Ga0182006_1000640 | 3300015261 | Bacteria | 24816 |
| 146 | Ga0182006_1001009 | 3300015261 | Bacteria | 18405 |
| 147 | Ga0182006_1006207 | 3300015261 | Bacteria | 5578 |
| 148 | Ga0182006_1015704 | 3300015261 | Bacteria | 3242 |
| 149 | Ga0182006_1030050 | 3300015261 | Bacteria | 2199 |
| 150 | Ga0182006_1041913 | 3300015261 | Bacteria | 1796 |
| 151 | Ga0182006_1060721 | 3300015261 | Bacteria | 1427 |
| 152 | Ga0182007_10004583 | 3300015262 | Bacteria | 6244 |
| 153 | Ga0182007_10019086 | 3300015262 | Bacteria | 2471 |
| 154 | Ga0182007_10057056 | 3300015262 | Bacteria | 1282 |
| 155 | Ga0182005_1002382 | 3300015265 | Bacteria | 6765 |
| 156 | Ga0182005_1005062 | 3300015265 | Bacteria | 4159 |
| 157 | Ga0182005_1028102 | 3300015265 | Bacteria | 1534 |
| 158 | Ga0163161_10003732 | 3300017792 | Bacteria | 10669 |
| 159 | Ga0163161_10010748 | 3300017792 | Bacteria | 6342 |
| 160 | Ga0163161_10013993 | 3300017792 | Bacteria | 5587 |
| 161 | Ga0163161_10021713 | 3300017792 | Bacteria | 4513 |
| 162 | Ga0163161_10036807 | 3300017792 | Bacteria | 3506 |
| 163 | Ga0163161_10053950 | 3300017792 | Bacteria | 2916 |
| 164 | Ga0163161_10126610 | 3300017792 | Bacteria | 1924 |
| 165 | Ga0163161_10238541 | 3300017792 | Bacteria | 1413 |
| 166 | Ga0209435_100487 | 3300025206 | Bacteria | 7849 |
| 167 | Ga0209760_100021 | 3300025207 | Bacteria | 163688 |
| 168 | Ga0209760_100194 | 3300025207 | Bacteria | 29472 |
| 169 | Ga0209784_100015 | 3300025224 | Bacteria | 482117 |
| 170 | Ga0209566_100012 | 3300025225 | Bacteria | 482281 |
| 171 | Ga0209674_100027 | 3300025226 | Bacteria | 482281 |
| 172 | Ga0209147_100019 | 3300025229 | Bacteria | 482139 |
| 173 | Ga0209563_100031 | 3300025230 | Bacteria | 482281 |
| 174 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 175 | Ga0207427_100038 | 3300025231 | Bacteria | 292975 |
| 176 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 177 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 178 | Ga0209258_100296 | 3300025242 | Bacteria | 81403 |
| 179 | Ga0209646_1000292 | 3300025246 | Bacteria | 42484 |
| 180 | Ga0209677_100016 | 3300025253 | Bacteria | 482117 |
| 181 | Ga0209759_1004305 | 3300025256 | Bacteria | 5354 |
| 182 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 183 | Ga0209233_1000074 | 3300025261 | Bacteria | 357367 |
| 184 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 185 | Ga0209676_1000056 | 3300025292 | Bacteria | 361329 |
| 186 | Ga0209676_1000524 | 3300025292 | Bacteria | 60019 |
| 187 | Ga0209676_1002719 | 3300025292 | Bacteria | 11913 |
| 188 | Ga0209676_1007863 | 3300025292 | Bacteria | 4898 |
| 189 | Ga0209050_1000060 | 3300025298 | Bacteria | 321699 |
| 190 | Ga0209050_1000208 | 3300025298 | Bacteria | 131310 |
| 191 | Ga0209050_1000361 | 3300025298 | Bacteria | 87075 |
| 192 | Ga0209050_1001601 | 3300025298 | Bacteria | 23382 |
| 193 | Ga0209051_1000037 | 3300025303 | Bacteria | 321747 |
| 194 | Ga0209051_1000061 | 3300025303 | Bacteria | 253485 |
| 195 | Ga0209051_1000368 | 3300025303 | Bacteria | 64958 |
| 196 | Ga0209051_1011404 | 3300025303 | Bacteria | 4390 |
| 197 | Ga0209257_1000637 | 3300025304 | Bacteria | 56279 |
| 198 | Ga0209257_1008780 | 3300025304 | Bacteria | 5616 |
| 199 | Ga0207656_10000014 | 3300025321 | Bacteria | 146941 |
| 200 | Ga0207696_1000032 | 3300025711 | Bacteria | 380071 |
| 201 | Ga0207696_1000034 | 3300025711 | Bacteria | 350426 |
| 202 | Ga0207696_1000293 | 3300025711 | Bacteria | 58344 |
| 203 | Ga0207696_1002462 | 3300025711 | Bacteria | 9054 |
| 204 | Ga0207696_1005740 | 3300025711 | Bacteria | 5102 |
| 205 | Ga0207696_1006743 | 3300025711 | Bacteria | 4584 |
| 206 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 207 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 208 | Ga0207655_1002213 | 3300025728 | Bacteria | 16140 |
| 209 | Ga0207655_1002214 | 3300025728 | Bacteria | 16124 |
| 210 | Ga0207655_1002284 | 3300025728 | Bacteria | 15777 |
| 211 | Ga0207655_1006185 | 3300025728 | Bacteria | 7976 |
| 212 | Ga0207655_1007329 | 3300025728 | Bacteria | 7168 |
| 213 | Ga0207655_1019949 | 3300025728 | Bacteria | 3475 |
| 214 | Ga0207655_1025950 | 3300025728 | Bacteria | 2827 |
| 215 | Ga0207655_1049318 | 3300025728 | Bacteria | 1720 |
| 216 | Ga0207655_1058096 | 3300025728 | Bacteria | 1515 |
| 217 | Ga0207655_1062492 | 3300025728 | Bacteria | 1432 |
| 218 | Ga0207713_1000014 | 3300025735 | Bacteria | 432450 |
| 219 | Ga0207713_1000493 | 3300025735 | Bacteria | 40740 |
| 220 | Ga0207713_1000696 | 3300025735 | Bacteria | 31509 |
| 221 | Ga0207713_1001099 | 3300025735 | Bacteria | 23158 |
| 222 | Ga0207713_1003197 | 3300025735 | Bacteria | 11321 |
| 223 | Ga0207713_1005108 | 3300025735 | Bacteria | 8317 |
| 224 | Ga0207713_1007824 | 3300025735 | Bacteria | 6234 |
| 225 | Ga0207713_1012139 | 3300025735 | Bacteria | 4630 |
| 226 | Ga0207713_1026477 | 3300025735 | Bacteria | 2657 |
| 227 | Ga0207713_1030419 | 3300025735 | Bacteria | 2404 |
| 228 | Ga0207713_1035227 | 3300025735 | Bacteria | 2162 |
| 229 | Ga0207713_1085410 | 3300025735 | Bacteria | 1124 |
| 230 | Ga0207671_10000019 | 3300025914 | Bacteria | 317781 |
| 231 | Ga0207649_10000002 | 3300025920 | Bacteria | 498633 |
| 232 | Ga0207681_10002090 | 3300025923 | Bacteria | 12799 |
| 233 | Ga0207681_10283474 | 3300025923 | Bacteria | 1305 |
| 234 | Ga0207650_10000337 | 3300025925 | Bacteria | 45511 |
| 235 | Ga0207650_10000421 | 3300025925 | Bacteria | 37575 |
| 236 | Ga0207706_10000136 | 3300025933 | Bacteria | 79887 |
| 237 | Ga0207706_10006583 | 3300025933 | Bacteria | 10759 |
| 238 | Ga0207686_10005889 | 3300025934 | Bacteria | 6581 |
| 239 | Ga0207686_10114636 | 3300025934 | Bacteria | 1824 |
| 240 | Ga0207709_10000134 | 3300025935 | Bacteria | 108529 |
| 241 | Ga0207709_10000699 | 3300025935 | Bacteria | 27072 |
| 242 | Ga0207709_10022130 | 3300025935 | Bacteria | 3604 |
| 243 | Ga0207709_10122234 | 3300025935 | Bacteria | 1760 |
| 244 | Ga0207711_10209994 | 3300025941 | Bacteria | 1778 |
| 245 | Ga0207679_10000006 | 3300025945 | Bacteria | 498868 |
| 246 | Ga0207712_10041152 | 3300025961 | Bacteria | 3174 |
| 247 | Ga0207639_10004918 | 3300026041 | Bacteria | 9002 |
| 248 | Ga0209281_1000010 | 3300027111 | Bacteria | 726106 |
| 249 | Ga0209281_1000013 | 3300027111 | Bacteria | 653449 |
| 250 | Ga0209281_1003222 | 3300027111 | Bacteria | 5565 |
| 251 | Ga0209281_1008557 | 3300027111 | Bacteria | 2472 |
| 252 | Ga0207428_10021829 | 3300027907 | Bacteria | 5415 |
| 253 | Ga0207428_10040345 | 3300027907 | Bacteria | 3788 |
| 254 | Ga0207428_10101950 | 3300027907 | Bacteria | 2217 |
| 255 | Ga0207428_10274082 | 3300027907 | Bacteria | 1254 |
| 256 | Ga0268266_10035410 | 3300028379 | Bacteria | 4246 |
| 257 | Ga0268266_10083646 | 3300028379 | Bacteria | 2786 |
| 258 | Ga0307511_10095374 | 3300030521 | Bacteria | 1988 |
| 259 | Ga0316177_1109772 | 3300030731 | Bacteria | 1988 |
| 260 | Ga0316179_1049348 | 3300030734 | Bacteria | 1680 |
| 261 | Ga0316178_1083052 | 3300030735 | Bacteria | 21791 |
| 262 | Ga0307408_100001820 | 3300031548 | Bacteria | 15531 |
| 263 | Ga0307408_100012631 | 3300031548 | Bacteria | 5600 |
| 264 | Ga0307408_100043394 | 3300031548 | Bacteria | 3199 |
| 265 | Ga0307516_10368403 | 3300031730 | Bacteria | 1100 |
| 266 | Ga0307405_10000600 | 3300031731 | Bacteria | 13836 |
| 267 | Ga0307405_10002971 | 3300031731 | Bacteria | 7661 |
| 268 | Ga0307405_10149243 | 3300031731 | Bacteria | 1641 |
| 269 | Ga0307413_10030392 | 3300031824 | Bacteria | 3034 |
| 270 | Ga0307406_10114529 | 3300031901 | Bacteria | 1862 |
| 271 | Ga0307407_10086328 | 3300031903 | Bacteria | 1911 |
| 272 | Ga0307412_10001424 | 3300031911 | Bacteria | 13333 |
| 273 | Ga0307412_10005406 | 3300031911 | Bacteria | 7168 |
| 274 | Ga0307412_10005742 | 3300031911 | Bacteria | 6975 |
| 275 | Ga0307412_10016716 | 3300031911 | Bacteria | 4376 |
| 276 | Ga0307412_10217496 | 3300031911 | Bacteria | 1462 |
| 277 | Ga0307409_100044538 | 3300031995 | Bacteria | 3343 |
| 278 | Ga0307416_100204640 | 3300032002 | Bacteria | 1876 |
| 279 | Ga0307414_10108449 | 3300032004 | Bacteria | 2106 |
| 280 | Ga0307411_10011937 | 3300032005 | Bacteria | 4714 |
| 281 | Ga0307510_10001784 | 3300033180 | Bacteria | 24023 |
| 282 | Ga0307510_10156796 | 3300033180 | Bacteria | 1882 |
| 283 | Ga0237819_01040 | 3300038705 | Bacteria | 8276 |
| 284 | Ga0439436_0001968 | 3300041404 | Bacteria | 6087 |
| 285 | Ga0439438_001691 | 3300041405 | Bacteria | 9708 |
| 286 | Ga0439438_001751 | 3300041405 | Bacteria | 9541 |
| 287 | Ga0439438_001896 | 3300041405 | Bacteria | 9156 |
| 288 | Ga0439438_005214 | 3300041405 | Bacteria | 4822 |
| 289 | Ga0439438_006476 | 3300041405 | Bacteria | 4121 |
| 290 | Ga0439438_010012 | 3300041405 | Bacteria | 3030 |
| 291 | Ga0439438_012538 | 3300041405 | Bacteria | 2596 |
| 292 | Ga0439438_012742 | 3300041405 | Bacteria | 2564 |
| 293 | Ga0439438_014142 | 3300041405 | Bacteria | 2382 |
| 294 | Ga0439438_018677 | 3300041405 | Bacteria | 1970 |
| 295 | Ga0439447_001121 | 3300041407 | Bacteria | 9734 |
| 296 | Ga0439447_001710 | 3300041407 | Bacteria | 8057 |
| 297 | Ga0439447_002220 | 3300041407 | Bacteria | 7124 |
| 298 | Ga0439447_007855 | 3300041407 | Bacteria | 3346 |
| 299 | Ga0439447_009508 | 3300041407 | Bacteria | 2940 |
| 300 | Ga0439447_013121 | 3300041407 | Bacteria | 2358 |
| 301 | Ga0439447_042694 | 3300041407 | Bacteria | 1100 |
| 302 | Ga0439466_0000163 | 3300041411 | Bacteria | 26650 |
| 303 | Ga0439466_0000942 | 3300041411 | Bacteria | 11156 |
| 304 | Ga0439466_0001747 | 3300041411 | Bacteria | 8496 |
| 305 | Ga0439466_0005958 | 3300041411 | Bacteria | 4639 |
| 306 | Ga0439466_0020529 | 3300041411 | Bacteria | 2352 |
| 307 | Ga0439466_0022787 | 3300041411 | Bacteria | 2207 |
| 308 | Ga0439466_0043014 | 3300041411 | Bacteria | 1501 |
| 309 | Ga0439466_0054574 | 3300041411 | Bacteria | 1301 |
| 310 | Ga0439465_0028286 | 3300041413 | Bacteria | 1777 |
| 311 | Ga0451797_1241239 | 3300041453 | Bacteria | 1226 |
| 312 | Ga0439445_0011656 | 3300042004 | Bacteria | 2100 |
| 313 | Ga0439432_000131 | 3300042006 | Bacteria | 24949 |
| 314 | Ga0439432_002819 | 3300042006 | Bacteria | 6481 |
| 315 | Ga0439432_006745 | 3300042006 | Bacteria | 4089 |
| 316 | Ga0439432_006900 | 3300042006 | Bacteria | 4042 |
| 317 | Ga0439432_019564 | 3300042006 | Bacteria | 2254 |
| 318 | Ga0439451_014086 | 3300042009 | Bacteria | 1613 |
| 319 | Ga0439451_021862 | 3300042009 | Bacteria | 1289 |
| 320 | Ga0439451_051178 | 3300042009 | Bacteria | 827 |
| 321 | Ga0439452_000207 | 3300042010 | Bacteria | 42410 |
| 322 | Ga0439452_001300 | 3300042010 | Bacteria | 10516 |
| 323 | Ga0439452_001453 | 3300042010 | Bacteria | 9676 |
| 324 | Ga0439452_001862 | 3300042010 | Bacteria | 8145 |
| 325 | Ga0439452_003681 | 3300042010 | Bacteria | 5306 |
| 326 | Ga0439456_000074 | 3300042013 | Bacteria | 35473 |
| 327 | Ga0439456_001007 | 3300042013 | Bacteria | 5598 |
| 328 | Ga0439456_013066 | 3300042013 | Bacteria | 1725 |
| 329 | Ga0439463_000239 | 3300042016 | Bacteria | 15161 |
| 330 | Ga0439463_000931 | 3300042016 | Bacteria | 8030 |
| 331 | Ga0439463_027324 | 3300042016 | Bacteria | 1436 |
| 332 | Ga0450911_001690 | 3300042115 | Bacteria | 4873 |
| 333 | Ga0450911_001939 | 3300042115 | Bacteria | 4332 |
| 334 | Ga0450911_004539 | 3300042115 | Bacteria | 2266 |
| 335 | Ga0450919_000714 | 3300042121 | Bacteria | 4186 |
| 336 | Ga0450922_000147 | 3300042124 | Bacteria | 7412 |
| 337 | Ga0450922_003025 | 3300042124 | Bacteria | 1552 |
| 338 | Ga0450890_001456 | 3300042127 | Bacteria | 3401 |
| 339 | Ga0450900_004396 | 3300042136 | Bacteria | 1618 |
| 340 | Ga0450903_006702 | 3300042138 | Bacteria | 1907 |
| 341 | Ga0450903_011976 | 3300042138 | Bacteria | 1390 |
| 342 | Ga0450906_000358 | 3300042145 | Bacteria | 9254 |
| 343 | Ga0450906_006543 | 3300042145 | Bacteria | 2346 |
| 344 | Ga0450906_008131 | 3300042145 | Bacteria | 2042 |
| 345 | Ga0450907_000197 | 3300042146 | Bacteria | 21929 |
| 346 | Ga0450907_000424 | 3300042146 | Bacteria | 12604 |
| 347 | Ga0450907_003201 | 3300042146 | Bacteria | 2955 |
| 348 | Ga0450910_000448 | 3300042147 | Bacteria | 4872 |
| 349 | Ga0450910_000974 | 3300042147 | Bacteria | 3469 |
| 350 | Ga0439446_0003304 | 3300042156 | Bacteria | 3983 |
| 351 | Ga0439446_0012156 | 3300042156 | Bacteria | 2348 |
| 352 | Ga0439446_0014964 | 3300042156 | Bacteria | 2147 |
| 353 | Ga0450908_010909 | 3300042184 | Bacteria | 1669 |
| 354 | Ga0439434_0022457 | 3300042435 | Bacteria | 1897 |
| 355 | Ga0439434_0041343 | 3300042435 | Bacteria | 1416 |
| 356 | Ga0439464_0002872 | 3300042439 | Bacteria | 4287 |
| 357 | Ga0439464_0012958 | 3300042439 | Bacteria | 2227 |
| 358 | Ga0439460_0016720 | 3300042461 | Bacteria | 1957 |
| 359 | Ga0439460_0044875 | 3300042461 | Bacteria | 1309 |
| 360 | Ga0450918_012043 | 3300042531 | Bacteria | 1507 |
| 361 | Ga0439440_0002537 | 3300042993 | Bacteria | 3457 |
| 362 | Ga0439440_0004375 | 3300042993 | Bacteria | 2772 |
| 363 | Ga0439440_0010195 | 3300042993 | Bacteria | 1959 |
| 364 | Ga0495617_000127 | 3300046452 | Bacteria | 50396 |
| 365 | Ga0495617_001743 | 3300046452 | Bacteria | 9300 |
| 366 | Ga0495617_007762 | 3300046452 | Bacteria | 3711 |
| 367 | Ga0495617_019312 | 3300046452 | Bacteria | 2304 |
| 368 | Ga0495617_021559 | 3300046452 | Bacteria | 2175 |
| 369 | Ga0495617_023764 | 3300046452 | Bacteria | 2069 |
| 370 | Ga0495617_039352 | 3300046452 | Bacteria | 1581 |
| 371 | Ga0495617_053812 | 3300046452 | Bacteria | 1336 |
| 372 | Ga0495617_054210 | 3300046452 | Bacteria | 1331 |
| 373 | Ga0495617_071973 | 3300046452 | Bacteria | 1137 |
| 374 | Ga0495627_000074 | 3300046453 | Bacteria | 123139 |
| 375 | Ga0495627_000386 | 3300046453 | Bacteria | 40131 |
| 376 | Ga0495627_000733 | 3300046453 | Bacteria | 24765 |
| 377 | Ga0495627_001977 | 3300046453 | Bacteria | 10586 |
| 378 | Ga0495627_007975 | 3300046453 | Bacteria | 4004 |
| 379 | Ga0495627_012510 | 3300046453 | Bacteria | 3007 |
| 380 | Ga0495627_013168 | 3300046453 | Bacteria | 2914 |
| 381 | Ga0495627_031178 | 3300046453 | Bacteria | 1685 |
| 382 | Ga0495627_067837 | 3300046453 | Bacteria | 1045 |
| 383 | Ga0495603_0012866 | 3300046455 | Bacteria | 5059 |
| 384 | Ga0495603_0195206 | 3300046455 | Bacteria | 1170 |
| 385 | Ga0495590_0001839 | 3300046457 | Bacteria | 8980 |
| 386 | Ga0495590_0002384 | 3300046457 | Bacteria | 7783 |
| 387 | Ga0495590_0007635 | 3300046457 | Bacteria | 4154 |
| 388 | Ga0495590_0043029 | 3300046457 | Bacteria | 1575 |
| 389 | Ga0495591_000581 | 3300046458 | Bacteria | 27805 |
| 390 | Ga0495591_002596 | 3300046458 | Bacteria | 9915 |
| 391 | Ga0495591_004699 | 3300046458 | Bacteria | 6555 |
| 392 | Ga0495591_006527 | 3300046458 | Bacteria | 5139 |
| 393 | Ga0495591_007840 | 3300046458 | Bacteria | 4461 |
| 394 | Ga0495591_009959 | 3300046458 | Bacteria | 3729 |
| 395 | Ga0495591_017008 | 3300046458 | Bacteria | 2510 |
| 396 | Ga0495591_020509 | 3300046458 | Bacteria | 2181 |
| 397 | Ga0495591_044590 | 3300046458 | Bacteria | 1241 |
| 398 | Ga0495591_046310 | 3300046458 | Bacteria | 1209 |
| 399 | Ga0495638_0008766 | 3300046460 | Bacteria | 7144 |
| 400 | Ga0495638_0009529 | 3300046460 | Bacteria | 6807 |
| 401 | Ga0495638_0010749 | 3300046460 | Bacteria | 6334 |
| 402 | Ga0495638_0021218 | 3300046460 | Bacteria | 4284 |
| 403 | Ga0495638_0087848 | 3300046460 | Bacteria | 1877 |
| 404 | Ga0495638_0114492 | 3300046460 | Bacteria | 1599 |
| 405 | Ga0495653_0005407 | 3300046463 | Bacteria | 10396 |
| 406 | Ga0495653_0023087 | 3300046463 | Bacteria | 5030 |
| 407 | Ga0495653_0023163 | 3300046463 | Bacteria | 5021 |
| 408 | Ga0495653_0028970 | 3300046463 | Bacteria | 4425 |
| 409 | Ga0495653_0154263 | 3300046463 | Bacteria | 1601 |
| 410 | Ga0495650_0002993 | 3300046471 | Bacteria | 12792 |
| 411 | Ga0495650_0009577 | 3300046471 | Bacteria | 5495 |
| 412 | Ga0495650_0013923 | 3300046471 | Bacteria | 4222 |
| 413 | Ga0495650_0021060 | 3300046471 | Bacteria | 3161 |
| 414 | Ga0495650_0025032 | 3300046471 | Bacteria | 2807 |
| 415 | Ga0495650_0029622 | 3300046471 | Bacteria | 2492 |
| 416 | Ga0495650_0053515 | 3300046471 | Bacteria | 1652 |
| 417 | Ga0495650_0078131 | 3300046471 | Bacteria | 1282 |
| 418 | Ga0495605_0000182 | 3300046474 | Bacteria | 78093 |
| 419 | Ga0495605_0000356 | 3300046474 | Bacteria | 44048 |
| 420 | Ga0495605_0000543 | 3300046474 | Bacteria | 31038 |
| 421 | Ga0495605_0004727 | 3300046474 | Bacteria | 7966 |
| 422 | Ga0495605_0006153 | 3300046474 | Bacteria | 6919 |
| 423 | Ga0495605_0006890 | 3300046474 | Bacteria | 6490 |
| 424 | Ga0495605_0008292 | 3300046474 | Bacteria | 5877 |
| 425 | Ga0495605_0014838 | 3300046474 | Bacteria | 4252 |
| 426 | Ga0495605_0026615 | 3300046474 | Bacteria | 3005 |
| 427 | Ga0495605_0092019 | 3300046474 | Bacteria | 1404 |
| 428 | Ga0495605_0130529 | 3300046474 | Bacteria | 1133 |
| 429 | Ga0495605_0164407 | 3300046474 | Bacteria | 984 |
| 430 | Ga0495639_0000341 | 3300046475 | Bacteria | 22512 |
| 431 | Ga0495639_0106179 | 3300046475 | Bacteria | 1329 |
| 432 | Ga0495584_0004163 | 3300046491 | Bacteria | 7807 |
| 433 | Ga0495584_0006489 | 3300046491 | Bacteria | 6116 |
| 434 | Ga0495584_0007702 | 3300046491 | Bacteria | 5609 |
| 435 | Ga0495584_0010483 | 3300046491 | Bacteria | 4760 |
| 436 | Ga0495584_0011307 | 3300046491 | Bacteria | 4571 |
| 437 | Ga0495584_0012444 | 3300046491 | Bacteria | 4343 |
| 438 | Ga0495584_0017462 | 3300046491 | Bacteria | 3652 |
| 439 | Ga0495584_0030573 | 3300046491 | Bacteria | 2727 |
| 440 | Ga0495584_0036106 | 3300046491 | Bacteria | 2496 |
| 441 | Ga0495584_0050058 | 3300046491 | Bacteria | 2104 |
| 442 | Ga0495584_0052419 | 3300046491 | Bacteria | 2053 |
| 443 | Ga0495584_0143111 | 3300046491 | Bacteria | 1214 |
| 444 | Ga0495584_0179484 | 3300046491 | Bacteria | 1076 |
| 445 | Ga0495585_0003685 | 3300046492 | Bacteria | 10239 |
| 446 | Ga0495585_0007614 | 3300046492 | Bacteria | 6615 |
| 447 | Ga0495585_0008396 | 3300046492 | Bacteria | 6261 |
| 448 | Ga0495585_0011899 | 3300046492 | Bacteria | 5138 |
| 449 | Ga0495585_0014945 | 3300046492 | Bacteria | 4514 |
| 450 | Ga0495585_0019119 | 3300046492 | Bacteria | 3953 |
| 451 | Ga0495585_0022272 | 3300046492 | Bacteria | 3637 |
| 452 | Ga0495585_0048596 | 3300046492 | Bacteria | 2358 |
| 453 | Ga0495585_0077685 | 3300046492 | Bacteria | 1802 |
| 454 | Ga0495585_0088277 | 3300046492 | Bacteria | 1672 |
| 455 | Ga0495585_0170821 | 3300046492 | Bacteria | 1123 |
| 456 | Ga0495594_0060354 | 3300046499 | Bacteria | 2097 |
| 457 | Ga0495596_0000549 | 3300046500 | Bacteria | 23504 |
| 458 | Ga0495607_0000549 | 3300046501 | Bacteria | 36677 |
| 459 | Ga0495607_0000682 | 3300046501 | Bacteria | 32843 |
| 460 | Ga0495607_0000721 | 3300046501 | Bacteria | 31777 |
| 461 | Ga0495607_0001083 | 3300046501 | Bacteria | 24864 |
| 462 | Ga0495607_0001478 | 3300046501 | Bacteria | 20905 |
| 463 | Ga0495607_0011723 | 3300046501 | Bacteria | 5817 |
| 464 | Ga0495607_0012161 | 3300046501 | Bacteria | 5691 |
| 465 | Ga0495607_0012868 | 3300046501 | Bacteria | 5503 |
| 466 | Ga0495607_0015670 | 3300046501 | Bacteria | 4907 |
| 467 | Ga0495607_0015729 | 3300046501 | Bacteria | 4896 |
| 468 | Ga0495607_0018822 | 3300046501 | Bacteria | 4392 |
| 469 | Ga0495607_0027747 | 3300046501 | Bacteria | 3497 |
| 470 | Ga0495607_0064416 | 3300046501 | Bacteria | 2070 |
| 471 | Ga0495607_0068205 | 3300046501 | Bacteria | 1995 |
| 472 | Ga0495607_0080706 | 3300046501 | Bacteria | 1788 |
| 473 | Ga0495607_0091416 | 3300046501 | Bacteria | 1648 |
| 474 | Ga0495607_0114745 | 3300046501 | Bacteria | 1423 |
| 475 | Ga0495607_0115298 | 3300046501 | Bacteria | 1418 |
| 476 | Ga0495607_0196446 | 3300046501 | Bacteria | 1001 |
| 477 | Ga0495583_0001352 | 3300046506 | Bacteria | 25418 |
| 478 | Ga0495583_0001430 | 3300046506 | Bacteria | 24242 |
| 479 | Ga0495583_0001463 | 3300046506 | Bacteria | 23779 |
| 480 | Ga0495583_0002110 | 3300046506 | Bacteria | 17865 |
| 481 | Ga0495583_0010993 | 3300046506 | Bacteria | 5223 |
| 482 | Ga0495583_0012791 | 3300046506 | Bacteria | 4725 |
| 483 | Ga0495583_0013261 | 3300046506 | Bacteria | 4607 |
| 484 | Ga0495583_0015208 | 3300046506 | Bacteria | 4196 |
| 485 | Ga0495583_0051075 | 3300046506 | Bacteria | 1886 |
| 486 | Ga0495583_0052437 | 3300046506 | Bacteria | 1855 |
| 487 | Ga0495606_0000518 | 3300046507 | Bacteria | 62348 |
| 488 | Ga0495606_0002865 | 3300046507 | Bacteria | 19088 |
| 489 | Ga0495606_0008750 | 3300046507 | Bacteria | 8702 |
| 490 | Ga0495606_0014249 | 3300046507 | Bacteria | 6217 |
| 491 | Ga0495606_0015507 | 3300046507 | Bacteria | 5865 |
| 492 | Ga0495606_0015690 | 3300046507 | Bacteria | 5819 |
| 493 | Ga0495606_0016021 | 3300046507 | Bacteria | 5740 |
| 494 | Ga0495606_0021751 | 3300046507 | Bacteria | 4691 |
| 495 | Ga0495606_0022560 | 3300046507 | Bacteria | 4581 |
| 496 | Ga0495606_0086804 | 3300046507 | Bacteria | 1932 |
| 497 | Ga0495606_0113824 | 3300046507 | Bacteria | 1628 |
| 498 | Ga0495606_0193641 | 3300046507 | Bacteria | 1164 |
| 499 | Ga0495606_0221558 | 3300046507 | Bacteria | 1065 |
| 500 | Ga0495610_0006641 | 3300046512 | Bacteria | 7894 |
| 501 | Ga0495610_0008423 | 3300046512 | Bacteria | 6684 |
| 502 | Ga0495610_0009397 | 3300046512 | Bacteria | 6189 |
| 503 | Ga0495610_0011965 | 3300046512 | Bacteria | 5259 |
| 504 | Ga0495610_0012861 | 3300046512 | Bacteria | 5005 |
| 505 | Ga0495610_0026056 | 3300046512 | Bacteria | 3127 |
| 506 | Ga0495610_0038399 | 3300046512 | Bacteria | 2430 |
| 507 | Ga0495610_0050035 | 3300046512 | Bacteria | 2042 |
| 508 | Ga0495610_0054490 | 3300046512 | Bacteria | 1932 |
| 509 | Ga0495610_0062865 | 3300046512 | Bacteria | 1760 |
| 510 | Ga0495610_0103624 | 3300046512 | Bacteria | 1270 |
| 511 | Ga0495610_0120654 | 3300046512 | Bacteria | 1149 |
| 512 | Ga0495616_0000823 | 3300046513 | Bacteria | 22657 |
| 513 | Ga0495616_0003782 | 3300046513 | Bacteria | 9651 |
| 514 | Ga0495616_0006083 | 3300046513 | Bacteria | 7355 |
| 515 | Ga0495616_0007448 | 3300046513 | Bacteria | 6552 |
| 516 | Ga0495616_0021398 | 3300046513 | Bacteria | 3502 |
| 517 | Ga0495616_0044113 | 3300046513 | Bacteria | 2263 |
| 518 | Ga0495616_0049557 | 3300046513 | Bacteria | 2104 |
| 519 | Ga0495616_0065241 | 3300046513 | Bacteria | 1774 |
| 520 | Ga0495620_0000003 | 3300046515 | Bacteria | 345923 |
| 521 | Ga0495620_0002112 | 3300046515 | Bacteria | 11559 |
| 522 | Ga0495620_0008259 | 3300046515 | Bacteria | 5599 |
| 523 | Ga0495620_0010161 | 3300046515 | Bacteria | 4972 |
| 524 | Ga0495620_0013883 | 3300046515 | Bacteria | 4111 |
| 525 | Ga0495620_0016325 | 3300046515 | Bacteria | 3728 |
| 526 | Ga0495620_0023069 | 3300046515 | Bacteria | 2983 |
| 527 | Ga0495620_0038356 | 3300046515 | Bacteria | 2127 |
| 528 | Ga0495620_0056662 | 3300046515 | Bacteria | 1647 |
| 529 | Ga0495620_0115664 | 3300046515 | Bacteria | 1060 |
| 530 | Ga0495630_0233809 | 3300046517 | Bacteria | 1404 |
| 531 | Ga0495631_0001514 | 3300046518 | Bacteria | 14016 |
| 532 | Ga0495631_0002924 | 3300046518 | Bacteria | 9463 |
| 533 | Ga0495631_0004995 | 3300046518 | Bacteria | 6991 |
| 534 | Ga0495631_0007648 | 3300046518 | Bacteria | 5488 |
| 535 | Ga0495631_0010837 | 3300046518 | Bacteria | 4503 |
| 536 | Ga0495631_0023437 | 3300046518 | Bacteria | 2860 |
| 537 | Ga0495631_0115294 | 3300046518 | Bacteria | 1155 |
| 538 | Ga0495631_0162450 | 3300046518 | Bacteria | 958 |
| 539 | Ga0495632_0000368 | 3300046519 | Bacteria | 42948 |
| 540 | Ga0495632_0001004 | 3300046519 | Bacteria | 24462 |
| 541 | Ga0495632_0001169 | 3300046519 | Bacteria | 22351 |
| 542 | Ga0495632_0001701 | 3300046519 | Bacteria | 17921 |
| 543 | Ga0495632_0003894 | 3300046519 | Bacteria | 10373 |
| 544 | Ga0495632_0004016 | 3300046519 | Bacteria | 10165 |
| 545 | Ga0495632_0006636 | 3300046519 | Bacteria | 7402 |
| 546 | Ga0495632_0006908 | 3300046519 | Bacteria | 7212 |
| 547 | Ga0495632_0009948 | 3300046519 | Bacteria | 5680 |
| 548 | Ga0495632_0011905 | 3300046519 | Bacteria | 5051 |
| 549 | Ga0495632_0015321 | 3300046519 | Bacteria | 4304 |
| 550 | Ga0495632_0018328 | 3300046519 | Bacteria | 3843 |
| 551 | Ga0495632_0019723 | 3300046519 | Bacteria | 3667 |
| 552 | Ga0495632_0022208 | 3300046519 | Bacteria | 3403 |
| 553 | Ga0495632_0053322 | 3300046519 | Bacteria | 1986 |
| 554 | Ga0495632_0066359 | 3300046519 | Bacteria | 1741 |
| 555 | Ga0495637_0000188 | 3300046520 | Bacteria | 48464 |
| 556 | Ga0495637_0001255 | 3300046520 | Bacteria | 15304 |
| 557 | Ga0495637_0004413 | 3300046520 | Bacteria | 7302 |
| 558 | Ga0495637_0005054 | 3300046520 | Bacteria | 6777 |
| 559 | Ga0495637_0005233 | 3300046520 | Bacteria | 6643 |
| 560 | Ga0495637_0006903 | 3300046520 | Bacteria | 5666 |
| 561 | Ga0495637_0009901 | 3300046520 | Bacteria | 4635 |
| 562 | Ga0495637_0011634 | 3300046520 | Bacteria | 4223 |
| 563 | Ga0495637_0014398 | 3300046520 | Bacteria | 3731 |
| 564 | Ga0495637_0020873 | 3300046520 | Bacteria | 3006 |
| 565 | Ga0495637_0028969 | 3300046520 | Bacteria | 2468 |
| 566 | Ga0495637_0030890 | 3300046520 | Bacteria | 2373 |
| 567 | Ga0495637_0039090 | 3300046520 | Bacteria | 2050 |
| 568 | Ga0495637_0045825 | 3300046520 | Bacteria | 1852 |
| 569 | Ga0495637_0045923 | 3300046520 | Bacteria | 1849 |
| 570 | Ga0495643_0000116 | 3300046522 | Bacteria | 130165 |
| 571 | Ga0495643_0001490 | 3300046522 | Bacteria | 21278 |
| 572 | Ga0495643_0008320 | 3300046522 | Bacteria | 6580 |
| 573 | Ga0495643_0008981 | 3300046522 | Bacteria | 6280 |
| 574 | Ga0495643_0025313 | 3300046522 | Bacteria | 3358 |
| 575 | Ga0495643_0044794 | 3300046522 | Bacteria | 2402 |
| 576 | Ga0495643_0057766 | 3300046522 | Bacteria | 2066 |
| 577 | Ga0495643_0076784 | 3300046522 | Bacteria | 1746 |
| 578 | Ga0495643_0115631 | 3300046522 | Bacteria | 1359 |
| 579 | Ga0495644_0004689 | 3300046523 | Bacteria | 5372 |
| 580 | Ga0495644_0004882 | 3300046523 | Bacteria | 5265 |
| 581 | Ga0495644_0006925 | 3300046523 | Bacteria | 4387 |
| 582 | Ga0495644_0007338 | 3300046523 | Bacteria | 4259 |
| 583 | Ga0495644_0027732 | 3300046523 | Bacteria | 2145 |
| 584 | Ga0495648_0001113 | 3300046524 | Bacteria | 27255 |
| 585 | Ga0495648_0001580 | 3300046524 | Bacteria | 22187 |
| 586 | Ga0495648_0007222 | 3300046524 | Bacteria | 8922 |
| 587 | Ga0495648_0010337 | 3300046524 | Bacteria | 7117 |
| 588 | Ga0495648_0019086 | 3300046524 | Bacteria | 4834 |
| 589 | Ga0495648_0019454 | 3300046524 | Bacteria | 4773 |
| 590 | Ga0495648_0019892 | 3300046524 | Bacteria | 4700 |
| 591 | Ga0495648_0021907 | 3300046524 | Bacteria | 4413 |
| 592 | Ga0495648_0022001 | 3300046524 | Bacteria | 4400 |
| 593 | Ga0495648_0029271 | 3300046524 | Bacteria | 3657 |
| 594 | Ga0495648_0036499 | 3300046524 | Bacteria | 3169 |
| 595 | Ga0495648_0067596 | 3300046524 | Bacteria | 2089 |
| 596 | Ga0495648_0084387 | 3300046524 | Bacteria | 1797 |
| 597 | Ga0495648_0114238 | 3300046524 | Bacteria | 1463 |
| 598 | Ga0495666_0036672 | 3300046526 | Bacteria | 2387 |
| 599 | Ga0495666_0047318 | 3300046526 | Bacteria | 2071 |
| 600 | Ga0495666_0093840 | 3300046526 | Bacteria | 1415 |
| 601 | Ga0495642_0000398 | 3300046528 | Bacteria | 23371 |
| 602 | Ga0495642_0002232 | 3300046528 | Bacteria | 7932 |
| 603 | Ga0495652_0267608 | 3300046529 | Bacteria | 1258 |
| 604 | Ga0495654_0000816 | 3300046530 | Bacteria | 23764 |
| 605 | Ga0495654_0001589 | 3300046530 | Bacteria | 15411 |
| 606 | Ga0495654_0008410 | 3300046530 | Bacteria | 5702 |
| 607 | Ga0495654_0008733 | 3300046530 | Bacteria | 5582 |
| 608 | Ga0495654_0009081 | 3300046530 | Bacteria | 5455 |
| 609 | Ga0495654_0011659 | 3300046530 | Bacteria | 4748 |
| 610 | Ga0495654_0013168 | 3300046530 | Bacteria | 4430 |
| 611 | Ga0495654_0015537 | 3300046530 | Bacteria | 4040 |
| 612 | Ga0495654_0015772 | 3300046530 | Bacteria | 4007 |
| 613 | Ga0495654_0018037 | 3300046530 | Bacteria | 3702 |
| 614 | Ga0495654_0020951 | 3300046530 | Bacteria | 3404 |
| 615 | Ga0495654_0022666 | 3300046530 | Bacteria | 3258 |
| 616 | Ga0495654_0027634 | 3300046530 | Bacteria | 2906 |
| 617 | Ga0495654_0071960 | 3300046530 | Bacteria | 1637 |
| 618 | Ga0495654_0082557 | 3300046530 | Bacteria | 1503 |
| 619 | Ga0495654_0132533 | 3300046530 | Bacteria | 1117 |
| 620 | Ga0495654_0138278 | 3300046530 | Bacteria | 1087 |
| 621 | Ga0495654_0147741 | 3300046530 | Bacteria | 1042 |
| 622 | Ga0495587_0179050 | 3300046536 | Bacteria | 1203 |
| 623 | Ga0495609_0000006 | 3300046538 | Bacteria | 431833 |
| 624 | Ga0495609_0002066 | 3300046538 | Bacteria | 12632 |
| 625 | Ga0495609_0005135 | 3300046538 | Bacteria | 6971 |
| 626 | Ga0495609_0007206 | 3300046538 | Bacteria | 5579 |
| 627 | Ga0495609_0009658 | 3300046538 | Bacteria | 4657 |
| 628 | Ga0495609_0012540 | 3300046538 | Bacteria | 4019 |
| 629 | Ga0495609_0043508 | 3300046538 | Bacteria | 2016 |
| 630 | Ga0495609_0070601 | 3300046538 | Bacteria | 1535 |
| 631 | Ga0495609_0074787 | 3300046538 | Bacteria | 1485 |
| 632 | Ga0495609_0089456 | 3300046538 | Bacteria | 1339 |
| 633 | Ga0495609_0134389 | 3300046538 | Bacteria | 1058 |
| 634 | Ga0495597_0000040 | 3300046542 | Bacteria | 112292 |
| 635 | Ga0495597_0003943 | 3300046542 | Bacteria | 8356 |
| 636 | Ga0495597_0009538 | 3300046542 | Bacteria | 4788 |
| 637 | Ga0495597_0011500 | 3300046542 | Bacteria | 4290 |
| 638 | Ga0495597_0032025 | 3300046542 | Bacteria | 2388 |
| 639 | Ga0495597_0065409 | 3300046542 | Bacteria | 1577 |
| 640 | Ga0495597_0069953 | 3300046542 | Bacteria | 1513 |
| 641 | Ga0495597_0120904 | 3300046542 | Bacteria | 1091 |
| 642 | Ga0495645_0109363 | 3300046543 | Bacteria | 1957 |
| 643 | Ga0495622_0003985 | 3300046557 | Bacteria | 6896 |
| 644 | Ga0495622_0004251 | 3300046557 | Bacteria | 6669 |
| 645 | Ga0495622_0005610 | 3300046557 | Bacteria | 5819 |
| 646 | Ga0495622_0016700 | 3300046557 | Bacteria | 3418 |
| 647 | Ga0495622_0017856 | 3300046557 | Bacteria | 3303 |
| 648 | Ga0495633_0006725 | 3300046558 | Bacteria | 6768 |
| 649 | Ga0495633_0008551 | 3300046558 | Bacteria | 5752 |
| 650 | Ga0495633_0025968 | 3300046558 | Bacteria | 2879 |
| 651 | Ga0495633_0146239 | 3300046558 | Bacteria | 1092 |
| 652 | Ga0495656_0001597 | 3300046615 | Bacteria | 7418 |
| 653 | Ga0495668_0004807 | 3300046616 | Bacteria | 9403 |
| 654 | Ga0495668_0012445 | 3300046616 | Bacteria | 5044 |
| 655 | Ga0495668_0070223 | 3300046616 | Bacteria | 1925 |
| 656 | Ga0495668_0070744 | 3300046616 | Bacteria | 1918 |
| 657 | Ga0495668_0114402 | 3300046616 | Bacteria | 1475 |
| 658 | Ga0495668_0162727 | 3300046616 | Bacteria | 1222 |
| 659 | Ga0495634_0004434 | 3300046642 | Bacteria | 11024 |
| 660 | Ga0495634_0084811 | 3300046642 | Bacteria | 2065 |
| 661 | Ga0495611_0000445 | 3300046648 | Bacteria | 25121 |
| 662 | Ga0495611_0007433 | 3300046648 | Bacteria | 4653 |
| 663 | Ga0495611_0168607 | 3300046648 | Bacteria | 1023 |
| 664 | Ga0495625_0000686 | 3300046660 | Bacteria | 48243 |
| 665 | Ga0495625_0018919 | 3300046660 | Bacteria | 5360 |
| 666 | Ga0495625_0029183 | 3300046660 | Bacteria | 4128 |
| 667 | Ga0495625_0036373 | 3300046660 | Bacteria | 3619 |
| 668 | Ga0495625_0040193 | 3300046660 | Bacteria | 3413 |
| 669 | Ga0495625_0078211 | 3300046660 | Bacteria | 2309 |
| 670 | Ga0495625_0096250 | 3300046660 | Bacteria | 2039 |
| 671 | Ga0495635_0005516 | 3300046663 | Bacteria | 8798 |
| 672 | Ga0495635_0088686 | 3300046663 | Bacteria | 2116 |
| 673 | Ga0495659_0003358 | 3300046664 | Bacteria | 5129 |
| 674 | Ga0495659_0004687 | 3300046664 | Bacteria | 4303 |
| 675 | Ga0495661_0000375 | 3300046665 | Bacteria | 48246 |
| 676 | Ga0495661_0000829 | 3300046665 | Bacteria | 28983 |
| 677 | Ga0495661_0001555 | 3300046665 | Bacteria | 18931 |
| 678 | Ga0495661_0002086 | 3300046665 | Bacteria | 15691 |
| 679 | Ga0495661_0008016 | 3300046665 | Bacteria | 7333 |
| 680 | Ga0495661_0018000 | 3300046665 | Bacteria | 4654 |
| 681 | Ga0495661_0027113 | 3300046665 | Bacteria | 3680 |
| 682 | Ga0495661_0034184 | 3300046665 | Bacteria | 3199 |
| 683 | Ga0495661_0057432 | 3300046665 | Bacteria | 2323 |
| 684 | Ga0495661_0063408 | 3300046665 | Bacteria | 2184 |
| 685 | Ga0495623_0010871 | 3300046679 | Bacteria | 5892 |
| 686 | Ga0495646_0010699 | 3300046680 | Bacteria | 5828 |
| 687 | Ga0495646_0012871 | 3300046680 | Bacteria | 5318 |
| 688 | Ga0495646_0052860 | 3300046680 | Bacteria | 2451 |
| 689 | Ga0495669_0009785 | 3300046684 | Bacteria | 4048 |
| 690 | Ga0495669_0140456 | 3300046684 | Bacteria | 1140 |
| 691 | Ga0495613_0055943 | 3300046689 | Bacteria | 2897 |
| 692 | Ga0495613_0088730 | 3300046689 | Bacteria | 2240 |
| 693 | Ga0495624_0014907 | 3300046690 | Bacteria | 5263 |
| 694 | Ga0495670_0001017 | 3300046691 | Bacteria | 13618 |
| 695 | Ga0495670_0002675 | 3300046691 | Bacteria | 8791 |
| 696 | Ga0495670_0002719 | 3300046691 | Bacteria | 8735 |
| 697 | Ga0495670_0006814 | 3300046691 | Bacteria | 5624 |
| 698 | Ga0495670_0016045 | 3300046691 | Bacteria | 3682 |
| 699 | Ga0495670_0031041 | 3300046691 | Bacteria | 2654 |
| 700 | Ga0495670_0062195 | 3300046691 | Bacteria | 1878 |
| 701 | Ga0495670_0176976 | 3300046691 | Bacteria | 1125 |
| 702 | Ga0495671_0002995 | 3300046692 | Bacteria | 10491 |
| 703 | Ga0495671_0003359 | 3300046692 | Bacteria | 9874 |
| 704 | Ga0495671_0007107 | 3300046692 | Bacteria | 6411 |
| 705 | Ga0495671_0012256 | 3300046692 | Bacteria | 4687 |
| 706 | Ga0495671_0016592 | 3300046692 | Bacteria | 3929 |
| 707 | Ga0495671_0018208 | 3300046692 | Bacteria | 3729 |
| 708 | Ga0495671_0023317 | 3300046692 | Bacteria | 3232 |
| 709 | Ga0495671_0025967 | 3300046692 | Bacteria | 3040 |
| 710 | Ga0495671_0028705 | 3300046692 | Bacteria | 2862 |
| 711 | Ga0495671_0130686 | 3300046692 | Bacteria | 1224 |
| 712 | Ga0495671_0135755 | 3300046692 | Bacteria | 1199 |
| 713 | Ga0495671_0163757 | 3300046692 | Bacteria | 1081 |
| 714 | Ga0495649_0000827 | 3300046694 | Bacteria | 24883 |
| 715 | Ga0495649_0002637 | 3300046694 | Bacteria | 12504 |
| 716 | Ga0495649_0004030 | 3300046694 | Bacteria | 9674 |
| 717 | Ga0495649_0004206 | 3300046694 | Bacteria | 9441 |
| 718 | Ga0495649_0007929 | 3300046694 | Bacteria | 6423 |
| 719 | Ga0495649_0012476 | 3300046694 | Bacteria | 4939 |
| 720 | Ga0495649_0013788 | 3300046694 | Bacteria | 4652 |
| 721 | Ga0495649_0015519 | 3300046694 | Bacteria | 4334 |
| 722 | Ga0495649_0018024 | 3300046694 | Bacteria | 3977 |
| 723 | Ga0495649_0026928 | 3300046694 | Bacteria | 3192 |
| 724 | Ga0495649_0030433 | 3300046694 | Bacteria | 2981 |
| 725 | Ga0495649_0034859 | 3300046694 | Bacteria | 2768 |
| 726 | Ga0495649_0052426 | 3300046694 | Bacteria | 2210 |
| 727 | Ga0495649_0053433 | 3300046694 | Bacteria | 2186 |
| 728 | Ga0495649_0056139 | 3300046694 | Bacteria | 2126 |
| 729 | Ga0495649_0180209 | 3300046694 | Bacteria | 1102 |
| 730 | Ga0495589_0001824 | 3300046794 | Bacteria | 12113 |
| 731 | Ga0495589_0002361 | 3300046794 | Bacteria | 10592 |
| 732 | Ga0495589_0003025 | 3300046794 | Bacteria | 9244 |
| 733 | Ga0495589_0009091 | 3300046794 | Bacteria | 5164 |
| 734 | Ga0495589_0009871 | 3300046794 | Bacteria | 4959 |
| 735 | Ga0495589_0060296 | 3300046794 | Bacteria | 1863 |
| 736 | Ga0495589_0066295 | 3300046794 | Bacteria | 1768 |
| 737 | Ga0495589_0084202 | 3300046794 | Bacteria | 1546 |
| 738 | Ga0495600_0017597 | 3300046809 | Bacteria | 4548 |
| 739 | Ga0495600_0078682 | 3300046809 | Bacteria | 2153 |
| 740 | Ga0495660_0000240 | 3300046810 | Bacteria | 53422 |
| 741 | Ga0495660_0010992 | 3300046810 | Bacteria | 5258 |
| 742 | Ga0495660_0014751 | 3300046810 | Bacteria | 4519 |
| 743 | Ga0495660_0019195 | 3300046810 | Bacteria | 3925 |
| 744 | Ga0495660_0028169 | 3300046810 | Bacteria | 3175 |
| 745 | Ga0495660_0035325 | 3300046810 | Bacteria | 2793 |
| 746 | Ga0495660_0035857 | 3300046810 | Bacteria | 2768 |
| 747 | Ga0495660_0040889 | 3300046810 | Bacteria | 2568 |
| 748 | Ga0495660_0042103 | 3300046810 | Bacteria | 2524 |
| 749 | Ga0495660_0043384 | 3300046810 | Bacteria | 2481 |
| 750 | Ga0495660_0045486 | 3300046810 | Bacteria | 2409 |
| 751 | Ga0495660_0058603 | 3300046810 | Bacteria | 2073 |
| 752 | Ga0495660_0084554 | 3300046810 | Bacteria | 1659 |
| 753 | Ga0495660_0089758 | 3300046810 | Bacteria | 1599 |
| 754 | Ga0495660_0097766 | 3300046810 | Bacteria | 1515 |
| 755 | Ga0495660_0118040 | 3300046810 | Bacteria | 1345 |
| 756 | Ga0495660_0148601 | 3300046810 | Bacteria | 1159 |
| 757 | Ga0495581_0200656 | 3300047315 | Bacteria | 1167 |
| 758 | Ga0495604_0019032 | 3300047317 | Bacteria | 5499 |
| 759 | Ga0495604_0020740 | 3300047317 | Bacteria | 5247 |
| 760 | Ga0495674_0303162 | 3300047319 | Bacteria | 1304 |
| 761 | Ga0495672_0005569 | 3300047320 | Bacteria | 9957 |
| 762 | Ga0495672_0007545 | 3300047320 | Bacteria | 8162 |
| 763 | Ga0495672_0008196 | 3300047320 | Bacteria | 7750 |
| 764 | Ga0495672_0008550 | 3300047320 | Bacteria | 7535 |
| 765 | Ga0495672_0011941 | 3300047320 | Bacteria | 6090 |
| 766 | Ga0495672_0015153 | 3300047320 | Bacteria | 5247 |
| 767 | Ga0495672_0019377 | 3300047320 | Bacteria | 4489 |
| 768 | Ga0495672_0019644 | 3300047320 | Bacteria | 4453 |
| 769 | Ga0495672_0019838 | 3300047320 | Bacteria | 4422 |
| 770 | Ga0495672_0020024 | 3300047320 | Bacteria | 4395 |
| 771 | Ga0495672_0023464 | 3300047320 | Bacteria | 3992 |
| 772 | Ga0495672_0024533 | 3300047320 | Bacteria | 3882 |
| 773 | Ga0495672_0065510 | 3300047320 | Bacteria | 2076 |
| 774 | Ga0495672_0084182 | 3300047320 | Bacteria | 1764 |
| 775 | Ga0495672_0110864 | 3300047320 | Bacteria | 1473 |
| 776 | Ga0495676_0000222 | 3300047321 | Bacteria | 45631 |
| 777 | Ga0495676_0075715 | 3300047321 | Bacteria | 2572 |
| 778 | Ga0495676_0099702 | 3300047321 | Bacteria | 2152 |
| 779 | Ga0495680_0008104 | 3300047322 | Bacteria | 9575 |
| 780 | Ga0495680_0046759 | 3300047322 | Bacteria | 3409 |
| 781 | Ga0495680_0177043 | 3300047322 | Bacteria | 1541 |
| 782 | Ga0495680_0344125 | 3300047322 | Bacteria | 1039 |
| 783 | Ga0495683_0002710 | 3300047323 | Bacteria | 10560 |
| 784 | Ga0495683_0003356 | 3300047323 | Bacteria | 9358 |
| 785 | Ga0495683_0013203 | 3300047323 | Bacteria | 4325 |
| 786 | Ga0495683_0013853 | 3300047323 | Bacteria | 4207 |
| 787 | Ga0495683_0016296 | 3300047323 | Bacteria | 3860 |
| 788 | Ga0495683_0040567 | 3300047323 | Bacteria | 2351 |
| 789 | Ga0495687_007131 | 3300047443 | Bacteria | 6663 |
| 790 | Ga0495687_010197 | 3300047443 | Bacteria | 5169 |
| 791 | Ga0495687_027735 | 3300047443 | Bacteria | 2645 |
| 792 | Ga0495675_0013933 | 3300047444 | Bacteria | 5084 |
| 793 | Ga0495677_0007690 | 3300047445 | Bacteria | 4021 |
| 794 | Ga0495679_004383 | 3300047446 | Bacteria | 6534 |
| 795 | Ga0495679_006006 | 3300047446 | Bacteria | 5305 |
| 796 | Ga0495679_006417 | 3300047446 | Bacteria | 5064 |
| 797 | Ga0495679_007031 | 3300047446 | Bacteria | 4755 |
| 798 | Ga0495679_008849 | 3300047446 | Bacteria | 4063 |
| 799 | Ga0495679_017253 | 3300047446 | Bacteria | 2587 |
| 800 | Ga0495679_017586 | 3300047446 | Bacteria | 2557 |
| 801 | Ga0495673_0002441 | 3300047469 | Bacteria | 13093 |
| 802 | Ga0495673_0003472 | 3300047469 | Bacteria | 10370 |
| 803 | Ga0495673_0005327 | 3300047469 | Bacteria | 7804 |
| 804 | Ga0495673_0005781 | 3300047469 | Bacteria | 7408 |
| 805 | Ga0495673_0006416 | 3300047469 | Bacteria | 6916 |
| 806 | Ga0495673_0006941 | 3300047469 | Bacteria | 6594 |
| 807 | Ga0495673_0008018 | 3300047469 | Bacteria | 5985 |
| 808 | Ga0495673_0011839 | 3300047469 | Bacteria | 4661 |
| 809 | Ga0495673_0020645 | 3300047469 | Bacteria | 3276 |
| 810 | Ga0495673_0023144 | 3300047469 | Bacteria | 3029 |
| 811 | Ga0495673_0025236 | 3300047469 | Bacteria | 2857 |
| 812 | Ga0495673_0040591 | 3300047469 | Bacteria | 2101 |
| 813 | Ga0495673_0045333 | 3300047469 | Bacteria | 1955 |
| 814 | Ga0495673_0081634 | 3300047469 | Bacteria | 1338 |
| 815 | Ga0495673_0082858 | 3300047469 | Bacteria | 1325 |
| 816 | Ga0495681_0000762 | 3300047470 | Bacteria | 24824 |
| 817 | Ga0495681_0001492 | 3300047470 | Bacteria | 17484 |
| 818 | Ga0495681_0005311 | 3300047470 | Bacteria | 8643 |
| 819 | Ga0495681_0007723 | 3300047470 | Bacteria | 6820 |
| 820 | Ga0495681_0008379 | 3300047470 | Bacteria | 6487 |
| 821 | Ga0495681_0009356 | 3300047470 | Bacteria | 6045 |
| 822 | Ga0495681_0011422 | 3300047470 | Bacteria | 5289 |
| 823 | Ga0495681_0014993 | 3300047470 | Bacteria | 4408 |
| 824 | Ga0495681_0029940 | 3300047470 | Bacteria | 2779 |
| 825 | Ga0495681_0036180 | 3300047470 | Bacteria | 2444 |
| 826 | Ga0495681_0058080 | 3300047470 | Bacteria | 1794 |
| 827 | Ga0495681_0136921 | 3300047470 | Bacteria | 1037 |
| 828 | Ga0495684_0146057 | 3300047471 | Bacteria | 1771 |
| 829 | Ga0495686_0006823 | 3300047472 | Bacteria | 8660 |
| 830 | Ga0495686_0021995 | 3300047472 | Bacteria | 4223 |
| 831 | Ga0495686_0030736 | 3300047472 | Bacteria | 3486 |
| 832 | Ga0495686_0085400 | 3300047472 | Bacteria | 1922 |
| 833 | Ga0495686_0092459 | 3300047472 | Bacteria | 1834 |
| 834 | Ga0495593_0027293 | 3300047673 | Bacteria | 3143 |
| 835 | Ga0495602_0044318 | 3300048088 | Bacteria | 4036 |
| 836 | Ga0495626_0000912 | 3300048091 | Bacteria | 25915 |
| 837 | Ga0495626_0001329 | 3300048091 | Bacteria | 20047 |
| 838 | Ga0495626_0002633 | 3300048091 | Bacteria | 12204 |
| 839 | Ga0495626_0004026 | 3300048091 | Bacteria | 9160 |
| 840 | Ga0495626_0004635 | 3300048091 | Bacteria | 8357 |
| 841 | Ga0495626_0004953 | 3300048091 | Bacteria | 7987 |
| 842 | Ga0495626_0010127 | 3300048091 | Bacteria | 5057 |
| 843 | Ga0495626_0032624 | 3300048091 | Bacteria | 2499 |
| 844 | Ga0495626_0058680 | 3300048091 | Bacteria | 1757 |
| 845 | Ga0495626_0078320 | 3300048091 | Bacteria | 1472 |
| 846 | Ga0495626_0136372 | 3300048091 | Bacteria | 1043 |
| 847 | Ga0496102_0001186 | 3300048905 | Bacteria | 23689 |
| 848 | Ga0496103_0017077 | 3300048906 | Bacteria | 4339 |
| 849 | Ga0496110_0034103 | 3300048913 | Bacteria | 4407 |
| 850 | Ga0496110_0248534 | 3300048913 | Bacteria | 1619 |
| 851 | Ga0496110_0314329 | 3300048913 | Bacteria | 1426 |
| 852 | Ga0496112_0344035 | 3300048915 | Bacteria | 1434 |
| 853 | Ga0496112_0502950 | 3300048915 | Bacteria | 1147 |
| 854 | Ga0496116_0001251 | 3300048919 | Bacteria | 29495 |
| 855 | Ga0496116_0001286 | 3300048919 | Bacteria | 28876 |
| 856 | Ga0496116_0014906 | 3300048919 | Bacteria | 6172 |
| 857 | Ga0496116_0026599 | 3300048919 | Bacteria | 4227 |
| 858 | Ga0496116_0029406 | 3300048919 | Bacteria | 3962 |
| 859 | Ga0496116_0071203 | 3300048919 | Bacteria | 2202 |
| 860 | Ga0496116_0132555 | 3300048919 | Bacteria | 1417 |
| 861 | Ga0496117_0001478 | 3300048920 | Bacteria | 33728 |
| 862 | Ga0496117_0007829 | 3300048920 | Bacteria | 10281 |
| 863 | Ga0496117_0008263 | 3300048920 | Bacteria | 9912 |
| 864 | Ga0496117_0014270 | 3300048920 | Bacteria | 6855 |
| 865 | Ga0496117_0041468 | 3300048920 | Bacteria | 3372 |
| 866 | Ga0496117_0074046 | 3300048920 | Bacteria | 2269 |
| 867 | Ga0496117_0083595 | 3300048920 | Bacteria | 2086 |
| 868 | Ga0496117_0146187 | 3300048920 | Bacteria | 1407 |
| 869 | Ga0496117_0230430 | 3300048920 | Bacteria | 1024 |
| 870 | Ga0496118_0010210 | 3300048921 | Bacteria | 9323 |
| 871 | Ga0496118_0014312 | 3300048921 | Bacteria | 7438 |
| 872 | Ga0496118_0076077 | 3300048921 | Bacteria | 2389 |
| 873 | Ga0496118_0081141 | 3300048921 | Bacteria | 2278 |
| 874 | Ga0496118_0108771 | 3300048921 | Bacteria | 1847 |
| 875 | Ga0496118_0109579 | 3300048921 | Bacteria | 1837 |
| 876 | Ga0496119_0033252 | 3300048922 | Bacteria | 3422 |
| 877 | Ga0496119_0037107 | 3300048922 | Bacteria | 3170 |
| 878 | Ga0496119_0144003 | 3300048922 | Bacteria | 1284 |
| 879 | Ga0496120_0058811 | 3300048923 | Bacteria | 2157 |
| 880 | Ga0496121_0003226 | 3300048924 | Bacteria | 23459 |
| 881 | Ga0496121_0014222 | 3300048924 | Bacteria | 8464 |
| 882 | Ga0496121_0029574 | 3300048924 | Bacteria | 5061 |
| 883 | Ga0496121_0031430 | 3300048924 | Bacteria | 4850 |
| 884 | Ga0496121_0035177 | 3300048924 | Bacteria | 4493 |
| 885 | Ga0496121_0066698 | 3300048924 | Bacteria | 2920 |
| 886 | Ga0496121_0094464 | 3300048924 | Bacteria | 2326 |
| 887 | Ga0496121_0106329 | 3300048924 | Bacteria | 2151 |
| 888 | Ga0496121_0157443 | 3300048924 | Bacteria | 1665 |
| 889 | Ga0496122_0000750 | 3300048925 | Bacteria | 63240 |
| 890 | Ga0496122_0015024 | 3300048925 | Bacteria | 7435 |
| 891 | Ga0496122_0036813 | 3300048925 | Bacteria | 3949 |
| 892 | Ga0496122_0046641 | 3300048925 | Bacteria | 3353 |
| 893 | Ga0496122_0104384 | 3300048925 | Bacteria | 1883 |
| 894 | Ga0496122_0259751 | 3300048925 | Bacteria | 965 |
| 895 | Ga0496123_0002466 | 3300048926 | Bacteria | 22888 |
| 896 | Ga0496123_0006350 | 3300048926 | Bacteria | 11475 |
| 897 | Ga0496123_0056288 | 3300048926 | Bacteria | 2571 |
| 898 | Ga0496123_0068118 | 3300048926 | Bacteria | 2243 |
| 899 | Ga0496123_0136290 | 3300048926 | Bacteria | 1350 |
| 900 | Ga0496124_0001993 | 3300048927 | Bacteria | 27810 |
| 901 | Ga0496124_0002028 | 3300048927 | Bacteria | 27547 |
| 902 | Ga0496124_0009462 | 3300048927 | Bacteria | 10033 |
| 903 | Ga0496124_0018695 | 3300048927 | Bacteria | 6482 |
| 904 | Ga0496124_0019452 | 3300048927 | Bacteria | 6318 |
| 905 | Ga0496124_0023597 | 3300048927 | Bacteria | 5613 |
| 906 | Ga0496124_0024971 | 3300048927 | Bacteria | 5420 |
| 907 | Ga0496124_0028730 | 3300048927 | Bacteria | 4969 |
| 908 | Ga0496124_0032109 | 3300048927 | Bacteria | 4642 |
| 909 | Ga0496124_0035773 | 3300048927 | Bacteria | 4341 |
| 910 | Ga0496124_0053505 | 3300048927 | Bacteria | 3421 |
| 911 | Ga0496124_0374387 | 3300048927 | Bacteria | 998 |
| 912 | Ga0496125_0009616 | 3300048928 | Bacteria | 9887 |
| 913 | Ga0496125_0028811 | 3300048928 | Bacteria | 5004 |
| 914 | Ga0496125_0030238 | 3300048928 | Bacteria | 4848 |
| 915 | Ga0496125_0035744 | 3300048928 | Bacteria | 4351 |
| 916 | Ga0496125_0067834 | 3300048928 | Bacteria | 2808 |
| 917 | Ga0496125_0110319 | 3300048928 | Bacteria | 1995 |
| 918 | Ga0496126_0023091 | 3300048929 | Bacteria | 6030 |
| 919 | Ga0496126_0074611 | 3300048929 | Bacteria | 3011 |
| 920 | Ga0496126_0106491 | 3300048929 | Bacteria | 2447 |
| 921 | Ga0495678_001841 | 3300049459 | Bacteria | 15528 |
| 922 | Ga0495678_002222 | 3300049459 | Bacteria | 13580 |
| 923 | Ga0495678_002897 | 3300049459 | Bacteria | 11050 |
| 924 | Ga0495678_004142 | 3300049459 | Bacteria | 8564 |
| 925 | Ga0495678_004588 | 3300049459 | Bacteria | 7944 |
| 926 | Ga0495678_005691 | 3300049459 | Bacteria | 6784 |
| 927 | Ga0495678_005950 | 3300049459 | Bacteria | 6594 |
| 928 | Ga0495678_009174 | 3300049459 | Bacteria | 4922 |
| 929 | Ga0495678_016662 | 3300049459 | Bacteria | 3352 |
| 930 | Ga0495678_025348 | 3300049459 | Bacteria | 2548 |
| 931 | Ga0495678_032044 | 3300049459 | Bacteria | 2184 |
| 932 | Ga0495678_053855 | 3300049459 | Bacteria | 1542 |
| 933 | Ga0495678_078503 | 3300049459 | Bacteria | 1191 |
| 934 | Ga0495682_0000426 | 3300049460 | Bacteria | 29534 |
| 935 | Ga0495682_0000616 | 3300049460 | Bacteria | 23944 |
| 936 | Ga0495682_0002905 | 3300049460 | Bacteria | 7863 |
| 937 | Ga0495682_0054116 | 3300049460 | Bacteria | 1457 |
| 938 | Ga0501032_0005995 | 3300049569 | Bacteria | 8969 |
| 939 | Ga0501037_0108012 | 3300049573 | Bacteria | 2005 |
| 940 | Ga0501241_005745 | 3300049758 | Bacteria | 2303 |
| 941 | nmdc:mga03683_115596_c1 | 3300050489 | Bacteria | 1190 |
| 942 | nmdc:mga00v17_36991_c1 | 3300050491 | Bacteria | 2912 |
| 943 | nmdc:mga00v17_67392_c1 | 3300050491 | Bacteria | 2211 |
| 944 | nmdc:mga0sz30_139275_c1 | 3300050516 | Bacteria | 1071 |
| 945 | nmdc:mga0sz30_16174_c1 | 3300050516 | Bacteria | 2957 |
| 946 | Ga0500572_001316 | 3300053111 | Bacteria | 6921 |
| 947 | Ga0500573_0143169 | 3300053140 | Bacteria | 1315 |
| 948 | Ga0500634_0031621 | 3300053161 | Bacteria | 2887 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042009 | Ga0439451_051178 | Ga0439451_051178_17_784 | 254 |
| 2 | 3300048924 | Ga0496121_0094464 | Ga0496121_0094464_31_879 | 281 |
| 3 | 3300046492 | Ga0495585_0019119 | Ga0495585_0019119_27_875 | 282 |
| 4 | 3300048927 | Ga0496124_0374387 | Ga0496124_0374387_45_893 | 282 |
| 5 | 3300046616 | Ga0495668_0070744 | Ga0495668_0070744_707_1561 | 283 |
| 6 | 3300046810 | Ga0495660_0000240 | Ga0495660_0000240_14566_15420 | 283 |
| 7 | 3300047320 | Ga0495672_0110864 | Ga0495672_0110864_485_1339 | 283 |
| 8 | iso_pu_bacteria | 2912963787 | 2912964935 | 283 |
| 9 | 3300013308 | Ga0157375_10437742 | Ga0157375_104377421 | 285 |
| 10 | 3300046492 | Ga0495585_0014945 | Ga0495585_0014945_805_1698 | 285 |
| 11 | 3300046512 | Ga0495610_0120654 | Ga0495610_0120654_274_1131 | 285 |
| 12 | 3300046665 | Ga0495661_0001555 | Ga0495661_0001555_3223_4116 | 285 |
| 13 | 3300009148 | Ga0105243_10078692 | Ga0105243_100786923 | 286 |
| 14 | 3300046694 | Ga0495649_0000827 | Ga0495649_0000827_2755_3657 | 286 |
| 15 | 3300047319 | Ga0495674_0303162 | Ga0495674_0303162_29_889 | 286 |
| 16 | 3300041404 | Ga0439436_0001968 | Ga0439436_0001968_1025_1906 | 287 |
| 17 | 3300041405 | Ga0439438_001751 | Ga0439438_001751_5267_6148 | 287 |
| 18 | 3300041407 | Ga0439447_001710 | Ga0439447_001710_3243_4124 | 287 |
| 19 | 3300041411 | Ga0439466_0001747 | Ga0439466_0001747_3314_4195 | 287 |
| 20 | 3300042006 | Ga0439432_002819 | Ga0439432_002819_1444_2325 | 287 |
| 21 | 3300042156 | Ga0439446_0012156 | Ga0439446_0012156_743_1624 | 287 |
| 22 | 3300046463 | Ga0495653_0005407 | Ga0495653_0005407_7879_8757 | 287 |
| 23 | 3300046507 | Ga0495606_0002865 | Ga0495606_0002865_1675_2553 | 287 |
| 24 | 3300046529 | Ga0495652_0267608 | Ga0495652_0267608_91_957 | 287 |
| 25 | 3300048913 | Ga0496110_0314329 | Ga0496110_0314329_158_1021 | 287 |
| 26 | 3300049459 | Ga0495678_002897 | Ga0495678_002897_1666_2544 | 287 |
| 27 | 3300049569 | Ga0501032_0005995 | Ga0501032_0005995_1179_2060 | 287 |
| 28 | 3300049573 | Ga0501037_0108012 | Ga0501037_0108012_907_1788 | 287 |
| 29 | 3300046501 | Ga0495607_0000682 | Ga0495607_0000682_4238_5146 | 288 |
| 30 | iso_pu_bacteria | 2811994881 | 2812368358 | 288 |
| 31 | iso_pu_bacteria | 2923519811 | 2923522413 | 288 |
| 32 | 3300005289 | Ga0065704_10076135 | Ga0065704_100761351 | 289 |
| 33 | 3300009036 | Ga0105244_10019308 | Ga0105244_100193083 | 289 |
| 34 | 3300009148 | Ga0105243_10184199 | Ga0105243_101841992 | 289 |
| 35 | 3300046515 | Ga0495620_0000003 | Ga0495620_0000003_116898_117767 | 289 |
| 36 | 3300046519 | Ga0495632_0000368 | Ga0495632_0000368_3829_4698 | 289 |
| 37 | 3300046522 | Ga0495643_0001490 | Ga0495643_0001490_17923_18792 | 289 |
| 38 | 3300046524 | Ga0495648_0001580 | Ga0495648_0001580_17504_18373 | 289 |
| 39 | 3300048913 | Ga0496110_0248534 | Ga0496110_0248534_357_1226 | 289 |
| 40 | 3300048919 | Ga0496116_0029406 | Ga0496116_0029406_603_1472 | 289 |
| 41 | 3300048920 | Ga0496117_0001478 | Ga0496117_0001478_3723_4592 | 289 |
| 42 | 3300048920 | Ga0496117_0008263 | Ga0496117_0008263_2863_3732 | 289 |
| 43 | 3300048921 | Ga0496118_0010210 | Ga0496118_0010210_2859_3728 | 289 |
| 44 | 3300048922 | Ga0496119_0144003 | Ga0496119_0144003_321_1190 | 289 |
| 45 | 3300048927 | Ga0496124_0019452 | Ga0496124_0019452_1903_2772 | 289 |
| 46 | 3300048927 | Ga0496124_0032109 | Ga0496124_0032109_1345_2214 | 289 |
| 47 | 3300048929 | Ga0496126_0106491 | Ga0496126_0106491_1414_2283 | 289 |
| 48 | 3300009011 | Ga0105251_10024748 | Ga0105251_100247482 | 290 |
| 49 | 3300009036 | Ga0105244_10046236 | Ga0105244_100462362 | 290 |
| 50 | 3300025728 | Ga0207655_1062492 | Ga0207655_10624921 | 290 |
| 51 | 3300025735 | Ga0207713_1035227 | Ga0207713_10352272 | 290 |
| 52 | 3300042010 | Ga0439452_001300 | Ga0439452_001300_6534_7448 | 290 |
| 53 | 3300046474 | Ga0495605_0008292 | Ga0495605_0008292_4589_5503 | 290 |
| 54 | 3300046491 | Ga0495584_0011307 | Ga0495584_0011307_3195_4109 | 290 |
| 55 | 3300046519 | Ga0495632_0003894 | Ga0495632_0003894_3031_3945 | 290 |
| 56 | 3300046522 | Ga0495643_0115631 | Ga0495643_0115631_71_985 | 290 |
| 57 | 3300046524 | Ga0495648_0084387 | Ga0495648_0084387_110_1024 | 290 |
| 58 | 3300046538 | Ga0495609_0002066 | Ga0495609_0002066_352_1266 | 290 |
| 59 | 3300046542 | Ga0495597_0011500 | Ga0495597_0011500_3002_3916 | 290 |
| 60 | 3300046694 | Ga0495649_0002637 | Ga0495649_0002637_3213_4127 | 290 |
| 61 | 3300047443 | Ga0495687_027735 | Ga0495687_027735_108_1058 | 290 |
| 62 | 3300049459 | Ga0495678_004588 | Ga0495678_004588_5802_6716 | 290 |
| 63 | iso_pu_bacteria | 2600254954 | 2600447025 | 290 |
| 64 | iso_pu_bacteria | 8054503363 | 8054504758 | 290 |
| 65 | iso_pu_bacteria | 8056131705 | 8056133121 | 290 |
| 66 | 3300041411 | Ga0439466_0020529 | Ga0439466_0020529_328_1230 | 291 |
| 67 | 3300042439 | Ga0439464_0012958 | Ga0439464_0012958_942_1841 | 291 |
| 68 | 3300013102 | Ga0157371_10000329 | Ga0157371_1000032928 | 292 |
| 69 | 3300046474 | Ga0495605_0000543 | Ga0495605_0000543_3856_4746 | 292 |
| 70 | 3300046530 | Ga0495654_0132533 | Ga0495654_0132533_131_1021 | 292 |
| 71 | iso_pu_bacteria | 2599185155 | 2599328418 | 292 |
| 72 | 3300046457 | Ga0495590_0043029 | Ga0495590_0043029_101_1006 | 293 |
| 73 | 3300046474 | Ga0495605_0164407 | Ga0495605_0164407_77_967 | 293 |
| 74 | 3300046507 | Ga0495606_0000518 | Ga0495606_0000518_20728_21612 | 293 |
| 75 | 3300046694 | Ga0495649_0004030 | Ga0495649_0004030_3311_4195 | 293 |
| 76 | iso_pu_bacteria | 2554235132 | 2554813603 | 293 |
| 77 | iso_pu_bacteria | 2606217733 | 2608381225 | 293 |
| 78 | iso_pu_bacteria | 2738543020 | 2739286467 | 293 |
| 79 | iso_pu_bacteria | 2738543021 | 2739291780 | 293 |
| 80 | iso_pu_bacteria | 2823421272 | 2823422583 | 293 |
| 81 | 3300005331 | Ga0070670_100011171 | Ga0070670_1000111718 | 294 |
| 82 | 3300025925 | Ga0207650_10000337 | Ga0207650_1000033713 | 294 |
| 83 | 3300046453 | Ga0495627_000386 | Ga0495627_000386_36310_37230 | 294 |
| 84 | 3300046471 | Ga0495650_0021060 | Ga0495650_0021060_88_1008 | 294 |
| 85 | 3300046518 | Ga0495631_0007648 | Ga0495631_0007648_710_1630 | 294 |
| 86 | 3300046519 | Ga0495632_0009948 | Ga0495632_0009948_1632_2552 | 294 |
| 87 | 3300046519 | Ga0495632_0015321 | Ga0495632_0015321_471_1391 | 294 |
| 88 | 3300046530 | Ga0495654_0008733 | Ga0495654_0008733_523_1443 | 294 |
| 89 | 3300046692 | Ga0495671_0003359 | Ga0495671_0003359_3143_4063 | 294 |
| 90 | 3300047469 | Ga0495673_0082858 | Ga0495673_0082858_12_920 | 294 |
| 91 | 3300048927 | Ga0496124_0035773 | Ga0496124_0035773_253_1170 | 294 |
| 92 | iso_pu_bacteria | 2826581358 | 2826584180 | 294 |
| 93 | iso_pu_bacteria | 2842815866 | 2842820946 | 294 |
| 94 | iso_pu_bacteria | 2842849001 | 2842849644 | 294 |
| 95 | iso_pu_bacteria | 8055878733 | 8055883907 | 294 |
| 96 | 3300003781 | Ga0055536_1005665 | Ga0055536_10056653 | 295 |
| 97 | 3300013102 | Ga0157371_10016205 | Ga0157371_100162056 | 295 |
| 98 | 3300013104 | Ga0157370_10084574 | Ga0157370_100845743 | 295 |
| 99 | 3300025292 | Ga0209676_1000524 | Ga0209676_100052415 | 295 |
| 100 | 3300042013 | Ga0439456_000074 | Ga0439456_000074_695_1618 | 295 |
| 101 | 3300046501 | Ga0495607_0000549 | Ga0495607_0000549_4456_5418 | 295 |
| 102 | 3300046536 | Ga0495587_0179050 | Ga0495587_0179050_127_1050 | 295 |
| 103 | 3300046542 | Ga0495597_0065409 | Ga0495597_0065409_285_1208 | 295 |
| 104 | 3300047469 | Ga0495673_0006941 | Ga0495673_0006941_4917_5855 | 295 |
| 105 | 3300049459 | Ga0495678_002222 | Ga0495678_002222_9495_10382 | 295 |
| 106 | 3300049460 | Ga0495682_0000616 | Ga0495682_0000616_20052_20975 | 295 |
| 107 | iso_pu_bacteria | 2619619299 | 2621301371 | 295 |
| 108 | iso_pu_bacteria | 2919456309 | 2919458227 | 295 |
| 109 | iso_pu_bacteria | 2939651529 | 2939653294 | 295 |
| 110 | 3300009011 | Ga0105251_10000061 | Ga0105251_1000006193 | 296 |
| 111 | 3300009036 | Ga0105244_10000272 | Ga0105244_1000027231 | 296 |
| 112 | 3300009092 | Ga0105250_10000299 | Ga0105250_100002996 | 296 |
| 113 | 3300025711 | Ga0207696_1000034 | Ga0207696_1000034239 | 296 |
| 114 | 3300025728 | Ga0207655_1006185 | Ga0207655_10061856 | 296 |
| 115 | 3300025735 | Ga0207713_1000014 | Ga0207713_1000014194 | 296 |
| 116 | 3300048927 | Ga0496124_0053505 | Ga0496124_0053505_2101_3021 | 296 |
| 117 | iso_pu_bacteria | 2597489888 | 2597862483 | 296 |
| 118 | iso_pu_bacteria | 2597489889 | 2597868259 | 296 |
| 119 | iso_pu_bacteria | 2599185167 | 2599396919 | 296 |
| 120 | iso_pu_bacteria | 2599185179 | 2599448897 | 296 |
| 121 | iso_pu_bacteria | 2599185189 | 2599508968 | 296 |
| 122 | iso_pu_bacteria | 2599185190 | 2599511344 | 296 |
| 123 | iso_pu_bacteria | 2599185191 | 2599517716 | 296 |
| 124 | iso_pu_bacteria | 2599185288 | 2599879802 | 296 |
| 125 | iso_pu_bacteria | 2599185290 | 2599890718 | 296 |
| 126 | iso_pu_bacteria | 2599185303 | 2599948309 | 296 |
| 127 | iso_pu_bacteria | 2600255296 | 2601691080 | 296 |
| 128 | iso_pu_bacteria | 2643221571 | 2643873291 | 296 |
| 129 | iso_pu_bacteria | 2643221713 | 2644624163 | 296 |
| 130 | iso_pu_bacteria | 2675903420 | 2677897641 | 296 |
| 131 | iso_pu_bacteria | 2721755607 | 2723247375 | 296 |
| 132 | iso_pu_bacteria | 2738541265 | 2738673855 | 296 |
| 133 | iso_pu_bacteria | 2738541282 | 2738752248 | 296 |
| 134 | iso_pu_bacteria | 2738541294 | 2738809264 | 296 |
| 135 | iso_pu_bacteria | 2738541303 | 2738861289 | 296 |
| 136 | iso_pu_bacteria | 2738541309 | 2738896624 | 296 |
| 137 | iso_pu_bacteria | 2808606385 | 2808975410 | 296 |
| 138 | iso_pu_bacteria | 2808606388 | 2808990951 | 296 |
| 139 | iso_pu_bacteria | 2816332298 | 2817489261 | 296 |
| 140 | iso_pu_bacteria | 2834028612 | 2834029168 | 296 |
| 141 | iso_pu_bacteria | 2842805378 | 2842808836 | 296 |
| 142 | iso_pu_bacteria | 2842826826 | 2842828872 | 296 |
| 143 | iso_pu_bacteria | 2842837860 | 2842842603 | 296 |
| 144 | iso_pu_bacteria | 2852612431 | 2852615354 | 296 |
| 145 | iso_pu_bacteria | 2852667396 | 2852670322 | 296 |
| 146 | iso_pu_bacteria | 2860867994 | 2860869221 | 296 |
| 147 | iso_pu_bacteria | 2908446538 | 2908448075 | 296 |
| 148 | iso_pu_bacteria | 2929189879 | 2929191177 | 296 |
| 149 | iso_pu_bacteria | 2931390751 | 2931392181 | 296 |
| 150 | iso_pu_bacteria | 2945928738 | 2945929394 | 296 |
| 151 | iso_pu_bacteria | 2945961074 | 2945961429 | 296 |
| 152 | iso_pu_bacteria | 2946006987 | 2946011665 | 296 |
| 153 | iso_pu_bacteria | 2946027586 | 2946029419 | 296 |
| 154 | iso_pu_bacteria | 2947233263 | 2947236007 | 296 |
| 155 | iso_pu_bacteria | 3007872151 | 3007872853 | 296 |
| 156 | iso_pu_bacteria | 8054285046 | 8054285794 | 296 |
| 157 | iso_pu_bacteria | 8054347763 | 8054348387 | 296 |
| 158 | iso_pu_bacteria | 8055817908 | 8055819201 | 296 |
| 159 | iso_pu_bacteria | 8056148874 | 8056149301 | 296 |
| 160 | iso_pu_bacteria | 8056161164 | 8056166712 | 296 |
| 161 | 3300003781 | Ga0055536_1000454 | Ga0055536_100045422 | 297 |
| 162 | 3300003791 | Ga0055530_10001302 | Ga0055530_100013026 | 297 |
| 163 | 3300003792 | Ga0055540_1000385 | Ga0055540_100038520 | 297 |
| 164 | 3300003794 | Ga0055531_10001143 | Ga0055531_100011436 | 297 |
| 165 | 3300003794 | Ga0055531_10001439 | Ga0055531_1000143917 | 297 |
| 166 | 3300046522 | Ga0495643_0000116 | Ga0495643_0000116_37570_38466 | 297 |
| 167 | 3300046558 | Ga0495633_0146239 | Ga0495633_0146239_110_1006 | 297 |
| 168 | 3300046660 | Ga0495625_0078211 | Ga0495625_0078211_344_1240 | 297 |
| 169 | 3300046692 | Ga0495671_0007107 | Ga0495671_0007107_1162_2058 | 297 |
| 170 | 3300048927 | Ga0496124_0002028 | Ga0496124_0002028_23430_24338 | 297 |
| 171 | iso_pu_bacteria | 2511231011 | 2511295554 | 297 |
| 172 | iso_pu_bacteria | 2511231023 | 2511367222 | 297 |
| 173 | iso_pu_bacteria | 2511231031 | 2511411054 | 297 |
| 174 | iso_pu_bacteria | 2511231156 | 2511823084 | 297 |
| 175 | iso_pu_bacteria | 2599185188 | 2599501186 | 297 |
| 176 | iso_pu_bacteria | 2599185212 | 2599613849 | 297 |
| 177 | iso_pu_bacteria | 2599185248 | 2599770739 | 297 |
| 178 | iso_pu_bacteria | 2599185289 | 2599886617 | 297 |
| 179 | iso_pu_bacteria | 2599185291 | 2599896986 | 297 |
| 180 | iso_pu_bacteria | 2599185300 | 2599934090 | 297 |
| 181 | iso_pu_bacteria | 2599185302 | 2599942990 | 297 |
| 182 | iso_pu_bacteria | 2599185304 | 2599953971 | 297 |
| 183 | iso_pu_bacteria | 2599185305 | 2599959483 | 297 |
| 184 | iso_pu_bacteria | 2599185306 | 2599966271 | 297 |
| 185 | iso_pu_bacteria | 2599185308 | 2599978114 | 297 |
| 186 | iso_pu_bacteria | 2599185309 | 2599985286 | 297 |
| 187 | iso_pu_bacteria | 2599185310 | 2599987210 | 297 |
| 188 | iso_pu_bacteria | 2599185311 | 2599995482 | 297 |
| 189 | iso_pu_bacteria | 2599185312 | 2599999961 | 297 |
| 190 | iso_pu_bacteria | 2599185313 | 2600008778 | 297 |
| 191 | iso_pu_bacteria | 2599185314 | 2600012416 | 297 |
| 192 | iso_pu_bacteria | 2599185315 | 2600016678 | 297 |
| 193 | iso_pu_bacteria | 2599185316 | 2600024909 | 297 |
| 194 | iso_pu_bacteria | 2599185317 | 2600029643 | 297 |
| 195 | iso_pu_bacteria | 2599185318 | 2600035465 | 297 |
| 196 | iso_pu_bacteria | 2599185319 | 2600041312 | 297 |
| 197 | iso_pu_bacteria | 2599185320 | 2600045536 | 297 |
| 198 | iso_pu_bacteria | 2599185321 | 2600056524 | 297 |
| 199 | iso_pu_bacteria | 2599185322 | 2600058440 | 297 |
| 200 | iso_pu_bacteria | 2599185323 | 2600063889 | 297 |
| 201 | iso_pu_bacteria | 2599185324 | 2600074816 | 297 |
| 202 | iso_pu_bacteria | 2599185325 | 2600079493 | 297 |
| 203 | iso_pu_bacteria | 2600254930 | 2600358321 | 297 |
| 204 | iso_pu_bacteria | 2643221650 | 2644281535 | 297 |
| 205 | iso_pu_bacteria | 2651869719 | 2652546814 | 297 |
| 206 | iso_pu_bacteria | 2667528170 | 2671094515 | 297 |
| 207 | iso_pu_bacteria | 2667528176 | 2671127872 | 297 |
| 208 | iso_pu_bacteria | 2675903515 | 2678261616 | 297 |
| 209 | iso_pu_bacteria | 2713897148 | 2715752799 | 297 |
| 210 | iso_pu_bacteria | 2738543025 | 2739312841 | 297 |
| 211 | iso_pu_bacteria | 2744054620 | 2745007965 | 297 |
| 212 | iso_pu_bacteria | 2773857673 | 2774136639 | 297 |
| 213 | iso_pu_bacteria | 2784132063 | 2784260394 | 297 |
| 214 | iso_pu_bacteria | 2791355520 | 2794594407 | 297 |
| 215 | iso_pu_bacteria | 2808606361 | 2808854129 | 297 |
| 216 | iso_pu_bacteria | 2808606376 | 2808923420 | 297 |
| 217 | iso_pu_bacteria | 2808606378 | 2808934161 | 297 |
| 218 | iso_pu_bacteria | 2808606380 | 2808945305 | 297 |
| 219 | iso_pu_bacteria | 2808606383 | 2808962438 | 297 |
| 220 | iso_pu_bacteria | 2808606389 | 2808997521 | 297 |
| 221 | iso_pu_bacteria | 2818991456 | 2819658437 | 297 |
| 222 | iso_pu_bacteria | 2825651385 | 2825653661 | 297 |
| 223 | iso_pu_bacteria | 2842832357 | 2842835646 | 297 |
| 224 | iso_pu_bacteria | 2842843487 | 2842847388 | 297 |
| 225 | iso_pu_bacteria | 2842854478 | 2842857217 | 297 |
| 226 | iso_pu_bacteria | 2852657418 | 2852662748 | 297 |
| 227 | iso_pu_bacteria | 2880230671 | 2880231762 | 297 |
| 228 | iso_pu_bacteria | 2904518522 | 2904520797 | 297 |
| 229 | iso_pu_bacteria | 2913036834 | 2913037955 | 297 |
| 230 | iso_pu_bacteria | 2919385768 | 2919385892 | 297 |
| 231 | iso_pu_bacteria | 2919481497 | 2919482864 | 297 |
| 232 | iso_pu_bacteria | 2919487758 | 2919490678 | 297 |
| 233 | iso_pu_bacteria | 2923586266 | 2923590920 | 297 |
| 234 | iso_pu_bacteria | 2929144301 | 2929145410 | 297 |
| 235 | iso_pu_bacteria | 2931369376 | 2931371252 | 297 |
| 236 | iso_pu_bacteria | 2969304461 | 2969305669 | 297 |
| 237 | iso_pu_bacteria | 2974289157 | 2974292704 | 297 |
| 238 | iso_pu_bacteria | 2988728565 | 2988732950 | 297 |
| 239 | iso_pu_bacteria | 2998139840 | 2998141108 | 297 |
| 240 | iso_pu_bacteria | 3007614139 | 3007614191 | 297 |
| 241 | iso_pu_bacteria | 3007718800 | 3007721472 | 297 |
| 242 | iso_pu_bacteria | 3007855910 | 3007860541 | 297 |
| 243 | iso_pu_bacteria | 3007861166 | 3007863670 | 297 |
| 244 | iso_pu_bacteria | 3007866637 | 3007871304 | 297 |
| 245 | iso_pu_bacteria | 8029995093 | 8029999654 | 297 |
| 246 | iso_pu_bacteria | 8056143049 | 8056147874 | 297 |
| 247 | iso_pu_bacteria | 8056166840 | 8056169945 | 297 |
| 248 | iso_pu_bacteria | 8056569372 | 8056569759 | 297 |
| 249 | 3300005290 | Ga0065712_10068159 | Ga0065712_100681596 | 298 |
| 250 | 3300046501 | Ga0495607_0091416 | Ga0495607_0091416_245_1165 | 298 |
| 251 | 3300046520 | Ga0495637_0001255 | Ga0495637_0001255_10634_11554 | 298 |
| 252 | 3300047320 | Ga0495672_0019644 | Ga0495672_0019644_1926_2843 | 298 |
| 253 | 3300047469 | Ga0495673_0002441 | Ga0495673_0002441_10573_11493 | 298 |
| 254 | 3300049459 | Ga0495678_001841 | Ga0495678_001841_3616_4536 | 298 |
| 255 | 3300005288 | Ga0065714_10009092 | Ga0065714_100090922 | 299 |
| 256 | 3300017792 | Ga0163161_10126610 | Ga0163161_101266102 | 299 |
| 257 | 3300041405 | Ga0439438_018677 | Ga0439438_018677_382_1296 | 299 |
| 258 | 3300041407 | Ga0439447_001121 | Ga0439447_001121_5795_6709 | 299 |
| 259 | 3300042009 | Ga0439451_021862 | Ga0439451_021862_145_1059 | 299 |
| 260 | 3300042146 | Ga0450907_000197 | Ga0450907_000197_20395_21309 | 299 |
| 261 | 3300042156 | Ga0439446_0014964 | Ga0439446_0014964_638_1552 | 299 |
| 262 | 3300042435 | Ga0439434_0041343 | Ga0439434_0041343_35_949 | 299 |
| 263 | 3300042993 | Ga0439440_0010195 | Ga0439440_0010195_638_1552 | 299 |
| 264 | 3300046453 | Ga0495627_000074 | Ga0495627_000074_78547_79485 | 299 |
| 265 | 3300046458 | Ga0495591_046310 | Ga0495591_046310_131_1033 | 299 |
| 266 | 3300046460 | Ga0495638_0021218 | Ga0495638_0021218_3285_4196 | 299 |
| 267 | 3300046501 | Ga0495607_0000721 | Ga0495607_0000721_30460_31383 | 299 |
| 268 | 3300046501 | Ga0495607_0114745 | Ga0495607_0114745_260_1222 | 299 |
| 269 | 3300046512 | Ga0495610_0050035 | Ga0495610_0050035_1005_1907 | 299 |
| 270 | 3300046520 | Ga0495637_0045825 | Ga0495637_0045825_424_1416 | 299 |
| 271 | 3300046522 | Ga0495643_0008981 | Ga0495643_0008981_431_1333 | 299 |
| 272 | 3300046524 | Ga0495648_0067596 | Ga0495648_0067596_100_1002 | 299 |
| 273 | 3300046542 | Ga0495597_0000040 | Ga0495597_0000040_34188_35099 | 299 |
| 274 | 3300046665 | Ga0495661_0034184 | Ga0495661_0034184_721_1623 | 299 |
| 275 | 3300046810 | Ga0495660_0040889 | Ga0495660_0040889_1256_2167 | 299 |
| 276 | 3300047320 | Ga0495672_0084182 | Ga0495672_0084182_527_1441 | 299 |
| 277 | 3300047446 | Ga0495679_006417 | Ga0495679_006417_1465_2367 | 299 |
| 278 | 3300053140 | Ga0500573_0143169 | Ga0500573_0143169_270_1208 | 299 |
| 279 | 3300053161 | Ga0500634_0031621 | Ga0500634_0031621_1553_2455 | 299 |
| 280 | iso_pu_bacteria | 3007419365 | 3007420744 | 299 |
| 281 | 3300002738 | JGI25154J39366_1003627 | JGI25154J39366_10036275 | 300 |
| 282 | 3300003751 | Ga0055538_1000073 | Ga0055538_100007387 | 300 |
| 283 | 3300003752 | Ga0055539_1000109 | Ga0055539_100010987 | 300 |
| 284 | 3300003756 | Ga0055533_1000117 | Ga0055533_100011787 | 300 |
| 285 | 3300003758 | Ga0055532_1000120 | Ga0055532_100012036 | 300 |
| 286 | 3300003759 | Ga0055525_1000156 | Ga0055525_100015687 | 300 |
| 287 | 3300003761 | Ga0055535_1005421 | Ga0055535_10054215 | 300 |
| 288 | 3300003841 | Ga0055541_1000074 | Ga0055541_100007487 | 300 |
| 289 | 3300005288 | Ga0065714_10003823 | Ga0065714_100038239 | 300 |
| 290 | 3300005290 | Ga0065712_10071669 | Ga0065712_100716693 | 300 |
| 291 | 3300005331 | Ga0070670_100000780 | Ga0070670_1000007802 | 300 |
| 292 | 3300005344 | Ga0070661_100000514 | Ga0070661_10000051423 | 300 |
| 293 | 3300005353 | Ga0070669_100004365 | Ga0070669_1000043656 | 300 |
| 294 | 3300005457 | Ga0070662_100000301 | Ga0070662_10000030122 | 300 |
| 295 | 3300005539 | Ga0068853_100006538 | Ga0068853_1000065388 | 300 |
| 296 | 3300005564 | Ga0070664_100000130 | Ga0070664_10000013042 | 300 |
| 297 | 3300005578 | Ga0068854_100003695 | Ga0068854_1000036955 | 300 |
| 298 | 3300005834 | Ga0068851_10000037 | Ga0068851_1000003768 | 300 |
| 299 | 3300009011 | Ga0105251_10003445 | Ga0105251_1000344512 | 300 |
| 300 | 3300009011 | Ga0105251_10004028 | Ga0105251_1000402811 | 300 |
| 301 | 3300009011 | Ga0105251_10029477 | Ga0105251_100294772 | 300 |
| 302 | 3300009036 | Ga0105244_10003044 | Ga0105244_100030448 | 300 |
| 303 | 3300009036 | Ga0105244_10007527 | Ga0105244_100075274 | 300 |
| 304 | 3300009092 | Ga0105250_10000332 | Ga0105250_100003326 | 300 |
| 305 | 3300009176 | Ga0105242_10000367 | Ga0105242_1000036714 | 300 |
| 306 | 3300009177 | Ga0105248_10134319 | Ga0105248_101343195 | 300 |
| 307 | 3300009545 | Ga0105237_10000196 | Ga0105237_1000019621 | 300 |
| 308 | 3300011119 | Ga0105246_10002077 | Ga0105246_100020775 | 300 |
| 309 | 3300011119 | Ga0105246_10005375 | Ga0105246_100053756 | 300 |
| 310 | 3300013100 | Ga0157373_10033665 | Ga0157373_100336654 | 300 |
| 311 | 3300013100 | Ga0157373_10033815 | Ga0157373_100338156 | 300 |
| 312 | 3300013100 | Ga0157373_10057708 | Ga0157373_100577084 | 300 |
| 313 | 3300013100 | Ga0157373_10169447 | Ga0157373_101694473 | 300 |
| 314 | 3300013104 | Ga0157370_10000846 | Ga0157370_1000084613 | 300 |
| 315 | 3300013105 | Ga0157369_10017783 | Ga0157369_100177835 | 300 |
| 316 | 3300013105 | Ga0157369_10079337 | Ga0157369_100793372 | 300 |
| 317 | 3300013306 | Ga0163162_10097608 | Ga0163162_100976082 | 300 |
| 318 | 3300013308 | Ga0157375_10023768 | Ga0157375_100237685 | 300 |
| 319 | 3300014497 | Ga0182008_10021905 | Ga0182008_100219056 | 300 |
| 320 | 3300015261 | Ga0182006_1000640 | Ga0182006_100064024 | 300 |
| 321 | 3300015262 | Ga0182007_10057056 | Ga0182007_100570561 | 300 |
| 322 | 3300017792 | Ga0163161_10013993 | Ga0163161_100139935 | 300 |
| 323 | 3300017792 | Ga0163161_10021713 | Ga0163161_100217136 | 300 |
| 324 | 3300017792 | Ga0163161_10036807 | Ga0163161_100368072 | 300 |
| 325 | 3300017792 | Ga0163161_10053950 | Ga0163161_100539505 | 300 |
| 326 | 3300025206 | Ga0209435_100487 | Ga0209435_1004873 | 300 |
| 327 | 3300025224 | Ga0209784_100015 | Ga0209784_100015119 | 300 |
| 328 | 3300025225 | Ga0209566_100012 | Ga0209566_100012119 | 300 |
| 329 | 3300025226 | Ga0209674_100027 | Ga0209674_100027119 | 300 |
| 330 | 3300025229 | Ga0209147_100019 | Ga0209147_100019119 | 300 |
| 331 | 3300025230 | Ga0209563_100031 | Ga0209563_100031119 | 300 |
| 332 | 3300025242 | Ga0209258_100296 | Ga0209258_1002965 | 300 |
| 333 | 3300025246 | Ga0209646_1000292 | Ga0209646_100029212 | 300 |
| 334 | 3300025253 | Ga0209677_100016 | Ga0209677_100016119 | 300 |
| 335 | 3300025256 | Ga0209759_1004305 | Ga0209759_10043058 | 300 |
| 336 | 3300025321 | Ga0207656_10000014 | Ga0207656_1000001439 | 300 |
| 337 | 3300025711 | Ga0207696_1000293 | Ga0207696_100029317 | 300 |
| 338 | 3300025728 | Ga0207655_1002284 | Ga0207655_10022846 | 300 |
| 339 | 3300025728 | Ga0207655_1025950 | Ga0207655_10259502 | 300 |
| 340 | 3300025735 | Ga0207713_1000493 | Ga0207713_10004936 | 300 |
| 341 | 3300025735 | Ga0207713_1000696 | Ga0207713_10006964 | 300 |
| 342 | 3300025735 | Ga0207713_1030419 | Ga0207713_10304192 | 300 |
| 343 | 3300025914 | Ga0207671_10000019 | Ga0207671_10000019239 | 300 |
| 344 | 3300025920 | Ga0207649_10000002 | Ga0207649_10000002428 | 300 |
| 345 | 3300025923 | Ga0207681_10002090 | Ga0207681_100020906 | 300 |
| 346 | 3300025925 | Ga0207650_10000421 | Ga0207650_100004217 | 300 |
| 347 | 3300025933 | Ga0207706_10000136 | Ga0207706_1000013633 | 300 |
| 348 | 3300025934 | Ga0207686_10005889 | Ga0207686_100058895 | 300 |
| 349 | 3300025941 | Ga0207711_10209994 | Ga0207711_102099942 | 300 |
| 350 | 3300025945 | Ga0207679_10000006 | Ga0207679_1000000663 | 300 |
| 351 | 3300026041 | Ga0207639_10004918 | Ga0207639_100049188 | 300 |
| 352 | 3300028379 | Ga0268266_10083646 | Ga0268266_100836463 | 300 |
| 353 | 3300031731 | Ga0307405_10000600 | Ga0307405_100006004 | 300 |
| 354 | 3300041453 | Ga0451797_1241239 | Ga0451797_1241239_183_1088 | 300 |
| 355 | 3300042006 | Ga0439432_000131 | Ga0439432_000131_3078_3983 | 300 |
| 356 | 3300046453 | Ga0495627_001977 | Ga0495627_001977_5832_6737 | 300 |
| 357 | 3300046458 | Ga0495591_002596 | Ga0495591_002596_3195_4100 | 300 |
| 358 | 3300046506 | Ga0495583_0001463 | Ga0495583_0001463_19665_20570 | 300 |
| 359 | 3300046507 | Ga0495606_0016021 | Ga0495606_0016021_1662_2567 | 300 |
| 360 | 3300046507 | Ga0495606_0113824 | Ga0495606_0113824_572_1477 | 300 |
| 361 | 3300046512 | Ga0495610_0026056 | Ga0495610_0026056_2078_2983 | 300 |
| 362 | 3300046512 | Ga0495610_0054490 | Ga0495610_0054490_116_1021 | 300 |
| 363 | 3300046519 | Ga0495632_0006908 | Ga0495632_0006908_1344_2249 | 300 |
| 364 | 3300046530 | Ga0495654_0000816 | Ga0495654_0000816_3218_4123 | 300 |
| 365 | 3300046530 | Ga0495654_0027634 | Ga0495654_0027634_1924_2829 | 300 |
| 366 | 3300046665 | Ga0495661_0002086 | Ga0495661_0002086_10800_11705 | 300 |
| 367 | 3300046794 | Ga0495589_0003025 | Ga0495589_0003025_703_1647 | 300 |
| 368 | 3300046810 | Ga0495660_0035857 | Ga0495660_0035857_238_1143 | 300 |
| 369 | 3300047446 | Ga0495679_007031 | Ga0495679_007031_312_1217 | 300 |
| 370 | 3300047446 | Ga0495679_017586 | Ga0495679_017586_1126_2070 | 300 |
| 371 | 3300047470 | Ga0495681_0058080 | Ga0495681_0058080_606_1511 | 300 |
| 372 | 3300048920 | Ga0496117_0007829 | Ga0496117_0007829_6231_7136 | 300 |
| 373 | 3300048920 | Ga0496117_0041468 | Ga0496117_0041468_2445_3350 | 300 |
| 374 | 3300048921 | Ga0496118_0076077 | Ga0496118_0076077_123_1028 | 300 |
| 375 | 3300048922 | Ga0496119_0037107 | Ga0496119_0037107_37_942 | 300 |
| 376 | 3300048924 | Ga0496121_0066698 | Ga0496121_0066698_219_1124 | 300 |
| 377 | 3300048925 | Ga0496122_0046641 | Ga0496122_0046641_807_1712 | 300 |
| 378 | 3300048925 | Ga0496122_0259751 | Ga0496122_0259751_17_922 | 300 |
| 379 | 3300048926 | Ga0496123_0068118 | Ga0496123_0068118_1215_2120 | 300 |
| 380 | 3300048927 | Ga0496124_0009462 | Ga0496124_0009462_3141_4046 | 300 |
| 381 | 3300048927 | Ga0496124_0024971 | Ga0496124_0024971_1952_2857 | 300 |
| 382 | 3300048928 | Ga0496125_0009616 | Ga0496125_0009616_5844_6749 | 300 |
| 383 | 3300048928 | Ga0496125_0028811 | Ga0496125_0028811_2385_3290 | 300 |
| 384 | 3300048928 | Ga0496125_0030238 | Ga0496125_0030238_2665_3570 | 300 |
| 385 | 3300048928 | Ga0496125_0035744 | Ga0496125_0035744_45_950 | 300 |
| 386 | 3300048928 | Ga0496125_0067834 | Ga0496125_0067834_89_994 | 300 |
| 387 | 3300048929 | Ga0496126_0023091 | Ga0496126_0023091_4817_5722 | 300 |
| 388 | 3300048929 | Ga0496126_0074611 | Ga0496126_0074611_221_1126 | 300 |
| 389 | iso_pu_bacteria | 2511231006 | 2511266689 | 300 |
| 390 | iso_pu_bacteria | 2511231007 | 2511273208 | 300 |
| 391 | iso_pu_bacteria | 2511231008 | 2511280009 | 300 |
| 392 | iso_pu_bacteria | 2511231010 | 2511290025 | 300 |
| 393 | iso_pu_bacteria | 2511231012 | 2511301921 | 300 |
| 394 | iso_pu_bacteria | 2511231014 | 2511316012 | 300 |
| 395 | iso_pu_bacteria | 2511231015 | 2511318881 | 300 |
| 396 | iso_pu_bacteria | 2511231016 | 2511328875 | 300 |
| 397 | iso_pu_bacteria | 2511231017 | 2511333284 | 300 |
| 398 | iso_pu_bacteria | 2511231018 | 2511340980 | 300 |
| 399 | iso_pu_bacteria | 2511231019 | 2511343968 | 300 |
| 400 | iso_pu_bacteria | 2511231020 | 2511351262 | 300 |
| 401 | iso_pu_bacteria | 2511231021 | 2511356273 | 300 |
| 402 | iso_pu_bacteria | 2511231022 | 2511362264 | 300 |
| 403 | iso_pu_bacteria | 2512047018 | 2512328574 | 300 |
| 404 | iso_pu_bacteria | 2582580891 | 2583790541 | 300 |
| 405 | iso_pu_bacteria | 2597489887 | 2597856318 | 300 |
| 406 | iso_pu_bacteria | 2599185185 | 2599483427 | 300 |
| 407 | iso_pu_bacteria | 2599185257 | 2599805333 | 300 |
| 408 | iso_pu_bacteria | 2599185307 | 2599974177 | 300 |
| 409 | iso_pu_bacteria | 2600254931 | 2600364040 | 300 |
| 410 | iso_pu_bacteria | 2600255318 | 2601800134 | 300 |
| 411 | iso_pu_bacteria | 2603880185 | 2606074600 | 300 |
| 412 | iso_pu_bacteria | 2603880199 | 2606127463 | 300 |
| 413 | iso_pu_bacteria | 2623620443 | 2624478887 | 300 |
| 414 | iso_pu_bacteria | 2623620446 | 2624490394 | 300 |
| 415 | iso_pu_bacteria | 2643221565 | 2643845500 | 300 |
| 416 | iso_pu_bacteria | 2643221589 | 2643952212 | 300 |
| 417 | iso_pu_bacteria | 2643221602 | 2644024026 | 300 |
| 418 | iso_pu_bacteria | 2643221633 | 2644189223 | 300 |
| 419 | iso_pu_bacteria | 2671180172 | 2671767932 | 300 |
| 420 | iso_pu_bacteria | 2713897149 | 2715757598 | 300 |
| 421 | iso_pu_bacteria | 2738541271 | 2738689903 | 300 |
| 422 | iso_pu_bacteria | 2738543004 | 2739198460 | 300 |
| 423 | iso_pu_bacteria | 2738543015 | 2739256773 | 300 |
| 424 | iso_pu_bacteria | 2738543016 | 2739265677 | 300 |
| 425 | iso_pu_bacteria | 2740892503 | 2743735726 | 300 |
| 426 | iso_pu_bacteria | 2773857670 | 2774122225 | 300 |
| 427 | iso_pu_bacteria | 2784132072 | 2784317584 | 300 |
| 428 | iso_pu_bacteria | 2808606377 | 2808928697 | 300 |
| 429 | iso_pu_bacteria | 2808606381 | 2808950818 | 300 |
| 430 | iso_pu_bacteria | 2808606382 | 2808956607 | 300 |
| 431 | iso_pu_bacteria | 2808606445 | 2809215824 | 300 |
| 432 | iso_pu_bacteria | 2860339153 | 2860340579 | 300 |
| 433 | iso_pu_bacteria | 2878029506 | 2878030847 | 300 |
| 434 | iso_pu_bacteria | 2904550169 | 2904553745 | 300 |
| 435 | iso_pu_bacteria | 2919063839 | 2919064642 | 300 |
| 436 | iso_pu_bacteria | 2919697872 | 2919703681 | 300 |
| 437 | iso_pu_bacteria | 2923153595 | 2923154735 | 300 |
| 438 | iso_pu_bacteria | 2931396565 | 2931399518 | 300 |
| 439 | iso_pu_bacteria | 2939636861 | 2939637976 | 300 |
| 440 | iso_pu_bacteria | 2984286254 | 2984291296 | 300 |
| 441 | iso_pu_bacteria | 3007395558 | 3007400263 | 300 |
| 442 | iso_pu_bacteria | 3007511990 | 3007512481 | 300 |
| 443 | iso_pu_bacteria | 3007619802 | 3007622470 | 300 |
| 444 | iso_pu_bacteria | 8015687852 | 8015688968 | 300 |
| 445 | iso_pu_bacteria | 8019775933 | 8019781831 | 300 |
| 446 | iso_pu_bacteria | 8055770955 | 8055772086 | 300 |
| 447 | iso_pu_bacteria | 8056125926 | 8056127183 | 300 |
| 448 | iso_pu_bacteria | 8056155041 | 8056159659 | 300 |
| 449 | iso_pu_bacteria | 8056172158 | 8056176071 | 300 |
| 450 | iso_pu_bacteria | 8056177738 | 8056180476 | 300 |
| 451 | 2162886007 | SwRhRL2b_contig_992609 | SwRhRL2b_0743.00003250 | 301 |
| 452 | 3300003791 | Ga0055530_10000176 | Ga0055530_1000017638 | 301 |
| 453 | 3300003792 | Ga0055540_1000193 | Ga0055540_100019338 | 301 |
| 454 | 3300005288 | Ga0065714_10071416 | Ga0065714_100714163 | 301 |
| 455 | 3300005289 | Ga0065704_10083727 | Ga0065704_100837273 | 301 |
| 456 | 3300005548 | Ga0070665_100035692 | Ga0070665_1000356924 | 301 |
| 457 | 3300006051 | Ga0075364_10129193 | Ga0075364_101291932 | 301 |
| 458 | 3300006946 | Ga0079104_1000414 | Ga0079104_100041436 | 301 |
| 459 | 3300006946 | Ga0079104_1008166 | Ga0079104_10081662 | 301 |
| 460 | 3300006948 | Ga0099826_10023577 | Ga0099826_100235774 | 301 |
| 461 | 3300009036 | Ga0105244_10018989 | Ga0105244_100189894 | 301 |
| 462 | 3300009036 | Ga0105244_10027162 | Ga0105244_100271623 | 301 |
| 463 | 3300009036 | Ga0105244_10096103 | Ga0105244_100961031 | 301 |
| 464 | 3300009092 | Ga0105250_10005536 | Ga0105250_100055364 | 301 |
| 465 | 3300009092 | Ga0105250_10009461 | Ga0105250_100094616 | 301 |
| 466 | 3300009148 | Ga0105243_10004177 | Ga0105243_100041775 | 301 |
| 467 | 3300011119 | Ga0105246_10002807 | Ga0105246_100028078 | 301 |
| 468 | 3300012498 | Ga0157345_1000166 | Ga0157345_100016610 | 301 |
| 469 | 3300013100 | Ga0157373_10001582 | Ga0157373_1000158217 | 301 |
| 470 | 3300013100 | Ga0157373_10006202 | Ga0157373_100062022 | 301 |
| 471 | 3300013100 | Ga0157373_10176590 | Ga0157373_101765902 | 301 |
| 472 | 3300013105 | Ga0157369_10015829 | Ga0157369_100158292 | 301 |
| 473 | 3300013306 | Ga0163162_10012886 | Ga0163162_100128868 | 301 |
| 474 | 3300013307 | Ga0157372_10001549 | Ga0157372_100015495 | 301 |
| 475 | 3300014497 | Ga0182008_10005701 | Ga0182008_100057016 | 301 |
| 476 | 3300015261 | Ga0182006_1001009 | Ga0182006_10010092 | 301 |
| 477 | 3300015261 | Ga0182006_1015704 | Ga0182006_10157042 | 301 |
| 478 | 3300015261 | Ga0182006_1030050 | Ga0182006_10300502 | 301 |
| 479 | 3300015261 | Ga0182006_1060721 | Ga0182006_10607212 | 301 |
| 480 | 3300015262 | Ga0182007_10019086 | Ga0182007_100190862 | 301 |
| 481 | 3300015265 | Ga0182005_1028102 | Ga0182005_10281022 | 301 |
| 482 | 3300017792 | Ga0163161_10003732 | Ga0163161_1000373210 | 301 |
| 483 | 3300025292 | Ga0209676_1007863 | Ga0209676_10078636 | 301 |
| 484 | 3300025298 | Ga0209050_1000060 | Ga0209050_100006045 | 301 |
| 485 | 3300025303 | Ga0209051_1000037 | Ga0209051_100003746 | 301 |
| 486 | 3300025304 | Ga0209257_1008780 | Ga0209257_10087802 | 301 |
| 487 | 3300025711 | Ga0207696_1000032 | Ga0207696_1000032224 | 301 |
| 488 | 3300025711 | Ga0207696_1002462 | Ga0207696_10024628 | 301 |
| 489 | 3300025728 | Ga0207655_1002213 | Ga0207655_10022135 | 301 |
| 490 | 3300025728 | Ga0207655_1007329 | Ga0207655_10073294 | 301 |
| 491 | 3300025728 | Ga0207655_1019949 | Ga0207655_10199492 | 301 |
| 492 | 3300025728 | Ga0207655_1049318 | Ga0207655_10493182 | 301 |
| 493 | 3300025933 | Ga0207706_10006583 | Ga0207706_100065832 | 301 |
| 494 | 3300025935 | Ga0207709_10000134 | Ga0207709_1000013444 | 301 |
| 495 | 3300027111 | Ga0209281_1000010 | Ga0209281_1000010193 | 301 |
| 496 | 3300027111 | Ga0209281_1003222 | Ga0209281_10032222 | 301 |
| 497 | 3300027111 | Ga0209281_1008557 | Ga0209281_10085573 | 301 |
| 498 | 3300028379 | Ga0268266_10035410 | Ga0268266_100354102 | 301 |
| 499 | 3300030731 | Ga0316177_1109772 | Ga0316177_11097722 | 301 |
| 500 | 3300030734 | Ga0316179_1049348 | Ga0316179_10493482 | 301 |
| 501 | 3300030735 | Ga0316178_1083052 | Ga0316178_108305217 | 301 |
| 502 | 3300031548 | Ga0307408_100001820 | Ga0307408_1000018205 | 301 |
| 503 | 3300031548 | Ga0307408_100012631 | Ga0307408_1000126314 | 301 |
| 504 | 3300031548 | Ga0307408_100043394 | Ga0307408_1000433941 | 301 |
| 505 | 3300031731 | Ga0307405_10002971 | Ga0307405_100029712 | 301 |
| 506 | 3300031731 | Ga0307405_10149243 | Ga0307405_101492432 | 301 |
| 507 | 3300031824 | Ga0307413_10030392 | Ga0307413_100303922 | 301 |
| 508 | 3300031901 | Ga0307406_10114529 | Ga0307406_101145291 | 301 |
| 509 | 3300031903 | Ga0307407_10086328 | Ga0307407_100863281 | 301 |
| 510 | 3300031911 | Ga0307412_10001424 | Ga0307412_100014243 | 301 |
| 511 | 3300031911 | Ga0307412_10005406 | Ga0307412_100054066 | 301 |
| 512 | 3300031911 | Ga0307412_10005742 | Ga0307412_100057426 | 301 |
| 513 | 3300031911 | Ga0307412_10016716 | Ga0307412_100167164 | 301 |
| 514 | 3300031911 | Ga0307412_10217496 | Ga0307412_102174962 | 301 |
| 515 | 3300031995 | Ga0307409_100044538 | Ga0307409_1000445384 | 301 |
| 516 | 3300032002 | Ga0307416_100204640 | Ga0307416_1002046401 | 301 |
| 517 | 3300032004 | Ga0307414_10108449 | Ga0307414_101084493 | 301 |
| 518 | 3300032005 | Ga0307411_10011937 | Ga0307411_100119375 | 301 |
| 519 | 3300033180 | Ga0307510_10001784 | Ga0307510_1000178422 | 301 |
| 520 | 3300038705 | Ga0237819_01040 | Ga0237819_01040_3926_4831 | 301 |
| 521 | 3300041405 | Ga0439438_005214 | Ga0439438_005214_584_1630 | 301 |
| 522 | 3300041405 | Ga0439438_006476 | Ga0439438_006476_1300_2205 | 301 |
| 523 | 3300041405 | Ga0439438_010012 | Ga0439438_010012_1191_2096 | 301 |
| 524 | 3300041405 | Ga0439438_012538 | Ga0439438_012538_1061_1966 | 301 |
| 525 | 3300041405 | Ga0439438_014142 | Ga0439438_014142_1037_1942 | 301 |
| 526 | 3300041407 | Ga0439447_009508 | Ga0439447_009508_696_1742 | 301 |
| 527 | 3300041407 | Ga0439447_013121 | Ga0439447_013121_565_1470 | 301 |
| 528 | 3300041411 | Ga0439466_0022787 | Ga0439466_0022787_437_1342 | 301 |
| 529 | 3300041411 | Ga0439466_0054574 | Ga0439466_0054574_334_1239 | 301 |
| 530 | 3300042004 | Ga0439445_0011656 | Ga0439445_0011656_217_1122 | 301 |
| 531 | 3300042006 | Ga0439432_006745 | Ga0439432_006745_1187_2092 | 301 |
| 532 | 3300042006 | Ga0439432_006900 | Ga0439432_006900_1160_2206 | 301 |
| 533 | 3300042010 | Ga0439452_000207 | Ga0439452_000207_38569_39474 | 301 |
| 534 | 3300042010 | Ga0439452_003681 | Ga0439452_003681_1192_2238 | 301 |
| 535 | 3300042013 | Ga0439456_013066 | Ga0439456_013066_484_1389 | 301 |
| 536 | 3300042115 | Ga0450911_001690 | Ga0450911_001690_1032_1937 | 301 |
| 537 | 3300042136 | Ga0450900_004396 | Ga0450900_004396_396_1301 | 301 |
| 538 | 3300042145 | Ga0450906_006543 | Ga0450906_006543_1038_1943 | 301 |
| 539 | 3300046452 | Ga0495617_001743 | Ga0495617_001743_5494_6399 | 301 |
| 540 | 3300046452 | Ga0495617_021559 | Ga0495617_021559_299_1204 | 301 |
| 541 | 3300046452 | Ga0495617_053812 | Ga0495617_053812_388_1293 | 301 |
| 542 | 3300046452 | Ga0495617_054210 | Ga0495617_054210_75_980 | 301 |
| 543 | 3300046453 | Ga0495627_000733 | Ga0495627_000733_3175_4080 | 301 |
| 544 | 3300046453 | Ga0495627_007975 | Ga0495627_007975_2095_3000 | 301 |
| 545 | 3300046453 | Ga0495627_013168 | Ga0495627_013168_1559_2464 | 301 |
| 546 | 3300046457 | Ga0495590_0001839 | Ga0495590_0001839_7169_8074 | 301 |
| 547 | 3300046458 | Ga0495591_000581 | Ga0495591_000581_3170_4075 | 301 |
| 548 | 3300046458 | Ga0495591_004699 | Ga0495591_004699_3129_4034 | 301 |
| 549 | 3300046458 | Ga0495591_017008 | Ga0495591_017008_524_1429 | 301 |
| 550 | 3300046458 | Ga0495591_020509 | Ga0495591_020509_595_1500 | 301 |
| 551 | 3300046458 | Ga0495591_044590 | Ga0495591_044590_263_1168 | 301 |
| 552 | 3300046460 | Ga0495638_0114492 | Ga0495638_0114492_409_1314 | 301 |
| 553 | 3300046463 | Ga0495653_0023087 | Ga0495653_0023087_3140_4045 | 301 |
| 554 | 3300046463 | Ga0495653_0154263 | Ga0495653_0154263_282_1187 | 301 |
| 555 | 3300046471 | Ga0495650_0009577 | Ga0495650_0009577_1472_2377 | 301 |
| 556 | 3300046471 | Ga0495650_0053515 | Ga0495650_0053515_591_1496 | 301 |
| 557 | 3300046474 | Ga0495605_0006153 | Ga0495605_0006153_5718_6623 | 301 |
| 558 | 3300046474 | Ga0495605_0092019 | Ga0495605_0092019_85_993 | 301 |
| 559 | 3300046491 | Ga0495584_0012444 | Ga0495584_0012444_108_1013 | 301 |
| 560 | 3300046491 | Ga0495584_0036106 | Ga0495584_0036106_470_1375 | 301 |
| 561 | 3300046492 | Ga0495585_0007614 | Ga0495585_0007614_3213_4118 | 301 |
| 562 | 3300046492 | Ga0495585_0048596 | Ga0495585_0048596_535_1440 | 301 |
| 563 | 3300046492 | Ga0495585_0077685 | Ga0495585_0077685_491_1396 | 301 |
| 564 | 3300046492 | Ga0495585_0170821 | Ga0495585_0170821_136_1041 | 301 |
| 565 | 3300046500 | Ga0495596_0000549 | Ga0495596_0000549_19435_20340 | 301 |
| 566 | 3300046501 | Ga0495607_0001083 | Ga0495607_0001083_20834_21739 | 301 |
| 567 | 3300046501 | Ga0495607_0012868 | Ga0495607_0012868_450_1355 | 301 |
| 568 | 3300046501 | Ga0495607_0068205 | Ga0495607_0068205_604_1509 | 301 |
| 569 | 3300046501 | Ga0495607_0115298 | Ga0495607_0115298_77_982 | 301 |
| 570 | 3300046501 | Ga0495607_0196446 | Ga0495607_0196446_24_929 | 301 |
| 571 | 3300046506 | Ga0495583_0052437 | Ga0495583_0052437_515_1420 | 301 |
| 572 | 3300046507 | Ga0495606_0008750 | Ga0495606_0008750_2344_3249 | 301 |
| 573 | 3300046507 | Ga0495606_0015690 | Ga0495606_0015690_1980_2885 | 301 |
| 574 | 3300046507 | Ga0495606_0022560 | Ga0495606_0022560_987_1892 | 301 |
| 575 | 3300046507 | Ga0495606_0086804 | Ga0495606_0086804_245_1150 | 301 |
| 576 | 3300046507 | Ga0495606_0221558 | Ga0495606_0221558_87_992 | 301 |
| 577 | 3300046512 | Ga0495610_0006641 | Ga0495610_0006641_1506_2411 | 301 |
| 578 | 3300046512 | Ga0495610_0012861 | Ga0495610_0012861_518_1423 | 301 |
| 579 | 3300046512 | Ga0495610_0062865 | Ga0495610_0062865_368_1273 | 301 |
| 580 | 3300046512 | Ga0495610_0103624 | Ga0495610_0103624_258_1163 | 301 |
| 581 | 3300046513 | Ga0495616_0000823 | Ga0495616_0000823_1001_1906 | 301 |
| 582 | 3300046513 | Ga0495616_0007448 | Ga0495616_0007448_2677_3582 | 301 |
| 583 | 3300046513 | Ga0495616_0049557 | Ga0495616_0049557_480_1385 | 301 |
| 584 | 3300046513 | Ga0495616_0065241 | Ga0495616_0065241_457_1362 | 301 |
| 585 | 3300046515 | Ga0495620_0002112 | Ga0495620_0002112_3213_4118 | 301 |
| 586 | 3300046515 | Ga0495620_0013883 | Ga0495620_0013883_3150_4055 | 301 |
| 587 | 3300046515 | Ga0495620_0023069 | Ga0495620_0023069_489_1394 | 301 |
| 588 | 3300046515 | Ga0495620_0038356 | Ga0495620_0038356_465_1370 | 301 |
| 589 | 3300046515 | Ga0495620_0056662 | Ga0495620_0056662_633_1538 | 301 |
| 590 | 3300046518 | Ga0495631_0001514 | Ga0495631_0001514_516_1421 | 301 |
| 591 | 3300046518 | Ga0495631_0004995 | Ga0495631_0004995_2908_3813 | 301 |
| 592 | 3300046518 | Ga0495631_0023437 | Ga0495631_0023437_101_1006 | 301 |
| 593 | 3300046519 | Ga0495632_0001701 | Ga0495632_0001701_13753_14658 | 301 |
| 594 | 3300046519 | Ga0495632_0004016 | Ga0495632_0004016_5844_6749 | 301 |
| 595 | 3300046519 | Ga0495632_0022208 | Ga0495632_0022208_517_1422 | 301 |
| 596 | 3300046519 | Ga0495632_0053322 | Ga0495632_0053322_309_1214 | 301 |
| 597 | 3300046520 | Ga0495637_0005054 | Ga0495637_0005054_3259_4164 | 301 |
| 598 | 3300046520 | Ga0495637_0028969 | Ga0495637_0028969_937_1842 | 301 |
| 599 | 3300046520 | Ga0495637_0030890 | Ga0495637_0030890_468_1412 | 301 |
| 600 | 3300046520 | Ga0495637_0045923 | Ga0495637_0045923_488_1393 | 301 |
| 601 | 3300046522 | Ga0495643_0008320 | Ga0495643_0008320_2152_3057 | 301 |
| 602 | 3300046522 | Ga0495643_0044794 | Ga0495643_0044794_1025_1930 | 301 |
| 603 | 3300046523 | Ga0495644_0004689 | Ga0495644_0004689_1653_2558 | 301 |
| 604 | 3300046524 | Ga0495648_0007222 | Ga0495648_0007222_3032_3937 | 301 |
| 605 | 3300046524 | Ga0495648_0010337 | Ga0495648_0010337_5698_6603 | 301 |
| 606 | 3300046524 | Ga0495648_0019086 | Ga0495648_0019086_1525_2430 | 301 |
| 607 | 3300046524 | Ga0495648_0019892 | Ga0495648_0019892_762_1667 | 301 |
| 608 | 3300046530 | Ga0495654_0001589 | Ga0495654_0001589_2301_3206 | 301 |
| 609 | 3300046530 | Ga0495654_0020951 | Ga0495654_0020951_185_1090 | 301 |
| 610 | 3300046530 | Ga0495654_0071960 | Ga0495654_0071960_130_1035 | 301 |
| 611 | 3300046530 | Ga0495654_0138278 | Ga0495654_0138278_109_1014 | 301 |
| 612 | 3300046538 | Ga0495609_0005135 | Ga0495609_0005135_3263_4168 | 301 |
| 613 | 3300046538 | Ga0495609_0012540 | Ga0495609_0012540_495_1400 | 301 |
| 614 | 3300046538 | Ga0495609_0043508 | Ga0495609_0043508_636_1541 | 301 |
| 615 | 3300046538 | Ga0495609_0089456 | Ga0495609_0089456_364_1269 | 301 |
| 616 | 3300046538 | Ga0495609_0134389 | Ga0495609_0134389_46_951 | 301 |
| 617 | 3300046542 | Ga0495597_0009538 | Ga0495597_0009538_3182_4087 | 301 |
| 618 | 3300046557 | Ga0495622_0005610 | Ga0495622_0005610_4431_5336 | 301 |
| 619 | 3300046558 | Ga0495633_0008551 | Ga0495633_0008551_102_1007 | 301 |
| 620 | 3300046616 | Ga0495668_0004807 | Ga0495668_0004807_5518_6423 | 301 |
| 621 | 3300046616 | Ga0495668_0114402 | Ga0495668_0114402_533_1438 | 301 |
| 622 | 3300046616 | Ga0495668_0162727 | Ga0495668_0162727_280_1185 | 301 |
| 623 | 3300046642 | Ga0495634_0084811 | Ga0495634_0084811_346_1251 | 301 |
| 624 | 3300046648 | Ga0495611_0000445 | Ga0495611_0000445_20791_21696 | 301 |
| 625 | 3300046660 | Ga0495625_0029183 | Ga0495625_0029183_2649_3554 | 301 |
| 626 | 3300046660 | Ga0495625_0036373 | Ga0495625_0036373_233_1138 | 301 |
| 627 | 3300046660 | Ga0495625_0040193 | Ga0495625_0040193_206_1111 | 301 |
| 628 | 3300046665 | Ga0495661_0027113 | Ga0495661_0027113_2298_3203 | 301 |
| 629 | 3300046665 | Ga0495661_0063408 | Ga0495661_0063408_1117_2022 | 301 |
| 630 | 3300046680 | Ga0495646_0052860 | Ga0495646_0052860_959_1864 | 301 |
| 631 | 3300046689 | Ga0495613_0088730 | Ga0495613_0088730_528_1433 | 301 |
| 632 | 3300046690 | Ga0495624_0014907 | Ga0495624_0014907_1048_1953 | 301 |
| 633 | 3300046691 | Ga0495670_0001017 | Ga0495670_0001017_505_1410 | 301 |
| 634 | 3300046692 | Ga0495671_0018208 | Ga0495671_0018208_2677_3582 | 301 |
| 635 | 3300046692 | Ga0495671_0025967 | Ga0495671_0025967_1467_2372 | 301 |
| 636 | 3300046692 | Ga0495671_0130686 | Ga0495671_0130686_74_979 | 301 |
| 637 | 3300046692 | Ga0495671_0163757 | Ga0495671_0163757_74_979 | 301 |
| 638 | 3300046694 | Ga0495649_0004206 | Ga0495649_0004206_6810_7715 | 301 |
| 639 | 3300046694 | Ga0495649_0007929 | Ga0495649_0007929_554_1459 | 301 |
| 640 | 3300046694 | Ga0495649_0015519 | Ga0495649_0015519_439_1344 | 301 |
| 641 | 3300046694 | Ga0495649_0052426 | Ga0495649_0052426_850_1755 | 301 |
| 642 | 3300046694 | Ga0495649_0053433 | Ga0495649_0053433_434_1339 | 301 |
| 643 | 3300046794 | Ga0495589_0001824 | Ga0495589_0001824_10711_11616 | 301 |
| 644 | 3300046794 | Ga0495589_0060296 | Ga0495589_0060296_458_1363 | 301 |
| 645 | 3300046794 | Ga0495589_0066295 | Ga0495589_0066295_65_970 | 301 |
| 646 | 3300046809 | Ga0495600_0078682 | Ga0495600_0078682_831_1736 | 301 |
| 647 | 3300046810 | Ga0495660_0010992 | Ga0495660_0010992_2315_3220 | 301 |
| 648 | 3300046810 | Ga0495660_0014751 | Ga0495660_0014751_3056_3961 | 301 |
| 649 | 3300046810 | Ga0495660_0019195 | Ga0495660_0019195_451_1356 | 301 |
| 650 | 3300046810 | Ga0495660_0028169 | Ga0495660_0028169_245_1150 | 301 |
| 651 | 3300046810 | Ga0495660_0042103 | Ga0495660_0042103_1128_2033 | 301 |
| 652 | 3300046810 | Ga0495660_0045486 | Ga0495660_0045486_491_1396 | 301 |
| 653 | 3300046810 | Ga0495660_0097766 | Ga0495660_0097766_397_1302 | 301 |
| 654 | 3300046810 | Ga0495660_0118040 | Ga0495660_0118040_367_1272 | 301 |
| 655 | 3300047320 | Ga0495672_0015153 | Ga0495672_0015153_3354_4259 | 301 |
| 656 | 3300047320 | Ga0495672_0065510 | Ga0495672_0065510_486_1391 | 301 |
| 657 | 3300047321 | Ga0495676_0075715 | Ga0495676_0075715_591_1496 | 301 |
| 658 | 3300047321 | Ga0495676_0099702 | Ga0495676_0099702_489_1394 | 301 |
| 659 | 3300047322 | Ga0495680_0177043 | Ga0495680_0177043_238_1143 | 301 |
| 660 | 3300047323 | Ga0495683_0016296 | Ga0495683_0016296_642_1547 | 301 |
| 661 | 3300047443 | Ga0495687_007131 | Ga0495687_007131_3039_3956 | 301 |
| 662 | 3300047446 | Ga0495679_004383 | Ga0495679_004383_2654_3559 | 301 |
| 663 | 3300047446 | Ga0495679_017253 | Ga0495679_017253_1208_2113 | 301 |
| 664 | 3300047469 | Ga0495673_0005781 | Ga0495673_0005781_3367_4272 | 301 |
| 665 | 3300047469 | Ga0495673_0020645 | Ga0495673_0020645_2315_3220 | 301 |
| 666 | 3300047469 | Ga0495673_0025236 | Ga0495673_0025236_1473_2378 | 301 |
| 667 | 3300047469 | Ga0495673_0081634 | Ga0495673_0081634_146_1051 | 301 |
| 668 | 3300047470 | Ga0495681_0000762 | Ga0495681_0000762_20798_21703 | 301 |
| 669 | 3300047470 | Ga0495681_0007723 | Ga0495681_0007723_2910_3815 | 301 |
| 670 | 3300047470 | Ga0495681_0014993 | Ga0495681_0014993_364_1269 | 301 |
| 671 | 3300047470 | Ga0495681_0036180 | Ga0495681_0036180_1020_1925 | 301 |
| 672 | 3300047471 | Ga0495684_0146057 | Ga0495684_0146057_301_1206 | 301 |
| 673 | 3300047472 | Ga0495686_0030736 | Ga0495686_0030736_466_1371 | 301 |
| 674 | 3300047472 | Ga0495686_0092459 | Ga0495686_0092459_457_1362 | 301 |
| 675 | 3300048088 | Ga0495602_0044318 | Ga0495602_0044318_943_1848 | 301 |
| 676 | 3300048091 | Ga0495626_0004026 | Ga0495626_0004026_3261_4166 | 301 |
| 677 | 3300048091 | Ga0495626_0004635 | Ga0495626_0004635_3127_4032 | 301 |
| 678 | 3300048091 | Ga0495626_0032624 | Ga0495626_0032624_1468_2373 | 301 |
| 679 | 3300048091 | Ga0495626_0058680 | Ga0495626_0058680_495_1400 | 301 |
| 680 | 3300048091 | Ga0495626_0078320 | Ga0495626_0078320_84_989 | 301 |
| 681 | 3300048919 | Ga0496116_0001251 | Ga0496116_0001251_24146_25051 | 301 |
| 682 | 3300048919 | Ga0496116_0026599 | Ga0496116_0026599_2576_3481 | 301 |
| 683 | 3300048922 | Ga0496119_0033252 | Ga0496119_0033252_1544_2449 | 301 |
| 684 | 3300048923 | Ga0496120_0058811 | Ga0496120_0058811_944_1849 | 301 |
| 685 | 3300048924 | Ga0496121_0031430 | Ga0496121_0031430_3154_4059 | 301 |
| 686 | 3300048926 | Ga0496123_0056288 | Ga0496123_0056288_1569_2474 | 301 |
| 687 | 3300049459 | Ga0495678_009174 | Ga0495678_009174_915_1820 | 301 |
| 688 | 3300049459 | Ga0495678_016662 | Ga0495678_016662_604_1509 | 301 |
| 689 | 3300049459 | Ga0495678_025348 | Ga0495678_025348_1412_2317 | 301 |
| 690 | 3300049459 | Ga0495678_053855 | Ga0495678_053855_95_1000 | 301 |
| 691 | 3300049460 | Ga0495682_0002905 | Ga0495682_0002905_513_1418 | 301 |
| 692 | 3300049758 | Ga0501241_005745 | Ga0501241_005745_456_1361 | 301 |
| 693 | 3300050491 | nmdc:mga00v17_67392_c1 | nmdc:mga00v17_67392_c1_1012_1917 | 301 |
| 694 | 3300053111 | Ga0500572_001316 | Ga0500572_001316_5577_6482 | 301 |
| 695 | iso_pu_bacteria | 2844665904 | 2844668610 | 301 |
| 696 | 3300046471 | Ga0495650_0025032 | Ga0495650_0025032_1533_2450 | 302 |
| 697 | 3300046474 | Ga0495605_0000182 | Ga0495605_0000182_37444_38361 | 302 |
| 698 | 3300046506 | Ga0495583_0001430 | Ga0495583_0001430_3400_4317 | 302 |
| 699 | 3300046506 | Ga0495583_0013261 | Ga0495583_0013261_402_1367 | 302 |
| 700 | 3300046519 | Ga0495632_0001004 | Ga0495632_0001004_3425_4342 | 302 |
| 701 | 3300046538 | Ga0495609_0000006 | Ga0495609_0000006_371400_372353 | 302 |
| 702 | 3300046538 | Ga0495609_0070601 | Ga0495609_0070601_445_1398 | 302 |
| 703 | 3300046543 | Ga0495645_0109363 | Ga0495645_0109363_446_1378 | 302 |
| 704 | 3300046665 | Ga0495661_0000829 | Ga0495661_0000829_24655_25572 | 302 |
| 705 | 3300047469 | Ga0495673_0040591 | Ga0495673_0040591_1003_1956 | 302 |
| 706 | 3300009011 | Ga0105251_10010616 | Ga0105251_100106164 | 303 |
| 707 | 3300009036 | Ga0105244_10011554 | Ga0105244_100115542 | 303 |
| 708 | 3300009148 | Ga0105243_10051884 | Ga0105243_100518844 | 303 |
| 709 | 3300025728 | Ga0207655_1000005 | Ga0207655_1000005315 | 303 |
| 710 | 3300025728 | Ga0207655_1000015 | Ga0207655_1000015404 | 303 |
| 711 | 3300025735 | Ga0207713_1007824 | Ga0207713_10078244 | 303 |
| 712 | 3300046453 | Ga0495627_067837 | Ga0495627_067837_72_983 | 303 |
| 713 | 3300046460 | Ga0495638_0009529 | Ga0495638_0009529_3959_4870 | 303 |
| 714 | 3300046471 | Ga0495650_0078131 | Ga0495650_0078131_21_932 | 303 |
| 715 | 3300046501 | Ga0495607_0015729 | Ga0495607_0015729_565_1500 | 303 |
| 716 | 3300046520 | Ga0495637_0005233 | Ga0495637_0005233_2655_3566 | 303 |
| 717 | 3300046694 | Ga0495649_0018024 | Ga0495649_0018024_61_972 | 303 |
| 718 | 3300047470 | Ga0495681_0009356 | Ga0495681_0009356_502_1413 | 303 |
| 719 | 3300048924 | Ga0496121_0014222 | Ga0496121_0014222_3216_4133 | 303 |
| 720 | 2124908027 | MRS2a_Contig_9445 | MRS2a_00333510 | 304 |
| 721 | 3300002737 | JGI25162J39368_1000103 | JGI25162J39368_100010358 | 304 |
| 722 | 3300002737 | JGI25162J39368_1000318 | JGI25162J39368_100031836 | 304 |
| 723 | 3300002771 | JGI25163J39215_1000809 | JGI25163J39215_10008093 | 304 |
| 724 | 3300002771 | JGI25163J39215_1001291 | JGI25163J39215_10012915 | 304 |
| 725 | 3300002772 | JGI25164J39214_1000082 | JGI25164J39214_100008218 | 304 |
| 726 | 3300002772 | JGI25164J39214_1000227 | JGI25164J39214_100022736 | 304 |
| 727 | 3300003214 | JGI25165J46597_1000185 | JGI25165J46597_100018518 | 304 |
| 728 | 3300003214 | JGI25165J46597_1000423 | JGI25165J46597_100042336 | 304 |
| 729 | 3300003578 | Ga0006562J51391_1043775 | Ga0006562J51391_10437751 | 304 |
| 730 | 3300003781 | Ga0055536_1000331 | Ga0055536_100033128 | 304 |
| 731 | 3300003791 | Ga0055530_10000351 | Ga0055530_1000035117 | 304 |
| 732 | 3300003791 | Ga0055530_10000511 | Ga0055530_1000051129 | 304 |
| 733 | 3300005288 | Ga0065714_10001142 | Ga0065714_100011422 | 304 |
| 734 | 3300005288 | Ga0065714_10007206 | Ga0065714_100072062 | 304 |
| 735 | 3300005288 | Ga0065714_10067449 | Ga0065714_100674493 | 304 |
| 736 | 3300005288 | Ga0065714_10076792 | Ga0065714_100767923 | 304 |
| 737 | 3300005288 | Ga0065714_10153673 | Ga0065714_101536731 | 304 |
| 738 | 3300005290 | Ga0065712_10002535 | Ga0065712_100025353 | 304 |
| 739 | 3300005293 | Ga0065715_10143679 | Ga0065715_101436792 | 304 |
| 740 | 3300005353 | Ga0070669_100321648 | Ga0070669_1003216481 | 304 |
| 741 | 3300005435 | Ga0070714_100260082 | Ga0070714_1002600822 | 304 |
| 742 | 3300006051 | Ga0075364_10165866 | Ga0075364_101658662 | 304 |
| 743 | 3300006058 | Ga0075432_10002236 | Ga0075432_100022362 | 304 |
| 744 | 3300006058 | Ga0075432_10067350 | Ga0075432_100673502 | 304 |
| 745 | 3300006177 | Ga0075362_10055845 | Ga0075362_100558452 | 304 |
| 746 | 3300006186 | Ga0075369_10005197 | Ga0075369_100051974 | 304 |
| 747 | 3300006914 | Ga0075436_100042714 | Ga0075436_1000427144 | 304 |
| 748 | 3300006914 | Ga0075436_100293387 | Ga0075436_1002933872 | 304 |
| 749 | 3300006946 | Ga0079104_1000467 | Ga0079104_10004677 | 304 |
| 750 | 3300009011 | Ga0105251_10001136 | Ga0105251_1000113615 | 304 |
| 751 | 3300009011 | Ga0105251_10007385 | Ga0105251_100073852 | 304 |
| 752 | 3300009011 | Ga0105251_10073962 | Ga0105251_100739622 | 304 |
| 753 | 3300009011 | Ga0105251_10077247 | Ga0105251_100772472 | 304 |
| 754 | 3300009011 | Ga0105251_10094193 | Ga0105251_100941932 | 304 |
| 755 | 3300009011 | Ga0105251_10152839 | Ga0105251_101528391 | 304 |
| 756 | 3300009036 | Ga0105244_10008012 | Ga0105244_100080125 | 304 |
| 757 | 3300009036 | Ga0105244_10121360 | Ga0105244_101213602 | 304 |
| 758 | 3300009092 | Ga0105250_10063323 | Ga0105250_100633232 | 304 |
| 759 | 3300009148 | Ga0105243_10000647 | Ga0105243_100006475 | 304 |
| 760 | 3300009148 | Ga0105243_10444603 | Ga0105243_104446032 | 304 |
| 761 | 3300009176 | Ga0105242_10184150 | Ga0105242_101841503 | 304 |
| 762 | 3300009553 | Ga0105249_10107793 | Ga0105249_101077932 | 304 |
| 763 | 3300013102 | Ga0157371_10001507 | Ga0157371_100015075 | 304 |
| 764 | 3300013102 | Ga0157371_10006271 | Ga0157371_100062717 | 304 |
| 765 | 3300013104 | Ga0157370_10010838 | Ga0157370_100108382 | 304 |
| 766 | 3300013104 | Ga0157370_10056348 | Ga0157370_100563482 | 304 |
| 767 | 3300013104 | Ga0157370_10153170 | Ga0157370_101531703 | 304 |
| 768 | 3300013104 | Ga0157370_10533888 | Ga0157370_105338882 | 304 |
| 769 | 3300013306 | Ga0163162_10019611 | Ga0163162_100196114 | 304 |
| 770 | 3300014497 | Ga0182008_10001933 | Ga0182008_1000193312 | 304 |
| 771 | 3300014497 | Ga0182008_10005795 | Ga0182008_100057954 | 304 |
| 772 | 3300014497 | Ga0182008_10008549 | Ga0182008_100085492 | 304 |
| 773 | 3300014497 | Ga0182008_10014390 | Ga0182008_100143905 | 304 |
| 774 | 3300014497 | Ga0182008_10022905 | Ga0182008_100229052 | 304 |
| 775 | 3300015261 | Ga0182006_1006207 | Ga0182006_10062075 | 304 |
| 776 | 3300015261 | Ga0182006_1041913 | Ga0182006_10419132 | 304 |
| 777 | 3300015262 | Ga0182007_10004583 | Ga0182007_100045836 | 304 |
| 778 | 3300015265 | Ga0182005_1002382 | Ga0182005_10023822 | 304 |
| 779 | 3300015265 | Ga0182005_1005062 | Ga0182005_10050625 | 304 |
| 780 | 3300017792 | Ga0163161_10010748 | Ga0163161_100107485 | 304 |
| 781 | 3300017792 | Ga0163161_10238541 | Ga0163161_102385412 | 304 |
| 782 | 3300025207 | Ga0209760_100021 | Ga0209760_100021105 | 304 |
| 783 | 3300025207 | Ga0209760_100194 | Ga0209760_10019418 | 304 |
| 784 | 3300025231 | Ga0207427_100001 | Ga0207427_100001296 | 304 |
| 785 | 3300025231 | Ga0207427_100038 | Ga0207427_10003818 | 304 |
| 786 | 3300025233 | Ga0209437_100003 | Ga0209437_1000031076 | 304 |
| 787 | 3300025233 | Ga0209437_100009 | Ga0209437_100009645 | 304 |
| 788 | 3300025261 | Ga0209233_1000007 | Ga0209233_1000007296 | 304 |
| 789 | 3300025261 | Ga0209233_1000074 | Ga0209233_100007418 | 304 |
| 790 | 3300025292 | Ga0209676_1000016 | Ga0209676_100001619 | 304 |
| 791 | 3300025292 | Ga0209676_1000056 | Ga0209676_100005635 | 304 |
| 792 | 3300025292 | Ga0209676_1002719 | Ga0209676_10027199 | 304 |
| 793 | 3300025298 | Ga0209050_1000208 | Ga0209050_1000208105 | 304 |
| 794 | 3300025298 | Ga0209050_1000361 | Ga0209050_100036135 | 304 |
| 795 | 3300025298 | Ga0209050_1001601 | Ga0209050_10016016 | 304 |
| 796 | 3300025303 | Ga0209051_1000061 | Ga0209051_100006135 | 304 |
| 797 | 3300025303 | Ga0209051_1000368 | Ga0209051_100036836 | 304 |
| 798 | 3300025303 | Ga0209051_1011404 | Ga0209051_10114042 | 304 |
| 799 | 3300025304 | Ga0209257_1000637 | Ga0209257_100063714 | 304 |
| 800 | 3300025711 | Ga0207696_1005740 | Ga0207696_10057405 | 304 |
| 801 | 3300025711 | Ga0207696_1006743 | Ga0207696_10067434 | 304 |
| 802 | 3300025728 | Ga0207655_1002214 | Ga0207655_10022146 | 304 |
| 803 | 3300025728 | Ga0207655_1058096 | Ga0207655_10580962 | 304 |
| 804 | 3300025735 | Ga0207713_1001099 | Ga0207713_10010999 | 304 |
| 805 | 3300025735 | Ga0207713_1003197 | Ga0207713_100319711 | 304 |
| 806 | 3300025735 | Ga0207713_1005108 | Ga0207713_10051085 | 304 |
| 807 | 3300025735 | Ga0207713_1012139 | Ga0207713_10121394 | 304 |
| 808 | 3300025735 | Ga0207713_1026477 | Ga0207713_10264772 | 304 |
| 809 | 3300025735 | Ga0207713_1085410 | Ga0207713_10854102 | 304 |
| 810 | 3300025923 | Ga0207681_10283474 | Ga0207681_102834742 | 304 |
| 811 | 3300025934 | Ga0207686_10114636 | Ga0207686_101146361 | 304 |
| 812 | 3300025935 | Ga0207709_10000699 | Ga0207709_1000069923 | 304 |
| 813 | 3300025935 | Ga0207709_10022130 | Ga0207709_100221304 | 304 |
| 814 | 3300025935 | Ga0207709_10122234 | Ga0207709_101222342 | 304 |
| 815 | 3300025961 | Ga0207712_10041152 | Ga0207712_100411523 | 304 |
| 816 | 3300027111 | Ga0209281_1000013 | Ga0209281_1000013341 | 304 |
| 817 | 3300027907 | Ga0207428_10021829 | Ga0207428_100218294 | 304 |
| 818 | 3300027907 | Ga0207428_10040345 | Ga0207428_100403452 | 304 |
| 819 | 3300027907 | Ga0207428_10101950 | Ga0207428_101019502 | 304 |
| 820 | 3300027907 | Ga0207428_10274082 | Ga0207428_102740822 | 304 |
| 821 | 3300030521 | Ga0307511_10095374 | Ga0307511_100953742 | 304 |
| 822 | 3300031730 | Ga0307516_10368403 | Ga0307516_103684032 | 304 |
| 823 | 3300033180 | Ga0307510_10156796 | Ga0307510_101567962 | 304 |
| 824 | 3300041405 | Ga0439438_001691 | Ga0439438_001691_5620_6534 | 304 |
| 825 | 3300041405 | Ga0439438_001896 | Ga0439438_001896_5232_6146 | 304 |
| 826 | 3300041405 | Ga0439438_012742 | Ga0439438_012742_268_1182 | 304 |
| 827 | 3300041407 | Ga0439447_002220 | Ga0439447_002220_758_1672 | 304 |
| 828 | 3300041407 | Ga0439447_007855 | Ga0439447_007855_2166_3080 | 304 |
| 829 | 3300041407 | Ga0439447_042694 | Ga0439447_042694_155_1069 | 304 |
| 830 | 3300041411 | Ga0439466_0000163 | Ga0439466_0000163_3129_4046 | 304 |
| 831 | 3300041411 | Ga0439466_0000942 | Ga0439466_0000942_8216_9130 | 304 |
| 832 | 3300041411 | Ga0439466_0005958 | Ga0439466_0005958_712_1626 | 304 |
| 833 | 3300041411 | Ga0439466_0043014 | Ga0439466_0043014_479_1393 | 304 |
| 834 | 3300041413 | Ga0439465_0028286 | Ga0439465_0028286_608_1522 | 304 |
| 835 | 3300042006 | Ga0439432_019564 | Ga0439432_019564_266_1180 | 304 |
| 836 | 3300042009 | Ga0439451_014086 | Ga0439451_014086_23_1015 | 304 |
| 837 | 3300042010 | Ga0439452_001453 | Ga0439452_001453_3046_3960 | 304 |
| 838 | 3300042010 | Ga0439452_001862 | Ga0439452_001862_4166_5080 | 304 |
| 839 | 3300042013 | Ga0439456_001007 | Ga0439456_001007_1408_2322 | 304 |
| 840 | 3300042016 | Ga0439463_000239 | Ga0439463_000239_11289_12227 | 304 |
| 841 | 3300042016 | Ga0439463_000931 | Ga0439463_000931_3058_3975 | 304 |
| 842 | 3300042016 | Ga0439463_027324 | Ga0439463_027324_73_987 | 304 |
| 843 | 3300042115 | Ga0450911_001939 | Ga0450911_001939_328_1242 | 304 |
| 844 | 3300042115 | Ga0450911_004539 | Ga0450911_004539_1012_1926 | 304 |
| 845 | 3300042121 | Ga0450919_000714 | Ga0450919_000714_1107_2021 | 304 |
| 846 | 3300042124 | Ga0450922_000147 | Ga0450922_000147_3359_4273 | 304 |
| 847 | 3300042124 | Ga0450922_003025 | Ga0450922_003025_462_1376 | 304 |
| 848 | 3300042127 | Ga0450890_001456 | Ga0450890_001456_366_1280 | 304 |
| 849 | 3300042138 | Ga0450903_006702 | Ga0450903_006702_92_1006 | 304 |
| 850 | 3300042138 | Ga0450903_011976 | Ga0450903_011976_360_1274 | 304 |
| 851 | 3300042145 | Ga0450906_000358 | Ga0450906_000358_511_1425 | 304 |
| 852 | 3300042145 | Ga0450906_008131 | Ga0450906_008131_1081_1995 | 304 |
| 853 | 3300042146 | Ga0450907_000424 | Ga0450907_000424_8663_9577 | 304 |
| 854 | 3300042146 | Ga0450907_003201 | Ga0450907_003201_765_1679 | 304 |
| 855 | 3300042147 | Ga0450910_000448 | Ga0450910_000448_1334_2248 | 304 |
| 856 | 3300042147 | Ga0450910_000974 | Ga0450910_000974_509_1423 | 304 |
| 857 | 3300042156 | Ga0439446_0003304 | Ga0439446_0003304_926_1840 | 304 |
| 858 | 3300042184 | Ga0450908_010909 | Ga0450908_010909_452_1366 | 304 |
| 859 | 3300042435 | Ga0439434_0022457 | Ga0439434_0022457_532_1446 | 304 |
| 860 | 3300042439 | Ga0439464_0002872 | Ga0439464_0002872_2303_3217 | 304 |
| 861 | 3300042461 | Ga0439460_0016720 | Ga0439460_0016720_40_954 | 304 |
| 862 | 3300042461 | Ga0439460_0044875 | Ga0439460_0044875_83_997 | 304 |
| 863 | 3300042531 | Ga0450918_012043 | Ga0450918_012043_306_1220 | 304 |
| 864 | 3300042993 | Ga0439440_0002537 | Ga0439440_0002537_2159_3076 | 304 |
| 865 | 3300042993 | Ga0439440_0004375 | Ga0439440_0004375_1116_2030 | 304 |
| 866 | 3300046452 | Ga0495617_000127 | Ga0495617_000127_3124_4038 | 304 |
| 867 | 3300046452 | Ga0495617_007762 | Ga0495617_007762_310_1224 | 304 |
| 868 | 3300046452 | Ga0495617_019312 | Ga0495617_019312_912_1826 | 304 |
| 869 | 3300046452 | Ga0495617_023764 | Ga0495617_023764_440_1354 | 304 |
| 870 | 3300046452 | Ga0495617_039352 | Ga0495617_039352_555_1469 | 304 |
| 871 | 3300046452 | Ga0495617_071973 | Ga0495617_071973_17_931 | 304 |
| 872 | 3300046453 | Ga0495627_012510 | Ga0495627_012510_238_1152 | 304 |
| 873 | 3300046453 | Ga0495627_031178 | Ga0495627_031178_186_1106 | 304 |
| 874 | 3300046455 | Ga0495603_0012866 | Ga0495603_0012866_840_1754 | 304 |
| 875 | 3300046455 | Ga0495603_0195206 | Ga0495603_0195206_140_1054 | 304 |
| 876 | 3300046457 | Ga0495590_0002384 | Ga0495590_0002384_3764_4678 | 304 |
| 877 | 3300046457 | Ga0495590_0007635 | Ga0495590_0007635_107_1021 | 304 |
| 878 | 3300046458 | Ga0495591_006527 | Ga0495591_006527_803_1756 | 304 |
| 879 | 3300046458 | Ga0495591_007840 | Ga0495591_007840_374_1294 | 304 |
| 880 | 3300046458 | Ga0495591_009959 | Ga0495591_009959_2703_3617 | 304 |
| 881 | 3300046460 | Ga0495638_0008766 | Ga0495638_0008766_3059_3973 | 304 |
| 882 | 3300046460 | Ga0495638_0010749 | Ga0495638_0010749_3173_4087 | 304 |
| 883 | 3300046460 | Ga0495638_0087848 | Ga0495638_0087848_525_1439 | 304 |
| 884 | 3300046463 | Ga0495653_0023163 | Ga0495653_0023163_3186_4100 | 304 |
| 885 | 3300046463 | Ga0495653_0028970 | Ga0495653_0028970_722_1636 | 304 |
| 886 | 3300046471 | Ga0495650_0002993 | Ga0495650_0002993_1941_2885 | 304 |
| 887 | 3300046471 | Ga0495650_0013923 | Ga0495650_0013923_1455_2369 | 304 |
| 888 | 3300046471 | Ga0495650_0029622 | Ga0495650_0029622_114_1028 | 304 |
| 889 | 3300046474 | Ga0495605_0000356 | Ga0495605_0000356_3475_4413 | 304 |
| 890 | 3300046474 | Ga0495605_0004727 | Ga0495605_0004727_3111_4025 | 304 |
| 891 | 3300046474 | Ga0495605_0006890 | Ga0495605_0006890_5519_6457 | 304 |
| 892 | 3300046474 | Ga0495605_0014838 | Ga0495605_0014838_61_1011 | 304 |
| 893 | 3300046474 | Ga0495605_0026615 | Ga0495605_0026615_1716_2630 | 304 |
| 894 | 3300046474 | Ga0495605_0130529 | Ga0495605_0130529_17_961 | 304 |
| 895 | 3300046475 | Ga0495639_0000341 | Ga0495639_0000341_3105_4019 | 304 |
| 896 | 3300046475 | Ga0495639_0106179 | Ga0495639_0106179_401_1315 | 304 |
| 897 | 3300046491 | Ga0495584_0004163 | Ga0495584_0004163_475_1389 | 304 |
| 898 | 3300046491 | Ga0495584_0006489 | Ga0495584_0006489_4416_5330 | 304 |
| 899 | 3300046491 | Ga0495584_0007702 | Ga0495584_0007702_119_1033 | 304 |
| 900 | 3300046491 | Ga0495584_0010483 | Ga0495584_0010483_331_1245 | 304 |
| 901 | 3300046491 | Ga0495584_0017462 | Ga0495584_0017462_2348_3262 | 304 |
| 902 | 3300046491 | Ga0495584_0030573 | Ga0495584_0030573_1091_2005 | 304 |
| 903 | 3300046491 | Ga0495584_0050058 | Ga0495584_0050058_1123_2067 | 304 |
| 904 | 3300046491 | Ga0495584_0052419 | Ga0495584_0052419_504_1418 | 304 |
| 905 | 3300046491 | Ga0495584_0143111 | Ga0495584_0143111_219_1133 | 304 |
| 906 | 3300046491 | Ga0495584_0179484 | Ga0495584_0179484_105_1019 | 304 |
| 907 | 3300046492 | Ga0495585_0003685 | Ga0495585_0003685_3031_3945 | 304 |
| 908 | 3300046492 | Ga0495585_0008396 | Ga0495585_0008396_4501_5415 | 304 |
| 909 | 3300046492 | Ga0495585_0011899 | Ga0495585_0011899_3720_4634 | 304 |
| 910 | 3300046492 | Ga0495585_0022272 | Ga0495585_0022272_574_1488 | 304 |
| 911 | 3300046492 | Ga0495585_0088277 | Ga0495585_0088277_93_1037 | 304 |
| 912 | 3300046499 | Ga0495594_0060354 | Ga0495594_0060354_638_1552 | 304 |
| 913 | 3300046501 | Ga0495607_0001478 | Ga0495607_0001478_3174_4088 | 304 |
| 914 | 3300046501 | Ga0495607_0011723 | Ga0495607_0011723_937_1851 | 304 |
| 915 | 3300046501 | Ga0495607_0012161 | Ga0495607_0012161_551_1465 | 304 |
| 916 | 3300046501 | Ga0495607_0015670 | Ga0495607_0015670_508_1446 | 304 |
| 917 | 3300046501 | Ga0495607_0018822 | Ga0495607_0018822_2691_3605 | 304 |
| 918 | 3300046501 | Ga0495607_0027747 | Ga0495607_0027747_2542_3456 | 304 |
| 919 | 3300046501 | Ga0495607_0064416 | Ga0495607_0064416_70_984 | 304 |
| 920 | 3300046501 | Ga0495607_0080706 | Ga0495607_0080706_301_1236 | 304 |
| 921 | 3300046506 | Ga0495583_0001352 | Ga0495583_0001352_21295_22239 | 304 |
| 922 | 3300046506 | Ga0495583_0002110 | Ga0495583_0002110_3115_4029 | 304 |
| 923 | 3300046506 | Ga0495583_0010993 | Ga0495583_0010993_3477_4415 | 304 |
| 924 | 3300046506 | Ga0495583_0012791 | Ga0495583_0012791_3385_4299 | 304 |
| 925 | 3300046506 | Ga0495583_0015208 | Ga0495583_0015208_2851_3876 | 304 |
| 926 | 3300046506 | Ga0495583_0051075 | Ga0495583_0051075_46_960 | 304 |
| 927 | 3300046507 | Ga0495606_0014249 | Ga0495606_0014249_2185_3099 | 304 |
| 928 | 3300046507 | Ga0495606_0015507 | Ga0495606_0015507_3300_4214 | 304 |
| 929 | 3300046507 | Ga0495606_0021751 | Ga0495606_0021751_3418_4362 | 304 |
| 930 | 3300046507 | Ga0495606_0193641 | Ga0495606_0193641_75_1013 | 304 |
| 931 | 3300046512 | Ga0495610_0008423 | Ga0495610_0008423_2433_3347 | 304 |
| 932 | 3300046512 | Ga0495610_0009397 | Ga0495610_0009397_781_1695 | 304 |
| 933 | 3300046512 | Ga0495610_0011965 | Ga0495610_0011965_1313_2227 | 304 |
| 934 | 3300046512 | Ga0495610_0038399 | Ga0495610_0038399_1406_2350 | 304 |
| 935 | 3300046513 | Ga0495616_0003782 | Ga0495616_0003782_6251_7165 | 304 |
| 936 | 3300046513 | Ga0495616_0006083 | Ga0495616_0006083_5263_6177 | 304 |
| 937 | 3300046513 | Ga0495616_0021398 | Ga0495616_0021398_887_1801 | 304 |
| 938 | 3300046513 | Ga0495616_0044113 | Ga0495616_0044113_349_1263 | 304 |
| 939 | 3300046515 | Ga0495620_0008259 | Ga0495620_0008259_315_1229 | 304 |
| 940 | 3300046515 | Ga0495620_0010161 | Ga0495620_0010161_546_1484 | 304 |
| 941 | 3300046515 | Ga0495620_0016325 | Ga0495620_0016325_2690_3604 | 304 |
| 942 | 3300046515 | Ga0495620_0115664 | Ga0495620_0115664_40_954 | 304 |
| 943 | 3300046517 | Ga0495630_0233809 | Ga0495630_0233809_429_1343 | 304 |
| 944 | 3300046518 | Ga0495631_0002924 | Ga0495631_0002924_3168_4082 | 304 |
| 945 | 3300046518 | Ga0495631_0010837 | Ga0495631_0010837_3178_4203 | 304 |
| 946 | 3300046518 | Ga0495631_0115294 | Ga0495631_0115294_66_980 | 304 |
| 947 | 3300046518 | Ga0495631_0162450 | Ga0495631_0162450_10_924 | 304 |
| 948 | 3300046519 | Ga0495632_0001169 | Ga0495632_0001169_18393_19307 | 304 |
| 949 | 3300046519 | Ga0495632_0006636 | Ga0495632_0006636_3244_4269 | 304 |
| 950 | 3300046519 | Ga0495632_0011905 | Ga0495632_0011905_2074_2988 | 304 |
| 951 | 3300046519 | Ga0495632_0018328 | Ga0495632_0018328_1915_2859 | 304 |
| 952 | 3300046519 | Ga0495632_0019723 | Ga0495632_0019723_1103_2017 | 304 |
| 953 | 3300046519 | Ga0495632_0066359 | Ga0495632_0066359_105_1019 | 304 |
| 954 | 3300046520 | Ga0495637_0000188 | Ga0495637_0000188_44248_45192 | 304 |
| 955 | 3300046520 | Ga0495637_0004413 | Ga0495637_0004413_3615_4529 | 304 |
| 956 | 3300046520 | Ga0495637_0006903 | Ga0495637_0006903_2875_3789 | 304 |
| 957 | 3300046520 | Ga0495637_0009901 | Ga0495637_0009901_3316_4230 | 304 |
| 958 | 3300046520 | Ga0495637_0011634 | Ga0495637_0011634_2861_3775 | 304 |
| 959 | 3300046520 | Ga0495637_0014398 | Ga0495637_0014398_2108_3022 | 304 |
| 960 | 3300046520 | Ga0495637_0020873 | Ga0495637_0020873_1628_2542 | 304 |
| 961 | 3300046520 | Ga0495637_0039090 | Ga0495637_0039090_396_1310 | 304 |
| 962 | 3300046522 | Ga0495643_0025313 | Ga0495643_0025313_2419_3333 | 304 |
| 963 | 3300046522 | Ga0495643_0057766 | Ga0495643_0057766_371_1396 | 304 |
| 964 | 3300046522 | Ga0495643_0076784 | Ga0495643_0076784_191_1105 | 304 |
| 965 | 3300046523 | Ga0495644_0004882 | Ga0495644_0004882_1125_2069 | 304 |
| 966 | 3300046523 | Ga0495644_0006925 | Ga0495644_0006925_1169_2083 | 304 |
| 967 | 3300046523 | Ga0495644_0007338 | Ga0495644_0007338_26_940 | 304 |
| 968 | 3300046523 | Ga0495644_0027732 | Ga0495644_0027732_798_1712 | 304 |
| 969 | 3300046524 | Ga0495648_0001113 | Ga0495648_0001113_891_1805 | 304 |
| 970 | 3300046524 | Ga0495648_0019454 | Ga0495648_0019454_598_1623 | 304 |
| 971 | 3300046524 | Ga0495648_0021907 | Ga0495648_0021907_2631_3545 | 304 |
| 972 | 3300046524 | Ga0495648_0022001 | Ga0495648_0022001_3176_4090 | 304 |
| 973 | 3300046524 | Ga0495648_0029271 | Ga0495648_0029271_2076_2990 | 304 |
| 974 | 3300046524 | Ga0495648_0036499 | Ga0495648_0036499_2176_3090 | 304 |
| 975 | 3300046524 | Ga0495648_0114238 | Ga0495648_0114238_454_1368 | 304 |
| 976 | 3300046526 | Ga0495666_0036672 | Ga0495666_0036672_740_1654 | 304 |
| 977 | 3300046526 | Ga0495666_0047318 | Ga0495666_0047318_22_936 | 304 |
| 978 | 3300046526 | Ga0495666_0093840 | Ga0495666_0093840_459_1373 | 304 |
| 979 | 3300046528 | Ga0495642_0000398 | Ga0495642_0000398_19348_20262 | 304 |
| 980 | 3300046528 | Ga0495642_0002232 | Ga0495642_0002232_3110_4024 | 304 |
| 981 | 3300046530 | Ga0495654_0008410 | Ga0495654_0008410_1026_1940 | 304 |
| 982 | 3300046530 | Ga0495654_0009081 | Ga0495654_0009081_4464_5378 | 304 |
| 983 | 3300046530 | Ga0495654_0011659 | Ga0495654_0011659_3272_4186 | 304 |
| 984 | 3300046530 | Ga0495654_0013168 | Ga0495654_0013168_3096_4010 | 304 |
| 985 | 3300046530 | Ga0495654_0015537 | Ga0495654_0015537_3027_3941 | 304 |
| 986 | 3300046530 | Ga0495654_0015772 | Ga0495654_0015772_189_1103 | 304 |
| 987 | 3300046530 | Ga0495654_0018037 | Ga0495654_0018037_663_1577 | 304 |
| 988 | 3300046530 | Ga0495654_0022666 | Ga0495654_0022666_2305_3219 | 304 |
| 989 | 3300046530 | Ga0495654_0082557 | Ga0495654_0082557_173_1117 | 304 |
| 990 | 3300046530 | Ga0495654_0147741 | Ga0495654_0147741_14_928 | 304 |
| 991 | 3300046538 | Ga0495609_0007206 | Ga0495609_0007206_1408_2352 | 304 |
| 992 | 3300046538 | Ga0495609_0009658 | Ga0495609_0009658_1711_2625 | 304 |
| 993 | 3300046538 | Ga0495609_0074787 | Ga0495609_0074787_162_1076 | 304 |
| 994 | 3300046542 | Ga0495597_0003943 | Ga0495597_0003943_2117_3031 | 304 |
| 995 | 3300046542 | Ga0495597_0032025 | Ga0495597_0032025_1395_2309 | 304 |
| 996 | 3300046542 | Ga0495597_0069953 | Ga0495597_0069953_154_1068 | 304 |
| 997 | 3300046542 | Ga0495597_0120904 | Ga0495597_0120904_106_1020 | 304 |
| 998 | 3300046557 | Ga0495622_0003985 | Ga0495622_0003985_3116_4030 | 304 |
| 999 | 3300046557 | Ga0495622_0004251 | Ga0495622_0004251_1863_2777 | 304 |
| 1000 | 3300046557 | Ga0495622_0016700 | Ga0495622_0016700_2216_3130 | 304 |
| 1001 | 3300046557 | Ga0495622_0017856 | Ga0495622_0017856_736_1680 | 304 |
| 1002 | 3300046558 | Ga0495633_0006725 | Ga0495633_0006725_5175_6089 | 304 |
| 1003 | 3300046558 | Ga0495633_0025968 | Ga0495633_0025968_93_1007 | 304 |
| 1004 | 3300046615 | Ga0495656_0001597 | Ga0495656_0001597_3057_3971 | 304 |
| 1005 | 3300046616 | Ga0495668_0012445 | Ga0495668_0012445_1093_2037 | 304 |
| 1006 | 3300046616 | Ga0495668_0070223 | Ga0495668_0070223_776_1714 | 304 |
| 1007 | 3300046642 | Ga0495634_0004434 | Ga0495634_0004434_3066_3980 | 304 |
| 1008 | 3300046648 | Ga0495611_0007433 | Ga0495611_0007433_1023_1967 | 304 |
| 1009 | 3300046648 | Ga0495611_0168607 | Ga0495611_0168607_47_961 | 304 |
| 1010 | 3300046660 | Ga0495625_0000686 | Ga0495625_0000686_44056_45000 | 304 |
| 1011 | 3300046660 | Ga0495625_0018919 | Ga0495625_0018919_641_1555 | 304 |
| 1012 | 3300046660 | Ga0495625_0096250 | Ga0495625_0096250_214_1128 | 304 |
| 1013 | 3300046663 | Ga0495635_0005516 | Ga0495635_0005516_4654_5568 | 304 |
| 1014 | 3300046663 | Ga0495635_0088686 | Ga0495635_0088686_424_1338 | 304 |
| 1015 | 3300046664 | Ga0495659_0003358 | Ga0495659_0003358_3787_4701 | 304 |
| 1016 | 3300046664 | Ga0495659_0004687 | Ga0495659_0004687_432_1346 | 304 |
| 1017 | 3300046665 | Ga0495661_0000375 | Ga0495661_0000375_44033_44977 | 304 |
| 1018 | 3300046665 | Ga0495661_0008016 | Ga0495661_0008016_3524_4438 | 304 |
| 1019 | 3300046665 | Ga0495661_0018000 | Ga0495661_0018000_464_1489 | 304 |
| 1020 | 3300046665 | Ga0495661_0057432 | Ga0495661_0057432_712_1626 | 304 |
| 1021 | 3300046679 | Ga0495623_0010871 | Ga0495623_0010871_3026_3940 | 304 |
| 1022 | 3300046680 | Ga0495646_0010699 | Ga0495646_0010699_2109_3023 | 304 |
| 1023 | 3300046680 | Ga0495646_0012871 | Ga0495646_0012871_1156_2070 | 304 |
| 1024 | 3300046684 | Ga0495669_0009785 | Ga0495669_0009785_1006_1920 | 304 |
| 1025 | 3300046684 | Ga0495669_0140456 | Ga0495669_0140456_24_938 | 304 |
| 1026 | 3300046689 | Ga0495613_0055943 | Ga0495613_0055943_467_1381 | 304 |
| 1027 | 3300046691 | Ga0495670_0002675 | Ga0495670_0002675_2849_3763 | 304 |
| 1028 | 3300046691 | Ga0495670_0002719 | Ga0495670_0002719_4669_5583 | 304 |
| 1029 | 3300046691 | Ga0495670_0006814 | Ga0495670_0006814_3091_4005 | 304 |
| 1030 | 3300046691 | Ga0495670_0016045 | Ga0495670_0016045_2697_3611 | 304 |
| 1031 | 3300046691 | Ga0495670_0031041 | Ga0495670_0031041_155_1069 | 304 |
| 1032 | 3300046691 | Ga0495670_0062195 | Ga0495670_0062195_395_1339 | 304 |
| 1033 | 3300046691 | Ga0495670_0176976 | Ga0495670_0176976_56_976 | 304 |
| 1034 | 3300046692 | Ga0495671_0002995 | Ga0495671_0002995_6465_7379 | 304 |
| 1035 | 3300046692 | Ga0495671_0012256 | Ga0495671_0012256_520_1545 | 304 |
| 1036 | 3300046692 | Ga0495671_0016592 | Ga0495671_0016592_2551_3501 | 304 |
| 1037 | 3300046692 | Ga0495671_0023317 | Ga0495671_0023317_2280_3194 | 304 |
| 1038 | 3300046692 | Ga0495671_0028705 | Ga0495671_0028705_1358_2272 | 304 |
| 1039 | 3300046692 | Ga0495671_0135755 | Ga0495671_0135755_54_968 | 304 |
| 1040 | 3300046694 | Ga0495649_0012476 | Ga0495649_0012476_3659_4573 | 304 |
| 1041 | 3300046694 | Ga0495649_0013788 | Ga0495649_0013788_675_1619 | 304 |
| 1042 | 3300046694 | Ga0495649_0026928 | Ga0495649_0026928_116_1030 | 304 |
| 1043 | 3300046694 | Ga0495649_0030433 | Ga0495649_0030433_1961_2875 | 304 |
| 1044 | 3300046694 | Ga0495649_0034859 | Ga0495649_0034859_997_1911 | 304 |
| 1045 | 3300046694 | Ga0495649_0056139 | Ga0495649_0056139_1061_1975 | 304 |
| 1046 | 3300046694 | Ga0495649_0180209 | Ga0495649_0180209_139_1053 | 304 |
| 1047 | 3300046794 | Ga0495589_0002361 | Ga0495589_0002361_6520_7434 | 304 |
| 1048 | 3300046794 | Ga0495589_0009091 | Ga0495589_0009091_1359_2273 | 304 |
| 1049 | 3300046794 | Ga0495589_0009871 | Ga0495589_0009871_1960_2874 | 304 |
| 1050 | 3300046794 | Ga0495589_0084202 | Ga0495589_0084202_588_1502 | 304 |
| 1051 | 3300046809 | Ga0495600_0017597 | Ga0495600_0017597_359_1273 | 304 |
| 1052 | 3300046810 | Ga0495660_0035325 | Ga0495660_0035325_1157_2101 | 304 |
| 1053 | 3300046810 | Ga0495660_0043384 | Ga0495660_0043384_192_1106 | 304 |
| 1054 | 3300046810 | Ga0495660_0058603 | Ga0495660_0058603_544_1458 | 304 |
| 1055 | 3300046810 | Ga0495660_0084554 | Ga0495660_0084554_183_1097 | 304 |
| 1056 | 3300046810 | Ga0495660_0089758 | Ga0495660_0089758_574_1488 | 304 |
| 1057 | 3300046810 | Ga0495660_0148601 | Ga0495660_0148601_15_929 | 304 |
| 1058 | 3300047315 | Ga0495581_0200656 | Ga0495581_0200656_185_1099 | 304 |
| 1059 | 3300047317 | Ga0495604_0019032 | Ga0495604_0019032_2790_3704 | 304 |
| 1060 | 3300047317 | Ga0495604_0020740 | Ga0495604_0020740_1162_2076 | 304 |
| 1061 | 3300047320 | Ga0495672_0005569 | Ga0495672_0005569_5677_6591 | 304 |
| 1062 | 3300047320 | Ga0495672_0007545 | Ga0495672_0007545_4169_5083 | 304 |
| 1063 | 3300047320 | Ga0495672_0008196 | Ga0495672_0008196_3862_4776 | 304 |
| 1064 | 3300047320 | Ga0495672_0008550 | Ga0495672_0008550_2856_3770 | 304 |
| 1065 | 3300047320 | Ga0495672_0011941 | Ga0495672_0011941_2258_3172 | 304 |
| 1066 | 3300047320 | Ga0495672_0019377 | Ga0495672_0019377_337_1251 | 304 |
| 1067 | 3300047320 | Ga0495672_0019838 | Ga0495672_0019838_2670_3614 | 304 |
| 1068 | 3300047320 | Ga0495672_0020024 | Ga0495672_0020024_3175_4089 | 304 |
| 1069 | 3300047320 | Ga0495672_0023464 | Ga0495672_0023464_125_1150 | 304 |
| 1070 | 3300047320 | Ga0495672_0024533 | Ga0495672_0024533_2848_3762 | 304 |
| 1071 | 3300047321 | Ga0495676_0000222 | Ga0495676_0000222_3222_4166 | 304 |
| 1072 | 3300047322 | Ga0495680_0008104 | Ga0495680_0008104_3114_4028 | 304 |
| 1073 | 3300047322 | Ga0495680_0046759 | Ga0495680_0046759_1475_2389 | 304 |
| 1074 | 3300047322 | Ga0495680_0344125 | Ga0495680_0344125_13_927 | 304 |
| 1075 | 3300047323 | Ga0495683_0002710 | Ga0495683_0002710_3121_4035 | 304 |
| 1076 | 3300047323 | Ga0495683_0003356 | Ga0495683_0003356_5274_6188 | 304 |
| 1077 | 3300047323 | Ga0495683_0013203 | Ga0495683_0013203_1133_2047 | 304 |
| 1078 | 3300047323 | Ga0495683_0013853 | Ga0495683_0013853_168_1082 | 304 |
| 1079 | 3300047323 | Ga0495683_0040567 | Ga0495683_0040567_1396_2310 | 304 |
| 1080 | 3300047443 | Ga0495687_010197 | Ga0495687_010197_329_1243 | 304 |
| 1081 | 3300047444 | Ga0495675_0013933 | Ga0495675_0013933_3249_4163 | 304 |
| 1082 | 3300047445 | Ga0495677_0007690 | Ga0495677_0007690_556_1470 | 304 |
| 1083 | 3300047446 | Ga0495679_006006 | Ga0495679_006006_3450_4394 | 304 |
| 1084 | 3300047446 | Ga0495679_008849 | Ga0495679_008849_3023_3937 | 304 |
| 1085 | 3300047469 | Ga0495673_0003472 | Ga0495673_0003472_6370_7284 | 304 |
| 1086 | 3300047469 | Ga0495673_0005327 | Ga0495673_0005327_3161_4168 | 304 |
| 1087 | 3300047469 | Ga0495673_0006416 | Ga0495673_0006416_2783_3697 | 304 |
| 1088 | 3300047469 | Ga0495673_0008018 | Ga0495673_0008018_4964_5878 | 304 |
| 1089 | 3300047469 | Ga0495673_0011839 | Ga0495673_0011839_3169_4083 | 304 |
| 1090 | 3300047469 | Ga0495673_0023144 | Ga0495673_0023144_1329_2354 | 304 |
| 1091 | 3300047469 | Ga0495673_0045333 | Ga0495673_0045333_663_1577 | 304 |
| 1092 | 3300047470 | Ga0495681_0001492 | Ga0495681_0001492_3038_3952 | 304 |
| 1093 | 3300047470 | Ga0495681_0005311 | Ga0495681_0005311_2950_3864 | 304 |
| 1094 | 3300047470 | Ga0495681_0008379 | Ga0495681_0008379_364_1278 | 304 |
| 1095 | 3300047470 | Ga0495681_0011422 | Ga0495681_0011422_2711_3625 | 304 |
| 1096 | 3300047470 | Ga0495681_0029940 | Ga0495681_0029940_254_1168 | 304 |
| 1097 | 3300047470 | Ga0495681_0136921 | Ga0495681_0136921_51_965 | 304 |
| 1098 | 3300047472 | Ga0495686_0006823 | Ga0495686_0006823_4694_5608 | 304 |
| 1099 | 3300047472 | Ga0495686_0021995 | Ga0495686_0021995_2875_3789 | 304 |
| 1100 | 3300047472 | Ga0495686_0085400 | Ga0495686_0085400_607_1632 | 304 |
| 1101 | 3300047673 | Ga0495593_0027293 | Ga0495593_0027293_1651_2565 | 304 |
| 1102 | 3300048091 | Ga0495626_0000912 | Ga0495626_0000912_5009_5923 | 304 |
| 1103 | 3300048091 | Ga0495626_0001329 | Ga0495626_0001329_3207_4121 | 304 |
| 1104 | 3300048091 | Ga0495626_0002633 | Ga0495626_0002633_7915_8829 | 304 |
| 1105 | 3300048091 | Ga0495626_0004953 | Ga0495626_0004953_3924_4838 | 304 |
| 1106 | 3300048091 | Ga0495626_0010127 | Ga0495626_0010127_3234_4178 | 304 |
| 1107 | 3300048091 | Ga0495626_0136372 | Ga0495626_0136372_33_947 | 304 |
| 1108 | 3300048905 | Ga0496102_0001186 | Ga0496102_0001186_19767_20681 | 304 |
| 1109 | 3300048906 | Ga0496103_0017077 | Ga0496103_0017077_417_1331 | 304 |
| 1110 | 3300048913 | Ga0496110_0034103 | Ga0496110_0034103_629_1582 | 304 |
| 1111 | 3300048915 | Ga0496112_0344035 | Ga0496112_0344035_453_1367 | 304 |
| 1112 | 3300048915 | Ga0496112_0502950 | Ga0496112_0502950_78_1016 | 304 |
| 1113 | 3300048919 | Ga0496116_0001286 | Ga0496116_0001286_24732_25658 | 304 |
| 1114 | 3300048919 | Ga0496116_0014906 | Ga0496116_0014906_3109_4023 | 304 |
| 1115 | 3300048919 | Ga0496116_0071203 | Ga0496116_0071203_400_1314 | 304 |
| 1116 | 3300048919 | Ga0496116_0132555 | Ga0496116_0132555_61_975 | 304 |
| 1117 | 3300048920 | Ga0496117_0014270 | Ga0496117_0014270_2923_3849 | 304 |
| 1118 | 3300048920 | Ga0496117_0074046 | Ga0496117_0074046_439_1356 | 304 |
| 1119 | 3300048920 | Ga0496117_0083595 | Ga0496117_0083595_227_1141 | 304 |
| 1120 | 3300048920 | Ga0496117_0146187 | Ga0496117_0146187_382_1302 | 304 |
| 1121 | 3300048920 | Ga0496117_0230430 | Ga0496117_0230430_70_984 | 304 |
| 1122 | 3300048921 | Ga0496118_0014312 | Ga0496118_0014312_3651_4577 | 304 |
| 1123 | 3300048921 | Ga0496118_0081141 | Ga0496118_0081141_957_1874 | 304 |
| 1124 | 3300048921 | Ga0496118_0108771 | Ga0496118_0108771_908_1822 | 304 |
| 1125 | 3300048921 | Ga0496118_0109579 | Ga0496118_0109579_520_1434 | 304 |
| 1126 | 3300048924 | Ga0496121_0003226 | Ga0496121_0003226_19084_20010 | 304 |
| 1127 | 3300048924 | Ga0496121_0029574 | Ga0496121_0029574_816_1754 | 304 |
| 1128 | 3300048924 | Ga0496121_0035177 | Ga0496121_0035177_3171_4085 | 304 |
| 1129 | 3300048924 | Ga0496121_0106329 | Ga0496121_0106329_1110_2024 | 304 |
| 1130 | 3300048924 | Ga0496121_0157443 | Ga0496121_0157443_194_1108 | 304 |
| 1131 | 3300048925 | Ga0496122_0000750 | Ga0496122_0000750_59024_59944 | 304 |
| 1132 | 3300048925 | Ga0496122_0015024 | Ga0496122_0015024_4216_5142 | 304 |
| 1133 | 3300048925 | Ga0496122_0036813 | Ga0496122_0036813_2998_3912 | 304 |
| 1134 | 3300048925 | Ga0496122_0104384 | Ga0496122_0104384_369_1307 | 304 |
| 1135 | 3300048926 | Ga0496123_0002466 | Ga0496123_0002466_3124_4050 | 304 |
| 1136 | 3300048926 | Ga0496123_0006350 | Ga0496123_0006350_3334_4254 | 304 |
| 1137 | 3300048926 | Ga0496123_0136290 | Ga0496123_0136290_40_954 | 304 |
| 1138 | 3300048927 | Ga0496124_0001993 | Ga0496124_0001993_3236_4174 | 304 |
| 1139 | 3300048927 | Ga0496124_0018695 | Ga0496124_0018695_5462_6376 | 304 |
| 1140 | 3300048927 | Ga0496124_0023597 | Ga0496124_0023597_4347_5261 | 304 |
| 1141 | 3300048927 | Ga0496124_0028730 | Ga0496124_0028730_561_1514 | 304 |
| 1142 | 3300048928 | Ga0496125_0110319 | Ga0496125_0110319_656_1570 | 304 |
| 1143 | 3300049459 | Ga0495678_004142 | Ga0495678_004142_1168_2082 | 304 |
| 1144 | 3300049459 | Ga0495678_005691 | Ga0495678_005691_1838_2752 | 304 |
| 1145 | 3300049459 | Ga0495678_005950 | Ga0495678_005950_2742_3686 | 304 |
| 1146 | 3300049459 | Ga0495678_032044 | Ga0495678_032044_591_1616 | 304 |
| 1147 | 3300049459 | Ga0495678_078503 | Ga0495678_078503_117_1031 | 304 |
| 1148 | 3300049460 | Ga0495682_0000426 | Ga0495682_0000426_25218_26156 | 304 |
| 1149 | 3300049460 | Ga0495682_0054116 | Ga0495682_0054116_438_1352 | 304 |
| 1150 | 3300050489 | nmdc:mga03683_115596_c1 | nmdc:mga03683_115596_c1_162_1076 | 304 |
| 1151 | 3300050491 | nmdc:mga00v17_36991_c1 | nmdc:mga00v17_36991_c1_819_1733 | 304 |
| 1152 | 3300050516 | nmdc:mga0sz30_139275_c1 | nmdc:mga0sz30_139275_c1_65_979 | 304 |
| 1153 | 3300050516 | nmdc:mga0sz30_16174_c1 | nmdc:mga0sz30_16174_c1_698_1612 | 304 |
| 1154 | iso_pu_bacteria | 2554235341 | 2555668104 | 304 |
| 1155 | iso_pu_bacteria | 2599185160 | 2599355103 | 304 |
| 1156 | iso_pu_bacteria | 2599185161 | 2599361073 | 304 |
| 1157 | iso_pu_bacteria | 2599185162 | 2599367395 | 304 |
| 1158 | iso_pu_bacteria | 2599185163 | 2599374185 | 304 |
| 1159 | iso_pu_bacteria | 2599185164 | 2599380209 | 304 |
| 1160 | iso_pu_bacteria | 2599185165 | 2599386656 | 304 |
| 1161 | iso_pu_bacteria | 2599185166 | 2599393043 | 304 |
| 1162 | iso_pu_bacteria | 2599185168 | 2599404810 | 304 |
| 1163 | iso_pu_bacteria | 2599185181 | 2599461937 | 304 |
| 1164 | iso_pu_bacteria | 2599185182 | 2599467020 | 304 |
| 1165 | iso_pu_bacteria | 2599185186 | 2599490970 | 304 |
| 1166 | iso_pu_bacteria | 2599185356 | 2600214559 | 304 |
| 1167 | iso_pu_bacteria | 2600255313 | 2601774736 | 304 |
| 1168 | iso_pu_bacteria | 2667528171 | 2671097704 | 304 |
| 1169 | iso_pu_bacteria | 2818991464 | 2819702787 | 304 |
| 1170 | iso_pu_bacteria | 2917070673 | 2917071866 | 304 |
| 1171 | iso_pu_bacteria | 2935353572 | 2935354038 | 304 |
| 1172 | iso_pu_bacteria | 637000220 | 637318482 | 304 |
| 1173 | iso_pu_bacteria | 8019769354 | 8019773347 | 304 |
| 1174 | iso_pu_bacteria | 8057798959 | 8057803376 | 304 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3trd-assembly1.cif.gz_A | structure of an alpha-beta serine hydrolase homologue from coxiella burnetii | 0.7887 | 39 | 271 |
| 7qjm-assembly2.cif.gz_B | crystal structure of an alpha/beta-hydrolase enzyme from chloroflexus sp. ms-g (202) | 0.7702 | 38 | 277 |
| 6imp-assembly2.cif.gz_B | crystal structure of alpha-beta hydrolase (abh) from vibrio vulnificus | 0.7696 | 33 | 272 |
| 7wwh-assembly2.cif.gz_B | crystal structure of the geobacillus thermoglucosidasius feruloyl esterase gthfae | 0.7652 | 39 | 271 |
| 7d79-assembly1.cif.gz_A | the structure of dcsb complex with its substrate analogue | 0.7618 | 37 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4E4T5_64_355_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.89 | 39 | 273 | 3.40.50.1820 |
| af_P54069_41_276_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8899 | 26 | 254 | 3.40.50.1820 |
| af_P42840_58_270_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8756 | 42 | 254 | 3.40.50.1820 |
| af_P77538_37_280_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8736 | 20 | 272 | 3.40.50.1820 |
| af_Q54H73_43_283_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8689 | 28 | 273 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A550FN92-F1-model_v4 | Alpha/beta hydrolase | 0.9652 | 13 | 277 |
GO:0016787
|
| AF-A0A4R7A388-F1-model_v4 | deleted | 0.9472 | 11 | 273 |
|
| AF-A0A1M5IFD8-F1-model_v4 | Serine aminopeptidase S33 domain-containing protein | 0.9332 | 37 | 272 |
GO:0016020
|
| AF-A0A2D5CC24-F1-model_v4 | deleted | 0.9306 | 78 | 292 |
|
| AF-A0A853ICX6-F1-model_v4 | Alpha/beta fold hydrolase | 0.9282 | 17 | 276 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar