F491223

General Info

Members Datasets Scaffolds Average Seq Length
1174 469 948 302

Family's Representative Sequence

Representative Sequence 3300041405|Ga0439438_005214|Ga0439438_005214_584_1630
Length 348
Sequence VVENVGASLLAIAMFQSTLMLTVLPQSRAGSLPQGTVFHLFFARFHRMRTLGILCLLLTLSGCSSLLFYPERGLPFTPERAKLDYRDVTLTTADGIRLHGWWLPVKPGVEVKGTVLHLHGNGGNLAWHLGGSWWLPEQGYQVLMVDYRGYGRSEGEPSLPAIYQDIDAAFKWLDQAPQVQGKPLVLLGQSLGGALAVHYLADHPERQPQLKALVLDGVPASYRDVGRFALSTSWLTWALQVPLSWLVPDGDSAIGSVAQLKGVPKLIYHSLDDPIVPLSNGIRLYQAAPPPRVLQLTRGGHVQTFADPVWRTVMLRYLDDPWHFDGLRRLGEIPNYPKSSVESSESPQ

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231031 Pseudomonas sp. GM16 Isolate Nodule
20 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
21 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
22 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
23 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
24 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
25 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
26 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
27 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
28 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
29 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
30 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
31 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
32 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
33 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
34 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
35 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
36 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
37 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
38 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
39 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
40 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
41 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
42 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
43 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
44 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
45 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
46 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
47 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
48 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
49 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
50 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
51 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
52 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
53 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
54 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
55 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
56 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
57 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
58 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
59 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
60 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
61 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
62 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
63 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
64 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
65 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
66 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
67 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
68 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
69 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
70 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
71 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
72 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
73 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
74 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
75 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
76 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
77 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
78 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
79 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
80 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
81 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
82 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
83 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
84 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
85 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
86 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
87 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
88 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
89 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
90 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
91 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
92 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
93 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
94 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
95 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
96 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
97 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
98 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
99 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
100 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
101 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
102 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
103 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
104 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
105 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
106 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
107 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
108 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
109 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
110 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
111 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
112 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
113 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
114 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
115 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
116 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
117 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
118 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
119 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
120 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
121 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
122 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
123 2773857670 Pseudomonas sp. 478 Isolate Unclassified
124 2773857673 Pseudomonas sp. 443 Isolate Unclassified
125 2784132063 Pseudomonas sp. 424 Isolate Unclassified
126 2784132072 Pseudomonas sp. 460 Isolate Unclassified
127 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
128 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
129 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
130 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
131 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
132 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
133 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
134 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
135 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
136 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
137 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
138 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
139 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
140 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
141 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
142 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
143 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
144 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
145 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
146 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
147 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
148 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
149 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
150 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
151 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
152 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
153 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
154 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
155 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
156 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
157 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
158 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
159 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
160 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
161 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
162 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
163 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
164 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
165 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
166 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
167 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
168 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
169 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
170 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
171 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
172 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
173 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
174 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
175 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
176 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
177 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
178 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
179 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
180 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
181 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
182 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
183 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
184 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
185 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
186 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
187 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
188 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
189 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
190 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
191 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
192 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
193 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
194 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
195 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
196 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
197 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
198 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
199 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
200 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
201 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
202 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
203 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
204 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
205 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
206 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
207 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
208 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
209 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
210 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
211 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
212 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
213 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
214 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
215 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
216 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
217 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
218 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
219 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
220 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
221 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
222 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
223 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
224 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
225 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
226 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
227 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
228 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
229 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
230 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
231 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
232 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
233 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
234 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
235 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
236 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
237 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
238 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
239 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
240 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
241 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
242 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
243 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
244 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
245 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
246 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
247 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
248 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
249 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
250 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
251 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
252 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
253 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
254 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
255 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
256 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
257 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
258 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
259 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
260 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
261 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
262 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
263 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
264 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
265 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
266 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
267 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
268 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
269 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
275 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
276 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
278 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
280 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
281 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
301 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
302 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
304 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
305 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
306 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
307 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
308 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
309 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
310 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
311 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
312 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
313 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
314 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
315 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
316 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
317 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
318 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
319 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
320 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
321 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
322 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
323 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
324 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
325 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
326 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
327 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
328 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
329 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
330 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
331 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
332 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
333 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
334 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
335 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
336 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
337 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
338 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
339 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
340 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
341 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
342 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
343 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
344 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
345 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
346 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
347 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
348 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
349 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
350 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
351 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
352 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
353 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
354 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
355 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
356 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
357 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
358 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
359 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
360 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
361 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
362 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
363 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
364 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
365 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
366 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
367 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
368 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
369 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
370 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
371 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
372 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
373 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
374 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
375 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
376 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
377 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
378 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
379 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
380 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
381 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
382 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
383 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
384 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
385 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
386 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
387 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
388 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
389 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
390 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
391 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
392 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
393 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
394 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
395 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
396 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
397 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
398 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
399 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
400 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
401 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
402 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
403 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
404 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
405 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
406 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
407 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
408 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
409 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
410 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
411 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
412 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
413 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
414 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
415 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
416 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
417 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
418 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
419 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
420 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
421 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
422 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
423 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
424 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
425 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
426 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
427 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
428 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
429 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
430 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
431 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
432 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
433 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
434 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
435 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
436 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
437 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
438 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
439 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
442 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
443 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
444 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
445 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
446 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
447 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
448 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
449 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
450 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
451 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
452 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
453 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
454 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
455 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
456 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
457 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
458 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
459 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
460 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
461 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
462 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
463 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
464 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
465 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
466 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
467 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
468 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
469 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.66
Metatranscriptomes 0.09
Isolates 19.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.79
Nodule 2.21
Rhizoplane 6.39
Rhizosphere 73.94
Stem 0
Stem Tuber 0
Unclassified 11.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_9445 2124908027 Bacteria 4397
2 SwRhRL2b_contig_992609 2162886007 Bacteria 1203
3 JGI25162J39368_1000103 3300002737 Bacteria 93730
4 JGI25162J39368_1000318 3300002737 Bacteria 42741
5 JGI25154J39366_1003627 3300002738 Bacteria 3152
6 JGI25163J39215_1000809 3300002771 Bacteria 7533
7 JGI25163J39215_1001291 3300002771 Bacteria 4460
8 JGI25164J39214_1000082 3300002772 Bacteria 93730
9 JGI25164J39214_1000227 3300002772 Bacteria 43917
10 JGI25165J46597_1000185 3300003214 Bacteria 93730
11 JGI25165J46597_1000423 3300003214 Bacteria 43917
12 Ga0006562J51391_1043775 3300003578 Bacteria 1270
13 Ga0055538_1000073 3300003751 Bacteria 90843
14 Ga0055539_1000109 3300003752 Bacteria 90843
15 Ga0055533_1000117 3300003756 Bacteria 90843
16 Ga0055532_1000120 3300003758 Bacteria 81088
17 Ga0055525_1000156 3300003759 Bacteria 90843
18 Ga0055535_1005421 3300003761 Bacteria 2802
19 Ga0055536_1000331 3300003781 Bacteria 34950
20 Ga0055536_1000454 3300003781 Bacteria 28777
21 Ga0055536_1005665 3300003781 Bacteria 6042
22 Ga0055530_10000176 3300003791 Bacteria 58667
23 Ga0055530_10000351 3300003791 Bacteria 41661
24 Ga0055530_10000511 3300003791 Bacteria 33798
25 Ga0055530_10001302 3300003791 Bacteria 18793
26 Ga0055540_1000193 3300003792 Bacteria 58670
27 Ga0055540_1000385 3300003792 Bacteria 36787
28 Ga0055531_10001143 3300003794 Bacteria 20543
29 Ga0055531_10001439 3300003794 Bacteria 17565
30 Ga0055541_1000074 3300003841 Bacteria 90843
31 Ga0065714_10001142 3300005288 Bacteria 1468
32 Ga0065714_10003823 3300005288 Bacteria 7961
33 Ga0065714_10007206 3300005288 Bacteria 5613
34 Ga0065714_10009092 3300005288 Bacteria 2387
35 Ga0065714_10067449 3300005288 Bacteria 5504
36 Ga0065714_10071416 3300005288 Bacteria 3584
37 Ga0065714_10076792 3300005288 Bacteria 2753
38 Ga0065714_10153673 3300005288 Bacteria 1090
39 Ga0065704_10076135 3300005289 Bacteria 5248
40 Ga0065704_10083727 3300005289 Bacteria 3426
41 Ga0065712_10002535 3300005290 Bacteria 5757
42 Ga0065712_10068159 3300005290 Bacteria 13672
43 Ga0065712_10071669 3300005290 Bacteria 5121
44 Ga0065715_10143679 3300005293 Bacteria 1817
45 Ga0070670_100000780 3300005331 Bacteria 24782
46 Ga0070670_100011171 3300005331 Bacteria 7674
47 Ga0070661_100000514 3300005344 Bacteria 29713
48 Ga0070669_100004365 3300005353 Bacteria 10208
49 Ga0070669_100321648 3300005353 Bacteria 1249
50 Ga0070714_100260082 3300005435 Bacteria 1607
51 Ga0070662_100000301 3300005457 Bacteria 29323
52 Ga0068853_100006538 3300005539 Bacteria 9279
53 Ga0070665_100035692 3300005548 Bacteria 5000
54 Ga0070664_100000130 3300005564 Bacteria 50283
55 Ga0068854_100003695 3300005578 Bacteria 9572
56 Ga0068851_10000037 3300005834 Bacteria 97386
57 Ga0075364_10129193 3300006051 Bacteria 1695
58 Ga0075364_10165866 3300006051 Bacteria 1492
59 Ga0075432_10002236 3300006058 Bacteria 6442
60 Ga0075432_10067350 3300006058 Bacteria 1282
61 Ga0075362_10055845 3300006177 Bacteria 1776
62 Ga0075369_10005197 3300006186 Bacteria 4848
63 Ga0075436_100042714 3300006914 Bacteria 3127
64 Ga0075436_100293387 3300006914 Bacteria 1164
65 Ga0079104_1000414 3300006946 Bacteria 49214
66 Ga0079104_1000467 3300006946 Bacteria 45232
67 Ga0079104_1008166 3300006946 Bacteria 3700
68 Ga0099826_10023577 3300006948 Bacteria 4584
69 Ga0105251_10000061 3300009011 Bacteria 102789
70 Ga0105251_10001136 3300009011 Bacteria 23150
71 Ga0105251_10003445 3300009011 Bacteria 11479
72 Ga0105251_10004028 3300009011 Bacteria 10356
73 Ga0105251_10007385 3300009011 Bacteria 6786
74 Ga0105251_10010616 3300009011 Bacteria 5324
75 Ga0105251_10024748 3300009011 Bacteria 3080
76 Ga0105251_10029477 3300009011 Bacteria 2764
77 Ga0105251_10073962 3300009011 Bacteria 1583
78 Ga0105251_10077247 3300009011 Bacteria 1544
79 Ga0105251_10094193 3300009011 Bacteria 1373
80 Ga0105251_10152839 3300009011 Bacteria 1042
81 Ga0105244_10000272 3300009036 Bacteria 52218
82 Ga0105244_10003044 3300009036 Bacteria 12301
83 Ga0105244_10007527 3300009036 Bacteria 6911
84 Ga0105244_10008012 3300009036 Bacteria 6647
85 Ga0105244_10011554 3300009036 Bacteria 5280
86 Ga0105244_10018989 3300009036 Bacteria 3847
87 Ga0105244_10019308 3300009036 Bacteria 3810
88 Ga0105244_10027162 3300009036 Bacteria 3088
89 Ga0105244_10046236 3300009036 Bacteria 2237
90 Ga0105244_10096103 3300009036 Bacteria 1453
91 Ga0105244_10121360 3300009036 Bacteria 1265
92 Ga0105250_10000299 3300009092 Bacteria 39028
93 Ga0105250_10000332 3300009092 Bacteria 36415
94 Ga0105250_10005536 3300009092 Bacteria 5651
95 Ga0105250_10009461 3300009092 Bacteria 4100
96 Ga0105250_10063323 3300009092 Bacteria 1488
97 Ga0105243_10000647 3300009148 Bacteria 34468
98 Ga0105243_10004177 3300009148 Bacteria 11451
99 Ga0105243_10051884 3300009148 Bacteria 3246
100 Ga0105243_10078692 3300009148 Bacteria 2685
101 Ga0105243_10184199 3300009148 Bacteria 1818
102 Ga0105243_10444603 3300009148 Bacteria 1215
103 Ga0105242_10000367 3300009176 Bacteria 36044
104 Ga0105242_10184150 3300009176 Bacteria 1844
105 Ga0105248_10134319 3300009177 Bacteria 2792
106 Ga0105237_10000196 3300009545 Bacteria 85826
107 Ga0105249_10107793 3300009553 Bacteria 2629
108 Ga0105246_10002077 3300011119 Bacteria 12065
109 Ga0105246_10002807 3300011119 Bacteria 10543
110 Ga0105246_10005375 3300011119 Bacteria 7797
111 Ga0157345_1000166 3300012498 Bacteria 10979
112 Ga0157373_10001582 3300013100 Bacteria 17385
113 Ga0157373_10006202 3300013100 Bacteria 8933
114 Ga0157373_10033665 3300013100 Bacteria 3685
115 Ga0157373_10033815 3300013100 Bacteria 3674
116 Ga0157373_10057708 3300013100 Bacteria 2753
117 Ga0157373_10169447 3300013100 Bacteria 1536
118 Ga0157373_10176590 3300013100 Bacteria 1503
119 Ga0157371_10000329 3300013102 Bacteria 61218
120 Ga0157371_10001507 3300013102 Bacteria 24071
121 Ga0157371_10006271 3300013102 Bacteria 9850
122 Ga0157371_10016205 3300013102 Bacteria 5568
123 Ga0157370_10000846 3300013104 Bacteria 38839
124 Ga0157370_10010838 3300013104 Bacteria 9576
125 Ga0157370_10056348 3300013104 Bacteria 3741
126 Ga0157370_10084574 3300013104 Bacteria 2982
127 Ga0157370_10153170 3300013104 Bacteria 2145
128 Ga0157370_10533888 3300013104 Bacteria 1076
129 Ga0157369_10015829 3300013105 Bacteria 8495
130 Ga0157369_10017783 3300013105 Bacteria 7982
131 Ga0157369_10079337 3300013105 Bacteria 3516
132 Ga0163162_10012886 3300013306 Bacteria 8165
133 Ga0163162_10019611 3300013306 Bacteria 6638
134 Ga0163162_10097608 3300013306 Bacteria 3027
135 Ga0157372_10001549 3300013307 Bacteria 25023
136 Ga0157375_10023768 3300013308 Bacteria 5662
137 Ga0157375_10437742 3300013308 Bacteria 1473
138 Ga0182008_10001933 3300014497 Bacteria 13365
139 Ga0182008_10005701 3300014497 Bacteria 7050
140 Ga0182008_10005795 3300014497 Bacteria 6986
141 Ga0182008_10008549 3300014497 Bacteria 5587
142 Ga0182008_10014390 3300014497 Bacteria 4143
143 Ga0182008_10021905 3300014497 Bacteria 3278
144 Ga0182008_10022905 3300014497 Bacteria 3196
145 Ga0182006_1000640 3300015261 Bacteria 24816
146 Ga0182006_1001009 3300015261 Bacteria 18405
147 Ga0182006_1006207 3300015261 Bacteria 5578
148 Ga0182006_1015704 3300015261 Bacteria 3242
149 Ga0182006_1030050 3300015261 Bacteria 2199
150 Ga0182006_1041913 3300015261 Bacteria 1796
151 Ga0182006_1060721 3300015261 Bacteria 1427
152 Ga0182007_10004583 3300015262 Bacteria 6244
153 Ga0182007_10019086 3300015262 Bacteria 2471
154 Ga0182007_10057056 3300015262 Bacteria 1282
155 Ga0182005_1002382 3300015265 Bacteria 6765
156 Ga0182005_1005062 3300015265 Bacteria 4159
157 Ga0182005_1028102 3300015265 Bacteria 1534
158 Ga0163161_10003732 3300017792 Bacteria 10669
159 Ga0163161_10010748 3300017792 Bacteria 6342
160 Ga0163161_10013993 3300017792 Bacteria 5587
161 Ga0163161_10021713 3300017792 Bacteria 4513
162 Ga0163161_10036807 3300017792 Bacteria 3506
163 Ga0163161_10053950 3300017792 Bacteria 2916
164 Ga0163161_10126610 3300017792 Bacteria 1924
165 Ga0163161_10238541 3300017792 Bacteria 1413
166 Ga0209435_100487 3300025206 Bacteria 7849
167 Ga0209760_100021 3300025207 Bacteria 163688
168 Ga0209760_100194 3300025207 Bacteria 29472
169 Ga0209784_100015 3300025224 Bacteria 482117
170 Ga0209566_100012 3300025225 Bacteria 482281
171 Ga0209674_100027 3300025226 Bacteria 482281
172 Ga0209147_100019 3300025229 Bacteria 482139
173 Ga0209563_100031 3300025230 Bacteria 482281
174 Ga0207427_100001 3300025231 Bacteria 1410763
175 Ga0207427_100038 3300025231 Bacteria 292975
176 Ga0209437_100003 3300025233 Bacteria 1517827
177 Ga0209437_100009 3300025233 Bacteria 915954
178 Ga0209258_100296 3300025242 Bacteria 81403
179 Ga0209646_1000292 3300025246 Bacteria 42484
180 Ga0209677_100016 3300025253 Bacteria 482117
181 Ga0209759_1004305 3300025256 Bacteria 5354
182 Ga0209233_1000007 3300025261 Bacteria 1411234
183 Ga0209233_1000074 3300025261 Bacteria 357367
184 Ga0209676_1000016 3300025292 Bacteria 655561
185 Ga0209676_1000056 3300025292 Bacteria 361329
186 Ga0209676_1000524 3300025292 Bacteria 60019
187 Ga0209676_1002719 3300025292 Bacteria 11913
188 Ga0209676_1007863 3300025292 Bacteria 4898
189 Ga0209050_1000060 3300025298 Bacteria 321699
190 Ga0209050_1000208 3300025298 Bacteria 131310
191 Ga0209050_1000361 3300025298 Bacteria 87075
192 Ga0209050_1001601 3300025298 Bacteria 23382
193 Ga0209051_1000037 3300025303 Bacteria 321747
194 Ga0209051_1000061 3300025303 Bacteria 253485
195 Ga0209051_1000368 3300025303 Bacteria 64958
196 Ga0209051_1011404 3300025303 Bacteria 4390
197 Ga0209257_1000637 3300025304 Bacteria 56279
198 Ga0209257_1008780 3300025304 Bacteria 5616
199 Ga0207656_10000014 3300025321 Bacteria 146941
200 Ga0207696_1000032 3300025711 Bacteria 380071
201 Ga0207696_1000034 3300025711 Bacteria 350426
202 Ga0207696_1000293 3300025711 Bacteria 58344
203 Ga0207696_1002462 3300025711 Bacteria 9054
204 Ga0207696_1005740 3300025711 Bacteria 5102
205 Ga0207696_1006743 3300025711 Bacteria 4584
206 Ga0207655_1000005 3300025728 Bacteria 917277
207 Ga0207655_1000015 3300025728 Bacteria 600662
208 Ga0207655_1002213 3300025728 Bacteria 16140
209 Ga0207655_1002214 3300025728 Bacteria 16124
210 Ga0207655_1002284 3300025728 Bacteria 15777
211 Ga0207655_1006185 3300025728 Bacteria 7976
212 Ga0207655_1007329 3300025728 Bacteria 7168
213 Ga0207655_1019949 3300025728 Bacteria 3475
214 Ga0207655_1025950 3300025728 Bacteria 2827
215 Ga0207655_1049318 3300025728 Bacteria 1720
216 Ga0207655_1058096 3300025728 Bacteria 1515
217 Ga0207655_1062492 3300025728 Bacteria 1432
218 Ga0207713_1000014 3300025735 Bacteria 432450
219 Ga0207713_1000493 3300025735 Bacteria 40740
220 Ga0207713_1000696 3300025735 Bacteria 31509
221 Ga0207713_1001099 3300025735 Bacteria 23158
222 Ga0207713_1003197 3300025735 Bacteria 11321
223 Ga0207713_1005108 3300025735 Bacteria 8317
224 Ga0207713_1007824 3300025735 Bacteria 6234
225 Ga0207713_1012139 3300025735 Bacteria 4630
226 Ga0207713_1026477 3300025735 Bacteria 2657
227 Ga0207713_1030419 3300025735 Bacteria 2404
228 Ga0207713_1035227 3300025735 Bacteria 2162
229 Ga0207713_1085410 3300025735 Bacteria 1124
230 Ga0207671_10000019 3300025914 Bacteria 317781
231 Ga0207649_10000002 3300025920 Bacteria 498633
232 Ga0207681_10002090 3300025923 Bacteria 12799
233 Ga0207681_10283474 3300025923 Bacteria 1305
234 Ga0207650_10000337 3300025925 Bacteria 45511
235 Ga0207650_10000421 3300025925 Bacteria 37575
236 Ga0207706_10000136 3300025933 Bacteria 79887
237 Ga0207706_10006583 3300025933 Bacteria 10759
238 Ga0207686_10005889 3300025934 Bacteria 6581
239 Ga0207686_10114636 3300025934 Bacteria 1824
240 Ga0207709_10000134 3300025935 Bacteria 108529
241 Ga0207709_10000699 3300025935 Bacteria 27072
242 Ga0207709_10022130 3300025935 Bacteria 3604
243 Ga0207709_10122234 3300025935 Bacteria 1760
244 Ga0207711_10209994 3300025941 Bacteria 1778
245 Ga0207679_10000006 3300025945 Bacteria 498868
246 Ga0207712_10041152 3300025961 Bacteria 3174
247 Ga0207639_10004918 3300026041 Bacteria 9002
248 Ga0209281_1000010 3300027111 Bacteria 726106
249 Ga0209281_1000013 3300027111 Bacteria 653449
250 Ga0209281_1003222 3300027111 Bacteria 5565
251 Ga0209281_1008557 3300027111 Bacteria 2472
252 Ga0207428_10021829 3300027907 Bacteria 5415
253 Ga0207428_10040345 3300027907 Bacteria 3788
254 Ga0207428_10101950 3300027907 Bacteria 2217
255 Ga0207428_10274082 3300027907 Bacteria 1254
256 Ga0268266_10035410 3300028379 Bacteria 4246
257 Ga0268266_10083646 3300028379 Bacteria 2786
258 Ga0307511_10095374 3300030521 Bacteria 1988
259 Ga0316177_1109772 3300030731 Bacteria 1988
260 Ga0316179_1049348 3300030734 Bacteria 1680
261 Ga0316178_1083052 3300030735 Bacteria 21791
262 Ga0307408_100001820 3300031548 Bacteria 15531
263 Ga0307408_100012631 3300031548 Bacteria 5600
264 Ga0307408_100043394 3300031548 Bacteria 3199
265 Ga0307516_10368403 3300031730 Bacteria 1100
266 Ga0307405_10000600 3300031731 Bacteria 13836
267 Ga0307405_10002971 3300031731 Bacteria 7661
268 Ga0307405_10149243 3300031731 Bacteria 1641
269 Ga0307413_10030392 3300031824 Bacteria 3034
270 Ga0307406_10114529 3300031901 Bacteria 1862
271 Ga0307407_10086328 3300031903 Bacteria 1911
272 Ga0307412_10001424 3300031911 Bacteria 13333
273 Ga0307412_10005406 3300031911 Bacteria 7168
274 Ga0307412_10005742 3300031911 Bacteria 6975
275 Ga0307412_10016716 3300031911 Bacteria 4376
276 Ga0307412_10217496 3300031911 Bacteria 1462
277 Ga0307409_100044538 3300031995 Bacteria 3343
278 Ga0307416_100204640 3300032002 Bacteria 1876
279 Ga0307414_10108449 3300032004 Bacteria 2106
280 Ga0307411_10011937 3300032005 Bacteria 4714
281 Ga0307510_10001784 3300033180 Bacteria 24023
282 Ga0307510_10156796 3300033180 Bacteria 1882
283 Ga0237819_01040 3300038705 Bacteria 8276
284 Ga0439436_0001968 3300041404 Bacteria 6087
285 Ga0439438_001691 3300041405 Bacteria 9708
286 Ga0439438_001751 3300041405 Bacteria 9541
287 Ga0439438_001896 3300041405 Bacteria 9156
288 Ga0439438_005214 3300041405 Bacteria 4822
289 Ga0439438_006476 3300041405 Bacteria 4121
290 Ga0439438_010012 3300041405 Bacteria 3030
291 Ga0439438_012538 3300041405 Bacteria 2596
292 Ga0439438_012742 3300041405 Bacteria 2564
293 Ga0439438_014142 3300041405 Bacteria 2382
294 Ga0439438_018677 3300041405 Bacteria 1970
295 Ga0439447_001121 3300041407 Bacteria 9734
296 Ga0439447_001710 3300041407 Bacteria 8057
297 Ga0439447_002220 3300041407 Bacteria 7124
298 Ga0439447_007855 3300041407 Bacteria 3346
299 Ga0439447_009508 3300041407 Bacteria 2940
300 Ga0439447_013121 3300041407 Bacteria 2358
301 Ga0439447_042694 3300041407 Bacteria 1100
302 Ga0439466_0000163 3300041411 Bacteria 26650
303 Ga0439466_0000942 3300041411 Bacteria 11156
304 Ga0439466_0001747 3300041411 Bacteria 8496
305 Ga0439466_0005958 3300041411 Bacteria 4639
306 Ga0439466_0020529 3300041411 Bacteria 2352
307 Ga0439466_0022787 3300041411 Bacteria 2207
308 Ga0439466_0043014 3300041411 Bacteria 1501
309 Ga0439466_0054574 3300041411 Bacteria 1301
310 Ga0439465_0028286 3300041413 Bacteria 1777
311 Ga0451797_1241239 3300041453 Bacteria 1226
312 Ga0439445_0011656 3300042004 Bacteria 2100
313 Ga0439432_000131 3300042006 Bacteria 24949
314 Ga0439432_002819 3300042006 Bacteria 6481
315 Ga0439432_006745 3300042006 Bacteria 4089
316 Ga0439432_006900 3300042006 Bacteria 4042
317 Ga0439432_019564 3300042006 Bacteria 2254
318 Ga0439451_014086 3300042009 Bacteria 1613
319 Ga0439451_021862 3300042009 Bacteria 1289
320 Ga0439451_051178 3300042009 Bacteria 827
321 Ga0439452_000207 3300042010 Bacteria 42410
322 Ga0439452_001300 3300042010 Bacteria 10516
323 Ga0439452_001453 3300042010 Bacteria 9676
324 Ga0439452_001862 3300042010 Bacteria 8145
325 Ga0439452_003681 3300042010 Bacteria 5306
326 Ga0439456_000074 3300042013 Bacteria 35473
327 Ga0439456_001007 3300042013 Bacteria 5598
328 Ga0439456_013066 3300042013 Bacteria 1725
329 Ga0439463_000239 3300042016 Bacteria 15161
330 Ga0439463_000931 3300042016 Bacteria 8030
331 Ga0439463_027324 3300042016 Bacteria 1436
332 Ga0450911_001690 3300042115 Bacteria 4873
333 Ga0450911_001939 3300042115 Bacteria 4332
334 Ga0450911_004539 3300042115 Bacteria 2266
335 Ga0450919_000714 3300042121 Bacteria 4186
336 Ga0450922_000147 3300042124 Bacteria 7412
337 Ga0450922_003025 3300042124 Bacteria 1552
338 Ga0450890_001456 3300042127 Bacteria 3401
339 Ga0450900_004396 3300042136 Bacteria 1618
340 Ga0450903_006702 3300042138 Bacteria 1907
341 Ga0450903_011976 3300042138 Bacteria 1390
342 Ga0450906_000358 3300042145 Bacteria 9254
343 Ga0450906_006543 3300042145 Bacteria 2346
344 Ga0450906_008131 3300042145 Bacteria 2042
345 Ga0450907_000197 3300042146 Bacteria 21929
346 Ga0450907_000424 3300042146 Bacteria 12604
347 Ga0450907_003201 3300042146 Bacteria 2955
348 Ga0450910_000448 3300042147 Bacteria 4872
349 Ga0450910_000974 3300042147 Bacteria 3469
350 Ga0439446_0003304 3300042156 Bacteria 3983
351 Ga0439446_0012156 3300042156 Bacteria 2348
352 Ga0439446_0014964 3300042156 Bacteria 2147
353 Ga0450908_010909 3300042184 Bacteria 1669
354 Ga0439434_0022457 3300042435 Bacteria 1897
355 Ga0439434_0041343 3300042435 Bacteria 1416
356 Ga0439464_0002872 3300042439 Bacteria 4287
357 Ga0439464_0012958 3300042439 Bacteria 2227
358 Ga0439460_0016720 3300042461 Bacteria 1957
359 Ga0439460_0044875 3300042461 Bacteria 1309
360 Ga0450918_012043 3300042531 Bacteria 1507
361 Ga0439440_0002537 3300042993 Bacteria 3457
362 Ga0439440_0004375 3300042993 Bacteria 2772
363 Ga0439440_0010195 3300042993 Bacteria 1959
364 Ga0495617_000127 3300046452 Bacteria 50396
365 Ga0495617_001743 3300046452 Bacteria 9300
366 Ga0495617_007762 3300046452 Bacteria 3711
367 Ga0495617_019312 3300046452 Bacteria 2304
368 Ga0495617_021559 3300046452 Bacteria 2175
369 Ga0495617_023764 3300046452 Bacteria 2069
370 Ga0495617_039352 3300046452 Bacteria 1581
371 Ga0495617_053812 3300046452 Bacteria 1336
372 Ga0495617_054210 3300046452 Bacteria 1331
373 Ga0495617_071973 3300046452 Bacteria 1137
374 Ga0495627_000074 3300046453 Bacteria 123139
375 Ga0495627_000386 3300046453 Bacteria 40131
376 Ga0495627_000733 3300046453 Bacteria 24765
377 Ga0495627_001977 3300046453 Bacteria 10586
378 Ga0495627_007975 3300046453 Bacteria 4004
379 Ga0495627_012510 3300046453 Bacteria 3007
380 Ga0495627_013168 3300046453 Bacteria 2914
381 Ga0495627_031178 3300046453 Bacteria 1685
382 Ga0495627_067837 3300046453 Bacteria 1045
383 Ga0495603_0012866 3300046455 Bacteria 5059
384 Ga0495603_0195206 3300046455 Bacteria 1170
385 Ga0495590_0001839 3300046457 Bacteria 8980
386 Ga0495590_0002384 3300046457 Bacteria 7783
387 Ga0495590_0007635 3300046457 Bacteria 4154
388 Ga0495590_0043029 3300046457 Bacteria 1575
389 Ga0495591_000581 3300046458 Bacteria 27805
390 Ga0495591_002596 3300046458 Bacteria 9915
391 Ga0495591_004699 3300046458 Bacteria 6555
392 Ga0495591_006527 3300046458 Bacteria 5139
393 Ga0495591_007840 3300046458 Bacteria 4461
394 Ga0495591_009959 3300046458 Bacteria 3729
395 Ga0495591_017008 3300046458 Bacteria 2510
396 Ga0495591_020509 3300046458 Bacteria 2181
397 Ga0495591_044590 3300046458 Bacteria 1241
398 Ga0495591_046310 3300046458 Bacteria 1209
399 Ga0495638_0008766 3300046460 Bacteria 7144
400 Ga0495638_0009529 3300046460 Bacteria 6807
401 Ga0495638_0010749 3300046460 Bacteria 6334
402 Ga0495638_0021218 3300046460 Bacteria 4284
403 Ga0495638_0087848 3300046460 Bacteria 1877
404 Ga0495638_0114492 3300046460 Bacteria 1599
405 Ga0495653_0005407 3300046463 Bacteria 10396
406 Ga0495653_0023087 3300046463 Bacteria 5030
407 Ga0495653_0023163 3300046463 Bacteria 5021
408 Ga0495653_0028970 3300046463 Bacteria 4425
409 Ga0495653_0154263 3300046463 Bacteria 1601
410 Ga0495650_0002993 3300046471 Bacteria 12792
411 Ga0495650_0009577 3300046471 Bacteria 5495
412 Ga0495650_0013923 3300046471 Bacteria 4222
413 Ga0495650_0021060 3300046471 Bacteria 3161
414 Ga0495650_0025032 3300046471 Bacteria 2807
415 Ga0495650_0029622 3300046471 Bacteria 2492
416 Ga0495650_0053515 3300046471 Bacteria 1652
417 Ga0495650_0078131 3300046471 Bacteria 1282
418 Ga0495605_0000182 3300046474 Bacteria 78093
419 Ga0495605_0000356 3300046474 Bacteria 44048
420 Ga0495605_0000543 3300046474 Bacteria 31038
421 Ga0495605_0004727 3300046474 Bacteria 7966
422 Ga0495605_0006153 3300046474 Bacteria 6919
423 Ga0495605_0006890 3300046474 Bacteria 6490
424 Ga0495605_0008292 3300046474 Bacteria 5877
425 Ga0495605_0014838 3300046474 Bacteria 4252
426 Ga0495605_0026615 3300046474 Bacteria 3005
427 Ga0495605_0092019 3300046474 Bacteria 1404
428 Ga0495605_0130529 3300046474 Bacteria 1133
429 Ga0495605_0164407 3300046474 Bacteria 984
430 Ga0495639_0000341 3300046475 Bacteria 22512
431 Ga0495639_0106179 3300046475 Bacteria 1329
432 Ga0495584_0004163 3300046491 Bacteria 7807
433 Ga0495584_0006489 3300046491 Bacteria 6116
434 Ga0495584_0007702 3300046491 Bacteria 5609
435 Ga0495584_0010483 3300046491 Bacteria 4760
436 Ga0495584_0011307 3300046491 Bacteria 4571
437 Ga0495584_0012444 3300046491 Bacteria 4343
438 Ga0495584_0017462 3300046491 Bacteria 3652
439 Ga0495584_0030573 3300046491 Bacteria 2727
440 Ga0495584_0036106 3300046491 Bacteria 2496
441 Ga0495584_0050058 3300046491 Bacteria 2104
442 Ga0495584_0052419 3300046491 Bacteria 2053
443 Ga0495584_0143111 3300046491 Bacteria 1214
444 Ga0495584_0179484 3300046491 Bacteria 1076
445 Ga0495585_0003685 3300046492 Bacteria 10239
446 Ga0495585_0007614 3300046492 Bacteria 6615
447 Ga0495585_0008396 3300046492 Bacteria 6261
448 Ga0495585_0011899 3300046492 Bacteria 5138
449 Ga0495585_0014945 3300046492 Bacteria 4514
450 Ga0495585_0019119 3300046492 Bacteria 3953
451 Ga0495585_0022272 3300046492 Bacteria 3637
452 Ga0495585_0048596 3300046492 Bacteria 2358
453 Ga0495585_0077685 3300046492 Bacteria 1802
454 Ga0495585_0088277 3300046492 Bacteria 1672
455 Ga0495585_0170821 3300046492 Bacteria 1123
456 Ga0495594_0060354 3300046499 Bacteria 2097
457 Ga0495596_0000549 3300046500 Bacteria 23504
458 Ga0495607_0000549 3300046501 Bacteria 36677
459 Ga0495607_0000682 3300046501 Bacteria 32843
460 Ga0495607_0000721 3300046501 Bacteria 31777
461 Ga0495607_0001083 3300046501 Bacteria 24864
462 Ga0495607_0001478 3300046501 Bacteria 20905
463 Ga0495607_0011723 3300046501 Bacteria 5817
464 Ga0495607_0012161 3300046501 Bacteria 5691
465 Ga0495607_0012868 3300046501 Bacteria 5503
466 Ga0495607_0015670 3300046501 Bacteria 4907
467 Ga0495607_0015729 3300046501 Bacteria 4896
468 Ga0495607_0018822 3300046501 Bacteria 4392
469 Ga0495607_0027747 3300046501 Bacteria 3497
470 Ga0495607_0064416 3300046501 Bacteria 2070
471 Ga0495607_0068205 3300046501 Bacteria 1995
472 Ga0495607_0080706 3300046501 Bacteria 1788
473 Ga0495607_0091416 3300046501 Bacteria 1648
474 Ga0495607_0114745 3300046501 Bacteria 1423
475 Ga0495607_0115298 3300046501 Bacteria 1418
476 Ga0495607_0196446 3300046501 Bacteria 1001
477 Ga0495583_0001352 3300046506 Bacteria 25418
478 Ga0495583_0001430 3300046506 Bacteria 24242
479 Ga0495583_0001463 3300046506 Bacteria 23779
480 Ga0495583_0002110 3300046506 Bacteria 17865
481 Ga0495583_0010993 3300046506 Bacteria 5223
482 Ga0495583_0012791 3300046506 Bacteria 4725
483 Ga0495583_0013261 3300046506 Bacteria 4607
484 Ga0495583_0015208 3300046506 Bacteria 4196
485 Ga0495583_0051075 3300046506 Bacteria 1886
486 Ga0495583_0052437 3300046506 Bacteria 1855
487 Ga0495606_0000518 3300046507 Bacteria 62348
488 Ga0495606_0002865 3300046507 Bacteria 19088
489 Ga0495606_0008750 3300046507 Bacteria 8702
490 Ga0495606_0014249 3300046507 Bacteria 6217
491 Ga0495606_0015507 3300046507 Bacteria 5865
492 Ga0495606_0015690 3300046507 Bacteria 5819
493 Ga0495606_0016021 3300046507 Bacteria 5740
494 Ga0495606_0021751 3300046507 Bacteria 4691
495 Ga0495606_0022560 3300046507 Bacteria 4581
496 Ga0495606_0086804 3300046507 Bacteria 1932
497 Ga0495606_0113824 3300046507 Bacteria 1628
498 Ga0495606_0193641 3300046507 Bacteria 1164
499 Ga0495606_0221558 3300046507 Bacteria 1065
500 Ga0495610_0006641 3300046512 Bacteria 7894
501 Ga0495610_0008423 3300046512 Bacteria 6684
502 Ga0495610_0009397 3300046512 Bacteria 6189
503 Ga0495610_0011965 3300046512 Bacteria 5259
504 Ga0495610_0012861 3300046512 Bacteria 5005
505 Ga0495610_0026056 3300046512 Bacteria 3127
506 Ga0495610_0038399 3300046512 Bacteria 2430
507 Ga0495610_0050035 3300046512 Bacteria 2042
508 Ga0495610_0054490 3300046512 Bacteria 1932
509 Ga0495610_0062865 3300046512 Bacteria 1760
510 Ga0495610_0103624 3300046512 Bacteria 1270
511 Ga0495610_0120654 3300046512 Bacteria 1149
512 Ga0495616_0000823 3300046513 Bacteria 22657
513 Ga0495616_0003782 3300046513 Bacteria 9651
514 Ga0495616_0006083 3300046513 Bacteria 7355
515 Ga0495616_0007448 3300046513 Bacteria 6552
516 Ga0495616_0021398 3300046513 Bacteria 3502
517 Ga0495616_0044113 3300046513 Bacteria 2263
518 Ga0495616_0049557 3300046513 Bacteria 2104
519 Ga0495616_0065241 3300046513 Bacteria 1774
520 Ga0495620_0000003 3300046515 Bacteria 345923
521 Ga0495620_0002112 3300046515 Bacteria 11559
522 Ga0495620_0008259 3300046515 Bacteria 5599
523 Ga0495620_0010161 3300046515 Bacteria 4972
524 Ga0495620_0013883 3300046515 Bacteria 4111
525 Ga0495620_0016325 3300046515 Bacteria 3728
526 Ga0495620_0023069 3300046515 Bacteria 2983
527 Ga0495620_0038356 3300046515 Bacteria 2127
528 Ga0495620_0056662 3300046515 Bacteria 1647
529 Ga0495620_0115664 3300046515 Bacteria 1060
530 Ga0495630_0233809 3300046517 Bacteria 1404
531 Ga0495631_0001514 3300046518 Bacteria 14016
532 Ga0495631_0002924 3300046518 Bacteria 9463
533 Ga0495631_0004995 3300046518 Bacteria 6991
534 Ga0495631_0007648 3300046518 Bacteria 5488
535 Ga0495631_0010837 3300046518 Bacteria 4503
536 Ga0495631_0023437 3300046518 Bacteria 2860
537 Ga0495631_0115294 3300046518 Bacteria 1155
538 Ga0495631_0162450 3300046518 Bacteria 958
539 Ga0495632_0000368 3300046519 Bacteria 42948
540 Ga0495632_0001004 3300046519 Bacteria 24462
541 Ga0495632_0001169 3300046519 Bacteria 22351
542 Ga0495632_0001701 3300046519 Bacteria 17921
543 Ga0495632_0003894 3300046519 Bacteria 10373
544 Ga0495632_0004016 3300046519 Bacteria 10165
545 Ga0495632_0006636 3300046519 Bacteria 7402
546 Ga0495632_0006908 3300046519 Bacteria 7212
547 Ga0495632_0009948 3300046519 Bacteria 5680
548 Ga0495632_0011905 3300046519 Bacteria 5051
549 Ga0495632_0015321 3300046519 Bacteria 4304
550 Ga0495632_0018328 3300046519 Bacteria 3843
551 Ga0495632_0019723 3300046519 Bacteria 3667
552 Ga0495632_0022208 3300046519 Bacteria 3403
553 Ga0495632_0053322 3300046519 Bacteria 1986
554 Ga0495632_0066359 3300046519 Bacteria 1741
555 Ga0495637_0000188 3300046520 Bacteria 48464
556 Ga0495637_0001255 3300046520 Bacteria 15304
557 Ga0495637_0004413 3300046520 Bacteria 7302
558 Ga0495637_0005054 3300046520 Bacteria 6777
559 Ga0495637_0005233 3300046520 Bacteria 6643
560 Ga0495637_0006903 3300046520 Bacteria 5666
561 Ga0495637_0009901 3300046520 Bacteria 4635
562 Ga0495637_0011634 3300046520 Bacteria 4223
563 Ga0495637_0014398 3300046520 Bacteria 3731
564 Ga0495637_0020873 3300046520 Bacteria 3006
565 Ga0495637_0028969 3300046520 Bacteria 2468
566 Ga0495637_0030890 3300046520 Bacteria 2373
567 Ga0495637_0039090 3300046520 Bacteria 2050
568 Ga0495637_0045825 3300046520 Bacteria 1852
569 Ga0495637_0045923 3300046520 Bacteria 1849
570 Ga0495643_0000116 3300046522 Bacteria 130165
571 Ga0495643_0001490 3300046522 Bacteria 21278
572 Ga0495643_0008320 3300046522 Bacteria 6580
573 Ga0495643_0008981 3300046522 Bacteria 6280
574 Ga0495643_0025313 3300046522 Bacteria 3358
575 Ga0495643_0044794 3300046522 Bacteria 2402
576 Ga0495643_0057766 3300046522 Bacteria 2066
577 Ga0495643_0076784 3300046522 Bacteria 1746
578 Ga0495643_0115631 3300046522 Bacteria 1359
579 Ga0495644_0004689 3300046523 Bacteria 5372
580 Ga0495644_0004882 3300046523 Bacteria 5265
581 Ga0495644_0006925 3300046523 Bacteria 4387
582 Ga0495644_0007338 3300046523 Bacteria 4259
583 Ga0495644_0027732 3300046523 Bacteria 2145
584 Ga0495648_0001113 3300046524 Bacteria 27255
585 Ga0495648_0001580 3300046524 Bacteria 22187
586 Ga0495648_0007222 3300046524 Bacteria 8922
587 Ga0495648_0010337 3300046524 Bacteria 7117
588 Ga0495648_0019086 3300046524 Bacteria 4834
589 Ga0495648_0019454 3300046524 Bacteria 4773
590 Ga0495648_0019892 3300046524 Bacteria 4700
591 Ga0495648_0021907 3300046524 Bacteria 4413
592 Ga0495648_0022001 3300046524 Bacteria 4400
593 Ga0495648_0029271 3300046524 Bacteria 3657
594 Ga0495648_0036499 3300046524 Bacteria 3169
595 Ga0495648_0067596 3300046524 Bacteria 2089
596 Ga0495648_0084387 3300046524 Bacteria 1797
597 Ga0495648_0114238 3300046524 Bacteria 1463
598 Ga0495666_0036672 3300046526 Bacteria 2387
599 Ga0495666_0047318 3300046526 Bacteria 2071
600 Ga0495666_0093840 3300046526 Bacteria 1415
601 Ga0495642_0000398 3300046528 Bacteria 23371
602 Ga0495642_0002232 3300046528 Bacteria 7932
603 Ga0495652_0267608 3300046529 Bacteria 1258
604 Ga0495654_0000816 3300046530 Bacteria 23764
605 Ga0495654_0001589 3300046530 Bacteria 15411
606 Ga0495654_0008410 3300046530 Bacteria 5702
607 Ga0495654_0008733 3300046530 Bacteria 5582
608 Ga0495654_0009081 3300046530 Bacteria 5455
609 Ga0495654_0011659 3300046530 Bacteria 4748
610 Ga0495654_0013168 3300046530 Bacteria 4430
611 Ga0495654_0015537 3300046530 Bacteria 4040
612 Ga0495654_0015772 3300046530 Bacteria 4007
613 Ga0495654_0018037 3300046530 Bacteria 3702
614 Ga0495654_0020951 3300046530 Bacteria 3404
615 Ga0495654_0022666 3300046530 Bacteria 3258
616 Ga0495654_0027634 3300046530 Bacteria 2906
617 Ga0495654_0071960 3300046530 Bacteria 1637
618 Ga0495654_0082557 3300046530 Bacteria 1503
619 Ga0495654_0132533 3300046530 Bacteria 1117
620 Ga0495654_0138278 3300046530 Bacteria 1087
621 Ga0495654_0147741 3300046530 Bacteria 1042
622 Ga0495587_0179050 3300046536 Bacteria 1203
623 Ga0495609_0000006 3300046538 Bacteria 431833
624 Ga0495609_0002066 3300046538 Bacteria 12632
625 Ga0495609_0005135 3300046538 Bacteria 6971
626 Ga0495609_0007206 3300046538 Bacteria 5579
627 Ga0495609_0009658 3300046538 Bacteria 4657
628 Ga0495609_0012540 3300046538 Bacteria 4019
629 Ga0495609_0043508 3300046538 Bacteria 2016
630 Ga0495609_0070601 3300046538 Bacteria 1535
631 Ga0495609_0074787 3300046538 Bacteria 1485
632 Ga0495609_0089456 3300046538 Bacteria 1339
633 Ga0495609_0134389 3300046538 Bacteria 1058
634 Ga0495597_0000040 3300046542 Bacteria 112292
635 Ga0495597_0003943 3300046542 Bacteria 8356
636 Ga0495597_0009538 3300046542 Bacteria 4788
637 Ga0495597_0011500 3300046542 Bacteria 4290
638 Ga0495597_0032025 3300046542 Bacteria 2388
639 Ga0495597_0065409 3300046542 Bacteria 1577
640 Ga0495597_0069953 3300046542 Bacteria 1513
641 Ga0495597_0120904 3300046542 Bacteria 1091
642 Ga0495645_0109363 3300046543 Bacteria 1957
643 Ga0495622_0003985 3300046557 Bacteria 6896
644 Ga0495622_0004251 3300046557 Bacteria 6669
645 Ga0495622_0005610 3300046557 Bacteria 5819
646 Ga0495622_0016700 3300046557 Bacteria 3418
647 Ga0495622_0017856 3300046557 Bacteria 3303
648 Ga0495633_0006725 3300046558 Bacteria 6768
649 Ga0495633_0008551 3300046558 Bacteria 5752
650 Ga0495633_0025968 3300046558 Bacteria 2879
651 Ga0495633_0146239 3300046558 Bacteria 1092
652 Ga0495656_0001597 3300046615 Bacteria 7418
653 Ga0495668_0004807 3300046616 Bacteria 9403
654 Ga0495668_0012445 3300046616 Bacteria 5044
655 Ga0495668_0070223 3300046616 Bacteria 1925
656 Ga0495668_0070744 3300046616 Bacteria 1918
657 Ga0495668_0114402 3300046616 Bacteria 1475
658 Ga0495668_0162727 3300046616 Bacteria 1222
659 Ga0495634_0004434 3300046642 Bacteria 11024
660 Ga0495634_0084811 3300046642 Bacteria 2065
661 Ga0495611_0000445 3300046648 Bacteria 25121
662 Ga0495611_0007433 3300046648 Bacteria 4653
663 Ga0495611_0168607 3300046648 Bacteria 1023
664 Ga0495625_0000686 3300046660 Bacteria 48243
665 Ga0495625_0018919 3300046660 Bacteria 5360
666 Ga0495625_0029183 3300046660 Bacteria 4128
667 Ga0495625_0036373 3300046660 Bacteria 3619
668 Ga0495625_0040193 3300046660 Bacteria 3413
669 Ga0495625_0078211 3300046660 Bacteria 2309
670 Ga0495625_0096250 3300046660 Bacteria 2039
671 Ga0495635_0005516 3300046663 Bacteria 8798
672 Ga0495635_0088686 3300046663 Bacteria 2116
673 Ga0495659_0003358 3300046664 Bacteria 5129
674 Ga0495659_0004687 3300046664 Bacteria 4303
675 Ga0495661_0000375 3300046665 Bacteria 48246
676 Ga0495661_0000829 3300046665 Bacteria 28983
677 Ga0495661_0001555 3300046665 Bacteria 18931
678 Ga0495661_0002086 3300046665 Bacteria 15691
679 Ga0495661_0008016 3300046665 Bacteria 7333
680 Ga0495661_0018000 3300046665 Bacteria 4654
681 Ga0495661_0027113 3300046665 Bacteria 3680
682 Ga0495661_0034184 3300046665 Bacteria 3199
683 Ga0495661_0057432 3300046665 Bacteria 2323
684 Ga0495661_0063408 3300046665 Bacteria 2184
685 Ga0495623_0010871 3300046679 Bacteria 5892
686 Ga0495646_0010699 3300046680 Bacteria 5828
687 Ga0495646_0012871 3300046680 Bacteria 5318
688 Ga0495646_0052860 3300046680 Bacteria 2451
689 Ga0495669_0009785 3300046684 Bacteria 4048
690 Ga0495669_0140456 3300046684 Bacteria 1140
691 Ga0495613_0055943 3300046689 Bacteria 2897
692 Ga0495613_0088730 3300046689 Bacteria 2240
693 Ga0495624_0014907 3300046690 Bacteria 5263
694 Ga0495670_0001017 3300046691 Bacteria 13618
695 Ga0495670_0002675 3300046691 Bacteria 8791
696 Ga0495670_0002719 3300046691 Bacteria 8735
697 Ga0495670_0006814 3300046691 Bacteria 5624
698 Ga0495670_0016045 3300046691 Bacteria 3682
699 Ga0495670_0031041 3300046691 Bacteria 2654
700 Ga0495670_0062195 3300046691 Bacteria 1878
701 Ga0495670_0176976 3300046691 Bacteria 1125
702 Ga0495671_0002995 3300046692 Bacteria 10491
703 Ga0495671_0003359 3300046692 Bacteria 9874
704 Ga0495671_0007107 3300046692 Bacteria 6411
705 Ga0495671_0012256 3300046692 Bacteria 4687
706 Ga0495671_0016592 3300046692 Bacteria 3929
707 Ga0495671_0018208 3300046692 Bacteria 3729
708 Ga0495671_0023317 3300046692 Bacteria 3232
709 Ga0495671_0025967 3300046692 Bacteria 3040
710 Ga0495671_0028705 3300046692 Bacteria 2862
711 Ga0495671_0130686 3300046692 Bacteria 1224
712 Ga0495671_0135755 3300046692 Bacteria 1199
713 Ga0495671_0163757 3300046692 Bacteria 1081
714 Ga0495649_0000827 3300046694 Bacteria 24883
715 Ga0495649_0002637 3300046694 Bacteria 12504
716 Ga0495649_0004030 3300046694 Bacteria 9674
717 Ga0495649_0004206 3300046694 Bacteria 9441
718 Ga0495649_0007929 3300046694 Bacteria 6423
719 Ga0495649_0012476 3300046694 Bacteria 4939
720 Ga0495649_0013788 3300046694 Bacteria 4652
721 Ga0495649_0015519 3300046694 Bacteria 4334
722 Ga0495649_0018024 3300046694 Bacteria 3977
723 Ga0495649_0026928 3300046694 Bacteria 3192
724 Ga0495649_0030433 3300046694 Bacteria 2981
725 Ga0495649_0034859 3300046694 Bacteria 2768
726 Ga0495649_0052426 3300046694 Bacteria 2210
727 Ga0495649_0053433 3300046694 Bacteria 2186
728 Ga0495649_0056139 3300046694 Bacteria 2126
729 Ga0495649_0180209 3300046694 Bacteria 1102
730 Ga0495589_0001824 3300046794 Bacteria 12113
731 Ga0495589_0002361 3300046794 Bacteria 10592
732 Ga0495589_0003025 3300046794 Bacteria 9244
733 Ga0495589_0009091 3300046794 Bacteria 5164
734 Ga0495589_0009871 3300046794 Bacteria 4959
735 Ga0495589_0060296 3300046794 Bacteria 1863
736 Ga0495589_0066295 3300046794 Bacteria 1768
737 Ga0495589_0084202 3300046794 Bacteria 1546
738 Ga0495600_0017597 3300046809 Bacteria 4548
739 Ga0495600_0078682 3300046809 Bacteria 2153
740 Ga0495660_0000240 3300046810 Bacteria 53422
741 Ga0495660_0010992 3300046810 Bacteria 5258
742 Ga0495660_0014751 3300046810 Bacteria 4519
743 Ga0495660_0019195 3300046810 Bacteria 3925
744 Ga0495660_0028169 3300046810 Bacteria 3175
745 Ga0495660_0035325 3300046810 Bacteria 2793
746 Ga0495660_0035857 3300046810 Bacteria 2768
747 Ga0495660_0040889 3300046810 Bacteria 2568
748 Ga0495660_0042103 3300046810 Bacteria 2524
749 Ga0495660_0043384 3300046810 Bacteria 2481
750 Ga0495660_0045486 3300046810 Bacteria 2409
751 Ga0495660_0058603 3300046810 Bacteria 2073
752 Ga0495660_0084554 3300046810 Bacteria 1659
753 Ga0495660_0089758 3300046810 Bacteria 1599
754 Ga0495660_0097766 3300046810 Bacteria 1515
755 Ga0495660_0118040 3300046810 Bacteria 1345
756 Ga0495660_0148601 3300046810 Bacteria 1159
757 Ga0495581_0200656 3300047315 Bacteria 1167
758 Ga0495604_0019032 3300047317 Bacteria 5499
759 Ga0495604_0020740 3300047317 Bacteria 5247
760 Ga0495674_0303162 3300047319 Bacteria 1304
761 Ga0495672_0005569 3300047320 Bacteria 9957
762 Ga0495672_0007545 3300047320 Bacteria 8162
763 Ga0495672_0008196 3300047320 Bacteria 7750
764 Ga0495672_0008550 3300047320 Bacteria 7535
765 Ga0495672_0011941 3300047320 Bacteria 6090
766 Ga0495672_0015153 3300047320 Bacteria 5247
767 Ga0495672_0019377 3300047320 Bacteria 4489
768 Ga0495672_0019644 3300047320 Bacteria 4453
769 Ga0495672_0019838 3300047320 Bacteria 4422
770 Ga0495672_0020024 3300047320 Bacteria 4395
771 Ga0495672_0023464 3300047320 Bacteria 3992
772 Ga0495672_0024533 3300047320 Bacteria 3882
773 Ga0495672_0065510 3300047320 Bacteria 2076
774 Ga0495672_0084182 3300047320 Bacteria 1764
775 Ga0495672_0110864 3300047320 Bacteria 1473
776 Ga0495676_0000222 3300047321 Bacteria 45631
777 Ga0495676_0075715 3300047321 Bacteria 2572
778 Ga0495676_0099702 3300047321 Bacteria 2152
779 Ga0495680_0008104 3300047322 Bacteria 9575
780 Ga0495680_0046759 3300047322 Bacteria 3409
781 Ga0495680_0177043 3300047322 Bacteria 1541
782 Ga0495680_0344125 3300047322 Bacteria 1039
783 Ga0495683_0002710 3300047323 Bacteria 10560
784 Ga0495683_0003356 3300047323 Bacteria 9358
785 Ga0495683_0013203 3300047323 Bacteria 4325
786 Ga0495683_0013853 3300047323 Bacteria 4207
787 Ga0495683_0016296 3300047323 Bacteria 3860
788 Ga0495683_0040567 3300047323 Bacteria 2351
789 Ga0495687_007131 3300047443 Bacteria 6663
790 Ga0495687_010197 3300047443 Bacteria 5169
791 Ga0495687_027735 3300047443 Bacteria 2645
792 Ga0495675_0013933 3300047444 Bacteria 5084
793 Ga0495677_0007690 3300047445 Bacteria 4021
794 Ga0495679_004383 3300047446 Bacteria 6534
795 Ga0495679_006006 3300047446 Bacteria 5305
796 Ga0495679_006417 3300047446 Bacteria 5064
797 Ga0495679_007031 3300047446 Bacteria 4755
798 Ga0495679_008849 3300047446 Bacteria 4063
799 Ga0495679_017253 3300047446 Bacteria 2587
800 Ga0495679_017586 3300047446 Bacteria 2557
801 Ga0495673_0002441 3300047469 Bacteria 13093
802 Ga0495673_0003472 3300047469 Bacteria 10370
803 Ga0495673_0005327 3300047469 Bacteria 7804
804 Ga0495673_0005781 3300047469 Bacteria 7408
805 Ga0495673_0006416 3300047469 Bacteria 6916
806 Ga0495673_0006941 3300047469 Bacteria 6594
807 Ga0495673_0008018 3300047469 Bacteria 5985
808 Ga0495673_0011839 3300047469 Bacteria 4661
809 Ga0495673_0020645 3300047469 Bacteria 3276
810 Ga0495673_0023144 3300047469 Bacteria 3029
811 Ga0495673_0025236 3300047469 Bacteria 2857
812 Ga0495673_0040591 3300047469 Bacteria 2101
813 Ga0495673_0045333 3300047469 Bacteria 1955
814 Ga0495673_0081634 3300047469 Bacteria 1338
815 Ga0495673_0082858 3300047469 Bacteria 1325
816 Ga0495681_0000762 3300047470 Bacteria 24824
817 Ga0495681_0001492 3300047470 Bacteria 17484
818 Ga0495681_0005311 3300047470 Bacteria 8643
819 Ga0495681_0007723 3300047470 Bacteria 6820
820 Ga0495681_0008379 3300047470 Bacteria 6487
821 Ga0495681_0009356 3300047470 Bacteria 6045
822 Ga0495681_0011422 3300047470 Bacteria 5289
823 Ga0495681_0014993 3300047470 Bacteria 4408
824 Ga0495681_0029940 3300047470 Bacteria 2779
825 Ga0495681_0036180 3300047470 Bacteria 2444
826 Ga0495681_0058080 3300047470 Bacteria 1794
827 Ga0495681_0136921 3300047470 Bacteria 1037
828 Ga0495684_0146057 3300047471 Bacteria 1771
829 Ga0495686_0006823 3300047472 Bacteria 8660
830 Ga0495686_0021995 3300047472 Bacteria 4223
831 Ga0495686_0030736 3300047472 Bacteria 3486
832 Ga0495686_0085400 3300047472 Bacteria 1922
833 Ga0495686_0092459 3300047472 Bacteria 1834
834 Ga0495593_0027293 3300047673 Bacteria 3143
835 Ga0495602_0044318 3300048088 Bacteria 4036
836 Ga0495626_0000912 3300048091 Bacteria 25915
837 Ga0495626_0001329 3300048091 Bacteria 20047
838 Ga0495626_0002633 3300048091 Bacteria 12204
839 Ga0495626_0004026 3300048091 Bacteria 9160
840 Ga0495626_0004635 3300048091 Bacteria 8357
841 Ga0495626_0004953 3300048091 Bacteria 7987
842 Ga0495626_0010127 3300048091 Bacteria 5057
843 Ga0495626_0032624 3300048091 Bacteria 2499
844 Ga0495626_0058680 3300048091 Bacteria 1757
845 Ga0495626_0078320 3300048091 Bacteria 1472
846 Ga0495626_0136372 3300048091 Bacteria 1043
847 Ga0496102_0001186 3300048905 Bacteria 23689
848 Ga0496103_0017077 3300048906 Bacteria 4339
849 Ga0496110_0034103 3300048913 Bacteria 4407
850 Ga0496110_0248534 3300048913 Bacteria 1619
851 Ga0496110_0314329 3300048913 Bacteria 1426
852 Ga0496112_0344035 3300048915 Bacteria 1434
853 Ga0496112_0502950 3300048915 Bacteria 1147
854 Ga0496116_0001251 3300048919 Bacteria 29495
855 Ga0496116_0001286 3300048919 Bacteria 28876
856 Ga0496116_0014906 3300048919 Bacteria 6172
857 Ga0496116_0026599 3300048919 Bacteria 4227
858 Ga0496116_0029406 3300048919 Bacteria 3962
859 Ga0496116_0071203 3300048919 Bacteria 2202
860 Ga0496116_0132555 3300048919 Bacteria 1417
861 Ga0496117_0001478 3300048920 Bacteria 33728
862 Ga0496117_0007829 3300048920 Bacteria 10281
863 Ga0496117_0008263 3300048920 Bacteria 9912
864 Ga0496117_0014270 3300048920 Bacteria 6855
865 Ga0496117_0041468 3300048920 Bacteria 3372
866 Ga0496117_0074046 3300048920 Bacteria 2269
867 Ga0496117_0083595 3300048920 Bacteria 2086
868 Ga0496117_0146187 3300048920 Bacteria 1407
869 Ga0496117_0230430 3300048920 Bacteria 1024
870 Ga0496118_0010210 3300048921 Bacteria 9323
871 Ga0496118_0014312 3300048921 Bacteria 7438
872 Ga0496118_0076077 3300048921 Bacteria 2389
873 Ga0496118_0081141 3300048921 Bacteria 2278
874 Ga0496118_0108771 3300048921 Bacteria 1847
875 Ga0496118_0109579 3300048921 Bacteria 1837
876 Ga0496119_0033252 3300048922 Bacteria 3422
877 Ga0496119_0037107 3300048922 Bacteria 3170
878 Ga0496119_0144003 3300048922 Bacteria 1284
879 Ga0496120_0058811 3300048923 Bacteria 2157
880 Ga0496121_0003226 3300048924 Bacteria 23459
881 Ga0496121_0014222 3300048924 Bacteria 8464
882 Ga0496121_0029574 3300048924 Bacteria 5061
883 Ga0496121_0031430 3300048924 Bacteria 4850
884 Ga0496121_0035177 3300048924 Bacteria 4493
885 Ga0496121_0066698 3300048924 Bacteria 2920
886 Ga0496121_0094464 3300048924 Bacteria 2326
887 Ga0496121_0106329 3300048924 Bacteria 2151
888 Ga0496121_0157443 3300048924 Bacteria 1665
889 Ga0496122_0000750 3300048925 Bacteria 63240
890 Ga0496122_0015024 3300048925 Bacteria 7435
891 Ga0496122_0036813 3300048925 Bacteria 3949
892 Ga0496122_0046641 3300048925 Bacteria 3353
893 Ga0496122_0104384 3300048925 Bacteria 1883
894 Ga0496122_0259751 3300048925 Bacteria 965
895 Ga0496123_0002466 3300048926 Bacteria 22888
896 Ga0496123_0006350 3300048926 Bacteria 11475
897 Ga0496123_0056288 3300048926 Bacteria 2571
898 Ga0496123_0068118 3300048926 Bacteria 2243
899 Ga0496123_0136290 3300048926 Bacteria 1350
900 Ga0496124_0001993 3300048927 Bacteria 27810
901 Ga0496124_0002028 3300048927 Bacteria 27547
902 Ga0496124_0009462 3300048927 Bacteria 10033
903 Ga0496124_0018695 3300048927 Bacteria 6482
904 Ga0496124_0019452 3300048927 Bacteria 6318
905 Ga0496124_0023597 3300048927 Bacteria 5613
906 Ga0496124_0024971 3300048927 Bacteria 5420
907 Ga0496124_0028730 3300048927 Bacteria 4969
908 Ga0496124_0032109 3300048927 Bacteria 4642
909 Ga0496124_0035773 3300048927 Bacteria 4341
910 Ga0496124_0053505 3300048927 Bacteria 3421
911 Ga0496124_0374387 3300048927 Bacteria 998
912 Ga0496125_0009616 3300048928 Bacteria 9887
913 Ga0496125_0028811 3300048928 Bacteria 5004
914 Ga0496125_0030238 3300048928 Bacteria 4848
915 Ga0496125_0035744 3300048928 Bacteria 4351
916 Ga0496125_0067834 3300048928 Bacteria 2808
917 Ga0496125_0110319 3300048928 Bacteria 1995
918 Ga0496126_0023091 3300048929 Bacteria 6030
919 Ga0496126_0074611 3300048929 Bacteria 3011
920 Ga0496126_0106491 3300048929 Bacteria 2447
921 Ga0495678_001841 3300049459 Bacteria 15528
922 Ga0495678_002222 3300049459 Bacteria 13580
923 Ga0495678_002897 3300049459 Bacteria 11050
924 Ga0495678_004142 3300049459 Bacteria 8564
925 Ga0495678_004588 3300049459 Bacteria 7944
926 Ga0495678_005691 3300049459 Bacteria 6784
927 Ga0495678_005950 3300049459 Bacteria 6594
928 Ga0495678_009174 3300049459 Bacteria 4922
929 Ga0495678_016662 3300049459 Bacteria 3352
930 Ga0495678_025348 3300049459 Bacteria 2548
931 Ga0495678_032044 3300049459 Bacteria 2184
932 Ga0495678_053855 3300049459 Bacteria 1542
933 Ga0495678_078503 3300049459 Bacteria 1191
934 Ga0495682_0000426 3300049460 Bacteria 29534
935 Ga0495682_0000616 3300049460 Bacteria 23944
936 Ga0495682_0002905 3300049460 Bacteria 7863
937 Ga0495682_0054116 3300049460 Bacteria 1457
938 Ga0501032_0005995 3300049569 Bacteria 8969
939 Ga0501037_0108012 3300049573 Bacteria 2005
940 Ga0501241_005745 3300049758 Bacteria 2303
941 nmdc:mga03683_115596_c1 3300050489 Bacteria 1190
942 nmdc:mga00v17_36991_c1 3300050491 Bacteria 2912
943 nmdc:mga00v17_67392_c1 3300050491 Bacteria 2211
944 nmdc:mga0sz30_139275_c1 3300050516 Bacteria 1071
945 nmdc:mga0sz30_16174_c1 3300050516 Bacteria 2957
946 Ga0500572_001316 3300053111 Bacteria 6921
947 Ga0500573_0143169 3300053140 Bacteria 1315
948 Ga0500634_0031621 3300053161 Bacteria 2887

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042009 Ga0439451_051178 Ga0439451_051178_17_784 254
2 3300048924 Ga0496121_0094464 Ga0496121_0094464_31_879 281
3 3300046492 Ga0495585_0019119 Ga0495585_0019119_27_875 282
4 3300048927 Ga0496124_0374387 Ga0496124_0374387_45_893 282
5 3300046616 Ga0495668_0070744 Ga0495668_0070744_707_1561 283
6 3300046810 Ga0495660_0000240 Ga0495660_0000240_14566_15420 283
7 3300047320 Ga0495672_0110864 Ga0495672_0110864_485_1339 283
8 iso_pu_bacteria 2912963787 2912964935 283
9 3300013308 Ga0157375_10437742 Ga0157375_104377421 285
10 3300046492 Ga0495585_0014945 Ga0495585_0014945_805_1698 285
11 3300046512 Ga0495610_0120654 Ga0495610_0120654_274_1131 285
12 3300046665 Ga0495661_0001555 Ga0495661_0001555_3223_4116 285
13 3300009148 Ga0105243_10078692 Ga0105243_100786923 286
14 3300046694 Ga0495649_0000827 Ga0495649_0000827_2755_3657 286
15 3300047319 Ga0495674_0303162 Ga0495674_0303162_29_889 286
16 3300041404 Ga0439436_0001968 Ga0439436_0001968_1025_1906 287
17 3300041405 Ga0439438_001751 Ga0439438_001751_5267_6148 287
18 3300041407 Ga0439447_001710 Ga0439447_001710_3243_4124 287
19 3300041411 Ga0439466_0001747 Ga0439466_0001747_3314_4195 287
20 3300042006 Ga0439432_002819 Ga0439432_002819_1444_2325 287
21 3300042156 Ga0439446_0012156 Ga0439446_0012156_743_1624 287
22 3300046463 Ga0495653_0005407 Ga0495653_0005407_7879_8757 287
23 3300046507 Ga0495606_0002865 Ga0495606_0002865_1675_2553 287
24 3300046529 Ga0495652_0267608 Ga0495652_0267608_91_957 287
25 3300048913 Ga0496110_0314329 Ga0496110_0314329_158_1021 287
26 3300049459 Ga0495678_002897 Ga0495678_002897_1666_2544 287
27 3300049569 Ga0501032_0005995 Ga0501032_0005995_1179_2060 287
28 3300049573 Ga0501037_0108012 Ga0501037_0108012_907_1788 287
29 3300046501 Ga0495607_0000682 Ga0495607_0000682_4238_5146 288
30 iso_pu_bacteria 2811994881 2812368358 288
31 iso_pu_bacteria 2923519811 2923522413 288
32 3300005289 Ga0065704_10076135 Ga0065704_100761351 289
33 3300009036 Ga0105244_10019308 Ga0105244_100193083 289
34 3300009148 Ga0105243_10184199 Ga0105243_101841992 289
35 3300046515 Ga0495620_0000003 Ga0495620_0000003_116898_117767 289
36 3300046519 Ga0495632_0000368 Ga0495632_0000368_3829_4698 289
37 3300046522 Ga0495643_0001490 Ga0495643_0001490_17923_18792 289
38 3300046524 Ga0495648_0001580 Ga0495648_0001580_17504_18373 289
39 3300048913 Ga0496110_0248534 Ga0496110_0248534_357_1226 289
40 3300048919 Ga0496116_0029406 Ga0496116_0029406_603_1472 289
41 3300048920 Ga0496117_0001478 Ga0496117_0001478_3723_4592 289
42 3300048920 Ga0496117_0008263 Ga0496117_0008263_2863_3732 289
43 3300048921 Ga0496118_0010210 Ga0496118_0010210_2859_3728 289
44 3300048922 Ga0496119_0144003 Ga0496119_0144003_321_1190 289
45 3300048927 Ga0496124_0019452 Ga0496124_0019452_1903_2772 289
46 3300048927 Ga0496124_0032109 Ga0496124_0032109_1345_2214 289
47 3300048929 Ga0496126_0106491 Ga0496126_0106491_1414_2283 289
48 3300009011 Ga0105251_10024748 Ga0105251_100247482 290
49 3300009036 Ga0105244_10046236 Ga0105244_100462362 290
50 3300025728 Ga0207655_1062492 Ga0207655_10624921 290
51 3300025735 Ga0207713_1035227 Ga0207713_10352272 290
52 3300042010 Ga0439452_001300 Ga0439452_001300_6534_7448 290
53 3300046474 Ga0495605_0008292 Ga0495605_0008292_4589_5503 290
54 3300046491 Ga0495584_0011307 Ga0495584_0011307_3195_4109 290
55 3300046519 Ga0495632_0003894 Ga0495632_0003894_3031_3945 290
56 3300046522 Ga0495643_0115631 Ga0495643_0115631_71_985 290
57 3300046524 Ga0495648_0084387 Ga0495648_0084387_110_1024 290
58 3300046538 Ga0495609_0002066 Ga0495609_0002066_352_1266 290
59 3300046542 Ga0495597_0011500 Ga0495597_0011500_3002_3916 290
60 3300046694 Ga0495649_0002637 Ga0495649_0002637_3213_4127 290
61 3300047443 Ga0495687_027735 Ga0495687_027735_108_1058 290
62 3300049459 Ga0495678_004588 Ga0495678_004588_5802_6716 290
63 iso_pu_bacteria 2600254954 2600447025 290
64 iso_pu_bacteria 8054503363 8054504758 290
65 iso_pu_bacteria 8056131705 8056133121 290
66 3300041411 Ga0439466_0020529 Ga0439466_0020529_328_1230 291
67 3300042439 Ga0439464_0012958 Ga0439464_0012958_942_1841 291
68 3300013102 Ga0157371_10000329 Ga0157371_1000032928 292
69 3300046474 Ga0495605_0000543 Ga0495605_0000543_3856_4746 292
70 3300046530 Ga0495654_0132533 Ga0495654_0132533_131_1021 292
71 iso_pu_bacteria 2599185155 2599328418 292
72 3300046457 Ga0495590_0043029 Ga0495590_0043029_101_1006 293
73 3300046474 Ga0495605_0164407 Ga0495605_0164407_77_967 293
74 3300046507 Ga0495606_0000518 Ga0495606_0000518_20728_21612 293
75 3300046694 Ga0495649_0004030 Ga0495649_0004030_3311_4195 293
76 iso_pu_bacteria 2554235132 2554813603 293
77 iso_pu_bacteria 2606217733 2608381225 293
78 iso_pu_bacteria 2738543020 2739286467 293
79 iso_pu_bacteria 2738543021 2739291780 293
80 iso_pu_bacteria 2823421272 2823422583 293
81 3300005331 Ga0070670_100011171 Ga0070670_1000111718 294
82 3300025925 Ga0207650_10000337 Ga0207650_1000033713 294
83 3300046453 Ga0495627_000386 Ga0495627_000386_36310_37230 294
84 3300046471 Ga0495650_0021060 Ga0495650_0021060_88_1008 294
85 3300046518 Ga0495631_0007648 Ga0495631_0007648_710_1630 294
86 3300046519 Ga0495632_0009948 Ga0495632_0009948_1632_2552 294
87 3300046519 Ga0495632_0015321 Ga0495632_0015321_471_1391 294
88 3300046530 Ga0495654_0008733 Ga0495654_0008733_523_1443 294
89 3300046692 Ga0495671_0003359 Ga0495671_0003359_3143_4063 294
90 3300047469 Ga0495673_0082858 Ga0495673_0082858_12_920 294
91 3300048927 Ga0496124_0035773 Ga0496124_0035773_253_1170 294
92 iso_pu_bacteria 2826581358 2826584180 294
93 iso_pu_bacteria 2842815866 2842820946 294
94 iso_pu_bacteria 2842849001 2842849644 294
95 iso_pu_bacteria 8055878733 8055883907 294
96 3300003781 Ga0055536_1005665 Ga0055536_10056653 295
97 3300013102 Ga0157371_10016205 Ga0157371_100162056 295
98 3300013104 Ga0157370_10084574 Ga0157370_100845743 295
99 3300025292 Ga0209676_1000524 Ga0209676_100052415 295
100 3300042013 Ga0439456_000074 Ga0439456_000074_695_1618 295
101 3300046501 Ga0495607_0000549 Ga0495607_0000549_4456_5418 295
102 3300046536 Ga0495587_0179050 Ga0495587_0179050_127_1050 295
103 3300046542 Ga0495597_0065409 Ga0495597_0065409_285_1208 295
104 3300047469 Ga0495673_0006941 Ga0495673_0006941_4917_5855 295
105 3300049459 Ga0495678_002222 Ga0495678_002222_9495_10382 295
106 3300049460 Ga0495682_0000616 Ga0495682_0000616_20052_20975 295
107 iso_pu_bacteria 2619619299 2621301371 295
108 iso_pu_bacteria 2919456309 2919458227 295
109 iso_pu_bacteria 2939651529 2939653294 295
110 3300009011 Ga0105251_10000061 Ga0105251_1000006193 296
111 3300009036 Ga0105244_10000272 Ga0105244_1000027231 296
112 3300009092 Ga0105250_10000299 Ga0105250_100002996 296
113 3300025711 Ga0207696_1000034 Ga0207696_1000034239 296
114 3300025728 Ga0207655_1006185 Ga0207655_10061856 296
115 3300025735 Ga0207713_1000014 Ga0207713_1000014194 296
116 3300048927 Ga0496124_0053505 Ga0496124_0053505_2101_3021 296
117 iso_pu_bacteria 2597489888 2597862483 296
118 iso_pu_bacteria 2597489889 2597868259 296
119 iso_pu_bacteria 2599185167 2599396919 296
120 iso_pu_bacteria 2599185179 2599448897 296
121 iso_pu_bacteria 2599185189 2599508968 296
122 iso_pu_bacteria 2599185190 2599511344 296
123 iso_pu_bacteria 2599185191 2599517716 296
124 iso_pu_bacteria 2599185288 2599879802 296
125 iso_pu_bacteria 2599185290 2599890718 296
126 iso_pu_bacteria 2599185303 2599948309 296
127 iso_pu_bacteria 2600255296 2601691080 296
128 iso_pu_bacteria 2643221571 2643873291 296
129 iso_pu_bacteria 2643221713 2644624163 296
130 iso_pu_bacteria 2675903420 2677897641 296
131 iso_pu_bacteria 2721755607 2723247375 296
132 iso_pu_bacteria 2738541265 2738673855 296
133 iso_pu_bacteria 2738541282 2738752248 296
134 iso_pu_bacteria 2738541294 2738809264 296
135 iso_pu_bacteria 2738541303 2738861289 296
136 iso_pu_bacteria 2738541309 2738896624 296
137 iso_pu_bacteria 2808606385 2808975410 296
138 iso_pu_bacteria 2808606388 2808990951 296
139 iso_pu_bacteria 2816332298 2817489261 296
140 iso_pu_bacteria 2834028612 2834029168 296
141 iso_pu_bacteria 2842805378 2842808836 296
142 iso_pu_bacteria 2842826826 2842828872 296
143 iso_pu_bacteria 2842837860 2842842603 296
144 iso_pu_bacteria 2852612431 2852615354 296
145 iso_pu_bacteria 2852667396 2852670322 296
146 iso_pu_bacteria 2860867994 2860869221 296
147 iso_pu_bacteria 2908446538 2908448075 296
148 iso_pu_bacteria 2929189879 2929191177 296
149 iso_pu_bacteria 2931390751 2931392181 296
150 iso_pu_bacteria 2945928738 2945929394 296
151 iso_pu_bacteria 2945961074 2945961429 296
152 iso_pu_bacteria 2946006987 2946011665 296
153 iso_pu_bacteria 2946027586 2946029419 296
154 iso_pu_bacteria 2947233263 2947236007 296
155 iso_pu_bacteria 3007872151 3007872853 296
156 iso_pu_bacteria 8054285046 8054285794 296
157 iso_pu_bacteria 8054347763 8054348387 296
158 iso_pu_bacteria 8055817908 8055819201 296
159 iso_pu_bacteria 8056148874 8056149301 296
160 iso_pu_bacteria 8056161164 8056166712 296
161 3300003781 Ga0055536_1000454 Ga0055536_100045422 297
162 3300003791 Ga0055530_10001302 Ga0055530_100013026 297
163 3300003792 Ga0055540_1000385 Ga0055540_100038520 297
164 3300003794 Ga0055531_10001143 Ga0055531_100011436 297
165 3300003794 Ga0055531_10001439 Ga0055531_1000143917 297
166 3300046522 Ga0495643_0000116 Ga0495643_0000116_37570_38466 297
167 3300046558 Ga0495633_0146239 Ga0495633_0146239_110_1006 297
168 3300046660 Ga0495625_0078211 Ga0495625_0078211_344_1240 297
169 3300046692 Ga0495671_0007107 Ga0495671_0007107_1162_2058 297
170 3300048927 Ga0496124_0002028 Ga0496124_0002028_23430_24338 297
171 iso_pu_bacteria 2511231011 2511295554 297
172 iso_pu_bacteria 2511231023 2511367222 297
173 iso_pu_bacteria 2511231031 2511411054 297
174 iso_pu_bacteria 2511231156 2511823084 297
175 iso_pu_bacteria 2599185188 2599501186 297
176 iso_pu_bacteria 2599185212 2599613849 297
177 iso_pu_bacteria 2599185248 2599770739 297
178 iso_pu_bacteria 2599185289 2599886617 297
179 iso_pu_bacteria 2599185291 2599896986 297
180 iso_pu_bacteria 2599185300 2599934090 297
181 iso_pu_bacteria 2599185302 2599942990 297
182 iso_pu_bacteria 2599185304 2599953971 297
183 iso_pu_bacteria 2599185305 2599959483 297
184 iso_pu_bacteria 2599185306 2599966271 297
185 iso_pu_bacteria 2599185308 2599978114 297
186 iso_pu_bacteria 2599185309 2599985286 297
187 iso_pu_bacteria 2599185310 2599987210 297
188 iso_pu_bacteria 2599185311 2599995482 297
189 iso_pu_bacteria 2599185312 2599999961 297
190 iso_pu_bacteria 2599185313 2600008778 297
191 iso_pu_bacteria 2599185314 2600012416 297
192 iso_pu_bacteria 2599185315 2600016678 297
193 iso_pu_bacteria 2599185316 2600024909 297
194 iso_pu_bacteria 2599185317 2600029643 297
195 iso_pu_bacteria 2599185318 2600035465 297
196 iso_pu_bacteria 2599185319 2600041312 297
197 iso_pu_bacteria 2599185320 2600045536 297
198 iso_pu_bacteria 2599185321 2600056524 297
199 iso_pu_bacteria 2599185322 2600058440 297
200 iso_pu_bacteria 2599185323 2600063889 297
201 iso_pu_bacteria 2599185324 2600074816 297
202 iso_pu_bacteria 2599185325 2600079493 297
203 iso_pu_bacteria 2600254930 2600358321 297
204 iso_pu_bacteria 2643221650 2644281535 297
205 iso_pu_bacteria 2651869719 2652546814 297
206 iso_pu_bacteria 2667528170 2671094515 297
207 iso_pu_bacteria 2667528176 2671127872 297
208 iso_pu_bacteria 2675903515 2678261616 297
209 iso_pu_bacteria 2713897148 2715752799 297
210 iso_pu_bacteria 2738543025 2739312841 297
211 iso_pu_bacteria 2744054620 2745007965 297
212 iso_pu_bacteria 2773857673 2774136639 297
213 iso_pu_bacteria 2784132063 2784260394 297
214 iso_pu_bacteria 2791355520 2794594407 297
215 iso_pu_bacteria 2808606361 2808854129 297
216 iso_pu_bacteria 2808606376 2808923420 297
217 iso_pu_bacteria 2808606378 2808934161 297
218 iso_pu_bacteria 2808606380 2808945305 297
219 iso_pu_bacteria 2808606383 2808962438 297
220 iso_pu_bacteria 2808606389 2808997521 297
221 iso_pu_bacteria 2818991456 2819658437 297
222 iso_pu_bacteria 2825651385 2825653661 297
223 iso_pu_bacteria 2842832357 2842835646 297
224 iso_pu_bacteria 2842843487 2842847388 297
225 iso_pu_bacteria 2842854478 2842857217 297
226 iso_pu_bacteria 2852657418 2852662748 297
227 iso_pu_bacteria 2880230671 2880231762 297
228 iso_pu_bacteria 2904518522 2904520797 297
229 iso_pu_bacteria 2913036834 2913037955 297
230 iso_pu_bacteria 2919385768 2919385892 297
231 iso_pu_bacteria 2919481497 2919482864 297
232 iso_pu_bacteria 2919487758 2919490678 297
233 iso_pu_bacteria 2923586266 2923590920 297
234 iso_pu_bacteria 2929144301 2929145410 297
235 iso_pu_bacteria 2931369376 2931371252 297
236 iso_pu_bacteria 2969304461 2969305669 297
237 iso_pu_bacteria 2974289157 2974292704 297
238 iso_pu_bacteria 2988728565 2988732950 297
239 iso_pu_bacteria 2998139840 2998141108 297
240 iso_pu_bacteria 3007614139 3007614191 297
241 iso_pu_bacteria 3007718800 3007721472 297
242 iso_pu_bacteria 3007855910 3007860541 297
243 iso_pu_bacteria 3007861166 3007863670 297
244 iso_pu_bacteria 3007866637 3007871304 297
245 iso_pu_bacteria 8029995093 8029999654 297
246 iso_pu_bacteria 8056143049 8056147874 297
247 iso_pu_bacteria 8056166840 8056169945 297
248 iso_pu_bacteria 8056569372 8056569759 297
249 3300005290 Ga0065712_10068159 Ga0065712_100681596 298
250 3300046501 Ga0495607_0091416 Ga0495607_0091416_245_1165 298
251 3300046520 Ga0495637_0001255 Ga0495637_0001255_10634_11554 298
252 3300047320 Ga0495672_0019644 Ga0495672_0019644_1926_2843 298
253 3300047469 Ga0495673_0002441 Ga0495673_0002441_10573_11493 298
254 3300049459 Ga0495678_001841 Ga0495678_001841_3616_4536 298
255 3300005288 Ga0065714_10009092 Ga0065714_100090922 299
256 3300017792 Ga0163161_10126610 Ga0163161_101266102 299
257 3300041405 Ga0439438_018677 Ga0439438_018677_382_1296 299
258 3300041407 Ga0439447_001121 Ga0439447_001121_5795_6709 299
259 3300042009 Ga0439451_021862 Ga0439451_021862_145_1059 299
260 3300042146 Ga0450907_000197 Ga0450907_000197_20395_21309 299
261 3300042156 Ga0439446_0014964 Ga0439446_0014964_638_1552 299
262 3300042435 Ga0439434_0041343 Ga0439434_0041343_35_949 299
263 3300042993 Ga0439440_0010195 Ga0439440_0010195_638_1552 299
264 3300046453 Ga0495627_000074 Ga0495627_000074_78547_79485 299
265 3300046458 Ga0495591_046310 Ga0495591_046310_131_1033 299
266 3300046460 Ga0495638_0021218 Ga0495638_0021218_3285_4196 299
267 3300046501 Ga0495607_0000721 Ga0495607_0000721_30460_31383 299
268 3300046501 Ga0495607_0114745 Ga0495607_0114745_260_1222 299
269 3300046512 Ga0495610_0050035 Ga0495610_0050035_1005_1907 299
270 3300046520 Ga0495637_0045825 Ga0495637_0045825_424_1416 299
271 3300046522 Ga0495643_0008981 Ga0495643_0008981_431_1333 299
272 3300046524 Ga0495648_0067596 Ga0495648_0067596_100_1002 299
273 3300046542 Ga0495597_0000040 Ga0495597_0000040_34188_35099 299
274 3300046665 Ga0495661_0034184 Ga0495661_0034184_721_1623 299
275 3300046810 Ga0495660_0040889 Ga0495660_0040889_1256_2167 299
276 3300047320 Ga0495672_0084182 Ga0495672_0084182_527_1441 299
277 3300047446 Ga0495679_006417 Ga0495679_006417_1465_2367 299
278 3300053140 Ga0500573_0143169 Ga0500573_0143169_270_1208 299
279 3300053161 Ga0500634_0031621 Ga0500634_0031621_1553_2455 299
280 iso_pu_bacteria 3007419365 3007420744 299
281 3300002738 JGI25154J39366_1003627 JGI25154J39366_10036275 300
282 3300003751 Ga0055538_1000073 Ga0055538_100007387 300
283 3300003752 Ga0055539_1000109 Ga0055539_100010987 300
284 3300003756 Ga0055533_1000117 Ga0055533_100011787 300
285 3300003758 Ga0055532_1000120 Ga0055532_100012036 300
286 3300003759 Ga0055525_1000156 Ga0055525_100015687 300
287 3300003761 Ga0055535_1005421 Ga0055535_10054215 300
288 3300003841 Ga0055541_1000074 Ga0055541_100007487 300
289 3300005288 Ga0065714_10003823 Ga0065714_100038239 300
290 3300005290 Ga0065712_10071669 Ga0065712_100716693 300
291 3300005331 Ga0070670_100000780 Ga0070670_1000007802 300
292 3300005344 Ga0070661_100000514 Ga0070661_10000051423 300
293 3300005353 Ga0070669_100004365 Ga0070669_1000043656 300
294 3300005457 Ga0070662_100000301 Ga0070662_10000030122 300
295 3300005539 Ga0068853_100006538 Ga0068853_1000065388 300
296 3300005564 Ga0070664_100000130 Ga0070664_10000013042 300
297 3300005578 Ga0068854_100003695 Ga0068854_1000036955 300
298 3300005834 Ga0068851_10000037 Ga0068851_1000003768 300
299 3300009011 Ga0105251_10003445 Ga0105251_1000344512 300
300 3300009011 Ga0105251_10004028 Ga0105251_1000402811 300
301 3300009011 Ga0105251_10029477 Ga0105251_100294772 300
302 3300009036 Ga0105244_10003044 Ga0105244_100030448 300
303 3300009036 Ga0105244_10007527 Ga0105244_100075274 300
304 3300009092 Ga0105250_10000332 Ga0105250_100003326 300
305 3300009176 Ga0105242_10000367 Ga0105242_1000036714 300
306 3300009177 Ga0105248_10134319 Ga0105248_101343195 300
307 3300009545 Ga0105237_10000196 Ga0105237_1000019621 300
308 3300011119 Ga0105246_10002077 Ga0105246_100020775 300
309 3300011119 Ga0105246_10005375 Ga0105246_100053756 300
310 3300013100 Ga0157373_10033665 Ga0157373_100336654 300
311 3300013100 Ga0157373_10033815 Ga0157373_100338156 300
312 3300013100 Ga0157373_10057708 Ga0157373_100577084 300
313 3300013100 Ga0157373_10169447 Ga0157373_101694473 300
314 3300013104 Ga0157370_10000846 Ga0157370_1000084613 300
315 3300013105 Ga0157369_10017783 Ga0157369_100177835 300
316 3300013105 Ga0157369_10079337 Ga0157369_100793372 300
317 3300013306 Ga0163162_10097608 Ga0163162_100976082 300
318 3300013308 Ga0157375_10023768 Ga0157375_100237685 300
319 3300014497 Ga0182008_10021905 Ga0182008_100219056 300
320 3300015261 Ga0182006_1000640 Ga0182006_100064024 300
321 3300015262 Ga0182007_10057056 Ga0182007_100570561 300
322 3300017792 Ga0163161_10013993 Ga0163161_100139935 300
323 3300017792 Ga0163161_10021713 Ga0163161_100217136 300
324 3300017792 Ga0163161_10036807 Ga0163161_100368072 300
325 3300017792 Ga0163161_10053950 Ga0163161_100539505 300
326 3300025206 Ga0209435_100487 Ga0209435_1004873 300
327 3300025224 Ga0209784_100015 Ga0209784_100015119 300
328 3300025225 Ga0209566_100012 Ga0209566_100012119 300
329 3300025226 Ga0209674_100027 Ga0209674_100027119 300
330 3300025229 Ga0209147_100019 Ga0209147_100019119 300
331 3300025230 Ga0209563_100031 Ga0209563_100031119 300
332 3300025242 Ga0209258_100296 Ga0209258_1002965 300
333 3300025246 Ga0209646_1000292 Ga0209646_100029212 300
334 3300025253 Ga0209677_100016 Ga0209677_100016119 300
335 3300025256 Ga0209759_1004305 Ga0209759_10043058 300
336 3300025321 Ga0207656_10000014 Ga0207656_1000001439 300
337 3300025711 Ga0207696_1000293 Ga0207696_100029317 300
338 3300025728 Ga0207655_1002284 Ga0207655_10022846 300
339 3300025728 Ga0207655_1025950 Ga0207655_10259502 300
340 3300025735 Ga0207713_1000493 Ga0207713_10004936 300
341 3300025735 Ga0207713_1000696 Ga0207713_10006964 300
342 3300025735 Ga0207713_1030419 Ga0207713_10304192 300
343 3300025914 Ga0207671_10000019 Ga0207671_10000019239 300
344 3300025920 Ga0207649_10000002 Ga0207649_10000002428 300
345 3300025923 Ga0207681_10002090 Ga0207681_100020906 300
346 3300025925 Ga0207650_10000421 Ga0207650_100004217 300
347 3300025933 Ga0207706_10000136 Ga0207706_1000013633 300
348 3300025934 Ga0207686_10005889 Ga0207686_100058895 300
349 3300025941 Ga0207711_10209994 Ga0207711_102099942 300
350 3300025945 Ga0207679_10000006 Ga0207679_1000000663 300
351 3300026041 Ga0207639_10004918 Ga0207639_100049188 300
352 3300028379 Ga0268266_10083646 Ga0268266_100836463 300
353 3300031731 Ga0307405_10000600 Ga0307405_100006004 300
354 3300041453 Ga0451797_1241239 Ga0451797_1241239_183_1088 300
355 3300042006 Ga0439432_000131 Ga0439432_000131_3078_3983 300
356 3300046453 Ga0495627_001977 Ga0495627_001977_5832_6737 300
357 3300046458 Ga0495591_002596 Ga0495591_002596_3195_4100 300
358 3300046506 Ga0495583_0001463 Ga0495583_0001463_19665_20570 300
359 3300046507 Ga0495606_0016021 Ga0495606_0016021_1662_2567 300
360 3300046507 Ga0495606_0113824 Ga0495606_0113824_572_1477 300
361 3300046512 Ga0495610_0026056 Ga0495610_0026056_2078_2983 300
362 3300046512 Ga0495610_0054490 Ga0495610_0054490_116_1021 300
363 3300046519 Ga0495632_0006908 Ga0495632_0006908_1344_2249 300
364 3300046530 Ga0495654_0000816 Ga0495654_0000816_3218_4123 300
365 3300046530 Ga0495654_0027634 Ga0495654_0027634_1924_2829 300
366 3300046665 Ga0495661_0002086 Ga0495661_0002086_10800_11705 300
367 3300046794 Ga0495589_0003025 Ga0495589_0003025_703_1647 300
368 3300046810 Ga0495660_0035857 Ga0495660_0035857_238_1143 300
369 3300047446 Ga0495679_007031 Ga0495679_007031_312_1217 300
370 3300047446 Ga0495679_017586 Ga0495679_017586_1126_2070 300
371 3300047470 Ga0495681_0058080 Ga0495681_0058080_606_1511 300
372 3300048920 Ga0496117_0007829 Ga0496117_0007829_6231_7136 300
373 3300048920 Ga0496117_0041468 Ga0496117_0041468_2445_3350 300
374 3300048921 Ga0496118_0076077 Ga0496118_0076077_123_1028 300
375 3300048922 Ga0496119_0037107 Ga0496119_0037107_37_942 300
376 3300048924 Ga0496121_0066698 Ga0496121_0066698_219_1124 300
377 3300048925 Ga0496122_0046641 Ga0496122_0046641_807_1712 300
378 3300048925 Ga0496122_0259751 Ga0496122_0259751_17_922 300
379 3300048926 Ga0496123_0068118 Ga0496123_0068118_1215_2120 300
380 3300048927 Ga0496124_0009462 Ga0496124_0009462_3141_4046 300
381 3300048927 Ga0496124_0024971 Ga0496124_0024971_1952_2857 300
382 3300048928 Ga0496125_0009616 Ga0496125_0009616_5844_6749 300
383 3300048928 Ga0496125_0028811 Ga0496125_0028811_2385_3290 300
384 3300048928 Ga0496125_0030238 Ga0496125_0030238_2665_3570 300
385 3300048928 Ga0496125_0035744 Ga0496125_0035744_45_950 300
386 3300048928 Ga0496125_0067834 Ga0496125_0067834_89_994 300
387 3300048929 Ga0496126_0023091 Ga0496126_0023091_4817_5722 300
388 3300048929 Ga0496126_0074611 Ga0496126_0074611_221_1126 300
389 iso_pu_bacteria 2511231006 2511266689 300
390 iso_pu_bacteria 2511231007 2511273208 300
391 iso_pu_bacteria 2511231008 2511280009 300
392 iso_pu_bacteria 2511231010 2511290025 300
393 iso_pu_bacteria 2511231012 2511301921 300
394 iso_pu_bacteria 2511231014 2511316012 300
395 iso_pu_bacteria 2511231015 2511318881 300
396 iso_pu_bacteria 2511231016 2511328875 300
397 iso_pu_bacteria 2511231017 2511333284 300
398 iso_pu_bacteria 2511231018 2511340980 300
399 iso_pu_bacteria 2511231019 2511343968 300
400 iso_pu_bacteria 2511231020 2511351262 300
401 iso_pu_bacteria 2511231021 2511356273 300
402 iso_pu_bacteria 2511231022 2511362264 300
403 iso_pu_bacteria 2512047018 2512328574 300
404 iso_pu_bacteria 2582580891 2583790541 300
405 iso_pu_bacteria 2597489887 2597856318 300
406 iso_pu_bacteria 2599185185 2599483427 300
407 iso_pu_bacteria 2599185257 2599805333 300
408 iso_pu_bacteria 2599185307 2599974177 300
409 iso_pu_bacteria 2600254931 2600364040 300
410 iso_pu_bacteria 2600255318 2601800134 300
411 iso_pu_bacteria 2603880185 2606074600 300
412 iso_pu_bacteria 2603880199 2606127463 300
413 iso_pu_bacteria 2623620443 2624478887 300
414 iso_pu_bacteria 2623620446 2624490394 300
415 iso_pu_bacteria 2643221565 2643845500 300
416 iso_pu_bacteria 2643221589 2643952212 300
417 iso_pu_bacteria 2643221602 2644024026 300
418 iso_pu_bacteria 2643221633 2644189223 300
419 iso_pu_bacteria 2671180172 2671767932 300
420 iso_pu_bacteria 2713897149 2715757598 300
421 iso_pu_bacteria 2738541271 2738689903 300
422 iso_pu_bacteria 2738543004 2739198460 300
423 iso_pu_bacteria 2738543015 2739256773 300
424 iso_pu_bacteria 2738543016 2739265677 300
425 iso_pu_bacteria 2740892503 2743735726 300
426 iso_pu_bacteria 2773857670 2774122225 300
427 iso_pu_bacteria 2784132072 2784317584 300
428 iso_pu_bacteria 2808606377 2808928697 300
429 iso_pu_bacteria 2808606381 2808950818 300
430 iso_pu_bacteria 2808606382 2808956607 300
431 iso_pu_bacteria 2808606445 2809215824 300
432 iso_pu_bacteria 2860339153 2860340579 300
433 iso_pu_bacteria 2878029506 2878030847 300
434 iso_pu_bacteria 2904550169 2904553745 300
435 iso_pu_bacteria 2919063839 2919064642 300
436 iso_pu_bacteria 2919697872 2919703681 300
437 iso_pu_bacteria 2923153595 2923154735 300
438 iso_pu_bacteria 2931396565 2931399518 300
439 iso_pu_bacteria 2939636861 2939637976 300
440 iso_pu_bacteria 2984286254 2984291296 300
441 iso_pu_bacteria 3007395558 3007400263 300
442 iso_pu_bacteria 3007511990 3007512481 300
443 iso_pu_bacteria 3007619802 3007622470 300
444 iso_pu_bacteria 8015687852 8015688968 300
445 iso_pu_bacteria 8019775933 8019781831 300
446 iso_pu_bacteria 8055770955 8055772086 300
447 iso_pu_bacteria 8056125926 8056127183 300
448 iso_pu_bacteria 8056155041 8056159659 300
449 iso_pu_bacteria 8056172158 8056176071 300
450 iso_pu_bacteria 8056177738 8056180476 300
451 2162886007 SwRhRL2b_contig_992609 SwRhRL2b_0743.00003250 301
452 3300003791 Ga0055530_10000176 Ga0055530_1000017638 301
453 3300003792 Ga0055540_1000193 Ga0055540_100019338 301
454 3300005288 Ga0065714_10071416 Ga0065714_100714163 301
455 3300005289 Ga0065704_10083727 Ga0065704_100837273 301
456 3300005548 Ga0070665_100035692 Ga0070665_1000356924 301
457 3300006051 Ga0075364_10129193 Ga0075364_101291932 301
458 3300006946 Ga0079104_1000414 Ga0079104_100041436 301
459 3300006946 Ga0079104_1008166 Ga0079104_10081662 301
460 3300006948 Ga0099826_10023577 Ga0099826_100235774 301
461 3300009036 Ga0105244_10018989 Ga0105244_100189894 301
462 3300009036 Ga0105244_10027162 Ga0105244_100271623 301
463 3300009036 Ga0105244_10096103 Ga0105244_100961031 301
464 3300009092 Ga0105250_10005536 Ga0105250_100055364 301
465 3300009092 Ga0105250_10009461 Ga0105250_100094616 301
466 3300009148 Ga0105243_10004177 Ga0105243_100041775 301
467 3300011119 Ga0105246_10002807 Ga0105246_100028078 301
468 3300012498 Ga0157345_1000166 Ga0157345_100016610 301
469 3300013100 Ga0157373_10001582 Ga0157373_1000158217 301
470 3300013100 Ga0157373_10006202 Ga0157373_100062022 301
471 3300013100 Ga0157373_10176590 Ga0157373_101765902 301
472 3300013105 Ga0157369_10015829 Ga0157369_100158292 301
473 3300013306 Ga0163162_10012886 Ga0163162_100128868 301
474 3300013307 Ga0157372_10001549 Ga0157372_100015495 301
475 3300014497 Ga0182008_10005701 Ga0182008_100057016 301
476 3300015261 Ga0182006_1001009 Ga0182006_10010092 301
477 3300015261 Ga0182006_1015704 Ga0182006_10157042 301
478 3300015261 Ga0182006_1030050 Ga0182006_10300502 301
479 3300015261 Ga0182006_1060721 Ga0182006_10607212 301
480 3300015262 Ga0182007_10019086 Ga0182007_100190862 301
481 3300015265 Ga0182005_1028102 Ga0182005_10281022 301
482 3300017792 Ga0163161_10003732 Ga0163161_1000373210 301
483 3300025292 Ga0209676_1007863 Ga0209676_10078636 301
484 3300025298 Ga0209050_1000060 Ga0209050_100006045 301
485 3300025303 Ga0209051_1000037 Ga0209051_100003746 301
486 3300025304 Ga0209257_1008780 Ga0209257_10087802 301
487 3300025711 Ga0207696_1000032 Ga0207696_1000032224 301
488 3300025711 Ga0207696_1002462 Ga0207696_10024628 301
489 3300025728 Ga0207655_1002213 Ga0207655_10022135 301
490 3300025728 Ga0207655_1007329 Ga0207655_10073294 301
491 3300025728 Ga0207655_1019949 Ga0207655_10199492 301
492 3300025728 Ga0207655_1049318 Ga0207655_10493182 301
493 3300025933 Ga0207706_10006583 Ga0207706_100065832 301
494 3300025935 Ga0207709_10000134 Ga0207709_1000013444 301
495 3300027111 Ga0209281_1000010 Ga0209281_1000010193 301
496 3300027111 Ga0209281_1003222 Ga0209281_10032222 301
497 3300027111 Ga0209281_1008557 Ga0209281_10085573 301
498 3300028379 Ga0268266_10035410 Ga0268266_100354102 301
499 3300030731 Ga0316177_1109772 Ga0316177_11097722 301
500 3300030734 Ga0316179_1049348 Ga0316179_10493482 301
501 3300030735 Ga0316178_1083052 Ga0316178_108305217 301
502 3300031548 Ga0307408_100001820 Ga0307408_1000018205 301
503 3300031548 Ga0307408_100012631 Ga0307408_1000126314 301
504 3300031548 Ga0307408_100043394 Ga0307408_1000433941 301
505 3300031731 Ga0307405_10002971 Ga0307405_100029712 301
506 3300031731 Ga0307405_10149243 Ga0307405_101492432 301
507 3300031824 Ga0307413_10030392 Ga0307413_100303922 301
508 3300031901 Ga0307406_10114529 Ga0307406_101145291 301
509 3300031903 Ga0307407_10086328 Ga0307407_100863281 301
510 3300031911 Ga0307412_10001424 Ga0307412_100014243 301
511 3300031911 Ga0307412_10005406 Ga0307412_100054066 301
512 3300031911 Ga0307412_10005742 Ga0307412_100057426 301
513 3300031911 Ga0307412_10016716 Ga0307412_100167164 301
514 3300031911 Ga0307412_10217496 Ga0307412_102174962 301
515 3300031995 Ga0307409_100044538 Ga0307409_1000445384 301
516 3300032002 Ga0307416_100204640 Ga0307416_1002046401 301
517 3300032004 Ga0307414_10108449 Ga0307414_101084493 301
518 3300032005 Ga0307411_10011937 Ga0307411_100119375 301
519 3300033180 Ga0307510_10001784 Ga0307510_1000178422 301
520 3300038705 Ga0237819_01040 Ga0237819_01040_3926_4831 301
521 3300041405 Ga0439438_005214 Ga0439438_005214_584_1630 301
522 3300041405 Ga0439438_006476 Ga0439438_006476_1300_2205 301
523 3300041405 Ga0439438_010012 Ga0439438_010012_1191_2096 301
524 3300041405 Ga0439438_012538 Ga0439438_012538_1061_1966 301
525 3300041405 Ga0439438_014142 Ga0439438_014142_1037_1942 301
526 3300041407 Ga0439447_009508 Ga0439447_009508_696_1742 301
527 3300041407 Ga0439447_013121 Ga0439447_013121_565_1470 301
528 3300041411 Ga0439466_0022787 Ga0439466_0022787_437_1342 301
529 3300041411 Ga0439466_0054574 Ga0439466_0054574_334_1239 301
530 3300042004 Ga0439445_0011656 Ga0439445_0011656_217_1122 301
531 3300042006 Ga0439432_006745 Ga0439432_006745_1187_2092 301
532 3300042006 Ga0439432_006900 Ga0439432_006900_1160_2206 301
533 3300042010 Ga0439452_000207 Ga0439452_000207_38569_39474 301
534 3300042010 Ga0439452_003681 Ga0439452_003681_1192_2238 301
535 3300042013 Ga0439456_013066 Ga0439456_013066_484_1389 301
536 3300042115 Ga0450911_001690 Ga0450911_001690_1032_1937 301
537 3300042136 Ga0450900_004396 Ga0450900_004396_396_1301 301
538 3300042145 Ga0450906_006543 Ga0450906_006543_1038_1943 301
539 3300046452 Ga0495617_001743 Ga0495617_001743_5494_6399 301
540 3300046452 Ga0495617_021559 Ga0495617_021559_299_1204 301
541 3300046452 Ga0495617_053812 Ga0495617_053812_388_1293 301
542 3300046452 Ga0495617_054210 Ga0495617_054210_75_980 301
543 3300046453 Ga0495627_000733 Ga0495627_000733_3175_4080 301
544 3300046453 Ga0495627_007975 Ga0495627_007975_2095_3000 301
545 3300046453 Ga0495627_013168 Ga0495627_013168_1559_2464 301
546 3300046457 Ga0495590_0001839 Ga0495590_0001839_7169_8074 301
547 3300046458 Ga0495591_000581 Ga0495591_000581_3170_4075 301
548 3300046458 Ga0495591_004699 Ga0495591_004699_3129_4034 301
549 3300046458 Ga0495591_017008 Ga0495591_017008_524_1429 301
550 3300046458 Ga0495591_020509 Ga0495591_020509_595_1500 301
551 3300046458 Ga0495591_044590 Ga0495591_044590_263_1168 301
552 3300046460 Ga0495638_0114492 Ga0495638_0114492_409_1314 301
553 3300046463 Ga0495653_0023087 Ga0495653_0023087_3140_4045 301
554 3300046463 Ga0495653_0154263 Ga0495653_0154263_282_1187 301
555 3300046471 Ga0495650_0009577 Ga0495650_0009577_1472_2377 301
556 3300046471 Ga0495650_0053515 Ga0495650_0053515_591_1496 301
557 3300046474 Ga0495605_0006153 Ga0495605_0006153_5718_6623 301
558 3300046474 Ga0495605_0092019 Ga0495605_0092019_85_993 301
559 3300046491 Ga0495584_0012444 Ga0495584_0012444_108_1013 301
560 3300046491 Ga0495584_0036106 Ga0495584_0036106_470_1375 301
561 3300046492 Ga0495585_0007614 Ga0495585_0007614_3213_4118 301
562 3300046492 Ga0495585_0048596 Ga0495585_0048596_535_1440 301
563 3300046492 Ga0495585_0077685 Ga0495585_0077685_491_1396 301
564 3300046492 Ga0495585_0170821 Ga0495585_0170821_136_1041 301
565 3300046500 Ga0495596_0000549 Ga0495596_0000549_19435_20340 301
566 3300046501 Ga0495607_0001083 Ga0495607_0001083_20834_21739 301
567 3300046501 Ga0495607_0012868 Ga0495607_0012868_450_1355 301
568 3300046501 Ga0495607_0068205 Ga0495607_0068205_604_1509 301
569 3300046501 Ga0495607_0115298 Ga0495607_0115298_77_982 301
570 3300046501 Ga0495607_0196446 Ga0495607_0196446_24_929 301
571 3300046506 Ga0495583_0052437 Ga0495583_0052437_515_1420 301
572 3300046507 Ga0495606_0008750 Ga0495606_0008750_2344_3249 301
573 3300046507 Ga0495606_0015690 Ga0495606_0015690_1980_2885 301
574 3300046507 Ga0495606_0022560 Ga0495606_0022560_987_1892 301
575 3300046507 Ga0495606_0086804 Ga0495606_0086804_245_1150 301
576 3300046507 Ga0495606_0221558 Ga0495606_0221558_87_992 301
577 3300046512 Ga0495610_0006641 Ga0495610_0006641_1506_2411 301
578 3300046512 Ga0495610_0012861 Ga0495610_0012861_518_1423 301
579 3300046512 Ga0495610_0062865 Ga0495610_0062865_368_1273 301
580 3300046512 Ga0495610_0103624 Ga0495610_0103624_258_1163 301
581 3300046513 Ga0495616_0000823 Ga0495616_0000823_1001_1906 301
582 3300046513 Ga0495616_0007448 Ga0495616_0007448_2677_3582 301
583 3300046513 Ga0495616_0049557 Ga0495616_0049557_480_1385 301
584 3300046513 Ga0495616_0065241 Ga0495616_0065241_457_1362 301
585 3300046515 Ga0495620_0002112 Ga0495620_0002112_3213_4118 301
586 3300046515 Ga0495620_0013883 Ga0495620_0013883_3150_4055 301
587 3300046515 Ga0495620_0023069 Ga0495620_0023069_489_1394 301
588 3300046515 Ga0495620_0038356 Ga0495620_0038356_465_1370 301
589 3300046515 Ga0495620_0056662 Ga0495620_0056662_633_1538 301
590 3300046518 Ga0495631_0001514 Ga0495631_0001514_516_1421 301
591 3300046518 Ga0495631_0004995 Ga0495631_0004995_2908_3813 301
592 3300046518 Ga0495631_0023437 Ga0495631_0023437_101_1006 301
593 3300046519 Ga0495632_0001701 Ga0495632_0001701_13753_14658 301
594 3300046519 Ga0495632_0004016 Ga0495632_0004016_5844_6749 301
595 3300046519 Ga0495632_0022208 Ga0495632_0022208_517_1422 301
596 3300046519 Ga0495632_0053322 Ga0495632_0053322_309_1214 301
597 3300046520 Ga0495637_0005054 Ga0495637_0005054_3259_4164 301
598 3300046520 Ga0495637_0028969 Ga0495637_0028969_937_1842 301
599 3300046520 Ga0495637_0030890 Ga0495637_0030890_468_1412 301
600 3300046520 Ga0495637_0045923 Ga0495637_0045923_488_1393 301
601 3300046522 Ga0495643_0008320 Ga0495643_0008320_2152_3057 301
602 3300046522 Ga0495643_0044794 Ga0495643_0044794_1025_1930 301
603 3300046523 Ga0495644_0004689 Ga0495644_0004689_1653_2558 301
604 3300046524 Ga0495648_0007222 Ga0495648_0007222_3032_3937 301
605 3300046524 Ga0495648_0010337 Ga0495648_0010337_5698_6603 301
606 3300046524 Ga0495648_0019086 Ga0495648_0019086_1525_2430 301
607 3300046524 Ga0495648_0019892 Ga0495648_0019892_762_1667 301
608 3300046530 Ga0495654_0001589 Ga0495654_0001589_2301_3206 301
609 3300046530 Ga0495654_0020951 Ga0495654_0020951_185_1090 301
610 3300046530 Ga0495654_0071960 Ga0495654_0071960_130_1035 301
611 3300046530 Ga0495654_0138278 Ga0495654_0138278_109_1014 301
612 3300046538 Ga0495609_0005135 Ga0495609_0005135_3263_4168 301
613 3300046538 Ga0495609_0012540 Ga0495609_0012540_495_1400 301
614 3300046538 Ga0495609_0043508 Ga0495609_0043508_636_1541 301
615 3300046538 Ga0495609_0089456 Ga0495609_0089456_364_1269 301
616 3300046538 Ga0495609_0134389 Ga0495609_0134389_46_951 301
617 3300046542 Ga0495597_0009538 Ga0495597_0009538_3182_4087 301
618 3300046557 Ga0495622_0005610 Ga0495622_0005610_4431_5336 301
619 3300046558 Ga0495633_0008551 Ga0495633_0008551_102_1007 301
620 3300046616 Ga0495668_0004807 Ga0495668_0004807_5518_6423 301
621 3300046616 Ga0495668_0114402 Ga0495668_0114402_533_1438 301
622 3300046616 Ga0495668_0162727 Ga0495668_0162727_280_1185 301
623 3300046642 Ga0495634_0084811 Ga0495634_0084811_346_1251 301
624 3300046648 Ga0495611_0000445 Ga0495611_0000445_20791_21696 301
625 3300046660 Ga0495625_0029183 Ga0495625_0029183_2649_3554 301
626 3300046660 Ga0495625_0036373 Ga0495625_0036373_233_1138 301
627 3300046660 Ga0495625_0040193 Ga0495625_0040193_206_1111 301
628 3300046665 Ga0495661_0027113 Ga0495661_0027113_2298_3203 301
629 3300046665 Ga0495661_0063408 Ga0495661_0063408_1117_2022 301
630 3300046680 Ga0495646_0052860 Ga0495646_0052860_959_1864 301
631 3300046689 Ga0495613_0088730 Ga0495613_0088730_528_1433 301
632 3300046690 Ga0495624_0014907 Ga0495624_0014907_1048_1953 301
633 3300046691 Ga0495670_0001017 Ga0495670_0001017_505_1410 301
634 3300046692 Ga0495671_0018208 Ga0495671_0018208_2677_3582 301
635 3300046692 Ga0495671_0025967 Ga0495671_0025967_1467_2372 301
636 3300046692 Ga0495671_0130686 Ga0495671_0130686_74_979 301
637 3300046692 Ga0495671_0163757 Ga0495671_0163757_74_979 301
638 3300046694 Ga0495649_0004206 Ga0495649_0004206_6810_7715 301
639 3300046694 Ga0495649_0007929 Ga0495649_0007929_554_1459 301
640 3300046694 Ga0495649_0015519 Ga0495649_0015519_439_1344 301
641 3300046694 Ga0495649_0052426 Ga0495649_0052426_850_1755 301
642 3300046694 Ga0495649_0053433 Ga0495649_0053433_434_1339 301
643 3300046794 Ga0495589_0001824 Ga0495589_0001824_10711_11616 301
644 3300046794 Ga0495589_0060296 Ga0495589_0060296_458_1363 301
645 3300046794 Ga0495589_0066295 Ga0495589_0066295_65_970 301
646 3300046809 Ga0495600_0078682 Ga0495600_0078682_831_1736 301
647 3300046810 Ga0495660_0010992 Ga0495660_0010992_2315_3220 301
648 3300046810 Ga0495660_0014751 Ga0495660_0014751_3056_3961 301
649 3300046810 Ga0495660_0019195 Ga0495660_0019195_451_1356 301
650 3300046810 Ga0495660_0028169 Ga0495660_0028169_245_1150 301
651 3300046810 Ga0495660_0042103 Ga0495660_0042103_1128_2033 301
652 3300046810 Ga0495660_0045486 Ga0495660_0045486_491_1396 301
653 3300046810 Ga0495660_0097766 Ga0495660_0097766_397_1302 301
654 3300046810 Ga0495660_0118040 Ga0495660_0118040_367_1272 301
655 3300047320 Ga0495672_0015153 Ga0495672_0015153_3354_4259 301
656 3300047320 Ga0495672_0065510 Ga0495672_0065510_486_1391 301
657 3300047321 Ga0495676_0075715 Ga0495676_0075715_591_1496 301
658 3300047321 Ga0495676_0099702 Ga0495676_0099702_489_1394 301
659 3300047322 Ga0495680_0177043 Ga0495680_0177043_238_1143 301
660 3300047323 Ga0495683_0016296 Ga0495683_0016296_642_1547 301
661 3300047443 Ga0495687_007131 Ga0495687_007131_3039_3956 301
662 3300047446 Ga0495679_004383 Ga0495679_004383_2654_3559 301
663 3300047446 Ga0495679_017253 Ga0495679_017253_1208_2113 301
664 3300047469 Ga0495673_0005781 Ga0495673_0005781_3367_4272 301
665 3300047469 Ga0495673_0020645 Ga0495673_0020645_2315_3220 301
666 3300047469 Ga0495673_0025236 Ga0495673_0025236_1473_2378 301
667 3300047469 Ga0495673_0081634 Ga0495673_0081634_146_1051 301
668 3300047470 Ga0495681_0000762 Ga0495681_0000762_20798_21703 301
669 3300047470 Ga0495681_0007723 Ga0495681_0007723_2910_3815 301
670 3300047470 Ga0495681_0014993 Ga0495681_0014993_364_1269 301
671 3300047470 Ga0495681_0036180 Ga0495681_0036180_1020_1925 301
672 3300047471 Ga0495684_0146057 Ga0495684_0146057_301_1206 301
673 3300047472 Ga0495686_0030736 Ga0495686_0030736_466_1371 301
674 3300047472 Ga0495686_0092459 Ga0495686_0092459_457_1362 301
675 3300048088 Ga0495602_0044318 Ga0495602_0044318_943_1848 301
676 3300048091 Ga0495626_0004026 Ga0495626_0004026_3261_4166 301
677 3300048091 Ga0495626_0004635 Ga0495626_0004635_3127_4032 301
678 3300048091 Ga0495626_0032624 Ga0495626_0032624_1468_2373 301
679 3300048091 Ga0495626_0058680 Ga0495626_0058680_495_1400 301
680 3300048091 Ga0495626_0078320 Ga0495626_0078320_84_989 301
681 3300048919 Ga0496116_0001251 Ga0496116_0001251_24146_25051 301
682 3300048919 Ga0496116_0026599 Ga0496116_0026599_2576_3481 301
683 3300048922 Ga0496119_0033252 Ga0496119_0033252_1544_2449 301
684 3300048923 Ga0496120_0058811 Ga0496120_0058811_944_1849 301
685 3300048924 Ga0496121_0031430 Ga0496121_0031430_3154_4059 301
686 3300048926 Ga0496123_0056288 Ga0496123_0056288_1569_2474 301
687 3300049459 Ga0495678_009174 Ga0495678_009174_915_1820 301
688 3300049459 Ga0495678_016662 Ga0495678_016662_604_1509 301
689 3300049459 Ga0495678_025348 Ga0495678_025348_1412_2317 301
690 3300049459 Ga0495678_053855 Ga0495678_053855_95_1000 301
691 3300049460 Ga0495682_0002905 Ga0495682_0002905_513_1418 301
692 3300049758 Ga0501241_005745 Ga0501241_005745_456_1361 301
693 3300050491 nmdc:mga00v17_67392_c1 nmdc:mga00v17_67392_c1_1012_1917 301
694 3300053111 Ga0500572_001316 Ga0500572_001316_5577_6482 301
695 iso_pu_bacteria 2844665904 2844668610 301
696 3300046471 Ga0495650_0025032 Ga0495650_0025032_1533_2450 302
697 3300046474 Ga0495605_0000182 Ga0495605_0000182_37444_38361 302
698 3300046506 Ga0495583_0001430 Ga0495583_0001430_3400_4317 302
699 3300046506 Ga0495583_0013261 Ga0495583_0013261_402_1367 302
700 3300046519 Ga0495632_0001004 Ga0495632_0001004_3425_4342 302
701 3300046538 Ga0495609_0000006 Ga0495609_0000006_371400_372353 302
702 3300046538 Ga0495609_0070601 Ga0495609_0070601_445_1398 302
703 3300046543 Ga0495645_0109363 Ga0495645_0109363_446_1378 302
704 3300046665 Ga0495661_0000829 Ga0495661_0000829_24655_25572 302
705 3300047469 Ga0495673_0040591 Ga0495673_0040591_1003_1956 302
706 3300009011 Ga0105251_10010616 Ga0105251_100106164 303
707 3300009036 Ga0105244_10011554 Ga0105244_100115542 303
708 3300009148 Ga0105243_10051884 Ga0105243_100518844 303
709 3300025728 Ga0207655_1000005 Ga0207655_1000005315 303
710 3300025728 Ga0207655_1000015 Ga0207655_1000015404 303
711 3300025735 Ga0207713_1007824 Ga0207713_10078244 303
712 3300046453 Ga0495627_067837 Ga0495627_067837_72_983 303
713 3300046460 Ga0495638_0009529 Ga0495638_0009529_3959_4870 303
714 3300046471 Ga0495650_0078131 Ga0495650_0078131_21_932 303
715 3300046501 Ga0495607_0015729 Ga0495607_0015729_565_1500 303
716 3300046520 Ga0495637_0005233 Ga0495637_0005233_2655_3566 303
717 3300046694 Ga0495649_0018024 Ga0495649_0018024_61_972 303
718 3300047470 Ga0495681_0009356 Ga0495681_0009356_502_1413 303
719 3300048924 Ga0496121_0014222 Ga0496121_0014222_3216_4133 303
720 2124908027 MRS2a_Contig_9445 MRS2a_00333510 304
721 3300002737 JGI25162J39368_1000103 JGI25162J39368_100010358 304
722 3300002737 JGI25162J39368_1000318 JGI25162J39368_100031836 304
723 3300002771 JGI25163J39215_1000809 JGI25163J39215_10008093 304
724 3300002771 JGI25163J39215_1001291 JGI25163J39215_10012915 304
725 3300002772 JGI25164J39214_1000082 JGI25164J39214_100008218 304
726 3300002772 JGI25164J39214_1000227 JGI25164J39214_100022736 304
727 3300003214 JGI25165J46597_1000185 JGI25165J46597_100018518 304
728 3300003214 JGI25165J46597_1000423 JGI25165J46597_100042336 304
729 3300003578 Ga0006562J51391_1043775 Ga0006562J51391_10437751 304
730 3300003781 Ga0055536_1000331 Ga0055536_100033128 304
731 3300003791 Ga0055530_10000351 Ga0055530_1000035117 304
732 3300003791 Ga0055530_10000511 Ga0055530_1000051129 304
733 3300005288 Ga0065714_10001142 Ga0065714_100011422 304
734 3300005288 Ga0065714_10007206 Ga0065714_100072062 304
735 3300005288 Ga0065714_10067449 Ga0065714_100674493 304
736 3300005288 Ga0065714_10076792 Ga0065714_100767923 304
737 3300005288 Ga0065714_10153673 Ga0065714_101536731 304
738 3300005290 Ga0065712_10002535 Ga0065712_100025353 304
739 3300005293 Ga0065715_10143679 Ga0065715_101436792 304
740 3300005353 Ga0070669_100321648 Ga0070669_1003216481 304
741 3300005435 Ga0070714_100260082 Ga0070714_1002600822 304
742 3300006051 Ga0075364_10165866 Ga0075364_101658662 304
743 3300006058 Ga0075432_10002236 Ga0075432_100022362 304
744 3300006058 Ga0075432_10067350 Ga0075432_100673502 304
745 3300006177 Ga0075362_10055845 Ga0075362_100558452 304
746 3300006186 Ga0075369_10005197 Ga0075369_100051974 304
747 3300006914 Ga0075436_100042714 Ga0075436_1000427144 304
748 3300006914 Ga0075436_100293387 Ga0075436_1002933872 304
749 3300006946 Ga0079104_1000467 Ga0079104_10004677 304
750 3300009011 Ga0105251_10001136 Ga0105251_1000113615 304
751 3300009011 Ga0105251_10007385 Ga0105251_100073852 304
752 3300009011 Ga0105251_10073962 Ga0105251_100739622 304
753 3300009011 Ga0105251_10077247 Ga0105251_100772472 304
754 3300009011 Ga0105251_10094193 Ga0105251_100941932 304
755 3300009011 Ga0105251_10152839 Ga0105251_101528391 304
756 3300009036 Ga0105244_10008012 Ga0105244_100080125 304
757 3300009036 Ga0105244_10121360 Ga0105244_101213602 304
758 3300009092 Ga0105250_10063323 Ga0105250_100633232 304
759 3300009148 Ga0105243_10000647 Ga0105243_100006475 304
760 3300009148 Ga0105243_10444603 Ga0105243_104446032 304
761 3300009176 Ga0105242_10184150 Ga0105242_101841503 304
762 3300009553 Ga0105249_10107793 Ga0105249_101077932 304
763 3300013102 Ga0157371_10001507 Ga0157371_100015075 304
764 3300013102 Ga0157371_10006271 Ga0157371_100062717 304
765 3300013104 Ga0157370_10010838 Ga0157370_100108382 304
766 3300013104 Ga0157370_10056348 Ga0157370_100563482 304
767 3300013104 Ga0157370_10153170 Ga0157370_101531703 304
768 3300013104 Ga0157370_10533888 Ga0157370_105338882 304
769 3300013306 Ga0163162_10019611 Ga0163162_100196114 304
770 3300014497 Ga0182008_10001933 Ga0182008_1000193312 304
771 3300014497 Ga0182008_10005795 Ga0182008_100057954 304
772 3300014497 Ga0182008_10008549 Ga0182008_100085492 304
773 3300014497 Ga0182008_10014390 Ga0182008_100143905 304
774 3300014497 Ga0182008_10022905 Ga0182008_100229052 304
775 3300015261 Ga0182006_1006207 Ga0182006_10062075 304
776 3300015261 Ga0182006_1041913 Ga0182006_10419132 304
777 3300015262 Ga0182007_10004583 Ga0182007_100045836 304
778 3300015265 Ga0182005_1002382 Ga0182005_10023822 304
779 3300015265 Ga0182005_1005062 Ga0182005_10050625 304
780 3300017792 Ga0163161_10010748 Ga0163161_100107485 304
781 3300017792 Ga0163161_10238541 Ga0163161_102385412 304
782 3300025207 Ga0209760_100021 Ga0209760_100021105 304
783 3300025207 Ga0209760_100194 Ga0209760_10019418 304
784 3300025231 Ga0207427_100001 Ga0207427_100001296 304
785 3300025231 Ga0207427_100038 Ga0207427_10003818 304
786 3300025233 Ga0209437_100003 Ga0209437_1000031076 304
787 3300025233 Ga0209437_100009 Ga0209437_100009645 304
788 3300025261 Ga0209233_1000007 Ga0209233_1000007296 304
789 3300025261 Ga0209233_1000074 Ga0209233_100007418 304
790 3300025292 Ga0209676_1000016 Ga0209676_100001619 304
791 3300025292 Ga0209676_1000056 Ga0209676_100005635 304
792 3300025292 Ga0209676_1002719 Ga0209676_10027199 304
793 3300025298 Ga0209050_1000208 Ga0209050_1000208105 304
794 3300025298 Ga0209050_1000361 Ga0209050_100036135 304
795 3300025298 Ga0209050_1001601 Ga0209050_10016016 304
796 3300025303 Ga0209051_1000061 Ga0209051_100006135 304
797 3300025303 Ga0209051_1000368 Ga0209051_100036836 304
798 3300025303 Ga0209051_1011404 Ga0209051_10114042 304
799 3300025304 Ga0209257_1000637 Ga0209257_100063714 304
800 3300025711 Ga0207696_1005740 Ga0207696_10057405 304
801 3300025711 Ga0207696_1006743 Ga0207696_10067434 304
802 3300025728 Ga0207655_1002214 Ga0207655_10022146 304
803 3300025728 Ga0207655_1058096 Ga0207655_10580962 304
804 3300025735 Ga0207713_1001099 Ga0207713_10010999 304
805 3300025735 Ga0207713_1003197 Ga0207713_100319711 304
806 3300025735 Ga0207713_1005108 Ga0207713_10051085 304
807 3300025735 Ga0207713_1012139 Ga0207713_10121394 304
808 3300025735 Ga0207713_1026477 Ga0207713_10264772 304
809 3300025735 Ga0207713_1085410 Ga0207713_10854102 304
810 3300025923 Ga0207681_10283474 Ga0207681_102834742 304
811 3300025934 Ga0207686_10114636 Ga0207686_101146361 304
812 3300025935 Ga0207709_10000699 Ga0207709_1000069923 304
813 3300025935 Ga0207709_10022130 Ga0207709_100221304 304
814 3300025935 Ga0207709_10122234 Ga0207709_101222342 304
815 3300025961 Ga0207712_10041152 Ga0207712_100411523 304
816 3300027111 Ga0209281_1000013 Ga0209281_1000013341 304
817 3300027907 Ga0207428_10021829 Ga0207428_100218294 304
818 3300027907 Ga0207428_10040345 Ga0207428_100403452 304
819 3300027907 Ga0207428_10101950 Ga0207428_101019502 304
820 3300027907 Ga0207428_10274082 Ga0207428_102740822 304
821 3300030521 Ga0307511_10095374 Ga0307511_100953742 304
822 3300031730 Ga0307516_10368403 Ga0307516_103684032 304
823 3300033180 Ga0307510_10156796 Ga0307510_101567962 304
824 3300041405 Ga0439438_001691 Ga0439438_001691_5620_6534 304
825 3300041405 Ga0439438_001896 Ga0439438_001896_5232_6146 304
826 3300041405 Ga0439438_012742 Ga0439438_012742_268_1182 304
827 3300041407 Ga0439447_002220 Ga0439447_002220_758_1672 304
828 3300041407 Ga0439447_007855 Ga0439447_007855_2166_3080 304
829 3300041407 Ga0439447_042694 Ga0439447_042694_155_1069 304
830 3300041411 Ga0439466_0000163 Ga0439466_0000163_3129_4046 304
831 3300041411 Ga0439466_0000942 Ga0439466_0000942_8216_9130 304
832 3300041411 Ga0439466_0005958 Ga0439466_0005958_712_1626 304
833 3300041411 Ga0439466_0043014 Ga0439466_0043014_479_1393 304
834 3300041413 Ga0439465_0028286 Ga0439465_0028286_608_1522 304
835 3300042006 Ga0439432_019564 Ga0439432_019564_266_1180 304
836 3300042009 Ga0439451_014086 Ga0439451_014086_23_1015 304
837 3300042010 Ga0439452_001453 Ga0439452_001453_3046_3960 304
838 3300042010 Ga0439452_001862 Ga0439452_001862_4166_5080 304
839 3300042013 Ga0439456_001007 Ga0439456_001007_1408_2322 304
840 3300042016 Ga0439463_000239 Ga0439463_000239_11289_12227 304
841 3300042016 Ga0439463_000931 Ga0439463_000931_3058_3975 304
842 3300042016 Ga0439463_027324 Ga0439463_027324_73_987 304
843 3300042115 Ga0450911_001939 Ga0450911_001939_328_1242 304
844 3300042115 Ga0450911_004539 Ga0450911_004539_1012_1926 304
845 3300042121 Ga0450919_000714 Ga0450919_000714_1107_2021 304
846 3300042124 Ga0450922_000147 Ga0450922_000147_3359_4273 304
847 3300042124 Ga0450922_003025 Ga0450922_003025_462_1376 304
848 3300042127 Ga0450890_001456 Ga0450890_001456_366_1280 304
849 3300042138 Ga0450903_006702 Ga0450903_006702_92_1006 304
850 3300042138 Ga0450903_011976 Ga0450903_011976_360_1274 304
851 3300042145 Ga0450906_000358 Ga0450906_000358_511_1425 304
852 3300042145 Ga0450906_008131 Ga0450906_008131_1081_1995 304
853 3300042146 Ga0450907_000424 Ga0450907_000424_8663_9577 304
854 3300042146 Ga0450907_003201 Ga0450907_003201_765_1679 304
855 3300042147 Ga0450910_000448 Ga0450910_000448_1334_2248 304
856 3300042147 Ga0450910_000974 Ga0450910_000974_509_1423 304
857 3300042156 Ga0439446_0003304 Ga0439446_0003304_926_1840 304
858 3300042184 Ga0450908_010909 Ga0450908_010909_452_1366 304
859 3300042435 Ga0439434_0022457 Ga0439434_0022457_532_1446 304
860 3300042439 Ga0439464_0002872 Ga0439464_0002872_2303_3217 304
861 3300042461 Ga0439460_0016720 Ga0439460_0016720_40_954 304
862 3300042461 Ga0439460_0044875 Ga0439460_0044875_83_997 304
863 3300042531 Ga0450918_012043 Ga0450918_012043_306_1220 304
864 3300042993 Ga0439440_0002537 Ga0439440_0002537_2159_3076 304
865 3300042993 Ga0439440_0004375 Ga0439440_0004375_1116_2030 304
866 3300046452 Ga0495617_000127 Ga0495617_000127_3124_4038 304
867 3300046452 Ga0495617_007762 Ga0495617_007762_310_1224 304
868 3300046452 Ga0495617_019312 Ga0495617_019312_912_1826 304
869 3300046452 Ga0495617_023764 Ga0495617_023764_440_1354 304
870 3300046452 Ga0495617_039352 Ga0495617_039352_555_1469 304
871 3300046452 Ga0495617_071973 Ga0495617_071973_17_931 304
872 3300046453 Ga0495627_012510 Ga0495627_012510_238_1152 304
873 3300046453 Ga0495627_031178 Ga0495627_031178_186_1106 304
874 3300046455 Ga0495603_0012866 Ga0495603_0012866_840_1754 304
875 3300046455 Ga0495603_0195206 Ga0495603_0195206_140_1054 304
876 3300046457 Ga0495590_0002384 Ga0495590_0002384_3764_4678 304
877 3300046457 Ga0495590_0007635 Ga0495590_0007635_107_1021 304
878 3300046458 Ga0495591_006527 Ga0495591_006527_803_1756 304
879 3300046458 Ga0495591_007840 Ga0495591_007840_374_1294 304
880 3300046458 Ga0495591_009959 Ga0495591_009959_2703_3617 304
881 3300046460 Ga0495638_0008766 Ga0495638_0008766_3059_3973 304
882 3300046460 Ga0495638_0010749 Ga0495638_0010749_3173_4087 304
883 3300046460 Ga0495638_0087848 Ga0495638_0087848_525_1439 304
884 3300046463 Ga0495653_0023163 Ga0495653_0023163_3186_4100 304
885 3300046463 Ga0495653_0028970 Ga0495653_0028970_722_1636 304
886 3300046471 Ga0495650_0002993 Ga0495650_0002993_1941_2885 304
887 3300046471 Ga0495650_0013923 Ga0495650_0013923_1455_2369 304
888 3300046471 Ga0495650_0029622 Ga0495650_0029622_114_1028 304
889 3300046474 Ga0495605_0000356 Ga0495605_0000356_3475_4413 304
890 3300046474 Ga0495605_0004727 Ga0495605_0004727_3111_4025 304
891 3300046474 Ga0495605_0006890 Ga0495605_0006890_5519_6457 304
892 3300046474 Ga0495605_0014838 Ga0495605_0014838_61_1011 304
893 3300046474 Ga0495605_0026615 Ga0495605_0026615_1716_2630 304
894 3300046474 Ga0495605_0130529 Ga0495605_0130529_17_961 304
895 3300046475 Ga0495639_0000341 Ga0495639_0000341_3105_4019 304
896 3300046475 Ga0495639_0106179 Ga0495639_0106179_401_1315 304
897 3300046491 Ga0495584_0004163 Ga0495584_0004163_475_1389 304
898 3300046491 Ga0495584_0006489 Ga0495584_0006489_4416_5330 304
899 3300046491 Ga0495584_0007702 Ga0495584_0007702_119_1033 304
900 3300046491 Ga0495584_0010483 Ga0495584_0010483_331_1245 304
901 3300046491 Ga0495584_0017462 Ga0495584_0017462_2348_3262 304
902 3300046491 Ga0495584_0030573 Ga0495584_0030573_1091_2005 304
903 3300046491 Ga0495584_0050058 Ga0495584_0050058_1123_2067 304
904 3300046491 Ga0495584_0052419 Ga0495584_0052419_504_1418 304
905 3300046491 Ga0495584_0143111 Ga0495584_0143111_219_1133 304
906 3300046491 Ga0495584_0179484 Ga0495584_0179484_105_1019 304
907 3300046492 Ga0495585_0003685 Ga0495585_0003685_3031_3945 304
908 3300046492 Ga0495585_0008396 Ga0495585_0008396_4501_5415 304
909 3300046492 Ga0495585_0011899 Ga0495585_0011899_3720_4634 304
910 3300046492 Ga0495585_0022272 Ga0495585_0022272_574_1488 304
911 3300046492 Ga0495585_0088277 Ga0495585_0088277_93_1037 304
912 3300046499 Ga0495594_0060354 Ga0495594_0060354_638_1552 304
913 3300046501 Ga0495607_0001478 Ga0495607_0001478_3174_4088 304
914 3300046501 Ga0495607_0011723 Ga0495607_0011723_937_1851 304
915 3300046501 Ga0495607_0012161 Ga0495607_0012161_551_1465 304
916 3300046501 Ga0495607_0015670 Ga0495607_0015670_508_1446 304
917 3300046501 Ga0495607_0018822 Ga0495607_0018822_2691_3605 304
918 3300046501 Ga0495607_0027747 Ga0495607_0027747_2542_3456 304
919 3300046501 Ga0495607_0064416 Ga0495607_0064416_70_984 304
920 3300046501 Ga0495607_0080706 Ga0495607_0080706_301_1236 304
921 3300046506 Ga0495583_0001352 Ga0495583_0001352_21295_22239 304
922 3300046506 Ga0495583_0002110 Ga0495583_0002110_3115_4029 304
923 3300046506 Ga0495583_0010993 Ga0495583_0010993_3477_4415 304
924 3300046506 Ga0495583_0012791 Ga0495583_0012791_3385_4299 304
925 3300046506 Ga0495583_0015208 Ga0495583_0015208_2851_3876 304
926 3300046506 Ga0495583_0051075 Ga0495583_0051075_46_960 304
927 3300046507 Ga0495606_0014249 Ga0495606_0014249_2185_3099 304
928 3300046507 Ga0495606_0015507 Ga0495606_0015507_3300_4214 304
929 3300046507 Ga0495606_0021751 Ga0495606_0021751_3418_4362 304
930 3300046507 Ga0495606_0193641 Ga0495606_0193641_75_1013 304
931 3300046512 Ga0495610_0008423 Ga0495610_0008423_2433_3347 304
932 3300046512 Ga0495610_0009397 Ga0495610_0009397_781_1695 304
933 3300046512 Ga0495610_0011965 Ga0495610_0011965_1313_2227 304
934 3300046512 Ga0495610_0038399 Ga0495610_0038399_1406_2350 304
935 3300046513 Ga0495616_0003782 Ga0495616_0003782_6251_7165 304
936 3300046513 Ga0495616_0006083 Ga0495616_0006083_5263_6177 304
937 3300046513 Ga0495616_0021398 Ga0495616_0021398_887_1801 304
938 3300046513 Ga0495616_0044113 Ga0495616_0044113_349_1263 304
939 3300046515 Ga0495620_0008259 Ga0495620_0008259_315_1229 304
940 3300046515 Ga0495620_0010161 Ga0495620_0010161_546_1484 304
941 3300046515 Ga0495620_0016325 Ga0495620_0016325_2690_3604 304
942 3300046515 Ga0495620_0115664 Ga0495620_0115664_40_954 304
943 3300046517 Ga0495630_0233809 Ga0495630_0233809_429_1343 304
944 3300046518 Ga0495631_0002924 Ga0495631_0002924_3168_4082 304
945 3300046518 Ga0495631_0010837 Ga0495631_0010837_3178_4203 304
946 3300046518 Ga0495631_0115294 Ga0495631_0115294_66_980 304
947 3300046518 Ga0495631_0162450 Ga0495631_0162450_10_924 304
948 3300046519 Ga0495632_0001169 Ga0495632_0001169_18393_19307 304
949 3300046519 Ga0495632_0006636 Ga0495632_0006636_3244_4269 304
950 3300046519 Ga0495632_0011905 Ga0495632_0011905_2074_2988 304
951 3300046519 Ga0495632_0018328 Ga0495632_0018328_1915_2859 304
952 3300046519 Ga0495632_0019723 Ga0495632_0019723_1103_2017 304
953 3300046519 Ga0495632_0066359 Ga0495632_0066359_105_1019 304
954 3300046520 Ga0495637_0000188 Ga0495637_0000188_44248_45192 304
955 3300046520 Ga0495637_0004413 Ga0495637_0004413_3615_4529 304
956 3300046520 Ga0495637_0006903 Ga0495637_0006903_2875_3789 304
957 3300046520 Ga0495637_0009901 Ga0495637_0009901_3316_4230 304
958 3300046520 Ga0495637_0011634 Ga0495637_0011634_2861_3775 304
959 3300046520 Ga0495637_0014398 Ga0495637_0014398_2108_3022 304
960 3300046520 Ga0495637_0020873 Ga0495637_0020873_1628_2542 304
961 3300046520 Ga0495637_0039090 Ga0495637_0039090_396_1310 304
962 3300046522 Ga0495643_0025313 Ga0495643_0025313_2419_3333 304
963 3300046522 Ga0495643_0057766 Ga0495643_0057766_371_1396 304
964 3300046522 Ga0495643_0076784 Ga0495643_0076784_191_1105 304
965 3300046523 Ga0495644_0004882 Ga0495644_0004882_1125_2069 304
966 3300046523 Ga0495644_0006925 Ga0495644_0006925_1169_2083 304
967 3300046523 Ga0495644_0007338 Ga0495644_0007338_26_940 304
968 3300046523 Ga0495644_0027732 Ga0495644_0027732_798_1712 304
969 3300046524 Ga0495648_0001113 Ga0495648_0001113_891_1805 304
970 3300046524 Ga0495648_0019454 Ga0495648_0019454_598_1623 304
971 3300046524 Ga0495648_0021907 Ga0495648_0021907_2631_3545 304
972 3300046524 Ga0495648_0022001 Ga0495648_0022001_3176_4090 304
973 3300046524 Ga0495648_0029271 Ga0495648_0029271_2076_2990 304
974 3300046524 Ga0495648_0036499 Ga0495648_0036499_2176_3090 304
975 3300046524 Ga0495648_0114238 Ga0495648_0114238_454_1368 304
976 3300046526 Ga0495666_0036672 Ga0495666_0036672_740_1654 304
977 3300046526 Ga0495666_0047318 Ga0495666_0047318_22_936 304
978 3300046526 Ga0495666_0093840 Ga0495666_0093840_459_1373 304
979 3300046528 Ga0495642_0000398 Ga0495642_0000398_19348_20262 304
980 3300046528 Ga0495642_0002232 Ga0495642_0002232_3110_4024 304
981 3300046530 Ga0495654_0008410 Ga0495654_0008410_1026_1940 304
982 3300046530 Ga0495654_0009081 Ga0495654_0009081_4464_5378 304
983 3300046530 Ga0495654_0011659 Ga0495654_0011659_3272_4186 304
984 3300046530 Ga0495654_0013168 Ga0495654_0013168_3096_4010 304
985 3300046530 Ga0495654_0015537 Ga0495654_0015537_3027_3941 304
986 3300046530 Ga0495654_0015772 Ga0495654_0015772_189_1103 304
987 3300046530 Ga0495654_0018037 Ga0495654_0018037_663_1577 304
988 3300046530 Ga0495654_0022666 Ga0495654_0022666_2305_3219 304
989 3300046530 Ga0495654_0082557 Ga0495654_0082557_173_1117 304
990 3300046530 Ga0495654_0147741 Ga0495654_0147741_14_928 304
991 3300046538 Ga0495609_0007206 Ga0495609_0007206_1408_2352 304
992 3300046538 Ga0495609_0009658 Ga0495609_0009658_1711_2625 304
993 3300046538 Ga0495609_0074787 Ga0495609_0074787_162_1076 304
994 3300046542 Ga0495597_0003943 Ga0495597_0003943_2117_3031 304
995 3300046542 Ga0495597_0032025 Ga0495597_0032025_1395_2309 304
996 3300046542 Ga0495597_0069953 Ga0495597_0069953_154_1068 304
997 3300046542 Ga0495597_0120904 Ga0495597_0120904_106_1020 304
998 3300046557 Ga0495622_0003985 Ga0495622_0003985_3116_4030 304
999 3300046557 Ga0495622_0004251 Ga0495622_0004251_1863_2777 304
1000 3300046557 Ga0495622_0016700 Ga0495622_0016700_2216_3130 304
1001 3300046557 Ga0495622_0017856 Ga0495622_0017856_736_1680 304
1002 3300046558 Ga0495633_0006725 Ga0495633_0006725_5175_6089 304
1003 3300046558 Ga0495633_0025968 Ga0495633_0025968_93_1007 304
1004 3300046615 Ga0495656_0001597 Ga0495656_0001597_3057_3971 304
1005 3300046616 Ga0495668_0012445 Ga0495668_0012445_1093_2037 304
1006 3300046616 Ga0495668_0070223 Ga0495668_0070223_776_1714 304
1007 3300046642 Ga0495634_0004434 Ga0495634_0004434_3066_3980 304
1008 3300046648 Ga0495611_0007433 Ga0495611_0007433_1023_1967 304
1009 3300046648 Ga0495611_0168607 Ga0495611_0168607_47_961 304
1010 3300046660 Ga0495625_0000686 Ga0495625_0000686_44056_45000 304
1011 3300046660 Ga0495625_0018919 Ga0495625_0018919_641_1555 304
1012 3300046660 Ga0495625_0096250 Ga0495625_0096250_214_1128 304
1013 3300046663 Ga0495635_0005516 Ga0495635_0005516_4654_5568 304
1014 3300046663 Ga0495635_0088686 Ga0495635_0088686_424_1338 304
1015 3300046664 Ga0495659_0003358 Ga0495659_0003358_3787_4701 304
1016 3300046664 Ga0495659_0004687 Ga0495659_0004687_432_1346 304
1017 3300046665 Ga0495661_0000375 Ga0495661_0000375_44033_44977 304
1018 3300046665 Ga0495661_0008016 Ga0495661_0008016_3524_4438 304
1019 3300046665 Ga0495661_0018000 Ga0495661_0018000_464_1489 304
1020 3300046665 Ga0495661_0057432 Ga0495661_0057432_712_1626 304
1021 3300046679 Ga0495623_0010871 Ga0495623_0010871_3026_3940 304
1022 3300046680 Ga0495646_0010699 Ga0495646_0010699_2109_3023 304
1023 3300046680 Ga0495646_0012871 Ga0495646_0012871_1156_2070 304
1024 3300046684 Ga0495669_0009785 Ga0495669_0009785_1006_1920 304
1025 3300046684 Ga0495669_0140456 Ga0495669_0140456_24_938 304
1026 3300046689 Ga0495613_0055943 Ga0495613_0055943_467_1381 304
1027 3300046691 Ga0495670_0002675 Ga0495670_0002675_2849_3763 304
1028 3300046691 Ga0495670_0002719 Ga0495670_0002719_4669_5583 304
1029 3300046691 Ga0495670_0006814 Ga0495670_0006814_3091_4005 304
1030 3300046691 Ga0495670_0016045 Ga0495670_0016045_2697_3611 304
1031 3300046691 Ga0495670_0031041 Ga0495670_0031041_155_1069 304
1032 3300046691 Ga0495670_0062195 Ga0495670_0062195_395_1339 304
1033 3300046691 Ga0495670_0176976 Ga0495670_0176976_56_976 304
1034 3300046692 Ga0495671_0002995 Ga0495671_0002995_6465_7379 304
1035 3300046692 Ga0495671_0012256 Ga0495671_0012256_520_1545 304
1036 3300046692 Ga0495671_0016592 Ga0495671_0016592_2551_3501 304
1037 3300046692 Ga0495671_0023317 Ga0495671_0023317_2280_3194 304
1038 3300046692 Ga0495671_0028705 Ga0495671_0028705_1358_2272 304
1039 3300046692 Ga0495671_0135755 Ga0495671_0135755_54_968 304
1040 3300046694 Ga0495649_0012476 Ga0495649_0012476_3659_4573 304
1041 3300046694 Ga0495649_0013788 Ga0495649_0013788_675_1619 304
1042 3300046694 Ga0495649_0026928 Ga0495649_0026928_116_1030 304
1043 3300046694 Ga0495649_0030433 Ga0495649_0030433_1961_2875 304
1044 3300046694 Ga0495649_0034859 Ga0495649_0034859_997_1911 304
1045 3300046694 Ga0495649_0056139 Ga0495649_0056139_1061_1975 304
1046 3300046694 Ga0495649_0180209 Ga0495649_0180209_139_1053 304
1047 3300046794 Ga0495589_0002361 Ga0495589_0002361_6520_7434 304
1048 3300046794 Ga0495589_0009091 Ga0495589_0009091_1359_2273 304
1049 3300046794 Ga0495589_0009871 Ga0495589_0009871_1960_2874 304
1050 3300046794 Ga0495589_0084202 Ga0495589_0084202_588_1502 304
1051 3300046809 Ga0495600_0017597 Ga0495600_0017597_359_1273 304
1052 3300046810 Ga0495660_0035325 Ga0495660_0035325_1157_2101 304
1053 3300046810 Ga0495660_0043384 Ga0495660_0043384_192_1106 304
1054 3300046810 Ga0495660_0058603 Ga0495660_0058603_544_1458 304
1055 3300046810 Ga0495660_0084554 Ga0495660_0084554_183_1097 304
1056 3300046810 Ga0495660_0089758 Ga0495660_0089758_574_1488 304
1057 3300046810 Ga0495660_0148601 Ga0495660_0148601_15_929 304
1058 3300047315 Ga0495581_0200656 Ga0495581_0200656_185_1099 304
1059 3300047317 Ga0495604_0019032 Ga0495604_0019032_2790_3704 304
1060 3300047317 Ga0495604_0020740 Ga0495604_0020740_1162_2076 304
1061 3300047320 Ga0495672_0005569 Ga0495672_0005569_5677_6591 304
1062 3300047320 Ga0495672_0007545 Ga0495672_0007545_4169_5083 304
1063 3300047320 Ga0495672_0008196 Ga0495672_0008196_3862_4776 304
1064 3300047320 Ga0495672_0008550 Ga0495672_0008550_2856_3770 304
1065 3300047320 Ga0495672_0011941 Ga0495672_0011941_2258_3172 304
1066 3300047320 Ga0495672_0019377 Ga0495672_0019377_337_1251 304
1067 3300047320 Ga0495672_0019838 Ga0495672_0019838_2670_3614 304
1068 3300047320 Ga0495672_0020024 Ga0495672_0020024_3175_4089 304
1069 3300047320 Ga0495672_0023464 Ga0495672_0023464_125_1150 304
1070 3300047320 Ga0495672_0024533 Ga0495672_0024533_2848_3762 304
1071 3300047321 Ga0495676_0000222 Ga0495676_0000222_3222_4166 304
1072 3300047322 Ga0495680_0008104 Ga0495680_0008104_3114_4028 304
1073 3300047322 Ga0495680_0046759 Ga0495680_0046759_1475_2389 304
1074 3300047322 Ga0495680_0344125 Ga0495680_0344125_13_927 304
1075 3300047323 Ga0495683_0002710 Ga0495683_0002710_3121_4035 304
1076 3300047323 Ga0495683_0003356 Ga0495683_0003356_5274_6188 304
1077 3300047323 Ga0495683_0013203 Ga0495683_0013203_1133_2047 304
1078 3300047323 Ga0495683_0013853 Ga0495683_0013853_168_1082 304
1079 3300047323 Ga0495683_0040567 Ga0495683_0040567_1396_2310 304
1080 3300047443 Ga0495687_010197 Ga0495687_010197_329_1243 304
1081 3300047444 Ga0495675_0013933 Ga0495675_0013933_3249_4163 304
1082 3300047445 Ga0495677_0007690 Ga0495677_0007690_556_1470 304
1083 3300047446 Ga0495679_006006 Ga0495679_006006_3450_4394 304
1084 3300047446 Ga0495679_008849 Ga0495679_008849_3023_3937 304
1085 3300047469 Ga0495673_0003472 Ga0495673_0003472_6370_7284 304
1086 3300047469 Ga0495673_0005327 Ga0495673_0005327_3161_4168 304
1087 3300047469 Ga0495673_0006416 Ga0495673_0006416_2783_3697 304
1088 3300047469 Ga0495673_0008018 Ga0495673_0008018_4964_5878 304
1089 3300047469 Ga0495673_0011839 Ga0495673_0011839_3169_4083 304
1090 3300047469 Ga0495673_0023144 Ga0495673_0023144_1329_2354 304
1091 3300047469 Ga0495673_0045333 Ga0495673_0045333_663_1577 304
1092 3300047470 Ga0495681_0001492 Ga0495681_0001492_3038_3952 304
1093 3300047470 Ga0495681_0005311 Ga0495681_0005311_2950_3864 304
1094 3300047470 Ga0495681_0008379 Ga0495681_0008379_364_1278 304
1095 3300047470 Ga0495681_0011422 Ga0495681_0011422_2711_3625 304
1096 3300047470 Ga0495681_0029940 Ga0495681_0029940_254_1168 304
1097 3300047470 Ga0495681_0136921 Ga0495681_0136921_51_965 304
1098 3300047472 Ga0495686_0006823 Ga0495686_0006823_4694_5608 304
1099 3300047472 Ga0495686_0021995 Ga0495686_0021995_2875_3789 304
1100 3300047472 Ga0495686_0085400 Ga0495686_0085400_607_1632 304
1101 3300047673 Ga0495593_0027293 Ga0495593_0027293_1651_2565 304
1102 3300048091 Ga0495626_0000912 Ga0495626_0000912_5009_5923 304
1103 3300048091 Ga0495626_0001329 Ga0495626_0001329_3207_4121 304
1104 3300048091 Ga0495626_0002633 Ga0495626_0002633_7915_8829 304
1105 3300048091 Ga0495626_0004953 Ga0495626_0004953_3924_4838 304
1106 3300048091 Ga0495626_0010127 Ga0495626_0010127_3234_4178 304
1107 3300048091 Ga0495626_0136372 Ga0495626_0136372_33_947 304
1108 3300048905 Ga0496102_0001186 Ga0496102_0001186_19767_20681 304
1109 3300048906 Ga0496103_0017077 Ga0496103_0017077_417_1331 304
1110 3300048913 Ga0496110_0034103 Ga0496110_0034103_629_1582 304
1111 3300048915 Ga0496112_0344035 Ga0496112_0344035_453_1367 304
1112 3300048915 Ga0496112_0502950 Ga0496112_0502950_78_1016 304
1113 3300048919 Ga0496116_0001286 Ga0496116_0001286_24732_25658 304
1114 3300048919 Ga0496116_0014906 Ga0496116_0014906_3109_4023 304
1115 3300048919 Ga0496116_0071203 Ga0496116_0071203_400_1314 304
1116 3300048919 Ga0496116_0132555 Ga0496116_0132555_61_975 304
1117 3300048920 Ga0496117_0014270 Ga0496117_0014270_2923_3849 304
1118 3300048920 Ga0496117_0074046 Ga0496117_0074046_439_1356 304
1119 3300048920 Ga0496117_0083595 Ga0496117_0083595_227_1141 304
1120 3300048920 Ga0496117_0146187 Ga0496117_0146187_382_1302 304
1121 3300048920 Ga0496117_0230430 Ga0496117_0230430_70_984 304
1122 3300048921 Ga0496118_0014312 Ga0496118_0014312_3651_4577 304
1123 3300048921 Ga0496118_0081141 Ga0496118_0081141_957_1874 304
1124 3300048921 Ga0496118_0108771 Ga0496118_0108771_908_1822 304
1125 3300048921 Ga0496118_0109579 Ga0496118_0109579_520_1434 304
1126 3300048924 Ga0496121_0003226 Ga0496121_0003226_19084_20010 304
1127 3300048924 Ga0496121_0029574 Ga0496121_0029574_816_1754 304
1128 3300048924 Ga0496121_0035177 Ga0496121_0035177_3171_4085 304
1129 3300048924 Ga0496121_0106329 Ga0496121_0106329_1110_2024 304
1130 3300048924 Ga0496121_0157443 Ga0496121_0157443_194_1108 304
1131 3300048925 Ga0496122_0000750 Ga0496122_0000750_59024_59944 304
1132 3300048925 Ga0496122_0015024 Ga0496122_0015024_4216_5142 304
1133 3300048925 Ga0496122_0036813 Ga0496122_0036813_2998_3912 304
1134 3300048925 Ga0496122_0104384 Ga0496122_0104384_369_1307 304
1135 3300048926 Ga0496123_0002466 Ga0496123_0002466_3124_4050 304
1136 3300048926 Ga0496123_0006350 Ga0496123_0006350_3334_4254 304
1137 3300048926 Ga0496123_0136290 Ga0496123_0136290_40_954 304
1138 3300048927 Ga0496124_0001993 Ga0496124_0001993_3236_4174 304
1139 3300048927 Ga0496124_0018695 Ga0496124_0018695_5462_6376 304
1140 3300048927 Ga0496124_0023597 Ga0496124_0023597_4347_5261 304
1141 3300048927 Ga0496124_0028730 Ga0496124_0028730_561_1514 304
1142 3300048928 Ga0496125_0110319 Ga0496125_0110319_656_1570 304
1143 3300049459 Ga0495678_004142 Ga0495678_004142_1168_2082 304
1144 3300049459 Ga0495678_005691 Ga0495678_005691_1838_2752 304
1145 3300049459 Ga0495678_005950 Ga0495678_005950_2742_3686 304
1146 3300049459 Ga0495678_032044 Ga0495678_032044_591_1616 304
1147 3300049459 Ga0495678_078503 Ga0495678_078503_117_1031 304
1148 3300049460 Ga0495682_0000426 Ga0495682_0000426_25218_26156 304
1149 3300049460 Ga0495682_0054116 Ga0495682_0054116_438_1352 304
1150 3300050489 nmdc:mga03683_115596_c1 nmdc:mga03683_115596_c1_162_1076 304
1151 3300050491 nmdc:mga00v17_36991_c1 nmdc:mga00v17_36991_c1_819_1733 304
1152 3300050516 nmdc:mga0sz30_139275_c1 nmdc:mga0sz30_139275_c1_65_979 304
1153 3300050516 nmdc:mga0sz30_16174_c1 nmdc:mga0sz30_16174_c1_698_1612 304
1154 iso_pu_bacteria 2554235341 2555668104 304
1155 iso_pu_bacteria 2599185160 2599355103 304
1156 iso_pu_bacteria 2599185161 2599361073 304
1157 iso_pu_bacteria 2599185162 2599367395 304
1158 iso_pu_bacteria 2599185163 2599374185 304
1159 iso_pu_bacteria 2599185164 2599380209 304
1160 iso_pu_bacteria 2599185165 2599386656 304
1161 iso_pu_bacteria 2599185166 2599393043 304
1162 iso_pu_bacteria 2599185168 2599404810 304
1163 iso_pu_bacteria 2599185181 2599461937 304
1164 iso_pu_bacteria 2599185182 2599467020 304
1165 iso_pu_bacteria 2599185186 2599490970 304
1166 iso_pu_bacteria 2599185356 2600214559 304
1167 iso_pu_bacteria 2600255313 2601774736 304
1168 iso_pu_bacteria 2667528171 2671097704 304
1169 iso_pu_bacteria 2818991464 2819702787 304
1170 iso_pu_bacteria 2917070673 2917071866 304
1171 iso_pu_bacteria 2935353572 2935354038 304
1172 iso_pu_bacteria 637000220 637318482 304
1173 iso_pu_bacteria 8019769354 8019773347 304
1174 iso_pu_bacteria 8057798959 8057803376 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

116

229

0.88

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

84

242

0.83

PF12146

Hydrolase_4

Serine aminopeptidase, S33

109

254

0.82

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

113

246

0.78

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

115

337

0.51

Structural Annotation

Top 5 Hits

ID Description Score Start End
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.7887 39 271
7qjm-assembly2.cif.gz_B crystal structure of an alpha/beta-hydrolase enzyme from chloroflexus sp. ms-g (202) 0.7702 38 277
6imp-assembly2.cif.gz_B crystal structure of alpha-beta hydrolase (abh) from vibrio vulnificus 0.7696 33 272
7wwh-assembly2.cif.gz_B crystal structure of the geobacillus thermoglucosidasius feruloyl esterase gthfae 0.7652 39 271
7d79-assembly1.cif.gz_A the structure of dcsb complex with its substrate analogue 0.7618 37 273
ID Description Score Start End Superfamily
af_Q4E4T5_64_355_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.89 39 273 3.40.50.1820
af_P54069_41_276_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8899 26 254 3.40.50.1820
af_P42840_58_270_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8756 42 254 3.40.50.1820
af_P77538_37_280_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8736 20 272 3.40.50.1820
af_Q54H73_43_283_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8689 28 273 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A550FN92-F1-model_v4 Alpha/beta hydrolase 0.9652 13 277 GO:0016787
AF-A0A4R7A388-F1-model_v4 deleted 0.9472 11 273
AF-A0A1M5IFD8-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9332 37 272 GO:0016020
AF-A0A2D5CC24-F1-model_v4 deleted 0.9306 78 292
AF-A0A853ICX6-F1-model_v4 Alpha/beta fold hydrolase 0.9282 17 276 GO:0016787

Feature Viewer

pLDDT pTM Quality
83.17 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map