F491193
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1172 | 494 | 956 | 108 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|640427133|640488693 |
| Length | 114 |
| Sequence | ALMRSSMSERNPIPLILTAIGSVVGTVAVLSYYGYLHIAKPEDALLLADYTMLKTVPGEDYRVSLQPASQVAQCIDGVLVLFDTEQKGLTGVLVDNKKRAVRCMEEPVPGGLLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 3 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 4 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 5 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 6 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 7 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 8 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 9 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 10 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 11 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 12 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 13 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 14 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 15 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 16 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 17 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 18 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 19 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 20 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 21 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 22 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 23 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 24 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 25 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 26 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 27 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 28 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 29 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 30 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 31 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 32 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 33 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 34 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 35 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 36 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 37 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 38 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 39 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 40 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 41 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 42 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 43 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 44 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 45 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 46 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 47 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 48 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 49 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 50 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 51 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 52 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 53 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 54 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 55 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 56 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 57 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 58 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 59 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 60 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 61 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 62 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 63 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 64 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 65 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 66 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 67 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 68 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 69 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 70 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 71 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 72 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 73 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 74 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 75 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 76 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 77 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 78 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 79 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 80 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 81 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 82 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 83 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 84 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 85 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 86 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 87 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 88 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 89 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 90 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 91 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 92 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 93 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 94 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 95 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 96 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 97 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 98 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 99 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 100 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 101 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 102 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 103 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 104 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 105 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 106 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 107 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 108 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 109 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 110 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 111 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 112 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 113 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 114 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 115 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 116 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 117 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 118 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 119 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 120 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 121 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 122 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 123 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 124 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 125 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 126 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 127 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 128 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 129 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 130 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 131 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 132 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 133 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 134 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 135 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 136 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 137 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 138 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 139 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 140 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 141 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 142 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 143 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 144 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 145 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 146 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 147 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 148 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 149 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 150 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 151 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 152 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 153 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 154 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 155 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 156 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 157 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 158 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 159 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 160 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 161 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 162 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 163 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 164 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 165 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 166 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 167 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 168 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 169 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 170 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 171 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 172 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 173 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 174 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 175 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 176 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 177 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 178 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 179 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 180 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 181 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 182 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 183 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 184 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 185 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 186 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 187 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 188 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 189 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 190 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 191 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 192 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 193 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 194 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 195 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 196 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 197 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 198 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 199 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 200 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 201 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 202 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 203 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 204 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 205 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 206 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 207 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 208 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 209 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 210 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 211 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 212 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 213 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 214 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 215 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 216 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 217 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 218 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 223 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 226 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 227 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 228 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 229 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 230 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 231 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 232 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 233 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 234 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 244 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 245 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 253 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 254 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 255 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 256 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 258 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 268 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 270 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 290 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 298 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 301 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 303 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 304 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 305 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 306 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 307 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 308 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 309 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 310 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 311 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 312 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 313 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 314 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 315 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 316 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 317 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 318 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 319 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 320 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 321 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 322 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 323 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 324 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 325 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 326 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 327 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 328 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 329 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 330 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 331 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 332 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 333 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 334 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 335 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 336 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 337 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 338 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 339 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 340 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 341 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 342 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 343 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 344 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 345 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 346 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 347 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 348 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 349 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 350 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 351 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 352 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 353 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 354 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 355 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 356 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 357 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 358 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 359 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 360 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 361 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 362 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 363 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 364 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 365 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 366 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 367 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 439 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 440 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 441 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 442 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 443 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 444 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 445 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 446 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 447 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 448 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 449 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 450 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 451 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 452 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 453 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 460 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 461 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 462 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 464 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 465 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 467 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 468 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 469 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 470 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 471 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 472 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 473 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 474 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 475 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 476 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 477 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 478 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 479 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 480 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 481 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 482 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 483 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 484 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 485 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 486 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 487 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 488 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 489 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 490 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 491 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 492 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 493 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 494 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.48 |
| Metatranscriptomes | 0.09 |
| Isolates | 18.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.03 |
| Nodule | 1.88 |
| Rhizoplane | 6.31 |
| Rhizosphere | 74.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_74 | 2124908027 | Bacteria | 32492 |
| 2 | JGI24741J21665_1015229 | 3300001915 | Bacteria | 1272 |
| 3 | JGI25156J39149_1022724 | 3300002705 | Bacteria | 1060 |
| 4 | JGI25162J39368_1000103 | 3300002737 | Bacteria | 93730 |
| 5 | JGI25154J39366_1003627 | 3300002738 | Bacteria | 3152 |
| 6 | JGI25163J39215_1000809 | 3300002771 | Bacteria | 7533 |
| 7 | JGI25164J39214_1000082 | 3300002772 | Bacteria | 93730 |
| 8 | JGI25165J46597_1000185 | 3300003214 | Bacteria | 93730 |
| 9 | Ga0055538_1000073 | 3300003751 | Bacteria | 90843 |
| 10 | Ga0055539_1000109 | 3300003752 | Bacteria | 90843 |
| 11 | Ga0055533_1000117 | 3300003756 | Bacteria | 90843 |
| 12 | Ga0055532_1000120 | 3300003758 | Bacteria | 81088 |
| 13 | Ga0055525_1000156 | 3300003759 | Bacteria | 90843 |
| 14 | Ga0055535_1005421 | 3300003761 | Bacteria | 2802 |
| 15 | Ga0055536_1000331 | 3300003781 | Bacteria | 34950 |
| 16 | Ga0055536_1000454 | 3300003781 | Bacteria | 28777 |
| 17 | Ga0055536_1005665 | 3300003781 | Bacteria | 6042 |
| 18 | Ga0055536_1045992 | 3300003781 | Bacteria | 995 |
| 19 | Ga0055534_1046413 | 3300003784 | Bacteria | 626 |
| 20 | Ga0055530_10000176 | 3300003791 | Bacteria | 58667 |
| 21 | Ga0055530_10000351 | 3300003791 | Bacteria | 41661 |
| 22 | Ga0055530_10000511 | 3300003791 | Bacteria | 33798 |
| 23 | Ga0055530_10001302 | 3300003791 | Bacteria | 18793 |
| 24 | Ga0055540_1000193 | 3300003792 | Bacteria | 58670 |
| 25 | Ga0055540_1000385 | 3300003792 | Bacteria | 36787 |
| 26 | Ga0055540_1005860 | 3300003792 | Bacteria | 5033 |
| 27 | Ga0055531_10001143 | 3300003794 | Bacteria | 20543 |
| 28 | Ga0055531_10001439 | 3300003794 | Bacteria | 17565 |
| 29 | Ga0055531_10114007 | 3300003794 | Bacteria | 536 |
| 30 | Ga0055541_1000074 | 3300003841 | Bacteria | 90843 |
| 31 | Ga0058692_1032544 | 3300003856 | Bacteria | 973 |
| 32 | Ga0065714_10001142 | 3300005288 | Bacteria | 1468 |
| 33 | Ga0065714_10003823 | 3300005288 | Bacteria | 7961 |
| 34 | Ga0065714_10011520 | 3300005288 | Bacteria | 2675 |
| 35 | Ga0065714_10011532 | 3300005288 | Bacteria | 2179 |
| 36 | Ga0065714_10067449 | 3300005288 | Bacteria | 5504 |
| 37 | Ga0065714_10068084 | 3300005288 | Bacteria | 4981 |
| 38 | Ga0065714_10071416 | 3300005288 | Bacteria | 3584 |
| 39 | Ga0065714_10072965 | 3300005288 | Bacteria | 3267 |
| 40 | Ga0065714_10115407 | 3300005288 | Bacteria | 1416 |
| 41 | Ga0065714_10290460 | 3300005288 | Bacteria | 709 |
| 42 | Ga0065714_10342080 | 3300005288 | Bacteria | 644 |
| 43 | Ga0065704_10081940 | 3300005289 | Bacteria | 3679 |
| 44 | Ga0065704_10083727 | 3300005289 | Bacteria | 3426 |
| 45 | Ga0065704_10100411 | 3300005289 | Bacteria | 2274 |
| 46 | Ga0065704_10122646 | 3300005289 | Bacteria | 1738 |
| 47 | Ga0065712_10002535 | 3300005290 | Bacteria | 5757 |
| 48 | Ga0065712_10068159 | 3300005290 | Bacteria | 13672 |
| 49 | Ga0065712_10071669 | 3300005290 | Bacteria | 5121 |
| 50 | Ga0065715_10143679 | 3300005293 | Bacteria | 1817 |
| 51 | Ga0070670_100000780 | 3300005331 | Bacteria | 24782 |
| 52 | Ga0070670_100011171 | 3300005331 | Bacteria | 7674 |
| 53 | Ga0070669_100004365 | 3300005353 | Bacteria | 10208 |
| 54 | Ga0070669_100465722 | 3300005353 | Bacteria | 1044 |
| 55 | Ga0070674_101547987 | 3300005356 | Bacteria | 597 |
| 56 | Ga0070662_100000301 | 3300005457 | Bacteria | 29323 |
| 57 | Ga0070662_100026557 | 3300005457 | Bacteria | 4011 |
| 58 | Ga0068853_100006538 | 3300005539 | Bacteria | 9279 |
| 59 | Ga0070665_100035692 | 3300005548 | Bacteria | 5000 |
| 60 | Ga0070665_100432236 | 3300005548 | Bacteria | 1325 |
| 61 | Ga0070664_100221778 | 3300005564 | Bacteria | 1692 |
| 62 | Ga0068854_100003695 | 3300005578 | Bacteria | 9572 |
| 63 | Ga0068851_10000037 | 3300005834 | Bacteria | 97386 |
| 64 | Ga0075364_10150505 | 3300006051 | Bacteria | 1568 |
| 65 | Ga0075364_10171938 | 3300006051 | Bacteria | 1465 |
| 66 | Ga0075432_10002236 | 3300006058 | Bacteria | 6442 |
| 67 | Ga0075432_10002301 | 3300006058 | Bacteria | 6364 |
| 68 | Ga0075432_10004206 | 3300006058 | Bacteria | 4899 |
| 69 | Ga0075432_10006320 | 3300006058 | Bacteria | 4028 |
| 70 | Ga0075432_10024162 | 3300006058 | Bacteria | 2082 |
| 71 | Ga0075432_10175545 | 3300006058 | Bacteria | 836 |
| 72 | Ga0075362_10233936 | 3300006177 | Bacteria | 900 |
| 73 | Ga0075362_10276515 | 3300006177 | Bacteria | 830 |
| 74 | Ga0075362_10581420 | 3300006177 | Bacteria | 578 |
| 75 | Ga0075369_10005197 | 3300006186 | Bacteria | 4848 |
| 76 | Ga0075436_100042714 | 3300006914 | Bacteria | 3127 |
| 77 | Ga0075436_100187212 | 3300006914 | Bacteria | 1464 |
| 78 | Ga0079104_1000414 | 3300006946 | Bacteria | 49214 |
| 79 | Ga0079104_1119063 | 3300006946 | Bacteria | 518 |
| 80 | Ga0099826_10023577 | 3300006948 | Bacteria | 4584 |
| 81 | Ga0105251_10000061 | 3300009011 | Bacteria | 102789 |
| 82 | Ga0105251_10001136 | 3300009011 | Bacteria | 23150 |
| 83 | Ga0105251_10003445 | 3300009011 | Bacteria | 11479 |
| 84 | Ga0105251_10004028 | 3300009011 | Bacteria | 10356 |
| 85 | Ga0105251_10007385 | 3300009011 | Bacteria | 6786 |
| 86 | Ga0105251_10009942 | 3300009011 | Bacteria | 5567 |
| 87 | Ga0105251_10010616 | 3300009011 | Bacteria | 5324 |
| 88 | Ga0105251_10029477 | 3300009011 | Bacteria | 2764 |
| 89 | Ga0105251_10033357 | 3300009011 | Bacteria | 2557 |
| 90 | Ga0105251_10087819 | 3300009011 | Bacteria | 1431 |
| 91 | Ga0105251_10098651 | 3300009011 | Bacteria | 1336 |
| 92 | Ga0105251_10139833 | 3300009011 | Bacteria | 1096 |
| 93 | Ga0105251_10190125 | 3300009011 | Bacteria | 925 |
| 94 | Ga0105251_10336684 | 3300009011 | Bacteria | 687 |
| 95 | Ga0105251_10408974 | 3300009011 | Bacteria | 625 |
| 96 | Ga0105244_10000272 | 3300009036 | Bacteria | 52218 |
| 97 | Ga0105244_10008012 | 3300009036 | Bacteria | 6647 |
| 98 | Ga0105244_10011554 | 3300009036 | Bacteria | 5280 |
| 99 | Ga0105244_10021963 | 3300009036 | Bacteria | 3518 |
| 100 | Ga0105244_10077072 | 3300009036 | Bacteria | 1654 |
| 101 | Ga0105244_10094795 | 3300009036 | Bacteria | 1465 |
| 102 | Ga0105244_10117921 | 3300009036 | Bacteria | 1287 |
| 103 | Ga0105244_10171466 | 3300009036 | Bacteria | 1032 |
| 104 | Ga0105244_10282450 | 3300009036 | Bacteria | 770 |
| 105 | Ga0105250_10000299 | 3300009092 | Bacteria | 39028 |
| 106 | Ga0105250_10000332 | 3300009092 | Bacteria | 36415 |
| 107 | Ga0105250_10005536 | 3300009092 | Bacteria | 5651 |
| 108 | Ga0105250_10009461 | 3300009092 | Bacteria | 4100 |
| 109 | Ga0105250_10023392 | 3300009092 | Bacteria | 2488 |
| 110 | Ga0105250_10075742 | 3300009092 | Bacteria | 1361 |
| 111 | Ga0105250_10096498 | 3300009092 | Bacteria | 1205 |
| 112 | Ga0105250_10226003 | 3300009092 | Bacteria | 795 |
| 113 | Ga0105243_10045025 | 3300009148 | Bacteria | 3465 |
| 114 | Ga0105243_10049392 | 3300009148 | Bacteria | 3319 |
| 115 | Ga0105243_10051884 | 3300009148 | Bacteria | 3246 |
| 116 | Ga0105243_10096623 | 3300009148 | Bacteria | 2444 |
| 117 | Ga0105243_10195715 | 3300009148 | Bacteria | 1769 |
| 118 | Ga0105242_10184150 | 3300009176 | Bacteria | 1844 |
| 119 | Ga0105248_10134319 | 3300009177 | Bacteria | 2792 |
| 120 | Ga0105237_10137591 | 3300009545 | Bacteria | 2437 |
| 121 | Ga0105249_13092582 | 3300009553 | Bacteria | 534 |
| 122 | Ga0105246_10002077 | 3300011119 | Bacteria | 12065 |
| 123 | Ga0105246_10005375 | 3300011119 | Bacteria | 7797 |
| 124 | Ga0105246_10196123 | 3300011119 | Bacteria | 1566 |
| 125 | Ga0105246_10628915 | 3300011119 | Bacteria | 931 |
| 126 | Ga0157345_1000166 | 3300012498 | Bacteria | 10979 |
| 127 | Ga0157347_1019611 | 3300012502 | Bacteria | 782 |
| 128 | Ga0157373_10001582 | 3300013100 | Bacteria | 17385 |
| 129 | Ga0157373_10006202 | 3300013100 | Bacteria | 8933 |
| 130 | Ga0157373_10021840 | 3300013100 | Bacteria | 4644 |
| 131 | Ga0157373_10033665 | 3300013100 | Bacteria | 3685 |
| 132 | Ga0157373_10053157 | 3300013100 | Bacteria | 2880 |
| 133 | Ga0157373_10150030 | 3300013100 | Bacteria | 1640 |
| 134 | Ga0157373_10169447 | 3300013100 | Bacteria | 1536 |
| 135 | Ga0157373_10180475 | 3300013100 | Bacteria | 1486 |
| 136 | Ga0157373_10879230 | 3300013100 | Bacteria | 664 |
| 137 | Ga0157371_10006271 | 3300013102 | Bacteria | 9850 |
| 138 | Ga0157371_10011479 | 3300013102 | Bacteria | 6816 |
| 139 | Ga0157371_10016205 | 3300013102 | Bacteria | 5568 |
| 140 | Ga0157371_10057216 | 3300013102 | Bacteria | 2765 |
| 141 | Ga0157371_10065540 | 3300013102 | Bacteria | 2572 |
| 142 | Ga0157371_10352185 | 3300013102 | Bacteria | 1072 |
| 143 | Ga0157370_10000846 | 3300013104 | Bacteria | 38839 |
| 144 | Ga0157370_10056348 | 3300013104 | Bacteria | 3741 |
| 145 | Ga0157370_10084574 | 3300013104 | Bacteria | 2982 |
| 146 | Ga0157370_10090355 | 3300013104 | Bacteria | 2876 |
| 147 | Ga0157370_10102773 | 3300013104 | Bacteria | 2675 |
| 148 | Ga0157370_10153170 | 3300013104 | Bacteria | 2145 |
| 149 | Ga0157370_10330107 | 3300013104 | Bacteria | 1407 |
| 150 | Ga0157370_10807467 | 3300013104 | Bacteria | 853 |
| 151 | Ga0157370_11325773 | 3300013104 | Bacteria | 648 |
| 152 | Ga0157370_11728320 | 3300013104 | Bacteria | 562 |
| 153 | Ga0157369_10015829 | 3300013105 | Bacteria | 8495 |
| 154 | Ga0157369_10017783 | 3300013105 | Bacteria | 7982 |
| 155 | Ga0157369_10079337 | 3300013105 | Bacteria | 3516 |
| 156 | Ga0157369_10246969 | 3300013105 | Bacteria | 1863 |
| 157 | Ga0157369_10347004 | 3300013105 | Bacteria | 1542 |
| 158 | Ga0157369_10428520 | 3300013105 | Bacteria | 1371 |
| 159 | Ga0157369_10828348 | 3300013105 | Bacteria | 950 |
| 160 | Ga0157369_11267519 | 3300013105 | Bacteria | 752 |
| 161 | Ga0163162_10012886 | 3300013306 | Bacteria | 8165 |
| 162 | Ga0163162_10062388 | 3300013306 | Bacteria | 3767 |
| 163 | Ga0163162_10097608 | 3300013306 | Bacteria | 3027 |
| 164 | Ga0163162_10957033 | 3300013306 | Bacteria | 967 |
| 165 | Ga0163162_11096331 | 3300013306 | Bacteria | 902 |
| 166 | Ga0163162_12441669 | 3300013306 | Bacteria | 601 |
| 167 | Ga0157372_10001549 | 3300013307 | Bacteria | 25023 |
| 168 | Ga0157372_10004137 | 3300013307 | Bacteria | 15535 |
| 169 | Ga0157375_11290937 | 3300013308 | Bacteria | 858 |
| 170 | Ga0157375_11951224 | 3300013308 | Bacteria | 697 |
| 171 | Ga0182008_10005701 | 3300014497 | Bacteria | 7050 |
| 172 | Ga0182008_10008549 | 3300014497 | Bacteria | 5587 |
| 173 | Ga0182008_10018278 | 3300014497 | Bacteria | 3630 |
| 174 | Ga0182008_10021905 | 3300014497 | Bacteria | 3278 |
| 175 | Ga0182008_10047996 | 3300014497 | Bacteria | 2121 |
| 176 | Ga0182008_10055715 | 3300014497 | Bacteria | 1954 |
| 177 | Ga0182008_10107940 | 3300014497 | Bacteria | 1378 |
| 178 | Ga0182008_10483638 | 3300014497 | Bacteria | 678 |
| 179 | Ga0182006_1000640 | 3300015261 | Bacteria | 24816 |
| 180 | Ga0182006_1001009 | 3300015261 | Bacteria | 18405 |
| 181 | Ga0182006_1012798 | 3300015261 | Bacteria | 3661 |
| 182 | Ga0182006_1030050 | 3300015261 | Bacteria | 2199 |
| 183 | Ga0182006_1041913 | 3300015261 | Bacteria | 1796 |
| 184 | Ga0182006_1057651 | 3300015261 | Bacteria | 1476 |
| 185 | Ga0182007_10004583 | 3300015262 | Bacteria | 6244 |
| 186 | Ga0182007_10019086 | 3300015262 | Bacteria | 2471 |
| 187 | Ga0182005_1002382 | 3300015265 | Bacteria | 6765 |
| 188 | Ga0182005_1011517 | 3300015265 | Bacteria | 2518 |
| 189 | Ga0182005_1030291 | 3300015265 | Bacteria | 1474 |
| 190 | Ga0182005_1107175 | 3300015265 | Bacteria | 787 |
| 191 | Ga0182005_1134649 | 3300015265 | Bacteria | 710 |
| 192 | Ga0163161_10003732 | 3300017792 | Bacteria | 10669 |
| 193 | Ga0163161_10013993 | 3300017792 | Bacteria | 5587 |
| 194 | Ga0163161_10021713 | 3300017792 | Bacteria | 4513 |
| 195 | Ga0163161_10036807 | 3300017792 | Bacteria | 3506 |
| 196 | Ga0163161_10053950 | 3300017792 | Bacteria | 2916 |
| 197 | Ga0163161_10210632 | 3300017792 | Bacteria | 1501 |
| 198 | Ga0163161_10352640 | 3300017792 | Bacteria | 1170 |
| 199 | Ga0209435_100487 | 3300025206 | Bacteria | 7849 |
| 200 | Ga0209760_100194 | 3300025207 | Bacteria | 29472 |
| 201 | Ga0209784_100015 | 3300025224 | Bacteria | 482117 |
| 202 | Ga0209566_100012 | 3300025225 | Bacteria | 482281 |
| 203 | Ga0209674_100027 | 3300025226 | Bacteria | 482281 |
| 204 | Ga0209147_100019 | 3300025229 | Bacteria | 482139 |
| 205 | Ga0209563_100031 | 3300025230 | Bacteria | 482281 |
| 206 | Ga0207427_100038 | 3300025231 | Bacteria | 292975 |
| 207 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 208 | Ga0209437_106571 | 3300025233 | Bacteria | 1930 |
| 209 | Ga0209258_100296 | 3300025242 | Bacteria | 81403 |
| 210 | Ga0209646_1000292 | 3300025246 | Bacteria | 42484 |
| 211 | Ga0209677_100016 | 3300025253 | Bacteria | 482117 |
| 212 | Ga0209759_1004305 | 3300025256 | Bacteria | 5354 |
| 213 | Ga0209759_1005302 | 3300025256 | Bacteria | 4557 |
| 214 | Ga0209233_1000074 | 3300025261 | Bacteria | 357367 |
| 215 | Ga0209676_1000056 | 3300025292 | Bacteria | 361329 |
| 216 | Ga0209676_1000503 | 3300025292 | Bacteria | 61955 |
| 217 | Ga0209676_1000524 | 3300025292 | Bacteria | 60019 |
| 218 | Ga0209676_1007863 | 3300025292 | Bacteria | 4898 |
| 219 | Ga0209050_1000060 | 3300025298 | Bacteria | 321699 |
| 220 | Ga0209050_1000361 | 3300025298 | Bacteria | 87075 |
| 221 | Ga0209051_1000037 | 3300025303 | Bacteria | 321747 |
| 222 | Ga0209051_1000061 | 3300025303 | Bacteria | 253485 |
| 223 | Ga0209257_1008780 | 3300025304 | Bacteria | 5616 |
| 224 | Ga0207656_10000014 | 3300025321 | Bacteria | 146941 |
| 225 | Ga0207696_1000034 | 3300025711 | Bacteria | 350426 |
| 226 | Ga0207696_1000293 | 3300025711 | Bacteria | 58344 |
| 227 | Ga0207696_1002462 | 3300025711 | Bacteria | 9054 |
| 228 | Ga0207696_1002498 | 3300025711 | Bacteria | 8984 |
| 229 | Ga0207696_1005740 | 3300025711 | Bacteria | 5102 |
| 230 | Ga0207696_1038649 | 3300025711 | Bacteria | 1408 |
| 231 | Ga0207696_1049493 | 3300025711 | Bacteria | 1205 |
| 232 | Ga0207696_1129935 | 3300025711 | Bacteria | 677 |
| 233 | Ga0207696_1134603 | 3300025711 | Bacteria | 663 |
| 234 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 235 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 236 | Ga0207655_1002284 | 3300025728 | Bacteria | 15777 |
| 237 | Ga0207655_1003175 | 3300025728 | Bacteria | 12403 |
| 238 | Ga0207655_1006185 | 3300025728 | Bacteria | 7976 |
| 239 | Ga0207655_1007329 | 3300025728 | Bacteria | 7168 |
| 240 | Ga0207655_1031840 | 3300025728 | Bacteria | 2421 |
| 241 | Ga0207655_1084598 | 3300025728 | Bacteria | 1134 |
| 242 | Ga0207655_1108755 | 3300025728 | Bacteria | 940 |
| 243 | Ga0207655_1144367 | 3300025728 | Bacteria | 760 |
| 244 | Ga0207713_1000014 | 3300025735 | Bacteria | 432450 |
| 245 | Ga0207713_1000493 | 3300025735 | Bacteria | 40740 |
| 246 | Ga0207713_1000696 | 3300025735 | Bacteria | 31509 |
| 247 | Ga0207713_1007669 | 3300025735 | Bacteria | 6317 |
| 248 | Ga0207713_1007824 | 3300025735 | Bacteria | 6234 |
| 249 | Ga0207713_1022834 | 3300025735 | Bacteria | 2958 |
| 250 | Ga0207713_1030419 | 3300025735 | Bacteria | 2404 |
| 251 | Ga0207713_1037519 | 3300025735 | Bacteria | 2065 |
| 252 | Ga0207713_1055157 | 3300025735 | Bacteria | 1553 |
| 253 | Ga0207713_1104000 | 3300025735 | Bacteria | 975 |
| 254 | Ga0207713_1121328 | 3300025735 | Bacteria | 876 |
| 255 | Ga0207713_1127585 | 3300025735 | Bacteria | 846 |
| 256 | Ga0207713_1146769 | 3300025735 | Bacteria | 765 |
| 257 | Ga0207671_10000019 | 3300025914 | Bacteria | 317781 |
| 258 | Ga0207671_10108147 | 3300025914 | Bacteria | 2113 |
| 259 | Ga0207649_10000002 | 3300025920 | Bacteria | 498633 |
| 260 | Ga0207681_10002090 | 3300025923 | Bacteria | 12799 |
| 261 | Ga0207650_10000337 | 3300025925 | Bacteria | 45511 |
| 262 | Ga0207650_10000421 | 3300025925 | Bacteria | 37575 |
| 263 | Ga0207706_10000136 | 3300025933 | Bacteria | 79887 |
| 264 | Ga0207686_10005889 | 3300025934 | Bacteria | 6581 |
| 265 | Ga0207686_10114636 | 3300025934 | Bacteria | 1824 |
| 266 | Ga0207709_10022130 | 3300025935 | Bacteria | 3604 |
| 267 | Ga0207709_10116462 | 3300025935 | Bacteria | 1797 |
| 268 | Ga0207709_10212157 | 3300025935 | Bacteria | 1390 |
| 269 | Ga0207709_10426065 | 3300025935 | Bacteria | 1020 |
| 270 | Ga0207679_10000006 | 3300025945 | Bacteria | 498868 |
| 271 | Ga0207679_10251297 | 3300025945 | Bacteria | 1503 |
| 272 | Ga0207640_10342229 | 3300025981 | Bacteria | 1198 |
| 273 | Ga0207639_10004918 | 3300026041 | Bacteria | 9002 |
| 274 | Ga0209281_1000010 | 3300027111 | Bacteria | 726106 |
| 275 | Ga0209281_1003222 | 3300027111 | Bacteria | 5565 |
| 276 | Ga0209281_1008557 | 3300027111 | Bacteria | 2472 |
| 277 | Ga0209371_1000095 | 3300027312 | Bacteria | 166175 |
| 278 | Ga0209371_1000414 | 3300027312 | Bacteria | 44059 |
| 279 | Ga0209371_1034274 | 3300027312 | Bacteria | 1077 |
| 280 | Ga0209969_1002749 | 3300027360 | Bacteria | 2438 |
| 281 | Ga0209996_1014712 | 3300027395 | Bacteria | 1064 |
| 282 | Ga0209995_1046387 | 3300027471 | Bacteria | 736 |
| 283 | Ga0209968_1002552 | 3300027526 | Bacteria | 2745 |
| 284 | Ga0209970_1006052 | 3300027614 | Bacteria | 1986 |
| 285 | Ga0209983_1001283 | 3300027665 | Bacteria | 5595 |
| 286 | Ga0209282_1053449 | 3300027666 | Bacteria | 2299 |
| 287 | Ga0209971_1003202 | 3300027682 | Bacteria | 3901 |
| 288 | Ga0209974_10017015 | 3300027876 | Bacteria | 2412 |
| 289 | Ga0209974_10147495 | 3300027876 | Bacteria | 847 |
| 290 | Ga0207428_10115665 | 3300027907 | Bacteria | 2060 |
| 291 | Ga0207428_10464313 | 3300027907 | Bacteria | 922 |
| 292 | Ga0207428_11008923 | 3300027907 | Bacteria | 585 |
| 293 | Ga0268266_10035410 | 3300028379 | Bacteria | 4246 |
| 294 | Ga0268266_10489311 | 3300028379 | Bacteria | 1173 |
| 295 | Ga0307517_10330548 | 3300028786 | Bacteria | 838 |
| 296 | Ga0268256_1000116 | 3300030500 | Bacteria | 115451 |
| 297 | Ga0268256_1000355 | 3300030500 | Bacteria | 44059 |
| 298 | Ga0268256_1038965 | 3300030500 | Bacteria | 1077 |
| 299 | Ga0307511_10095374 | 3300030521 | Bacteria | 1988 |
| 300 | Ga0307511_10165516 | 3300030521 | Bacteria | 1229 |
| 301 | Ga0316177_1109772 | 3300030731 | Bacteria | 1988 |
| 302 | Ga0314311_1132065 | 3300030733 | Bacteria | 2392 |
| 303 | Ga0316179_1069901 | 3300030734 | Bacteria | 807 |
| 304 | Ga0316179_1072406 | 3300030734 | Bacteria | 590 |
| 305 | Ga0316178_1083052 | 3300030735 | Bacteria | 21791 |
| 306 | Ga0316183_1110648 | 3300030742 | Bacteria | 1429 |
| 307 | Ga0316181_1073709 | 3300030744 | Bacteria | 4264 |
| 308 | Ga0316181_1229307 | 3300030744 | Bacteria | 2009 |
| 309 | Ga0307408_100000090 | 3300031548 | Bacteria | 100442 |
| 310 | Ga0307408_100001820 | 3300031548 | Bacteria | 15531 |
| 311 | Ga0307408_100012631 | 3300031548 | Bacteria | 5600 |
| 312 | Ga0307408_100033101 | 3300031548 | Bacteria | 3608 |
| 313 | Ga0307408_100043394 | 3300031548 | Bacteria | 3199 |
| 314 | Ga0307408_100091057 | 3300031548 | Bacteria | 2302 |
| 315 | Ga0307408_100304403 | 3300031548 | Bacteria | 1336 |
| 316 | Ga0307516_10165237 | 3300031730 | Bacteria | 1959 |
| 317 | Ga0307405_10000600 | 3300031731 | Bacteria | 13836 |
| 318 | Ga0307405_10002971 | 3300031731 | Bacteria | 7661 |
| 319 | Ga0307405_10816712 | 3300031731 | Bacteria | 782 |
| 320 | Ga0307413_10030392 | 3300031824 | Bacteria | 3034 |
| 321 | Ga0307413_10035507 | 3300031824 | Bacteria | 2860 |
| 322 | Ga0307406_10404673 | 3300031901 | Bacteria | 1083 |
| 323 | Ga0307406_11599635 | 3300031901 | Bacteria | 575 |
| 324 | Ga0307407_10394198 | 3300031903 | Bacteria | 991 |
| 325 | Ga0307407_11584211 | 3300031903 | Bacteria | 519 |
| 326 | Ga0307412_10001424 | 3300031911 | Bacteria | 13333 |
| 327 | Ga0307412_10005406 | 3300031911 | Bacteria | 7168 |
| 328 | Ga0307412_10005742 | 3300031911 | Bacteria | 6975 |
| 329 | Ga0307412_10016716 | 3300031911 | Bacteria | 4376 |
| 330 | Ga0307412_10028909 | 3300031911 | Bacteria | 3474 |
| 331 | Ga0307412_10334663 | 3300031911 | Bacteria | 1209 |
| 332 | Ga0307412_10549823 | 3300031911 | Bacteria | 969 |
| 333 | Ga0307412_12100073 | 3300031911 | Bacteria | 524 |
| 334 | Ga0307409_100044538 | 3300031995 | Bacteria | 3343 |
| 335 | Ga0307416_100204640 | 3300032002 | Bacteria | 1876 |
| 336 | Ga0307416_100478207 | 3300032002 | Bacteria | 1305 |
| 337 | Ga0307414_10024653 | 3300032004 | Bacteria | 3840 |
| 338 | Ga0307414_10108449 | 3300032004 | Bacteria | 2106 |
| 339 | Ga0307414_10215889 | 3300032004 | Bacteria | 1571 |
| 340 | Ga0307414_10225755 | 3300032004 | Bacteria | 1540 |
| 341 | Ga0307414_10399640 | 3300032004 | Bacteria | 1193 |
| 342 | Ga0307414_10470843 | 3300032004 | Bacteria | 1106 |
| 343 | Ga0307414_11274515 | 3300032004 | Bacteria | 681 |
| 344 | Ga0307411_10028832 | 3300032005 | Bacteria | 3380 |
| 345 | Ga0307411_10098638 | 3300032005 | Bacteria | 2059 |
| 346 | Ga0307411_11721935 | 3300032005 | Bacteria | 580 |
| 347 | Ga0307510_10001784 | 3300033180 | Bacteria | 24023 |
| 348 | Ga0439436_0001968 | 3300041404 | Bacteria | 6087 |
| 349 | Ga0439438_001691 | 3300041405 | Bacteria | 9708 |
| 350 | Ga0439438_001751 | 3300041405 | Bacteria | 9541 |
| 351 | Ga0439438_001896 | 3300041405 | Bacteria | 9156 |
| 352 | Ga0439438_005214 | 3300041405 | Bacteria | 4822 |
| 353 | Ga0439438_006476 | 3300041405 | Bacteria | 4121 |
| 354 | Ga0439438_010012 | 3300041405 | Bacteria | 3030 |
| 355 | Ga0439438_012538 | 3300041405 | Bacteria | 2596 |
| 356 | Ga0439438_014142 | 3300041405 | Bacteria | 2382 |
| 357 | Ga0439438_018677 | 3300041405 | Bacteria | 1970 |
| 358 | Ga0439447_001121 | 3300041407 | Bacteria | 9734 |
| 359 | Ga0439447_001710 | 3300041407 | Bacteria | 8057 |
| 360 | Ga0439447_002220 | 3300041407 | Bacteria | 7124 |
| 361 | Ga0439447_002824 | 3300041407 | Bacteria | 6236 |
| 362 | Ga0439447_007855 | 3300041407 | Bacteria | 3346 |
| 363 | Ga0439447_009508 | 3300041407 | Bacteria | 2940 |
| 364 | Ga0439447_013121 | 3300041407 | Bacteria | 2358 |
| 365 | Ga0439447_040010 | 3300041407 | Bacteria | 1145 |
| 366 | Ga0439453_0017923 | 3300041408 | Bacteria | 1248 |
| 367 | Ga0439461_0072053 | 3300041410 | Bacteria | 802 |
| 368 | Ga0439466_0000163 | 3300041411 | Bacteria | 26650 |
| 369 | Ga0439466_0001747 | 3300041411 | Bacteria | 8496 |
| 370 | Ga0439466_0004531 | 3300041411 | Bacteria | 5336 |
| 371 | Ga0439466_0005958 | 3300041411 | Bacteria | 4639 |
| 372 | Ga0439466_0012003 | 3300041411 | Bacteria | 3200 |
| 373 | Ga0439466_0015802 | 3300041411 | Bacteria | 2738 |
| 374 | Ga0439466_0020529 | 3300041411 | Bacteria | 2352 |
| 375 | Ga0439466_0020615 | 3300041411 | Bacteria | 2347 |
| 376 | Ga0439466_0022787 | 3300041411 | Bacteria | 2207 |
| 377 | Ga0439466_0091343 | 3300041411 | Bacteria | 954 |
| 378 | Ga0439465_0013128 | 3300041413 | Bacteria | 2586 |
| 379 | Ga0451847_0095971 | 3300041503 | Bacteria | 677 |
| 380 | Ga0451843_0170682 | 3300041509 | Bacteria | 578 |
| 381 | Ga0451843_1387418 | 3300041509 | Bacteria | 592 |
| 382 | Ga0439431_0038654 | 3300041997 | Bacteria | 1208 |
| 383 | Ga0439431_0051182 | 3300041997 | Bacteria | 1071 |
| 384 | Ga0439431_0071673 | 3300041997 | Bacteria | 924 |
| 385 | Ga0439437_000171 | 3300042000 | Bacteria | 5511 |
| 386 | Ga0439432_000131 | 3300042006 | Bacteria | 24949 |
| 387 | Ga0439432_002819 | 3300042006 | Bacteria | 6481 |
| 388 | Ga0439432_006745 | 3300042006 | Bacteria | 4089 |
| 389 | Ga0439432_006900 | 3300042006 | Bacteria | 4042 |
| 390 | Ga0439432_013630 | 3300042006 | Bacteria | 2762 |
| 391 | Ga0439432_090129 | 3300042006 | Bacteria | 923 |
| 392 | Ga0439451_015770 | 3300042009 | Bacteria | 1523 |
| 393 | Ga0439451_021244 | 3300042009 | Bacteria | 1309 |
| 394 | Ga0439451_022951 | 3300042009 | Bacteria | 1257 |
| 395 | Ga0439451_046689 | 3300042009 | Bacteria | 867 |
| 396 | Ga0439451_048987 | 3300042009 | Bacteria | 845 |
| 397 | Ga0439452_000207 | 3300042010 | Bacteria | 42410 |
| 398 | Ga0439452_001453 | 3300042010 | Bacteria | 9676 |
| 399 | Ga0439452_003681 | 3300042010 | Bacteria | 5306 |
| 400 | Ga0439452_005021 | 3300042010 | Bacteria | 4327 |
| 401 | Ga0439452_005870 | 3300042010 | Bacteria | 3908 |
| 402 | Ga0439455_0002951 | 3300042012 | Bacteria | 3187 |
| 403 | Ga0439456_000074 | 3300042013 | Bacteria | 35473 |
| 404 | Ga0439456_001007 | 3300042013 | Bacteria | 5598 |
| 405 | Ga0439456_013066 | 3300042013 | Bacteria | 1725 |
| 406 | Ga0439456_057998 | 3300042013 | Bacteria | 849 |
| 407 | Ga0439463_000931 | 3300042016 | Bacteria | 8030 |
| 408 | Ga0439463_003800 | 3300042016 | Bacteria | 3807 |
| 409 | Ga0439463_017076 | 3300042016 | Bacteria | 1797 |
| 410 | Ga0439463_025820 | 3300042016 | Bacteria | 1474 |
| 411 | Ga0439463_052478 | 3300042016 | Bacteria | 1040 |
| 412 | Ga0450911_000204 | 3300042115 | Bacteria | 23320 |
| 413 | Ga0450911_001533 | 3300042115 | Bacteria | 5244 |
| 414 | Ga0450911_001690 | 3300042115 | Bacteria | 4873 |
| 415 | Ga0450911_019593 | 3300042115 | Bacteria | 886 |
| 416 | Ga0450911_022817 | 3300042115 | Bacteria | 814 |
| 417 | Ga0450913_008618 | 3300042117 | Bacteria | 788 |
| 418 | Ga0450919_000714 | 3300042121 | Bacteria | 4186 |
| 419 | Ga0450919_001291 | 3300042121 | Bacteria | 3276 |
| 420 | Ga0450919_024943 | 3300042121 | Bacteria | 678 |
| 421 | Ga0450920_008400 | 3300042122 | Bacteria | 1887 |
| 422 | Ga0450922_000147 | 3300042124 | Bacteria | 7412 |
| 423 | Ga0450890_001456 | 3300042127 | Bacteria | 3401 |
| 424 | Ga0450898_008349 | 3300042134 | Bacteria | 1633 |
| 425 | Ga0450899_013446 | 3300042135 | Bacteria | 924 |
| 426 | Ga0450900_015198 | 3300042136 | Bacteria | 1033 |
| 427 | Ga0450902_000613 | 3300042137 | Bacteria | 4521 |
| 428 | Ga0450902_016728 | 3300042137 | Bacteria | 1196 |
| 429 | Ga0450902_035238 | 3300042137 | Bacteria | 846 |
| 430 | Ga0450903_003177 | 3300042138 | Bacteria | 2863 |
| 431 | Ga0450903_022067 | 3300042138 | Bacteria | 982 |
| 432 | Ga0450903_043155 | 3300042138 | Bacteria | 665 |
| 433 | Ga0450904_000466 | 3300042139 | Bacteria | 8021 |
| 434 | Ga0450904_003311 | 3300042139 | Bacteria | 1762 |
| 435 | Ga0450905_015180 | 3300042142 | Bacteria | 1103 |
| 436 | Ga0450905_088041 | 3300042142 | Bacteria | 546 |
| 437 | Ga0450905_092763 | 3300042142 | Bacteria | 535 |
| 438 | Ga0450906_000358 | 3300042145 | Bacteria | 9254 |
| 439 | Ga0450906_006543 | 3300042145 | Bacteria | 2346 |
| 440 | Ga0450907_000197 | 3300042146 | Bacteria | 21929 |
| 441 | Ga0450907_000424 | 3300042146 | Bacteria | 12604 |
| 442 | Ga0450907_003201 | 3300042146 | Bacteria | 2955 |
| 443 | Ga0450910_000448 | 3300042147 | Bacteria | 4872 |
| 444 | Ga0450910_000974 | 3300042147 | Bacteria | 3469 |
| 445 | Ga0439446_0000313 | 3300042156 | Bacteria | 9270 |
| 446 | Ga0439446_0003304 | 3300042156 | Bacteria | 3983 |
| 447 | Ga0439446_0012156 | 3300042156 | Bacteria | 2348 |
| 448 | Ga0439446_0014964 | 3300042156 | Bacteria | 2147 |
| 449 | Ga0450908_033066 | 3300042184 | Bacteria | 896 |
| 450 | Ga0450909_001937 | 3300042185 | Bacteria | 2923 |
| 451 | Ga0439434_0001659 | 3300042435 | Bacteria | 6443 |
| 452 | Ga0439434_0017329 | 3300042435 | Bacteria | 2155 |
| 453 | Ga0439434_0022457 | 3300042435 | Bacteria | 1897 |
| 454 | Ga0439459_0007181 | 3300042438 | Bacteria | 1875 |
| 455 | Ga0439464_0002872 | 3300042439 | Bacteria | 4287 |
| 456 | Ga0439464_0012530 | 3300042439 | Bacteria | 2259 |
| 457 | Ga0439464_0012958 | 3300042439 | Bacteria | 2227 |
| 458 | Ga0439464_0033449 | 3300042439 | Bacteria | 1447 |
| 459 | Ga0439464_0120884 | 3300042439 | Bacteria | 807 |
| 460 | Ga0439460_0033857 | 3300042461 | Bacteria | 1469 |
| 461 | Ga0439460_0158649 | 3300042461 | Bacteria | 757 |
| 462 | Ga0439460_0271055 | 3300042461 | Bacteria | 589 |
| 463 | Ga0450916_003148 | 3300042530 | Bacteria | 1798 |
| 464 | Ga0450916_046562 | 3300042530 | Bacteria | 673 |
| 465 | Ga0450893_0018953 | 3300042532 | Bacteria | 1175 |
| 466 | Ga0450893_0035470 | 3300042532 | Bacteria | 900 |
| 467 | Ga0450901_007035 | 3300042533 | Bacteria | 1158 |
| 468 | Ga0439440_0002537 | 3300042993 | Bacteria | 3457 |
| 469 | Ga0439440_0004375 | 3300042993 | Bacteria | 2772 |
| 470 | Ga0439440_0010195 | 3300042993 | Bacteria | 1959 |
| 471 | Ga0495617_000127 | 3300046452 | Bacteria | 50396 |
| 472 | Ga0495617_021559 | 3300046452 | Bacteria | 2175 |
| 473 | Ga0495617_039352 | 3300046452 | Bacteria | 1581 |
| 474 | Ga0495617_065203 | 3300046452 | Bacteria | 1201 |
| 475 | Ga0495617_256887 | 3300046452 | Bacteria | 537 |
| 476 | Ga0495627_000074 | 3300046453 | Bacteria | 123139 |
| 477 | Ga0495627_000386 | 3300046453 | Bacteria | 40131 |
| 478 | Ga0495627_000733 | 3300046453 | Bacteria | 24765 |
| 479 | Ga0495627_001977 | 3300046453 | Bacteria | 10586 |
| 480 | Ga0495627_007975 | 3300046453 | Bacteria | 4004 |
| 481 | Ga0495627_013168 | 3300046453 | Bacteria | 2914 |
| 482 | Ga0495603_0079892 | 3300046455 | Bacteria | 1917 |
| 483 | Ga0495603_0138625 | 3300046455 | Bacteria | 1415 |
| 484 | Ga0495590_0006319 | 3300046457 | Bacteria | 4636 |
| 485 | Ga0495590_0090451 | 3300046457 | Bacteria | 1082 |
| 486 | Ga0495591_000351 | 3300046458 | Bacteria | 40796 |
| 487 | Ga0495591_002596 | 3300046458 | Bacteria | 9915 |
| 488 | Ga0495591_004699 | 3300046458 | Bacteria | 6555 |
| 489 | Ga0495591_007840 | 3300046458 | Bacteria | 4461 |
| 490 | Ga0495591_008429 | 3300046458 | Bacteria | 4222 |
| 491 | Ga0495591_009959 | 3300046458 | Bacteria | 3729 |
| 492 | Ga0495591_017008 | 3300046458 | Bacteria | 2510 |
| 493 | Ga0495591_020509 | 3300046458 | Bacteria | 2181 |
| 494 | Ga0495591_062064 | 3300046458 | Bacteria | 990 |
| 495 | Ga0495629_0130214 | 3300046459 | Bacteria | 1752 |
| 496 | Ga0495638_0008766 | 3300046460 | Bacteria | 7144 |
| 497 | Ga0495638_0009529 | 3300046460 | Bacteria | 6807 |
| 498 | Ga0495638_0022186 | 3300046460 | Bacteria | 4170 |
| 499 | Ga0495638_0174564 | 3300046460 | Bacteria | 1230 |
| 500 | Ga0495638_0370003 | 3300046460 | Bacteria | 751 |
| 501 | Ga0495638_0534188 | 3300046460 | Bacteria | 585 |
| 502 | Ga0495653_0023163 | 3300046463 | Bacteria | 5021 |
| 503 | Ga0495653_0028970 | 3300046463 | Bacteria | 4425 |
| 504 | Ga0495653_0119539 | 3300046463 | Bacteria | 1880 |
| 505 | Ga0495653_0154263 | 3300046463 | Bacteria | 1601 |
| 506 | Ga0495653_0346348 | 3300046463 | Bacteria | 956 |
| 507 | Ga0495650_0009577 | 3300046471 | Bacteria | 5495 |
| 508 | Ga0495650_0013923 | 3300046471 | Bacteria | 4222 |
| 509 | Ga0495650_0021060 | 3300046471 | Bacteria | 3161 |
| 510 | Ga0495650_0025032 | 3300046471 | Bacteria | 2807 |
| 511 | Ga0495650_0025111 | 3300046471 | Bacteria | 2800 |
| 512 | Ga0495650_0053515 | 3300046471 | Bacteria | 1652 |
| 513 | Ga0495650_0058133 | 3300046471 | Bacteria | 1562 |
| 514 | Ga0495650_0068133 | 3300046471 | Bacteria | 1404 |
| 515 | Ga0495650_0083417 | 3300046471 | Bacteria | 1228 |
| 516 | Ga0495605_0000182 | 3300046474 | Bacteria | 78093 |
| 517 | Ga0495605_0000362 | 3300046474 | Bacteria | 43622 |
| 518 | Ga0495605_0000543 | 3300046474 | Bacteria | 31038 |
| 519 | Ga0495605_0006153 | 3300046474 | Bacteria | 6919 |
| 520 | Ga0495605_0008292 | 3300046474 | Bacteria | 5877 |
| 521 | Ga0495605_0014838 | 3300046474 | Bacteria | 4252 |
| 522 | Ga0495605_0026615 | 3300046474 | Bacteria | 3005 |
| 523 | Ga0495605_0092019 | 3300046474 | Bacteria | 1404 |
| 524 | Ga0495605_0168874 | 3300046474 | Bacteria | 967 |
| 525 | Ga0495605_0244601 | 3300046474 | Bacteria | 769 |
| 526 | Ga0495584_0003206 | 3300046491 | Bacteria | 9104 |
| 527 | Ga0495584_0006489 | 3300046491 | Bacteria | 6116 |
| 528 | Ga0495584_0011307 | 3300046491 | Bacteria | 4571 |
| 529 | Ga0495584_0012444 | 3300046491 | Bacteria | 4343 |
| 530 | Ga0495584_0017462 | 3300046491 | Bacteria | 3652 |
| 531 | Ga0495584_0029637 | 3300046491 | Bacteria | 2774 |
| 532 | Ga0495584_0036106 | 3300046491 | Bacteria | 2496 |
| 533 | Ga0495584_0052419 | 3300046491 | Bacteria | 2053 |
| 534 | Ga0495585_0007614 | 3300046492 | Bacteria | 6615 |
| 535 | Ga0495585_0008396 | 3300046492 | Bacteria | 6261 |
| 536 | Ga0495585_0011899 | 3300046492 | Bacteria | 5138 |
| 537 | Ga0495585_0019119 | 3300046492 | Bacteria | 3953 |
| 538 | Ga0495585_0022272 | 3300046492 | Bacteria | 3637 |
| 539 | Ga0495585_0034124 | 3300046492 | Bacteria | 2876 |
| 540 | Ga0495585_0048596 | 3300046492 | Bacteria | 2358 |
| 541 | Ga0495585_0054031 | 3300046492 | Bacteria | 2221 |
| 542 | Ga0495585_0077685 | 3300046492 | Bacteria | 1802 |
| 543 | Ga0495594_0000506 | 3300046499 | Bacteria | 19879 |
| 544 | Ga0495594_0060354 | 3300046499 | Bacteria | 2097 |
| 545 | Ga0495596_0037994 | 3300046500 | Bacteria | 1903 |
| 546 | Ga0495596_0077745 | 3300046500 | Bacteria | 1288 |
| 547 | Ga0495607_0000549 | 3300046501 | Bacteria | 36677 |
| 548 | Ga0495607_0000721 | 3300046501 | Bacteria | 31777 |
| 549 | Ga0495607_0001083 | 3300046501 | Bacteria | 24864 |
| 550 | Ga0495607_0001478 | 3300046501 | Bacteria | 20905 |
| 551 | Ga0495607_0012868 | 3300046501 | Bacteria | 5503 |
| 552 | Ga0495607_0015729 | 3300046501 | Bacteria | 4896 |
| 553 | Ga0495607_0018822 | 3300046501 | Bacteria | 4392 |
| 554 | Ga0495607_0027747 | 3300046501 | Bacteria | 3497 |
| 555 | Ga0495607_0068205 | 3300046501 | Bacteria | 1995 |
| 556 | Ga0495607_0092096 | 3300046501 | Bacteria | 1640 |
| 557 | Ga0495607_0097136 | 3300046501 | Bacteria | 1585 |
| 558 | Ga0495607_0170257 | 3300046501 | Bacteria | 1100 |
| 559 | Ga0495607_0236195 | 3300046501 | Bacteria | 886 |
| 560 | Ga0495607_0534086 | 3300046501 | Bacteria | 516 |
| 561 | Ga0495583_0000701 | 3300046506 | Bacteria | 43155 |
| 562 | Ga0495583_0001430 | 3300046506 | Bacteria | 24242 |
| 563 | Ga0495583_0001463 | 3300046506 | Bacteria | 23779 |
| 564 | Ga0495583_0002110 | 3300046506 | Bacteria | 17865 |
| 565 | Ga0495583_0013261 | 3300046506 | Bacteria | 4607 |
| 566 | Ga0495583_0052437 | 3300046506 | Bacteria | 1855 |
| 567 | Ga0495583_0289118 | 3300046506 | Bacteria | 652 |
| 568 | Ga0495606_0000518 | 3300046507 | Bacteria | 62348 |
| 569 | Ga0495606_0008750 | 3300046507 | Bacteria | 8702 |
| 570 | Ga0495606_0015690 | 3300046507 | Bacteria | 5819 |
| 571 | Ga0495606_0016021 | 3300046507 | Bacteria | 5740 |
| 572 | Ga0495606_0053644 | 3300046507 | Bacteria | 2615 |
| 573 | Ga0495606_0086804 | 3300046507 | Bacteria | 1932 |
| 574 | Ga0495606_0132869 | 3300046507 | Bacteria | 1477 |
| 575 | Ga0495606_0209612 | 3300046507 | Bacteria | 1104 |
| 576 | Ga0495606_0233472 | 3300046507 | Bacteria | 1029 |
| 577 | Ga0495610_0006641 | 3300046512 | Bacteria | 7894 |
| 578 | Ga0495610_0011965 | 3300046512 | Bacteria | 5259 |
| 579 | Ga0495610_0013001 | 3300046512 | Bacteria | 4972 |
| 580 | Ga0495610_0026056 | 3300046512 | Bacteria | 3127 |
| 581 | Ga0495610_0050035 | 3300046512 | Bacteria | 2042 |
| 582 | Ga0495610_0054490 | 3300046512 | Bacteria | 1932 |
| 583 | Ga0495610_0062865 | 3300046512 | Bacteria | 1760 |
| 584 | Ga0495610_0118983 | 3300046512 | Bacteria | 1160 |
| 585 | Ga0495610_0263793 | 3300046512 | Bacteria | 677 |
| 586 | Ga0495616_0000823 | 3300046513 | Bacteria | 22657 |
| 587 | Ga0495616_0003782 | 3300046513 | Bacteria | 9651 |
| 588 | Ga0495616_0007448 | 3300046513 | Bacteria | 6552 |
| 589 | Ga0495616_0021398 | 3300046513 | Bacteria | 3502 |
| 590 | Ga0495616_0049557 | 3300046513 | Bacteria | 2104 |
| 591 | Ga0495616_0065241 | 3300046513 | Bacteria | 1774 |
| 592 | Ga0495616_0079097 | 3300046513 | Bacteria | 1576 |
| 593 | Ga0495616_0250496 | 3300046513 | Bacteria | 761 |
| 594 | Ga0495620_0000003 | 3300046515 | Bacteria | 345923 |
| 595 | Ga0495620_0000219 | 3300046515 | Bacteria | 43161 |
| 596 | Ga0495620_0002112 | 3300046515 | Bacteria | 11559 |
| 597 | Ga0495620_0021320 | 3300046515 | Bacteria | 3148 |
| 598 | Ga0495620_0023069 | 3300046515 | Bacteria | 2983 |
| 599 | Ga0495620_0038356 | 3300046515 | Bacteria | 2127 |
| 600 | Ga0495620_0056662 | 3300046515 | Bacteria | 1647 |
| 601 | Ga0495620_0082315 | 3300046515 | Bacteria | 1301 |
| 602 | Ga0495620_0171733 | 3300046515 | Bacteria | 840 |
| 603 | Ga0495630_0186104 | 3300046517 | Bacteria | 1584 |
| 604 | Ga0495631_0001514 | 3300046518 | Bacteria | 14016 |
| 605 | Ga0495631_0002924 | 3300046518 | Bacteria | 9463 |
| 606 | Ga0495631_0007648 | 3300046518 | Bacteria | 5488 |
| 607 | Ga0495631_0088232 | 3300046518 | Bacteria | 1335 |
| 608 | Ga0495632_0000368 | 3300046519 | Bacteria | 42948 |
| 609 | Ga0495632_0001004 | 3300046519 | Bacteria | 24462 |
| 610 | Ga0495632_0001169 | 3300046519 | Bacteria | 22351 |
| 611 | Ga0495632_0003894 | 3300046519 | Bacteria | 10373 |
| 612 | Ga0495632_0004016 | 3300046519 | Bacteria | 10165 |
| 613 | Ga0495632_0006908 | 3300046519 | Bacteria | 7212 |
| 614 | Ga0495632_0009005 | 3300046519 | Bacteria | 6054 |
| 615 | Ga0495632_0009948 | 3300046519 | Bacteria | 5680 |
| 616 | Ga0495632_0015321 | 3300046519 | Bacteria | 4304 |
| 617 | Ga0495632_0022208 | 3300046519 | Bacteria | 3403 |
| 618 | Ga0495632_0053322 | 3300046519 | Bacteria | 1986 |
| 619 | Ga0495632_0065401 | 3300046519 | Bacteria | 1756 |
| 620 | Ga0495632_0066359 | 3300046519 | Bacteria | 1741 |
| 621 | Ga0495632_0127958 | 3300046519 | Bacteria | 1183 |
| 622 | Ga0495632_0522548 | 3300046519 | Bacteria | 510 |
| 623 | Ga0495637_0004413 | 3300046520 | Bacteria | 7302 |
| 624 | Ga0495637_0005233 | 3300046520 | Bacteria | 6643 |
| 625 | Ga0495637_0014398 | 3300046520 | Bacteria | 3731 |
| 626 | Ga0495637_0018333 | 3300046520 | Bacteria | 3248 |
| 627 | Ga0495637_0020873 | 3300046520 | Bacteria | 3006 |
| 628 | Ga0495637_0021522 | 3300046520 | Bacteria | 2955 |
| 629 | Ga0495637_0028969 | 3300046520 | Bacteria | 2468 |
| 630 | Ga0495637_0030890 | 3300046520 | Bacteria | 2373 |
| 631 | Ga0495637_0031897 | 3300046520 | Bacteria | 2326 |
| 632 | Ga0495637_0042927 | 3300046520 | Bacteria | 1932 |
| 633 | Ga0495637_0045825 | 3300046520 | Bacteria | 1852 |
| 634 | Ga0495637_0045923 | 3300046520 | Bacteria | 1849 |
| 635 | Ga0495637_0080271 | 3300046520 | Bacteria | 1301 |
| 636 | Ga0495643_0000116 | 3300046522 | Bacteria | 130165 |
| 637 | Ga0495643_0000890 | 3300046522 | Bacteria | 31795 |
| 638 | Ga0495643_0001490 | 3300046522 | Bacteria | 21278 |
| 639 | Ga0495643_0008981 | 3300046522 | Bacteria | 6280 |
| 640 | Ga0495643_0025313 | 3300046522 | Bacteria | 3358 |
| 641 | Ga0495643_0044794 | 3300046522 | Bacteria | 2402 |
| 642 | Ga0495643_0115631 | 3300046522 | Bacteria | 1359 |
| 643 | Ga0495643_0129424 | 3300046522 | Bacteria | 1268 |
| 644 | Ga0495643_0136079 | 3300046522 | Bacteria | 1229 |
| 645 | Ga0495644_0027732 | 3300046523 | Bacteria | 2145 |
| 646 | Ga0495644_0105512 | 3300046523 | Bacteria | 1067 |
| 647 | Ga0495648_0001113 | 3300046524 | Bacteria | 27255 |
| 648 | Ga0495648_0001580 | 3300046524 | Bacteria | 22187 |
| 649 | Ga0495648_0007222 | 3300046524 | Bacteria | 8922 |
| 650 | Ga0495648_0010337 | 3300046524 | Bacteria | 7117 |
| 651 | Ga0495648_0019892 | 3300046524 | Bacteria | 4700 |
| 652 | Ga0495648_0021013 | 3300046524 | Bacteria | 4533 |
| 653 | Ga0495648_0029271 | 3300046524 | Bacteria | 3657 |
| 654 | Ga0495648_0067596 | 3300046524 | Bacteria | 2089 |
| 655 | Ga0495648_0084387 | 3300046524 | Bacteria | 1797 |
| 656 | Ga0495648_0113600 | 3300046524 | Bacteria | 1468 |
| 657 | Ga0495648_0216408 | 3300046524 | Bacteria | 948 |
| 658 | Ga0495648_0396484 | 3300046524 | Bacteria | 618 |
| 659 | Ga0495666_0036672 | 3300046526 | Bacteria | 2387 |
| 660 | Ga0495666_0045910 | 3300046526 | Bacteria | 2106 |
| 661 | Ga0495666_0047318 | 3300046526 | Bacteria | 2071 |
| 662 | Ga0495642_0000398 | 3300046528 | Bacteria | 23371 |
| 663 | Ga0495642_0105252 | 3300046528 | Bacteria | 1203 |
| 664 | Ga0495654_0000816 | 3300046530 | Bacteria | 23764 |
| 665 | Ga0495654_0001589 | 3300046530 | Bacteria | 15411 |
| 666 | Ga0495654_0008410 | 3300046530 | Bacteria | 5702 |
| 667 | Ga0495654_0008733 | 3300046530 | Bacteria | 5582 |
| 668 | Ga0495654_0011659 | 3300046530 | Bacteria | 4748 |
| 669 | Ga0495654_0013142 | 3300046530 | Bacteria | 4433 |
| 670 | Ga0495654_0013168 | 3300046530 | Bacteria | 4430 |
| 671 | Ga0495654_0027634 | 3300046530 | Bacteria | 2906 |
| 672 | Ga0495654_0071960 | 3300046530 | Bacteria | 1637 |
| 673 | Ga0495654_0124604 | 3300046530 | Bacteria | 1162 |
| 674 | Ga0495654_0142796 | 3300046530 | Bacteria | 1065 |
| 675 | Ga0495654_0166871 | 3300046530 | Bacteria | 962 |
| 676 | Ga0495654_0219997 | 3300046530 | Bacteria | 803 |
| 677 | Ga0495654_0381647 | 3300046530 | Bacteria | 562 |
| 678 | Ga0495586_0070019 | 3300046535 | Bacteria | 1915 |
| 679 | Ga0495587_0026110 | 3300046536 | Bacteria | 3563 |
| 680 | Ga0495587_0204982 | 3300046536 | Bacteria | 1114 |
| 681 | Ga0495587_0411086 | 3300046536 | Bacteria | 751 |
| 682 | Ga0495609_0000006 | 3300046538 | Bacteria | 431833 |
| 683 | Ga0495609_0000317 | 3300046538 | Bacteria | 43158 |
| 684 | Ga0495609_0002066 | 3300046538 | Bacteria | 12632 |
| 685 | Ga0495609_0005135 | 3300046538 | Bacteria | 6971 |
| 686 | Ga0495609_0009658 | 3300046538 | Bacteria | 4657 |
| 687 | Ga0495609_0012540 | 3300046538 | Bacteria | 4019 |
| 688 | Ga0495609_0043508 | 3300046538 | Bacteria | 2016 |
| 689 | Ga0495609_0070601 | 3300046538 | Bacteria | 1535 |
| 690 | Ga0495597_0000040 | 3300046542 | Bacteria | 112292 |
| 691 | Ga0495597_0002162 | 3300046542 | Bacteria | 12921 |
| 692 | Ga0495597_0009538 | 3300046542 | Bacteria | 4788 |
| 693 | Ga0495597_0011500 | 3300046542 | Bacteria | 4290 |
| 694 | Ga0495597_0015427 | 3300046542 | Bacteria | 3618 |
| 695 | Ga0495597_0065409 | 3300046542 | Bacteria | 1577 |
| 696 | Ga0495645_0109363 | 3300046543 | Bacteria | 1957 |
| 697 | Ga0495622_0003985 | 3300046557 | Bacteria | 6896 |
| 698 | Ga0495622_0005610 | 3300046557 | Bacteria | 5819 |
| 699 | Ga0495622_0155316 | 3300046557 | Bacteria | 1033 |
| 700 | Ga0495633_0000476 | 3300046558 | Bacteria | 40643 |
| 701 | Ga0495633_0006725 | 3300046558 | Bacteria | 6768 |
| 702 | Ga0495633_0008551 | 3300046558 | Bacteria | 5752 |
| 703 | Ga0495656_0001597 | 3300046615 | Bacteria | 7418 |
| 704 | Ga0495668_0070744 | 3300046616 | Bacteria | 1918 |
| 705 | Ga0495668_0117490 | 3300046616 | Bacteria | 1454 |
| 706 | Ga0495668_0237894 | 3300046616 | Bacteria | 997 |
| 707 | Ga0495634_0004434 | 3300046642 | Bacteria | 11024 |
| 708 | Ga0495611_0000445 | 3300046648 | Bacteria | 25121 |
| 709 | Ga0495611_0002772 | 3300046648 | Bacteria | 7861 |
| 710 | Ga0495611_0111200 | 3300046648 | Bacteria | 1275 |
| 711 | Ga0495611_0234152 | 3300046648 | Bacteria | 853 |
| 712 | Ga0495625_0029183 | 3300046660 | Bacteria | 4128 |
| 713 | Ga0495625_0078211 | 3300046660 | Bacteria | 2309 |
| 714 | Ga0495625_0291444 | 3300046660 | Bacteria | 1047 |
| 715 | Ga0495625_0296628 | 3300046660 | Bacteria | 1035 |
| 716 | Ga0495625_0323572 | 3300046660 | Bacteria | 981 |
| 717 | Ga0495625_0621818 | 3300046660 | Bacteria | 646 |
| 718 | Ga0495625_0684005 | 3300046660 | Bacteria | 607 |
| 719 | Ga0495625_0870826 | 3300046660 | Bacteria | 518 |
| 720 | Ga0495635_0005516 | 3300046663 | Bacteria | 8798 |
| 721 | Ga0495635_0088686 | 3300046663 | Bacteria | 2116 |
| 722 | Ga0495659_0003358 | 3300046664 | Bacteria | 5129 |
| 723 | Ga0495659_0004687 | 3300046664 | Bacteria | 4303 |
| 724 | Ga0495661_0000232 | 3300046665 | Bacteria | 64230 |
| 725 | Ga0495661_0000829 | 3300046665 | Bacteria | 28983 |
| 726 | Ga0495661_0002086 | 3300046665 | Bacteria | 15691 |
| 727 | Ga0495661_0034184 | 3300046665 | Bacteria | 3199 |
| 728 | Ga0495661_0057432 | 3300046665 | Bacteria | 2323 |
| 729 | Ga0495661_0150885 | 3300046665 | Bacteria | 1255 |
| 730 | Ga0495661_0243446 | 3300046665 | Bacteria | 921 |
| 731 | Ga0495661_0441740 | 3300046665 | Bacteria | 627 |
| 732 | Ga0495588_0016063 | 3300046674 | Bacteria | 3612 |
| 733 | Ga0495623_0010871 | 3300046679 | Bacteria | 5892 |
| 734 | Ga0495646_0010699 | 3300046680 | Bacteria | 5828 |
| 735 | Ga0495646_0012871 | 3300046680 | Bacteria | 5318 |
| 736 | Ga0495669_0009785 | 3300046684 | Bacteria | 4048 |
| 737 | Ga0495613_0055943 | 3300046689 | Bacteria | 2897 |
| 738 | Ga0495670_0001017 | 3300046691 | Bacteria | 13618 |
| 739 | Ga0495670_0002719 | 3300046691 | Bacteria | 8735 |
| 740 | Ga0495670_0004837 | 3300046691 | Bacteria | 6612 |
| 741 | Ga0495670_0016045 | 3300046691 | Bacteria | 3682 |
| 742 | Ga0495671_0003359 | 3300046692 | Bacteria | 9874 |
| 743 | Ga0495671_0007107 | 3300046692 | Bacteria | 6411 |
| 744 | Ga0495671_0016592 | 3300046692 | Bacteria | 3929 |
| 745 | Ga0495671_0018208 | 3300046692 | Bacteria | 3729 |
| 746 | Ga0495671_0019402 | 3300046692 | Bacteria | 3595 |
| 747 | Ga0495671_0025967 | 3300046692 | Bacteria | 3040 |
| 748 | Ga0495671_0085085 | 3300046692 | Bacteria | 1549 |
| 749 | Ga0495671_0184679 | 3300046692 | Bacteria | 1012 |
| 750 | Ga0495671_0304593 | 3300046692 | Bacteria | 766 |
| 751 | Ga0495671_0612815 | 3300046692 | Bacteria | 517 |
| 752 | Ga0495649_0002637 | 3300046694 | Bacteria | 12504 |
| 753 | Ga0495649_0004030 | 3300046694 | Bacteria | 9674 |
| 754 | Ga0495649_0004206 | 3300046694 | Bacteria | 9441 |
| 755 | Ga0495649_0007929 | 3300046694 | Bacteria | 6423 |
| 756 | Ga0495649_0052426 | 3300046694 | Bacteria | 2210 |
| 757 | Ga0495649_0053433 | 3300046694 | Bacteria | 2186 |
| 758 | Ga0495649_0070785 | 3300046694 | Bacteria | 1869 |
| 759 | Ga0495649_0100611 | 3300046694 | Bacteria | 1536 |
| 760 | Ga0495649_0112315 | 3300046694 | Bacteria | 1444 |
| 761 | Ga0495649_0140078 | 3300046694 | Bacteria | 1273 |
| 762 | Ga0495649_0153383 | 3300046694 | Bacteria | 1209 |
| 763 | Ga0495589_0001824 | 3300046794 | Bacteria | 12113 |
| 764 | Ga0495589_0002361 | 3300046794 | Bacteria | 10592 |
| 765 | Ga0495589_0003025 | 3300046794 | Bacteria | 9244 |
| 766 | Ga0495589_0008204 | 3300046794 | Bacteria | 5461 |
| 767 | Ga0495589_0009091 | 3300046794 | Bacteria | 5164 |
| 768 | Ga0495589_0009871 | 3300046794 | Bacteria | 4959 |
| 769 | Ga0495589_0060296 | 3300046794 | Bacteria | 1863 |
| 770 | Ga0495600_0017597 | 3300046809 | Bacteria | 4548 |
| 771 | Ga0495600_0069543 | 3300046809 | Bacteria | 2301 |
| 772 | Ga0495660_0000240 | 3300046810 | Bacteria | 53422 |
| 773 | Ga0495660_0010105 | 3300046810 | Bacteria | 5488 |
| 774 | Ga0495660_0014751 | 3300046810 | Bacteria | 4519 |
| 775 | Ga0495660_0019195 | 3300046810 | Bacteria | 3925 |
| 776 | Ga0495660_0040889 | 3300046810 | Bacteria | 2568 |
| 777 | Ga0495660_0042103 | 3300046810 | Bacteria | 2524 |
| 778 | Ga0495660_0045486 | 3300046810 | Bacteria | 2409 |
| 779 | Ga0495660_0089758 | 3300046810 | Bacteria | 1599 |
| 780 | Ga0495660_0131102 | 3300046810 | Bacteria | 1257 |
| 781 | Ga0495660_0202485 | 3300046810 | Bacteria | 947 |
| 782 | Ga0495604_0019032 | 3300047317 | Bacteria | 5499 |
| 783 | Ga0495604_0020740 | 3300047317 | Bacteria | 5247 |
| 784 | Ga0495636_0002597 | 3300047318 | Bacteria | 6944 |
| 785 | Ga0495636_0181027 | 3300047318 | Bacteria | 956 |
| 786 | Ga0495674_0303162 | 3300047319 | Bacteria | 1304 |
| 787 | Ga0495672_0019644 | 3300047320 | Bacteria | 4453 |
| 788 | Ga0495672_0061162 | 3300047320 | Bacteria | 2171 |
| 789 | Ga0495672_0065510 | 3300047320 | Bacteria | 2076 |
| 790 | Ga0495672_0084182 | 3300047320 | Bacteria | 1764 |
| 791 | Ga0495672_0103137 | 3300047320 | Bacteria | 1543 |
| 792 | Ga0495672_0110864 | 3300047320 | Bacteria | 1473 |
| 793 | Ga0495672_0265430 | 3300047320 | Bacteria | 826 |
| 794 | Ga0495672_0281837 | 3300047320 | Bacteria | 794 |
| 795 | Ga0495676_0075715 | 3300047321 | Bacteria | 2572 |
| 796 | Ga0495680_0008104 | 3300047322 | Bacteria | 9575 |
| 797 | Ga0495680_0046759 | 3300047322 | Bacteria | 3409 |
| 798 | Ga0495680_0218769 | 3300047322 | Bacteria | 1360 |
| 799 | Ga0495680_1014014 | 3300047322 | Bacteria | 529 |
| 800 | Ga0495683_0000289 | 3300047323 | Bacteria | 43297 |
| 801 | Ga0495683_0003356 | 3300047323 | Bacteria | 9358 |
| 802 | Ga0495683_0040567 | 3300047323 | Bacteria | 2351 |
| 803 | Ga0495683_0050970 | 3300047323 | Bacteria | 2070 |
| 804 | Ga0495683_0241100 | 3300047323 | Bacteria | 797 |
| 805 | Ga0495683_0274781 | 3300047323 | Bacteria | 731 |
| 806 | Ga0495675_0013933 | 3300047444 | Bacteria | 5084 |
| 807 | Ga0495675_0498524 | 3300047444 | Bacteria | 699 |
| 808 | Ga0495677_0007690 | 3300047445 | Bacteria | 4021 |
| 809 | Ga0495679_004383 | 3300047446 | Bacteria | 6534 |
| 810 | Ga0495679_006361 | 3300047446 | Bacteria | 5095 |
| 811 | Ga0495679_006417 | 3300047446 | Bacteria | 5064 |
| 812 | Ga0495679_017253 | 3300047446 | Bacteria | 2587 |
| 813 | Ga0495679_017586 | 3300047446 | Bacteria | 2557 |
| 814 | Ga0495679_046881 | 3300047446 | Bacteria | 1313 |
| 815 | Ga0495673_0003472 | 3300047469 | Bacteria | 10370 |
| 816 | Ga0495673_0005327 | 3300047469 | Bacteria | 7804 |
| 817 | Ga0495673_0005781 | 3300047469 | Bacteria | 7408 |
| 818 | Ga0495673_0006941 | 3300047469 | Bacteria | 6594 |
| 819 | Ga0495673_0011839 | 3300047469 | Bacteria | 4661 |
| 820 | Ga0495673_0013122 | 3300047469 | Bacteria | 4364 |
| 821 | Ga0495673_0025236 | 3300047469 | Bacteria | 2857 |
| 822 | Ga0495673_0041794 | 3300047469 | Bacteria | 2061 |
| 823 | Ga0495673_0104499 | 3300047469 | Bacteria | 1140 |
| 824 | Ga0495673_0105878 | 3300047469 | Bacteria | 1130 |
| 825 | Ga0495681_0000762 | 3300047470 | Bacteria | 24824 |
| 826 | Ga0495681_0001492 | 3300047470 | Bacteria | 17484 |
| 827 | Ga0495681_0008925 | 3300047470 | Bacteria | 6228 |
| 828 | Ga0495681_0009356 | 3300047470 | Bacteria | 6045 |
| 829 | Ga0495681_0009954 | 3300047470 | Bacteria | 5799 |
| 830 | Ga0495681_0014993 | 3300047470 | Bacteria | 4408 |
| 831 | Ga0495681_0036180 | 3300047470 | Bacteria | 2444 |
| 832 | Ga0495681_0048475 | 3300047470 | Bacteria | 2013 |
| 833 | Ga0495681_0058080 | 3300047470 | Bacteria | 1794 |
| 834 | Ga0495681_0083985 | 3300047470 | Bacteria | 1417 |
| 835 | Ga0495686_0021995 | 3300047472 | Bacteria | 4223 |
| 836 | Ga0495686_0030736 | 3300047472 | Bacteria | 3486 |
| 837 | Ga0495686_0092459 | 3300047472 | Bacteria | 1834 |
| 838 | Ga0495686_0307783 | 3300047472 | Bacteria | 872 |
| 839 | Ga0495686_0442794 | 3300047472 | Bacteria | 691 |
| 840 | Ga0495593_0027293 | 3300047673 | Bacteria | 3143 |
| 841 | Ga0495593_0130000 | 3300047673 | Bacteria | 1278 |
| 842 | Ga0495626_0004635 | 3300048091 | Bacteria | 8357 |
| 843 | Ga0495626_0032624 | 3300048091 | Bacteria | 2499 |
| 844 | Ga0495626_0058680 | 3300048091 | Bacteria | 1757 |
| 845 | Ga0495626_0090500 | 3300048091 | Bacteria | 1345 |
| 846 | Ga0495626_0103613 | 3300048091 | Bacteria | 1238 |
| 847 | Ga0495626_0136738 | 3300048091 | Bacteria | 1041 |
| 848 | Ga0496102_0001186 | 3300048905 | Bacteria | 23689 |
| 849 | Ga0496103_0017077 | 3300048906 | Bacteria | 4339 |
| 850 | Ga0496110_0314329 | 3300048913 | Bacteria | 1426 |
| 851 | Ga0496110_0329391 | 3300048913 | Bacteria | 1391 |
| 852 | Ga0496110_1010618 | 3300048913 | Bacteria | 739 |
| 853 | Ga0496114_0137484 | 3300048917 | Bacteria | 2113 |
| 854 | Ga0496114_0321493 | 3300048917 | Bacteria | 1367 |
| 855 | Ga0496116_0001251 | 3300048919 | Bacteria | 29495 |
| 856 | Ga0496116_0029406 | 3300048919 | Bacteria | 3962 |
| 857 | Ga0496116_0071203 | 3300048919 | Bacteria | 2202 |
| 858 | Ga0496117_0001478 | 3300048920 | Bacteria | 33728 |
| 859 | Ga0496117_0007829 | 3300048920 | Bacteria | 10281 |
| 860 | Ga0496117_0008263 | 3300048920 | Bacteria | 9912 |
| 861 | Ga0496117_0041468 | 3300048920 | Bacteria | 3372 |
| 862 | Ga0496117_0059427 | 3300048920 | Bacteria | 2640 |
| 863 | Ga0496117_0074046 | 3300048920 | Bacteria | 2269 |
| 864 | Ga0496117_0104654 | 3300048920 | Bacteria | 1780 |
| 865 | Ga0496117_0289699 | 3300048920 | Bacteria | 872 |
| 866 | Ga0496117_0621726 | 3300048920 | Bacteria | 502 |
| 867 | Ga0496118_0004423 | 3300048921 | Bacteria | 16676 |
| 868 | Ga0496118_0076077 | 3300048921 | Bacteria | 2389 |
| 869 | Ga0496118_0081141 | 3300048921 | Bacteria | 2278 |
| 870 | Ga0496118_0084480 | 3300048921 | Bacteria | 2214 |
| 871 | Ga0496118_0088067 | 3300048921 | Bacteria | 2149 |
| 872 | Ga0496118_0109579 | 3300048921 | Bacteria | 1837 |
| 873 | Ga0496119_0000207 | 3300048922 | Bacteria | 83748 |
| 874 | Ga0496119_0037107 | 3300048922 | Bacteria | 3170 |
| 875 | Ga0496119_0125463 | 3300048922 | Bacteria | 1405 |
| 876 | Ga0496119_0142247 | 3300048922 | Bacteria | 1294 |
| 877 | Ga0496119_0270849 | 3300048922 | Bacteria | 848 |
| 878 | Ga0496120_0009849 | 3300048923 | Bacteria | 6732 |
| 879 | Ga0496120_0015054 | 3300048923 | Bacteria | 5117 |
| 880 | Ga0496120_0076271 | 3300048923 | Bacteria | 1827 |
| 881 | Ga0496120_0109051 | 3300048923 | Bacteria | 1449 |
| 882 | Ga0496120_0163695 | 3300048923 | Bacteria | 1106 |
| 883 | Ga0496121_0031430 | 3300048924 | Bacteria | 4850 |
| 884 | Ga0496121_0066698 | 3300048924 | Bacteria | 2920 |
| 885 | Ga0496121_0094464 | 3300048924 | Bacteria | 2326 |
| 886 | Ga0496121_0116495 | 3300048924 | Bacteria | 2026 |
| 887 | Ga0496121_0300810 | 3300048924 | Bacteria | 1089 |
| 888 | Ga0496122_0002127 | 3300048925 | Bacteria | 29138 |
| 889 | Ga0496122_0018595 | 3300048925 | Bacteria | 6405 |
| 890 | Ga0496122_0063303 | 3300048925 | Bacteria | 2700 |
| 891 | Ga0496122_0087950 | 3300048925 | Bacteria | 2132 |
| 892 | Ga0496122_0094718 | 3300048925 | Bacteria | 2020 |
| 893 | Ga0496122_0115168 | 3300048925 | Bacteria | 1752 |
| 894 | Ga0496122_0172038 | 3300048925 | Bacteria | 1304 |
| 895 | Ga0496123_0000387 | 3300048926 | Bacteria | 82706 |
| 896 | Ga0496123_0027794 | 3300048926 | Bacteria | 4204 |
| 897 | Ga0496123_0048509 | 3300048926 | Bacteria | 2856 |
| 898 | Ga0496123_0069293 | 3300048926 | Bacteria | 2215 |
| 899 | Ga0496123_0070799 | 3300048926 | Bacteria | 2180 |
| 900 | Ga0496123_0086236 | 3300048926 | Bacteria | 1884 |
| 901 | Ga0496124_0009462 | 3300048927 | Bacteria | 10033 |
| 902 | Ga0496124_0017418 | 3300048927 | Bacteria | 6770 |
| 903 | Ga0496124_0019452 | 3300048927 | Bacteria | 6318 |
| 904 | Ga0496124_0024971 | 3300048927 | Bacteria | 5420 |
| 905 | Ga0496124_0027845 | 3300048927 | Bacteria | 5063 |
| 906 | Ga0496124_0053505 | 3300048927 | Bacteria | 3421 |
| 907 | Ga0496124_0177850 | 3300048927 | Bacteria | 1640 |
| 908 | Ga0496124_0209443 | 3300048927 | Bacteria | 1476 |
| 909 | Ga0496124_0358988 | 3300048927 | Bacteria | 1027 |
| 910 | Ga0496125_0009616 | 3300048928 | Bacteria | 9887 |
| 911 | Ga0496125_0017334 | 3300048928 | Bacteria | 6874 |
| 912 | Ga0496125_0023336 | 3300048928 | Bacteria | 5712 |
| 913 | Ga0496125_0028811 | 3300048928 | Bacteria | 5004 |
| 914 | Ga0496125_0035744 | 3300048928 | Bacteria | 4351 |
| 915 | Ga0496125_0067834 | 3300048928 | Bacteria | 2808 |
| 916 | Ga0496125_0110319 | 3300048928 | Bacteria | 1995 |
| 917 | Ga0496125_0134073 | 3300048928 | Bacteria | 1736 |
| 918 | Ga0496125_0138426 | 3300048928 | Bacteria | 1697 |
| 919 | Ga0496126_0012460 | 3300048929 | Bacteria | 8709 |
| 920 | Ga0496126_0074611 | 3300048929 | Bacteria | 3011 |
| 921 | Ga0496126_0115154 | 3300048929 | Bacteria | 2338 |
| 922 | Ga0496126_0187901 | 3300048929 | Bacteria | 1751 |
| 923 | Ga0496126_0481092 | 3300048929 | Bacteria | 995 |
| 924 | Ga0495678_000412 | 3300049459 | Bacteria | 43250 |
| 925 | Ga0495678_002222 | 3300049459 | Bacteria | 13580 |
| 926 | Ga0495678_004142 | 3300049459 | Bacteria | 8564 |
| 927 | Ga0495678_004588 | 3300049459 | Bacteria | 7944 |
| 928 | Ga0495678_009174 | 3300049459 | Bacteria | 4922 |
| 929 | Ga0495678_025348 | 3300049459 | Bacteria | 2548 |
| 930 | Ga0495678_049667 | 3300049459 | Bacteria | 1629 |
| 931 | Ga0495678_055955 | 3300049459 | Bacteria | 1502 |
| 932 | Ga0495678_082907 | 3300049459 | Bacteria | 1147 |
| 933 | Ga0495678_086446 | 3300049459 | Bacteria | 1114 |
| 934 | Ga0495682_0000616 | 3300049460 | Bacteria | 23944 |
| 935 | Ga0495682_0002905 | 3300049460 | Bacteria | 7863 |
| 936 | Ga0495682_0022350 | 3300049460 | Bacteria | 2365 |
| 937 | Ga0495682_0054116 | 3300049460 | Bacteria | 1457 |
| 938 | Ga0495682_0055347 | 3300049460 | Bacteria | 1438 |
| 939 | Ga0495682_0228804 | 3300049460 | Bacteria | 658 |
| 940 | Ga0501314_045998 | 3300049530 | Bacteria | 518 |
| 941 | Ga0501032_0702482 | 3300049569 | Bacteria | 641 |
| 942 | Ga0501033_0384040 | 3300049570 | Bacteria | 981 |
| 943 | Ga0501034_0000370 | 3300049571 | Bacteria | 76588 |
| 944 | Ga0501034_0314956 | 3300049571 | Bacteria | 1499 |
| 945 | Ga0501222_068915 | 3300049662 | Bacteria | 547 |
| 946 | Ga0501227_060804 | 3300049665 | Bacteria | 968 |
| 947 | Ga0501241_005745 | 3300049758 | Bacteria | 2303 |
| 948 | Ga0501035_0740385 | 3300049822 | Bacteria | 790 |
| 949 | Ga0501226_000005 | 3300049853 | Bacteria | 271019 |
| 950 | nmdc:mga00v17_67392_c1 | 3300050491 | Bacteria | 2211 |
| 951 | nmdc:mga08x19_482303_c2 | 3300050514 | Bacteria | 563 |
| 952 | Ga0500650_0478805 | 3300053098 | Bacteria | 531 |
| 953 | Ga0500572_001316 | 3300053111 | Bacteria | 6921 |
| 954 | Ga0500621_100282 | 3300053126 | Bacteria | 1143 |
| 955 | Ga0500577_0070427 | 3300053142 | Bacteria | 1370 |
| 956 | Ga0500634_0031621 | 3300053161 | Bacteria | 2887 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 3007252601 | 3007256116 | 95 |
| 2 | iso_pu_bacteria | 2990196909 | 2990200347 | 98 |
| 3 | 3300041411 | Ga0439466_0020529 | Ga0439466_0020529_1341_1640 | 99 |
| 4 | 3300042439 | Ga0439464_0120884 | Ga0439464_0120884_305_604 | 99 |
| 5 | 3300003856 | Ga0058692_1032544 | Ga0058692_10325442 | 100 |
| 6 | 3300009011 | Ga0105251_10190125 | Ga0105251_101901252 | 100 |
| 7 | 3300009092 | Ga0105250_10075742 | Ga0105250_100757422 | 100 |
| 8 | 3300013102 | Ga0157371_10011479 | Ga0157371_100114796 | 100 |
| 9 | 3300013306 | Ga0163162_12441669 | Ga0163162_124416691 | 100 |
| 10 | 3300015261 | Ga0182006_1012798 | Ga0182006_10127982 | 100 |
| 11 | 3300025711 | Ga0207696_1129935 | Ga0207696_11299352 | 100 |
| 12 | 3300025735 | Ga0207713_1146769 | Ga0207713_11467692 | 100 |
| 13 | 3300027312 | Ga0209371_1000095 | Ga0209371_1000095101 | 100 |
| 14 | 3300030500 | Ga0268256_1000116 | Ga0268256_100011617 | 100 |
| 15 | 3300041411 | Ga0439466_0091343 | Ga0439466_0091343_567_869 | 100 |
| 16 | 3300042156 | Ga0439446_0000313 | Ga0439446_0000313_7240_7542 | 100 |
| 17 | 3300042439 | Ga0439464_0033449 | Ga0439464_0033449_742_1044 | 100 |
| 18 | 3300046453 | Ga0495627_000386 | Ga0495627_000386_36015_36317 | 100 |
| 19 | 3300046471 | Ga0495650_0021060 | Ga0495650_0021060_1001_1303 | 100 |
| 20 | 3300046518 | Ga0495631_0007648 | Ga0495631_0007648_1623_1925 | 100 |
| 21 | 3300046519 | Ga0495632_0009948 | Ga0495632_0009948_1337_1639 | 100 |
| 22 | 3300046519 | Ga0495632_0015321 | Ga0495632_0015321_176_478 | 100 |
| 23 | 3300046530 | Ga0495654_0008733 | Ga0495654_0008733_1436_1738 | 100 |
| 24 | 3300046692 | Ga0495671_0003359 | Ga0495671_0003359_4056_4358 | 100 |
| 25 | 3300047320 | Ga0495672_0265430 | Ga0495672_0265430_423_725 | 100 |
| 26 | 3300048926 | Ga0496123_0070799 | Ga0496123_0070799_1375_1677 | 100 |
| 27 | iso_pu_bacteria | 3007315729 | 3007319793 | 100 |
| 28 | 3300009011 | Ga0105251_10000061 | Ga0105251_1000006192 | 101 |
| 29 | 3300009092 | Ga0105250_10000299 | Ga0105250_100002997 | 101 |
| 30 | 3300025711 | Ga0207696_1000034 | Ga0207696_1000034238 | 101 |
| 31 | 3300025735 | Ga0207713_1000014 | Ga0207713_1000014195 | 101 |
| 32 | iso_pu_bacteria | 2728369097 | 2729147671 | 101 |
| 33 | iso_pu_bacteria | 2599185155 | 2599328419 | 102 |
| 34 | iso_pu_bacteria | 2826581358 | 2826584181 | 102 |
| 35 | iso_pu_bacteria | 2842815866 | 2842820947 | 102 |
| 36 | iso_pu_bacteria | 2842849001 | 2842849643 | 102 |
| 37 | 3300027360 | Ga0209969_1002749 | Ga0209969_10027491 | 103 |
| 38 | 3300027395 | Ga0209996_1014712 | Ga0209996_10147122 | 103 |
| 39 | 3300027471 | Ga0209995_1046387 | Ga0209995_10463872 | 103 |
| 40 | 3300027526 | Ga0209968_1002552 | Ga0209968_10025522 | 103 |
| 41 | 3300027614 | Ga0209970_1006052 | Ga0209970_10060522 | 103 |
| 42 | 3300027665 | Ga0209983_1001283 | Ga0209983_10012835 | 103 |
| 43 | 3300027682 | Ga0209971_1003202 | Ga0209971_10032022 | 103 |
| 44 | 3300027876 | Ga0209974_10017015 | Ga0209974_100170152 | 103 |
| 45 | iso_pu_bacteria | 2554235132 | 2554813604 | 103 |
| 46 | iso_pu_bacteria | 2600254954 | 2600447024 | 103 |
| 47 | iso_pu_bacteria | 2600255389 | 2602010088 | 103 |
| 48 | iso_pu_bacteria | 2606217733 | 2608381224 | 103 |
| 49 | iso_pu_bacteria | 2808606379 | 2808943023 | 103 |
| 50 | iso_pu_bacteria | 2811994881 | 2812368357 | 103 |
| 51 | iso_pu_bacteria | 2823421272 | 2823422584 | 103 |
| 52 | iso_pu_bacteria | 2923519811 | 2923522412 | 103 |
| 53 | iso_pu_bacteria | 651053060 | 651176742 | 103 |
| 54 | iso_pu_bacteria | 8034962539 | 8034966250 | 103 |
| 55 | 3300009036 | Ga0105244_10021963 | Ga0105244_100219634 | 104 |
| 56 | 3300025728 | Ga0207655_1031840 | Ga0207655_10318402 | 104 |
| 57 | iso_pu_bacteria | 2511231006 | 2511266688 | 104 |
| 58 | iso_pu_bacteria | 2511231024 | 2511378077 | 104 |
| 59 | iso_pu_bacteria | 2512047018 | 2512328575 | 104 |
| 60 | iso_pu_bacteria | 2554235341 | 2555668105 | 104 |
| 61 | iso_pu_bacteria | 2582580891 | 2583790542 | 104 |
| 62 | iso_pu_bacteria | 2597489887 | 2597856319 | 104 |
| 63 | iso_pu_bacteria | 2597489888 | 2597862484 | 104 |
| 64 | iso_pu_bacteria | 2597489889 | 2597868260 | 104 |
| 65 | iso_pu_bacteria | 2599185160 | 2599355104 | 104 |
| 66 | iso_pu_bacteria | 2599185161 | 2599361072 | 104 |
| 67 | iso_pu_bacteria | 2599185162 | 2599367394 | 104 |
| 68 | iso_pu_bacteria | 2599185163 | 2599374184 | 104 |
| 69 | iso_pu_bacteria | 2599185164 | 2599380210 | 104 |
| 70 | iso_pu_bacteria | 2599185165 | 2599386657 | 104 |
| 71 | iso_pu_bacteria | 2599185166 | 2599393042 | 104 |
| 72 | iso_pu_bacteria | 2599185167 | 2599396918 | 104 |
| 73 | iso_pu_bacteria | 2599185168 | 2599404809 | 104 |
| 74 | iso_pu_bacteria | 2599185179 | 2599448896 | 104 |
| 75 | iso_pu_bacteria | 2599185181 | 2599461938 | 104 |
| 76 | iso_pu_bacteria | 2599185182 | 2599467019 | 104 |
| 77 | iso_pu_bacteria | 2599185185 | 2599483426 | 104 |
| 78 | iso_pu_bacteria | 2599185186 | 2599490969 | 104 |
| 79 | iso_pu_bacteria | 2599185189 | 2599508969 | 104 |
| 80 | iso_pu_bacteria | 2599185190 | 2599511345 | 104 |
| 81 | iso_pu_bacteria | 2599185191 | 2599517715 | 104 |
| 82 | iso_pu_bacteria | 2599185257 | 2599805332 | 104 |
| 83 | iso_pu_bacteria | 2599185288 | 2599879803 | 104 |
| 84 | iso_pu_bacteria | 2599185290 | 2599890719 | 104 |
| 85 | iso_pu_bacteria | 2599185303 | 2599948310 | 104 |
| 86 | iso_pu_bacteria | 2599185356 | 2600214560 | 104 |
| 87 | iso_pu_bacteria | 2600254931 | 2600364039 | 104 |
| 88 | iso_pu_bacteria | 2600255296 | 2601691081 | 104 |
| 89 | iso_pu_bacteria | 2600255313 | 2601774735 | 104 |
| 90 | iso_pu_bacteria | 2619619299 | 2621301370 | 104 |
| 91 | iso_pu_bacteria | 2643221571 | 2643873290 | 104 |
| 92 | iso_pu_bacteria | 2643221713 | 2644624164 | 104 |
| 93 | iso_pu_bacteria | 2667528171 | 2671097705 | 104 |
| 94 | iso_pu_bacteria | 2671180172 | 2671767933 | 104 |
| 95 | iso_pu_bacteria | 2721755607 | 2723247376 | 104 |
| 96 | iso_pu_bacteria | 2738541265 | 2738673856 | 104 |
| 97 | iso_pu_bacteria | 2738541282 | 2738752249 | 104 |
| 98 | iso_pu_bacteria | 2738541294 | 2738809265 | 104 |
| 99 | iso_pu_bacteria | 2738541303 | 2738861290 | 104 |
| 100 | iso_pu_bacteria | 2738541309 | 2738896625 | 104 |
| 101 | iso_pu_bacteria | 2738543020 | 2739286466 | 104 |
| 102 | iso_pu_bacteria | 2738543021 | 2739291779 | 104 |
| 103 | iso_pu_bacteria | 2740892503 | 2743735727 | 104 |
| 104 | iso_pu_bacteria | 2765235841 | 2765582284 | 104 |
| 105 | iso_pu_bacteria | 2808606385 | 2808975411 | 104 |
| 106 | iso_pu_bacteria | 2808606388 | 2808990950 | 104 |
| 107 | iso_pu_bacteria | 2816332298 | 2817489262 | 104 |
| 108 | iso_pu_bacteria | 2818991464 | 2819702788 | 104 |
| 109 | iso_pu_bacteria | 2842805378 | 2842808835 | 104 |
| 110 | iso_pu_bacteria | 2842826826 | 2842828873 | 104 |
| 111 | iso_pu_bacteria | 2842837860 | 2842842604 | 104 |
| 112 | iso_pu_bacteria | 2844665904 | 2844668611 | 104 |
| 113 | iso_pu_bacteria | 2852612431 | 2852615353 | 104 |
| 114 | iso_pu_bacteria | 2852667396 | 2852670321 | 104 |
| 115 | iso_pu_bacteria | 2860867994 | 2860869222 | 104 |
| 116 | iso_pu_bacteria | 2908446538 | 2908448076 | 104 |
| 117 | iso_pu_bacteria | 2912963787 | 2912964936 | 104 |
| 118 | iso_pu_bacteria | 2917070673 | 2917071867 | 104 |
| 119 | iso_pu_bacteria | 2919155634 | 2919158838 | 104 |
| 120 | iso_pu_bacteria | 2923153595 | 2923154736 | 104 |
| 121 | iso_pu_bacteria | 2929189879 | 2929191178 | 104 |
| 122 | iso_pu_bacteria | 2931390751 | 2931392182 | 104 |
| 123 | iso_pu_bacteria | 2935353572 | 2935354039 | 104 |
| 124 | iso_pu_bacteria | 2939651529 | 2939653295 | 104 |
| 125 | iso_pu_bacteria | 2945928738 | 2945929393 | 104 |
| 126 | iso_pu_bacteria | 2945961074 | 2945961430 | 104 |
| 127 | iso_pu_bacteria | 2946006987 | 2946011664 | 104 |
| 128 | iso_pu_bacteria | 2946027586 | 2946029420 | 104 |
| 129 | iso_pu_bacteria | 2947233263 | 2947236008 | 104 |
| 130 | iso_pu_bacteria | 2984286254 | 2984291295 | 104 |
| 131 | iso_pu_bacteria | 3007395558 | 3007400264 | 104 |
| 132 | iso_pu_bacteria | 3007419365 | 3007420745 | 104 |
| 133 | iso_pu_bacteria | 637000220 | 637318483 | 104 |
| 134 | iso_pu_bacteria | 8015687852 | 8015688969 | 104 |
| 135 | iso_pu_bacteria | 8052494512 | 8052495735 | 104 |
| 136 | iso_pu_bacteria | 8054285046 | 8054285795 | 104 |
| 137 | iso_pu_bacteria | 8054347763 | 8054348386 | 104 |
| 138 | iso_pu_bacteria | 8054503363 | 8054504759 | 104 |
| 139 | iso_pu_bacteria | 8054929484 | 8054929545 | 104 |
| 140 | iso_pu_bacteria | 8055770955 | 8055772087 | 104 |
| 141 | iso_pu_bacteria | 8055817908 | 8055819202 | 104 |
| 142 | iso_pu_bacteria | 8056131705 | 8056133122 | 104 |
| 143 | iso_pu_bacteria | 8056148874 | 8056149302 | 104 |
| 144 | iso_pu_bacteria | 8056161164 | 8056166711 | 104 |
| 145 | iso_pu_bacteria | 2511231004 | 2511253999 | 105 |
| 146 | iso_pu_bacteria | 2511231007 | 2511273209 | 105 |
| 147 | iso_pu_bacteria | 2511231008 | 2511280010 | 105 |
| 148 | iso_pu_bacteria | 2511231010 | 2511290026 | 105 |
| 149 | iso_pu_bacteria | 2511231011 | 2511295555 | 105 |
| 150 | iso_pu_bacteria | 2511231016 | 2511328876 | 105 |
| 151 | iso_pu_bacteria | 2511231018 | 2511340979 | 105 |
| 152 | iso_pu_bacteria | 2511231019 | 2511343969 | 105 |
| 153 | iso_pu_bacteria | 2511231021 | 2511356274 | 105 |
| 154 | iso_pu_bacteria | 2511231022 | 2511362263 | 105 |
| 155 | iso_pu_bacteria | 2511231023 | 2511367223 | 105 |
| 156 | iso_pu_bacteria | 2511231031 | 2511411053 | 105 |
| 157 | iso_pu_bacteria | 2599185188 | 2599501187 | 105 |
| 158 | iso_pu_bacteria | 2599185212 | 2599613848 | 105 |
| 159 | iso_pu_bacteria | 2599185248 | 2599770738 | 105 |
| 160 | iso_pu_bacteria | 2599185289 | 2599886616 | 105 |
| 161 | iso_pu_bacteria | 2599185291 | 2599896985 | 105 |
| 162 | iso_pu_bacteria | 2599185300 | 2599934089 | 105 |
| 163 | iso_pu_bacteria | 2599185302 | 2599942989 | 105 |
| 164 | iso_pu_bacteria | 2599185304 | 2599953972 | 105 |
| 165 | iso_pu_bacteria | 2599185305 | 2599959484 | 105 |
| 166 | iso_pu_bacteria | 2599185306 | 2599966270 | 105 |
| 167 | iso_pu_bacteria | 2599185308 | 2599978115 | 105 |
| 168 | iso_pu_bacteria | 2599185309 | 2599985285 | 105 |
| 169 | iso_pu_bacteria | 2599185310 | 2599987209 | 105 |
| 170 | iso_pu_bacteria | 2599185311 | 2599995483 | 105 |
| 171 | iso_pu_bacteria | 2599185312 | 2599999962 | 105 |
| 172 | iso_pu_bacteria | 2599185313 | 2600008777 | 105 |
| 173 | iso_pu_bacteria | 2599185314 | 2600012415 | 105 |
| 174 | iso_pu_bacteria | 2599185315 | 2600016679 | 105 |
| 175 | iso_pu_bacteria | 2599185316 | 2600024908 | 105 |
| 176 | iso_pu_bacteria | 2599185317 | 2600029644 | 105 |
| 177 | iso_pu_bacteria | 2599185318 | 2600035464 | 105 |
| 178 | iso_pu_bacteria | 2599185319 | 2600041311 | 105 |
| 179 | iso_pu_bacteria | 2599185320 | 2600045535 | 105 |
| 180 | iso_pu_bacteria | 2599185321 | 2600056525 | 105 |
| 181 | iso_pu_bacteria | 2599185322 | 2600058439 | 105 |
| 182 | iso_pu_bacteria | 2599185323 | 2600063890 | 105 |
| 183 | iso_pu_bacteria | 2599185324 | 2600074815 | 105 |
| 184 | iso_pu_bacteria | 2599185325 | 2600079492 | 105 |
| 185 | iso_pu_bacteria | 2600254930 | 2600358322 | 105 |
| 186 | iso_pu_bacteria | 2600255318 | 2601800135 | 105 |
| 187 | iso_pu_bacteria | 2603880185 | 2606074599 | 105 |
| 188 | iso_pu_bacteria | 2603880199 | 2606127462 | 105 |
| 189 | iso_pu_bacteria | 2623620443 | 2624478888 | 105 |
| 190 | iso_pu_bacteria | 2623620446 | 2624490395 | 105 |
| 191 | iso_pu_bacteria | 2643221633 | 2644189222 | 105 |
| 192 | iso_pu_bacteria | 2643221650 | 2644281534 | 105 |
| 193 | iso_pu_bacteria | 2651869719 | 2652546813 | 105 |
| 194 | iso_pu_bacteria | 2667528170 | 2671094516 | 105 |
| 195 | iso_pu_bacteria | 2667528176 | 2671127871 | 105 |
| 196 | iso_pu_bacteria | 2675903515 | 2678261617 | 105 |
| 197 | iso_pu_bacteria | 2713897148 | 2715752800 | 105 |
| 198 | iso_pu_bacteria | 2713897149 | 2715757599 | 105 |
| 199 | iso_pu_bacteria | 2718217725 | 2718632772 | 105 |
| 200 | iso_pu_bacteria | 2738543025 | 2739312842 | 105 |
| 201 | iso_pu_bacteria | 2744054620 | 2745007966 | 105 |
| 202 | iso_pu_bacteria | 2773857670 | 2774122226 | 105 |
| 203 | iso_pu_bacteria | 2773857673 | 2774136638 | 105 |
| 204 | iso_pu_bacteria | 2784132063 | 2784260393 | 105 |
| 205 | iso_pu_bacteria | 2784132072 | 2784317585 | 105 |
| 206 | iso_pu_bacteria | 2791355520 | 2794594408 | 105 |
| 207 | iso_pu_bacteria | 2808606361 | 2808854130 | 105 |
| 208 | iso_pu_bacteria | 2808606373 | 2808904890 | 105 |
| 209 | iso_pu_bacteria | 2808606376 | 2808923421 | 105 |
| 210 | iso_pu_bacteria | 2808606377 | 2808928696 | 105 |
| 211 | iso_pu_bacteria | 2808606378 | 2808934162 | 105 |
| 212 | iso_pu_bacteria | 2808606380 | 2808945304 | 105 |
| 213 | iso_pu_bacteria | 2808606381 | 2808950817 | 105 |
| 214 | iso_pu_bacteria | 2808606383 | 2808962437 | 105 |
| 215 | iso_pu_bacteria | 2808606389 | 2808997522 | 105 |
| 216 | iso_pu_bacteria | 2818991456 | 2819658438 | 105 |
| 217 | iso_pu_bacteria | 2825651385 | 2825653660 | 105 |
| 218 | iso_pu_bacteria | 2842832357 | 2842835645 | 105 |
| 219 | iso_pu_bacteria | 2842843487 | 2842847387 | 105 |
| 220 | iso_pu_bacteria | 2842854478 | 2842857216 | 105 |
| 221 | iso_pu_bacteria | 2852657418 | 2852662749 | 105 |
| 222 | iso_pu_bacteria | 2878029506 | 2878030848 | 105 |
| 223 | iso_pu_bacteria | 2880230671 | 2880231763 | 105 |
| 224 | iso_pu_bacteria | 2904518522 | 2904520798 | 105 |
| 225 | iso_pu_bacteria | 2913036834 | 2913037956 | 105 |
| 226 | iso_pu_bacteria | 2919063839 | 2919064641 | 105 |
| 227 | iso_pu_bacteria | 2919385768 | 2919385893 | 105 |
| 228 | iso_pu_bacteria | 2919456309 | 2919458226 | 105 |
| 229 | iso_pu_bacteria | 2919481497 | 2919482865 | 105 |
| 230 | iso_pu_bacteria | 2919487758 | 2919490679 | 105 |
| 231 | iso_pu_bacteria | 2919697872 | 2919703680 | 105 |
| 232 | iso_pu_bacteria | 2923586266 | 2923590919 | 105 |
| 233 | iso_pu_bacteria | 2929144301 | 2929145411 | 105 |
| 234 | iso_pu_bacteria | 2931369376 | 2931371251 | 105 |
| 235 | iso_pu_bacteria | 2931396565 | 2931399519 | 105 |
| 236 | iso_pu_bacteria | 2939636861 | 2939637975 | 105 |
| 237 | iso_pu_bacteria | 2969304461 | 2969305670 | 105 |
| 238 | iso_pu_bacteria | 2974289157 | 2974292703 | 105 |
| 239 | iso_pu_bacteria | 2988728565 | 2988732951 | 105 |
| 240 | iso_pu_bacteria | 2998139840 | 2998141109 | 105 |
| 241 | iso_pu_bacteria | 3007614139 | 3007614190 | 105 |
| 242 | iso_pu_bacteria | 3007619802 | 3007622469 | 105 |
| 243 | iso_pu_bacteria | 3007861166 | 3007863669 | 105 |
| 244 | iso_pu_bacteria | 3007866637 | 3007871305 | 105 |
| 245 | iso_pu_bacteria | 8019775933 | 8019781830 | 105 |
| 246 | iso_pu_bacteria | 8029995093 | 8029999653 | 105 |
| 247 | iso_pu_bacteria | 8055878733 | 8055883906 | 105 |
| 248 | iso_pu_bacteria | 8056143049 | 8056147873 | 105 |
| 249 | iso_pu_bacteria | 8056155041 | 8056159658 | 105 |
| 250 | iso_pu_bacteria | 8056166840 | 8056169944 | 105 |
| 251 | iso_pu_bacteria | 8056172158 | 8056176070 | 105 |
| 252 | iso_pu_bacteria | 8056177738 | 8056180475 | 105 |
| 253 | iso_pu_bacteria | 8056569372 | 8056569760 | 105 |
| 254 | 3300005290 | Ga0065712_10068159 | Ga0065712_100681595 | 106 |
| 255 | 3300009036 | Ga0105244_10000272 | Ga0105244_1000027232 | 106 |
| 256 | 3300009148 | Ga0105243_10045025 | Ga0105243_100450252 | 106 |
| 257 | 3300025728 | Ga0207655_1006185 | Ga0207655_10061855 | 106 |
| 258 | 3300048927 | Ga0496124_0053505 | Ga0496124_0053505_1784_2104 | 106 |
| 259 | 3300005288 | Ga0065714_10001142 | Ga0065714_100011421 | 107 |
| 260 | 3300031548 | Ga0307408_100000090 | Ga0307408_10000009086 | 107 |
| 261 | 3300032004 | Ga0307414_10024653 | Ga0307414_100246535 | 107 |
| 262 | 3300041404 | Ga0439436_0001968 | Ga0439436_0001968_1903_2226 | 107 |
| 263 | 3300041405 | Ga0439438_001751 | Ga0439438_001751_4947_5270 | 107 |
| 264 | 3300041407 | Ga0439447_001710 | Ga0439447_001710_4121_4444 | 107 |
| 265 | 3300041411 | Ga0439466_0001747 | Ga0439466_0001747_4192_4515 | 107 |
| 266 | 3300041411 | Ga0439466_0004531 | Ga0439466_0004531_247_570 | 107 |
| 267 | 3300041997 | Ga0439431_0071673 | Ga0439431_0071673_85_408 | 107 |
| 268 | 3300042006 | Ga0439432_002819 | Ga0439432_002819_2322_2645 | 107 |
| 269 | 3300042010 | Ga0439452_005021 | Ga0439452_005021_3695_4018 | 107 |
| 270 | 3300042121 | Ga0450919_024943 | Ga0450919_024943_178_501 | 107 |
| 271 | 3300042156 | Ga0439446_0012156 | Ga0439446_0012156_423_746 | 107 |
| 272 | 3300042435 | Ga0439434_0017329 | Ga0439434_0017329_598_921 | 107 |
| 273 | 3300042439 | Ga0439464_0012530 | Ga0439464_0012530_45_368 | 107 |
| 274 | 3300042439 | Ga0439464_0012958 | Ga0439464_0012958_1838_2161 | 107 |
| 275 | 3300049571 | Ga0501034_0314956 | Ga0501034_0314956_1040_1363 | 107 |
| 276 | iso_pu_bacteria | 640427133 | 640488693 | 107 |
| 277 | 3300001915 | JGI24741J21665_1015229 | JGI24741J21665_10152293 | 108 |
| 278 | 3300002705 | JGI25156J39149_1022724 | JGI25156J39149_10227242 | 108 |
| 279 | 3300002737 | JGI25162J39368_1000103 | JGI25162J39368_100010359 | 108 |
| 280 | 3300002738 | JGI25154J39366_1003627 | JGI25154J39366_10036274 | 108 |
| 281 | 3300002771 | JGI25163J39215_1000809 | JGI25163J39215_10008094 | 108 |
| 282 | 3300002772 | JGI25164J39214_1000082 | JGI25164J39214_100008217 | 108 |
| 283 | 3300003214 | JGI25165J46597_1000185 | JGI25165J46597_100018517 | 108 |
| 284 | 3300003751 | Ga0055538_1000073 | Ga0055538_100007388 | 108 |
| 285 | 3300003752 | Ga0055539_1000109 | Ga0055539_100010988 | 108 |
| 286 | 3300003756 | Ga0055533_1000117 | Ga0055533_100011788 | 108 |
| 287 | 3300003758 | Ga0055532_1000120 | Ga0055532_100012035 | 108 |
| 288 | 3300003759 | Ga0055525_1000156 | Ga0055525_100015688 | 108 |
| 289 | 3300003761 | Ga0055535_1005421 | Ga0055535_10054214 | 108 |
| 290 | 3300003781 | Ga0055536_1000331 | Ga0055536_100033127 | 108 |
| 291 | 3300003791 | Ga0055530_10000351 | Ga0055530_1000035118 | 108 |
| 292 | 3300003791 | Ga0055530_10000511 | Ga0055530_1000051128 | 108 |
| 293 | 3300003792 | Ga0055540_1005860 | Ga0055540_10058602 | 108 |
| 294 | 3300003841 | Ga0055541_1000074 | Ga0055541_100007488 | 108 |
| 295 | 3300005288 | Ga0065714_10003823 | Ga0065714_100038238 | 108 |
| 296 | 3300005288 | Ga0065714_10068084 | Ga0065714_100680842 | 108 |
| 297 | 3300005288 | Ga0065714_10290460 | Ga0065714_102904602 | 108 |
| 298 | 3300005289 | Ga0065704_10081940 | Ga0065704_100819402 | 108 |
| 299 | 3300005289 | Ga0065704_10100411 | Ga0065704_101004114 | 108 |
| 300 | 3300005289 | Ga0065704_10122646 | Ga0065704_101226464 | 108 |
| 301 | 3300005290 | Ga0065712_10071669 | Ga0065712_100716692 | 108 |
| 302 | 3300005331 | Ga0070670_100000780 | Ga0070670_1000007803 | 108 |
| 303 | 3300005331 | Ga0070670_100011171 | Ga0070670_1000111717 | 108 |
| 304 | 3300005353 | Ga0070669_100004365 | Ga0070669_1000043657 | 108 |
| 305 | 3300005353 | Ga0070669_100465722 | Ga0070669_1004657222 | 108 |
| 306 | 3300005356 | Ga0070674_101547987 | Ga0070674_1015479871 | 108 |
| 307 | 3300005457 | Ga0070662_100000301 | Ga0070662_10000030121 | 108 |
| 308 | 3300005539 | Ga0068853_100006538 | Ga0068853_1000065389 | 108 |
| 309 | 3300005564 | Ga0070664_100221778 | Ga0070664_1002217783 | 108 |
| 310 | 3300005578 | Ga0068854_100003695 | Ga0068854_1000036954 | 108 |
| 311 | 3300005834 | Ga0068851_10000037 | Ga0068851_1000003769 | 108 |
| 312 | 3300006058 | Ga0075432_10024162 | Ga0075432_100241623 | 108 |
| 313 | 3300006177 | Ga0075362_10276515 | Ga0075362_102765152 | 108 |
| 314 | 3300006914 | Ga0075436_100187212 | Ga0075436_1001872122 | 108 |
| 315 | 3300009011 | Ga0105251_10001136 | Ga0105251_1000113616 | 108 |
| 316 | 3300009011 | Ga0105251_10003445 | Ga0105251_1000344511 | 108 |
| 317 | 3300009011 | Ga0105251_10004028 | Ga0105251_1000402810 | 108 |
| 318 | 3300009011 | Ga0105251_10009942 | Ga0105251_100099423 | 108 |
| 319 | 3300009011 | Ga0105251_10010616 | Ga0105251_100106163 | 108 |
| 320 | 3300009011 | Ga0105251_10029477 | Ga0105251_100294771 | 108 |
| 321 | 3300009011 | Ga0105251_10033357 | Ga0105251_100333572 | 108 |
| 322 | 3300009011 | Ga0105251_10087819 | Ga0105251_100878192 | 108 |
| 323 | 3300009011 | Ga0105251_10139833 | Ga0105251_101398332 | 108 |
| 324 | 3300009036 | Ga0105244_10011554 | Ga0105244_100115543 | 108 |
| 325 | 3300009036 | Ga0105244_10094795 | Ga0105244_100947953 | 108 |
| 326 | 3300009036 | Ga0105244_10117921 | Ga0105244_101179212 | 108 |
| 327 | 3300009036 | Ga0105244_10282450 | Ga0105244_102824502 | 108 |
| 328 | 3300009092 | Ga0105250_10000332 | Ga0105250_100003327 | 108 |
| 329 | 3300009092 | Ga0105250_10023392 | Ga0105250_100233924 | 108 |
| 330 | 3300009092 | Ga0105250_10096498 | Ga0105250_100964982 | 108 |
| 331 | 3300009092 | Ga0105250_10226003 | Ga0105250_102260031 | 108 |
| 332 | 3300009148 | Ga0105243_10051884 | Ga0105243_100518843 | 108 |
| 333 | 3300009148 | Ga0105243_10096623 | Ga0105243_100966234 | 108 |
| 334 | 3300009148 | Ga0105243_10195715 | Ga0105243_101957152 | 108 |
| 335 | 3300009177 | Ga0105248_10134319 | Ga0105248_101343194 | 108 |
| 336 | 3300009545 | Ga0105237_10137591 | Ga0105237_101375912 | 108 |
| 337 | 3300011119 | Ga0105246_10002077 | Ga0105246_100020776 | 108 |
| 338 | 3300011119 | Ga0105246_10005375 | Ga0105246_100053757 | 108 |
| 339 | 3300013100 | Ga0157373_10021840 | Ga0157373_100218401 | 108 |
| 340 | 3300013100 | Ga0157373_10033665 | Ga0157373_100336653 | 108 |
| 341 | 3300013100 | Ga0157373_10169447 | Ga0157373_101694472 | 108 |
| 342 | 3300013100 | Ga0157373_10180475 | Ga0157373_101804752 | 108 |
| 343 | 3300013102 | Ga0157371_10057216 | Ga0157371_100572162 | 108 |
| 344 | 3300013102 | Ga0157371_10065540 | Ga0157371_100655402 | 108 |
| 345 | 3300013102 | Ga0157371_10352185 | Ga0157371_103521852 | 108 |
| 346 | 3300013104 | Ga0157370_10000846 | Ga0157370_1000084614 | 108 |
| 347 | 3300013104 | Ga0157370_10090355 | Ga0157370_100903555 | 108 |
| 348 | 3300013104 | Ga0157370_10102773 | Ga0157370_101027735 | 108 |
| 349 | 3300013104 | Ga0157370_10330107 | Ga0157370_103301072 | 108 |
| 350 | 3300013104 | Ga0157370_11728320 | Ga0157370_117283201 | 108 |
| 351 | 3300013105 | Ga0157369_10017783 | Ga0157369_100177836 | 108 |
| 352 | 3300013105 | Ga0157369_10079337 | Ga0157369_100793373 | 108 |
| 353 | 3300013306 | Ga0163162_10062388 | Ga0163162_100623882 | 108 |
| 354 | 3300013306 | Ga0163162_10097608 | Ga0163162_100976083 | 108 |
| 355 | 3300013306 | Ga0163162_10957033 | Ga0163162_109570332 | 108 |
| 356 | 3300013307 | Ga0157372_10004137 | Ga0157372_100041376 | 108 |
| 357 | 3300014497 | Ga0182008_10021905 | Ga0182008_100219055 | 108 |
| 358 | 3300014497 | Ga0182008_10055715 | Ga0182008_100557152 | 108 |
| 359 | 3300015261 | Ga0182006_1000640 | Ga0182006_100064023 | 108 |
| 360 | 3300015265 | Ga0182005_1030291 | Ga0182005_10302912 | 108 |
| 361 | 3300017792 | Ga0163161_10013993 | Ga0163161_100139934 | 108 |
| 362 | 3300017792 | Ga0163161_10021713 | Ga0163161_100217135 | 108 |
| 363 | 3300017792 | Ga0163161_10036807 | Ga0163161_100368073 | 108 |
| 364 | 3300017792 | Ga0163161_10053950 | Ga0163161_100539504 | 108 |
| 365 | 3300017792 | Ga0163161_10352640 | Ga0163161_103526402 | 108 |
| 366 | 3300025206 | Ga0209435_100487 | Ga0209435_1004874 | 108 |
| 367 | 3300025207 | Ga0209760_100194 | Ga0209760_10019417 | 108 |
| 368 | 3300025224 | Ga0209784_100015 | Ga0209784_100015120 | 108 |
| 369 | 3300025225 | Ga0209566_100012 | Ga0209566_100012120 | 108 |
| 370 | 3300025226 | Ga0209674_100027 | Ga0209674_100027120 | 108 |
| 371 | 3300025229 | Ga0209147_100019 | Ga0209147_100019120 | 108 |
| 372 | 3300025230 | Ga0209563_100031 | Ga0209563_100031120 | 108 |
| 373 | 3300025231 | Ga0207427_100038 | Ga0207427_10003817 | 108 |
| 374 | 3300025233 | Ga0209437_100009 | Ga0209437_100009644 | 108 |
| 375 | 3300025233 | Ga0209437_106571 | Ga0209437_1065712 | 108 |
| 376 | 3300025242 | Ga0209258_100296 | Ga0209258_1002964 | 108 |
| 377 | 3300025246 | Ga0209646_1000292 | Ga0209646_100029213 | 108 |
| 378 | 3300025253 | Ga0209677_100016 | Ga0209677_100016120 | 108 |
| 379 | 3300025256 | Ga0209759_1004305 | Ga0209759_10043057 | 108 |
| 380 | 3300025256 | Ga0209759_1005302 | Ga0209759_10053022 | 108 |
| 381 | 3300025261 | Ga0209233_1000074 | Ga0209233_100007417 | 108 |
| 382 | 3300025292 | Ga0209676_1000056 | Ga0209676_100005634 | 108 |
| 383 | 3300025292 | Ga0209676_1000503 | Ga0209676_100050324 | 108 |
| 384 | 3300025298 | Ga0209050_1000361 | Ga0209050_100036134 | 108 |
| 385 | 3300025303 | Ga0209051_1000061 | Ga0209051_100006134 | 108 |
| 386 | 3300025321 | Ga0207656_10000014 | Ga0207656_1000001438 | 108 |
| 387 | 3300025711 | Ga0207696_1000293 | Ga0207696_100029318 | 108 |
| 388 | 3300025711 | Ga0207696_1002498 | Ga0207696_10024987 | 108 |
| 389 | 3300025711 | Ga0207696_1038649 | Ga0207696_10386492 | 108 |
| 390 | 3300025711 | Ga0207696_1049493 | Ga0207696_10494931 | 108 |
| 391 | 3300025711 | Ga0207696_1134603 | Ga0207696_11346032 | 108 |
| 392 | 3300025728 | Ga0207655_1000005 | Ga0207655_1000005316 | 108 |
| 393 | 3300025728 | Ga0207655_1000015 | Ga0207655_1000015405 | 108 |
| 394 | 3300025728 | Ga0207655_1002284 | Ga0207655_10022847 | 108 |
| 395 | 3300025728 | Ga0207655_1003175 | Ga0207655_10031759 | 108 |
| 396 | 3300025728 | Ga0207655_1108755 | Ga0207655_11087552 | 108 |
| 397 | 3300025728 | Ga0207655_1144367 | Ga0207655_11443672 | 108 |
| 398 | 3300025735 | Ga0207713_1000493 | Ga0207713_10004937 | 108 |
| 399 | 3300025735 | Ga0207713_1000696 | Ga0207713_10006965 | 108 |
| 400 | 3300025735 | Ga0207713_1007669 | Ga0207713_10076693 | 108 |
| 401 | 3300025735 | Ga0207713_1007824 | Ga0207713_10078243 | 108 |
| 402 | 3300025735 | Ga0207713_1022834 | Ga0207713_10228343 | 108 |
| 403 | 3300025735 | Ga0207713_1030419 | Ga0207713_10304193 | 108 |
| 404 | 3300025735 | Ga0207713_1037519 | Ga0207713_10375191 | 108 |
| 405 | 3300025735 | Ga0207713_1121328 | Ga0207713_11213282 | 108 |
| 406 | 3300025735 | Ga0207713_1127585 | Ga0207713_11275852 | 108 |
| 407 | 3300025914 | Ga0207671_10000019 | Ga0207671_10000019240 | 108 |
| 408 | 3300025914 | Ga0207671_10108147 | Ga0207671_101081473 | 108 |
| 409 | 3300025920 | Ga0207649_10000002 | Ga0207649_10000002427 | 108 |
| 410 | 3300025923 | Ga0207681_10002090 | Ga0207681_100020907 | 108 |
| 411 | 3300025925 | Ga0207650_10000337 | Ga0207650_1000033714 | 108 |
| 412 | 3300025925 | Ga0207650_10000421 | Ga0207650_100004218 | 108 |
| 413 | 3300025933 | Ga0207706_10000136 | Ga0207706_1000013634 | 108 |
| 414 | 3300025934 | Ga0207686_10005889 | Ga0207686_100058896 | 108 |
| 415 | 3300025935 | Ga0207709_10116462 | Ga0207709_101164623 | 108 |
| 416 | 3300025935 | Ga0207709_10212157 | Ga0207709_102121572 | 108 |
| 417 | 3300025935 | Ga0207709_10426065 | Ga0207709_104260651 | 108 |
| 418 | 3300025945 | Ga0207679_10000006 | Ga0207679_1000000664 | 108 |
| 419 | 3300025945 | Ga0207679_10251297 | Ga0207679_102512972 | 108 |
| 420 | 3300025981 | Ga0207640_10342229 | Ga0207640_103422292 | 108 |
| 421 | 3300026041 | Ga0207639_10004918 | Ga0207639_100049189 | 108 |
| 422 | 3300027312 | Ga0209371_1000414 | Ga0209371_10004149 | 108 |
| 423 | 3300027312 | Ga0209371_1034274 | Ga0209371_10342742 | 108 |
| 424 | 3300027876 | Ga0209974_10147495 | Ga0209974_101474952 | 108 |
| 425 | 3300027907 | Ga0207428_10115665 | Ga0207428_101156652 | 108 |
| 426 | 3300030500 | Ga0268256_1000355 | Ga0268256_10003559 | 108 |
| 427 | 3300030500 | Ga0268256_1038965 | Ga0268256_10389652 | 108 |
| 428 | 3300030521 | Ga0307511_10165516 | Ga0307511_101655161 | 108 |
| 429 | 3300031731 | Ga0307405_10000600 | Ga0307405_100006005 | 108 |
| 430 | 3300041407 | Ga0439447_007855 | Ga0439447_007855_1843_2169 | 108 |
| 431 | 3300041411 | Ga0439466_0000163 | Ga0439466_0000163_4043_4369 | 108 |
| 432 | 3300041411 | Ga0439466_0005958 | Ga0439466_0005958_1623_1949 | 108 |
| 433 | 3300041509 | Ga0451843_1387418 | Ga0451843_1387418_12_338 | 108 |
| 434 | 3300042006 | Ga0439432_000131 | Ga0439432_000131_3980_4306 | 108 |
| 435 | 3300042006 | Ga0439432_090129 | Ga0439432_090129_184_510 | 108 |
| 436 | 3300042013 | Ga0439456_000074 | Ga0439456_000074_1615_1941 | 108 |
| 437 | 3300042016 | Ga0439463_000931 | Ga0439463_000931_3972_4298 | 108 |
| 438 | 3300042134 | Ga0450898_008349 | Ga0450898_008349_1283_1609 | 108 |
| 439 | 3300042135 | Ga0450899_013446 | Ga0450899_013446_341_667 | 108 |
| 440 | 3300042136 | Ga0450900_015198 | Ga0450900_015198_615_941 | 108 |
| 441 | 3300042137 | Ga0450902_000613 | Ga0450902_000613_122_448 | 108 |
| 442 | 3300042142 | Ga0450905_015180 | Ga0450905_015180_694_1020 | 108 |
| 443 | 3300042142 | Ga0450905_088041 | Ga0450905_088041_95_421 | 108 |
| 444 | 3300042533 | Ga0450901_007035 | Ga0450901_007035_664_990 | 108 |
| 445 | 3300042993 | Ga0439440_0002537 | Ga0439440_0002537_1836_2162 | 108 |
| 446 | 3300046453 | Ga0495627_001977 | Ga0495627_001977_5509_5835 | 108 |
| 447 | 3300046455 | Ga0495603_0079892 | Ga0495603_0079892_1156_1485 | 108 |
| 448 | 3300046458 | Ga0495591_002596 | Ga0495591_002596_4097_4423 | 108 |
| 449 | 3300046458 | Ga0495591_008429 | Ga0495591_008429_539_868 | 108 |
| 450 | 3300046471 | Ga0495650_0058133 | Ga0495650_0058133_674_1003 | 108 |
| 451 | 3300046474 | Ga0495605_0000362 | Ga0495605_0000362_4170_4499 | 108 |
| 452 | 3300046499 | Ga0495594_0000506 | Ga0495594_0000506_17035_17364 | 108 |
| 453 | 3300046501 | Ga0495607_0015729 | Ga0495607_0015729_242_568 | 108 |
| 454 | 3300046501 | Ga0495607_0097136 | Ga0495607_0097136_289_615 | 108 |
| 455 | 3300046501 | Ga0495607_0236195 | Ga0495607_0236195_13_339 | 108 |
| 456 | 3300046501 | Ga0495607_0534086 | Ga0495607_0534086_29_355 | 108 |
| 457 | 3300046506 | Ga0495583_0000701 | Ga0495583_0000701_4162_4491 | 108 |
| 458 | 3300046506 | Ga0495583_0001463 | Ga0495583_0001463_19342_19668 | 108 |
| 459 | 3300046507 | Ga0495606_0000518 | Ga0495606_0000518_21609_21935 | 108 |
| 460 | 3300046507 | Ga0495606_0016021 | Ga0495606_0016021_1339_1665 | 108 |
| 461 | 3300046512 | Ga0495610_0013001 | Ga0495610_0013001_4144_4473 | 108 |
| 462 | 3300046512 | Ga0495610_0026056 | Ga0495610_0026056_1755_2081 | 108 |
| 463 | 3300046512 | Ga0495610_0050035 | Ga0495610_0050035_682_1008 | 108 |
| 464 | 3300046512 | Ga0495610_0054490 | Ga0495610_0054490_1018_1344 | 108 |
| 465 | 3300046513 | Ga0495616_0250496 | Ga0495616_0250496_341_670 | 108 |
| 466 | 3300046515 | Ga0495620_0000003 | Ga0495620_0000003_117764_118090 | 108 |
| 467 | 3300046515 | Ga0495620_0000219 | Ga0495620_0000219_38666_38995 | 108 |
| 468 | 3300046515 | Ga0495620_0021320 | Ga0495620_0021320_1348_1674 | 108 |
| 469 | 3300046515 | Ga0495620_0082315 | Ga0495620_0082315_111_437 | 108 |
| 470 | 3300046518 | Ga0495631_0088232 | Ga0495631_0088232_841_1167 | 108 |
| 471 | 3300046519 | Ga0495632_0000368 | Ga0495632_0000368_4695_5021 | 108 |
| 472 | 3300046519 | Ga0495632_0006908 | Ga0495632_0006908_2246_2572 | 108 |
| 473 | 3300046520 | Ga0495637_0021522 | Ga0495637_0021522_1010_1339 | 108 |
| 474 | 3300046522 | Ga0495643_0000116 | Ga0495643_0000116_38463_38789 | 108 |
| 475 | 3300046522 | Ga0495643_0000890 | Ga0495643_0000890_2289_2615 | 108 |
| 476 | 3300046522 | Ga0495643_0001490 | Ga0495643_0001490_18789_19115 | 108 |
| 477 | 3300046522 | Ga0495643_0008981 | Ga0495643_0008981_1330_1656 | 108 |
| 478 | 3300046522 | Ga0495643_0044794 | Ga0495643_0044794_702_1028 | 108 |
| 479 | 3300046524 | Ga0495648_0001580 | Ga0495648_0001580_17181_17507 | 108 |
| 480 | 3300046524 | Ga0495648_0021013 | Ga0495648_0021013_929_1258 | 108 |
| 481 | 3300046524 | Ga0495648_0067596 | Ga0495648_0067596_999_1325 | 108 |
| 482 | 3300046530 | Ga0495654_0000816 | Ga0495654_0000816_4120_4446 | 108 |
| 483 | 3300046530 | Ga0495654_0013142 | Ga0495654_0013142_1512_1841 | 108 |
| 484 | 3300046530 | Ga0495654_0027634 | Ga0495654_0027634_1601_1927 | 108 |
| 485 | 3300046530 | Ga0495654_0381647 | Ga0495654_0381647_209_535 | 108 |
| 486 | 3300046538 | Ga0495609_0000317 | Ga0495609_0000317_38663_38992 | 108 |
| 487 | 3300046542 | Ga0495597_0002162 | Ga0495597_0002162_11061_11390 | 108 |
| 488 | 3300046558 | Ga0495633_0000476 | Ga0495633_0000476_38780_39109 | 108 |
| 489 | 3300046648 | Ga0495611_0002772 | Ga0495611_0002772_4168_4497 | 108 |
| 490 | 3300046660 | Ga0495625_0078211 | Ga0495625_0078211_21_347 | 108 |
| 491 | 3300046665 | Ga0495661_0000232 | Ga0495661_0000232_4182_4511 | 108 |
| 492 | 3300046665 | Ga0495661_0002086 | Ga0495661_0002086_10477_10803 | 108 |
| 493 | 3300046665 | Ga0495661_0034184 | Ga0495661_0034184_1620_1946 | 108 |
| 494 | 3300046691 | Ga0495670_0004837 | Ga0495670_0004837_5158_5487 | 108 |
| 495 | 3300046692 | Ga0495671_0007107 | Ga0495671_0007107_2055_2381 | 108 |
| 496 | 3300046692 | Ga0495671_0019402 | Ga0495671_0019402_1891_2220 | 108 |
| 497 | 3300046694 | Ga0495649_0004030 | Ga0495649_0004030_2988_3314 | 108 |
| 498 | 3300046694 | Ga0495649_0112315 | Ga0495649_0112315_101_427 | 108 |
| 499 | 3300046694 | Ga0495649_0153383 | Ga0495649_0153383_497_823 | 108 |
| 500 | 3300046794 | Ga0495589_0003025 | Ga0495589_0003025_1644_1970 | 108 |
| 501 | 3300046794 | Ga0495589_0008204 | Ga0495589_0008204_4150_4479 | 108 |
| 502 | 3300046810 | Ga0495660_0010105 | Ga0495660_0010105_1454_1783 | 108 |
| 503 | 3300046810 | Ga0495660_0202485 | Ga0495660_0202485_250_576 | 108 |
| 504 | 3300047320 | Ga0495672_0084182 | Ga0495672_0084182_204_530 | 108 |
| 505 | 3300047323 | Ga0495683_0000289 | Ga0495683_0000289_38791_39120 | 108 |
| 506 | 3300047446 | Ga0495679_006361 | Ga0495679_006361_3397_3726 | 108 |
| 507 | 3300047446 | Ga0495679_006417 | Ga0495679_006417_1142_1468 | 108 |
| 508 | 3300047446 | Ga0495679_017586 | Ga0495679_017586_803_1129 | 108 |
| 509 | 3300047469 | Ga0495673_0005327 | Ga0495673_0005327_4181_4507 | 108 |
| 510 | 3300047469 | Ga0495673_0013122 | Ga0495673_0013122_2429_2758 | 108 |
| 511 | 3300047470 | Ga0495681_0048475 | Ga0495681_0048475_1517_1846 | 108 |
| 512 | 3300047470 | Ga0495681_0058080 | Ga0495681_0058080_283_609 | 108 |
| 513 | 3300047470 | Ga0495681_0083985 | Ga0495681_0083985_146_472 | 108 |
| 514 | 3300047472 | Ga0495686_0307783 | Ga0495686_0307783_127_453 | 108 |
| 515 | 3300047472 | Ga0495686_0442794 | Ga0495686_0442794_333_659 | 108 |
| 516 | 3300048913 | Ga0496110_0314329 | Ga0496110_0314329_1018_1344 | 108 |
| 517 | 3300048917 | Ga0496114_0137484 | Ga0496114_0137484_1644_1970 | 108 |
| 518 | 3300048917 | Ga0496114_0321493 | Ga0496114_0321493_183_509 | 108 |
| 519 | 3300048919 | Ga0496116_0029406 | Ga0496116_0029406_1469_1795 | 108 |
| 520 | 3300048920 | Ga0496117_0001478 | Ga0496117_0001478_4589_4915 | 108 |
| 521 | 3300048920 | Ga0496117_0007829 | Ga0496117_0007829_5908_6234 | 108 |
| 522 | 3300048920 | Ga0496117_0008263 | Ga0496117_0008263_3729_4055 | 108 |
| 523 | 3300048920 | Ga0496117_0041468 | Ga0496117_0041468_2122_2448 | 108 |
| 524 | 3300048920 | Ga0496117_0059427 | Ga0496117_0059427_1640_1966 | 108 |
| 525 | 3300048920 | Ga0496117_0104654 | Ga0496117_0104654_1237_1563 | 108 |
| 526 | 3300048920 | Ga0496117_0289699 | Ga0496117_0289699_10_336 | 108 |
| 527 | 3300048920 | Ga0496117_0621726 | Ga0496117_0621726_55_384 | 108 |
| 528 | 3300048921 | Ga0496118_0004423 | Ga0496118_0004423_11641_11967 | 108 |
| 529 | 3300048921 | Ga0496118_0076077 | Ga0496118_0076077_1025_1351 | 108 |
| 530 | 3300048921 | Ga0496118_0084480 | Ga0496118_0084480_1214_1540 | 108 |
| 531 | 3300048921 | Ga0496118_0088067 | Ga0496118_0088067_220_546 | 108 |
| 532 | 3300048922 | Ga0496119_0000207 | Ga0496119_0000207_43990_44316 | 108 |
| 533 | 3300048922 | Ga0496119_0037107 | Ga0496119_0037107_939_1265 | 108 |
| 534 | 3300048922 | Ga0496119_0125463 | Ga0496119_0125463_738_1064 | 108 |
| 535 | 3300048922 | Ga0496119_0142247 | Ga0496119_0142247_583_909 | 108 |
| 536 | 3300048922 | Ga0496119_0270849 | Ga0496119_0270849_66_392 | 108 |
| 537 | 3300048923 | Ga0496120_0009849 | Ga0496120_0009849_5496_5822 | 108 |
| 538 | 3300048923 | Ga0496120_0015054 | Ga0496120_0015054_88_414 | 108 |
| 539 | 3300048923 | Ga0496120_0076271 | Ga0496120_0076271_1344_1670 | 108 |
| 540 | 3300048923 | Ga0496120_0109051 | Ga0496120_0109051_966_1292 | 108 |
| 541 | 3300048923 | Ga0496120_0163695 | Ga0496120_0163695_27_353 | 108 |
| 542 | 3300048924 | Ga0496121_0066698 | Ga0496121_0066698_1121_1447 | 108 |
| 543 | 3300048924 | Ga0496121_0094464 | Ga0496121_0094464_876_1202 | 108 |
| 544 | 3300048924 | Ga0496121_0116495 | Ga0496121_0116495_1513_1839 | 108 |
| 545 | 3300048924 | Ga0496121_0300810 | Ga0496121_0300810_653_979 | 108 |
| 546 | 3300048925 | Ga0496122_0002127 | Ga0496122_0002127_5070_5396 | 108 |
| 547 | 3300048925 | Ga0496122_0018595 | Ga0496122_0018595_5216_5545 | 108 |
| 548 | 3300048925 | Ga0496122_0063303 | Ga0496122_0063303_1180_1506 | 108 |
| 549 | 3300048925 | Ga0496122_0087950 | Ga0496122_0087950_1663_1989 | 108 |
| 550 | 3300048925 | Ga0496122_0094718 | Ga0496122_0094718_696_1022 | 108 |
| 551 | 3300048925 | Ga0496122_0115168 | Ga0496122_0115168_886_1212 | 108 |
| 552 | 3300048925 | Ga0496122_0172038 | Ga0496122_0172038_639_965 | 108 |
| 553 | 3300048926 | Ga0496123_0000387 | Ga0496123_0000387_34186_34512 | 108 |
| 554 | 3300048926 | Ga0496123_0027794 | Ga0496123_0027794_984_1313 | 108 |
| 555 | 3300048926 | Ga0496123_0048509 | Ga0496123_0048509_1657_1983 | 108 |
| 556 | 3300048926 | Ga0496123_0069293 | Ga0496123_0069293_1739_2065 | 108 |
| 557 | 3300048926 | Ga0496123_0086236 | Ga0496123_0086236_1405_1731 | 108 |
| 558 | 3300048927 | Ga0496124_0009462 | Ga0496124_0009462_4043_4369 | 108 |
| 559 | 3300048927 | Ga0496124_0017418 | Ga0496124_0017418_5295_5624 | 108 |
| 560 | 3300048927 | Ga0496124_0019452 | Ga0496124_0019452_2769_3095 | 108 |
| 561 | 3300048927 | Ga0496124_0024971 | Ga0496124_0024971_1629_1955 | 108 |
| 562 | 3300048927 | Ga0496124_0027845 | Ga0496124_0027845_4538_4864 | 108 |
| 563 | 3300048927 | Ga0496124_0177850 | Ga0496124_0177850_152_478 | 108 |
| 564 | 3300048927 | Ga0496124_0209443 | Ga0496124_0209443_813_1139 | 108 |
| 565 | 3300048927 | Ga0496124_0358988 | Ga0496124_0358988_150_476 | 108 |
| 566 | 3300048928 | Ga0496125_0009616 | Ga0496125_0009616_5521_5847 | 108 |
| 567 | 3300048928 | Ga0496125_0017334 | Ga0496125_0017334_5587_5913 | 108 |
| 568 | 3300048928 | Ga0496125_0028811 | Ga0496125_0028811_3287_3613 | 108 |
| 569 | 3300048928 | Ga0496125_0035744 | Ga0496125_0035744_947_1273 | 108 |
| 570 | 3300048928 | Ga0496125_0067834 | Ga0496125_0067834_991_1317 | 108 |
| 571 | 3300048928 | Ga0496125_0134073 | Ga0496125_0134073_1149_1475 | 108 |
| 572 | 3300048928 | Ga0496125_0138426 | Ga0496125_0138426_362_688 | 108 |
| 573 | 3300048929 | Ga0496126_0012460 | Ga0496126_0012460_5051_5377 | 108 |
| 574 | 3300048929 | Ga0496126_0074611 | Ga0496126_0074611_1123_1449 | 108 |
| 575 | 3300048929 | Ga0496126_0187901 | Ga0496126_0187901_1066_1392 | 108 |
| 576 | 3300048929 | Ga0496126_0481092 | Ga0496126_0481092_643_969 | 108 |
| 577 | 3300049459 | Ga0495678_000412 | Ga0495678_000412_4163_4492 | 108 |
| 578 | 3300049460 | Ga0495682_0000616 | Ga0495682_0000616_19729_20055 | 108 |
| 579 | 3300049569 | Ga0501032_0702482 | Ga0501032_0702482_271_603 | 108 |
| 580 | 3300049570 | Ga0501033_0384040 | Ga0501033_0384040_355_687 | 108 |
| 581 | 3300049571 | Ga0501034_0000370 | Ga0501034_0000370_37526_37852 | 108 |
| 582 | 3300049822 | Ga0501035_0740385 | Ga0501035_0740385_223_555 | 108 |
| 583 | 3300050514 | nmdc:mga08x19_482303_c2 | nmdc:mga08x19_482303_c2_118_444 | 108 |
| 584 | 3300053161 | Ga0500634_0031621 | Ga0500634_0031621_1230_1556 | 108 |
| 585 | 2124908027 | MRS2a_Contig_74 | MRS2a_00596910 | 109 |
| 586 | 3300003781 | Ga0055536_1000454 | Ga0055536_100045421 | 109 |
| 587 | 3300003781 | Ga0055536_1005665 | Ga0055536_10056652 | 109 |
| 588 | 3300003781 | Ga0055536_1045992 | Ga0055536_10459922 | 109 |
| 589 | 3300003784 | Ga0055534_1046413 | Ga0055534_10464131 | 109 |
| 590 | 3300003791 | Ga0055530_10000176 | Ga0055530_1000017637 | 109 |
| 591 | 3300003791 | Ga0055530_10001302 | Ga0055530_100013025 | 109 |
| 592 | 3300003792 | Ga0055540_1000193 | Ga0055540_100019337 | 109 |
| 593 | 3300003792 | Ga0055540_1000385 | Ga0055540_100038519 | 109 |
| 594 | 3300003794 | Ga0055531_10001143 | Ga0055531_100011435 | 109 |
| 595 | 3300003794 | Ga0055531_10001439 | Ga0055531_1000143916 | 109 |
| 596 | 3300003794 | Ga0055531_10114007 | Ga0055531_101140072 | 109 |
| 597 | 3300005288 | Ga0065714_10011520 | Ga0065714_100115201 | 109 |
| 598 | 3300005288 | Ga0065714_10011532 | Ga0065714_100115322 | 109 |
| 599 | 3300005288 | Ga0065714_10067449 | Ga0065714_100674494 | 109 |
| 600 | 3300005288 | Ga0065714_10071416 | Ga0065714_100714164 | 109 |
| 601 | 3300005288 | Ga0065714_10072965 | Ga0065714_100729654 | 109 |
| 602 | 3300005288 | Ga0065714_10115407 | Ga0065714_101154071 | 109 |
| 603 | 3300005288 | Ga0065714_10342080 | Ga0065714_103420802 | 109 |
| 604 | 3300005289 | Ga0065704_10083727 | Ga0065704_100837274 | 109 |
| 605 | 3300005290 | Ga0065712_10002535 | Ga0065712_100025354 | 109 |
| 606 | 3300005293 | Ga0065715_10143679 | Ga0065715_101436793 | 109 |
| 607 | 3300005457 | Ga0070662_100026557 | Ga0070662_1000265572 | 109 |
| 608 | 3300005548 | Ga0070665_100035692 | Ga0070665_1000356923 | 109 |
| 609 | 3300005548 | Ga0070665_100432236 | Ga0070665_1004322362 | 109 |
| 610 | 3300006051 | Ga0075364_10150505 | Ga0075364_101505052 | 109 |
| 611 | 3300006051 | Ga0075364_10171938 | Ga0075364_101719382 | 109 |
| 612 | 3300006058 | Ga0075432_10002236 | Ga0075432_100022363 | 109 |
| 613 | 3300006058 | Ga0075432_10002301 | Ga0075432_100023015 | 109 |
| 614 | 3300006058 | Ga0075432_10004206 | Ga0075432_100042061 | 109 |
| 615 | 3300006058 | Ga0075432_10006320 | Ga0075432_100063203 | 109 |
| 616 | 3300006058 | Ga0075432_10175545 | Ga0075432_101755452 | 109 |
| 617 | 3300006177 | Ga0075362_10233936 | Ga0075362_102339361 | 109 |
| 618 | 3300006177 | Ga0075362_10581420 | Ga0075362_105814202 | 109 |
| 619 | 3300006186 | Ga0075369_10005197 | Ga0075369_100051973 | 109 |
| 620 | 3300006914 | Ga0075436_100042714 | Ga0075436_1000427143 | 109 |
| 621 | 3300006946 | Ga0079104_1000414 | Ga0079104_100041437 | 109 |
| 622 | 3300006946 | Ga0079104_1119063 | Ga0079104_11190632 | 109 |
| 623 | 3300006948 | Ga0099826_10023577 | Ga0099826_100235773 | 109 |
| 624 | 3300009011 | Ga0105251_10007385 | Ga0105251_100073853 | 109 |
| 625 | 3300009011 | Ga0105251_10098651 | Ga0105251_100986512 | 109 |
| 626 | 3300009011 | Ga0105251_10336684 | Ga0105251_103366842 | 109 |
| 627 | 3300009011 | Ga0105251_10408974 | Ga0105251_104089742 | 109 |
| 628 | 3300009036 | Ga0105244_10008012 | Ga0105244_100080124 | 109 |
| 629 | 3300009036 | Ga0105244_10077072 | Ga0105244_100770722 | 109 |
| 630 | 3300009036 | Ga0105244_10171466 | Ga0105244_101714662 | 109 |
| 631 | 3300009092 | Ga0105250_10005536 | Ga0105250_100055363 | 109 |
| 632 | 3300009092 | Ga0105250_10009461 | Ga0105250_100094615 | 109 |
| 633 | 3300009148 | Ga0105243_10049392 | Ga0105243_100493924 | 109 |
| 634 | 3300009176 | Ga0105242_10184150 | Ga0105242_101841502 | 109 |
| 635 | 3300009553 | Ga0105249_13092582 | Ga0105249_130925822 | 109 |
| 636 | 3300011119 | Ga0105246_10196123 | Ga0105246_101961232 | 109 |
| 637 | 3300011119 | Ga0105246_10628915 | Ga0105246_106289152 | 109 |
| 638 | 3300012498 | Ga0157345_1000166 | Ga0157345_10001669 | 109 |
| 639 | 3300012502 | Ga0157347_1019611 | Ga0157347_10196112 | 109 |
| 640 | 3300013100 | Ga0157373_10001582 | Ga0157373_1000158216 | 109 |
| 641 | 3300013100 | Ga0157373_10006202 | Ga0157373_100062023 | 109 |
| 642 | 3300013100 | Ga0157373_10053157 | Ga0157373_100531572 | 109 |
| 643 | 3300013100 | Ga0157373_10150030 | Ga0157373_101500302 | 109 |
| 644 | 3300013100 | Ga0157373_10879230 | Ga0157373_108792302 | 109 |
| 645 | 3300013102 | Ga0157371_10006271 | Ga0157371_100062716 | 109 |
| 646 | 3300013102 | Ga0157371_10016205 | Ga0157371_100162055 | 109 |
| 647 | 3300013104 | Ga0157370_10056348 | Ga0157370_100563483 | 109 |
| 648 | 3300013104 | Ga0157370_10084574 | Ga0157370_100845742 | 109 |
| 649 | 3300013104 | Ga0157370_10153170 | Ga0157370_101531702 | 109 |
| 650 | 3300013104 | Ga0157370_10807467 | Ga0157370_108074671 | 109 |
| 651 | 3300013104 | Ga0157370_11325773 | Ga0157370_113257731 | 109 |
| 652 | 3300013105 | Ga0157369_10015829 | Ga0157369_100158293 | 109 |
| 653 | 3300013105 | Ga0157369_10246969 | Ga0157369_102469692 | 109 |
| 654 | 3300013105 | Ga0157369_10347004 | Ga0157369_103470043 | 109 |
| 655 | 3300013105 | Ga0157369_10428520 | Ga0157369_104285202 | 109 |
| 656 | 3300013105 | Ga0157369_10828348 | Ga0157369_108283482 | 109 |
| 657 | 3300013105 | Ga0157369_11267519 | Ga0157369_112675192 | 109 |
| 658 | 3300013306 | Ga0163162_10012886 | Ga0163162_100128869 | 109 |
| 659 | 3300013306 | Ga0163162_11096331 | Ga0163162_110963311 | 109 |
| 660 | 3300013307 | Ga0157372_10001549 | Ga0157372_100015496 | 109 |
| 661 | 3300013308 | Ga0157375_11290937 | Ga0157375_112909371 | 109 |
| 662 | 3300013308 | Ga0157375_11951224 | Ga0157375_119512242 | 109 |
| 663 | 3300014497 | Ga0182008_10005701 | Ga0182008_100057015 | 109 |
| 664 | 3300014497 | Ga0182008_10008549 | Ga0182008_100085491 | 109 |
| 665 | 3300014497 | Ga0182008_10018278 | Ga0182008_100182785 | 109 |
| 666 | 3300014497 | Ga0182008_10047996 | Ga0182008_100479962 | 109 |
| 667 | 3300014497 | Ga0182008_10107940 | Ga0182008_101079402 | 109 |
| 668 | 3300014497 | Ga0182008_10483638 | Ga0182008_104836382 | 109 |
| 669 | 3300015261 | Ga0182006_1001009 | Ga0182006_10010093 | 109 |
| 670 | 3300015261 | Ga0182006_1030050 | Ga0182006_10300503 | 109 |
| 671 | 3300015261 | Ga0182006_1041913 | Ga0182006_10419133 | 109 |
| 672 | 3300015261 | Ga0182006_1057651 | Ga0182006_10576512 | 109 |
| 673 | 3300015262 | Ga0182007_10004583 | Ga0182007_100045837 | 109 |
| 674 | 3300015262 | Ga0182007_10019086 | Ga0182007_100190863 | 109 |
| 675 | 3300015265 | Ga0182005_1002382 | Ga0182005_10023823 | 109 |
| 676 | 3300015265 | Ga0182005_1011517 | Ga0182005_10115174 | 109 |
| 677 | 3300015265 | Ga0182005_1107175 | Ga0182005_11071751 | 109 |
| 678 | 3300015265 | Ga0182005_1134649 | Ga0182005_11346491 | 109 |
| 679 | 3300017792 | Ga0163161_10003732 | Ga0163161_100037329 | 109 |
| 680 | 3300017792 | Ga0163161_10210632 | Ga0163161_102106322 | 109 |
| 681 | 3300025292 | Ga0209676_1000524 | Ga0209676_100052416 | 109 |
| 682 | 3300025292 | Ga0209676_1007863 | Ga0209676_10078635 | 109 |
| 683 | 3300025298 | Ga0209050_1000060 | Ga0209050_100006044 | 109 |
| 684 | 3300025303 | Ga0209051_1000037 | Ga0209051_100003745 | 109 |
| 685 | 3300025304 | Ga0209257_1008780 | Ga0209257_10087803 | 109 |
| 686 | 3300025711 | Ga0207696_1002462 | Ga0207696_10024627 | 109 |
| 687 | 3300025711 | Ga0207696_1005740 | Ga0207696_10057404 | 109 |
| 688 | 3300025728 | Ga0207655_1007329 | Ga0207655_10073295 | 109 |
| 689 | 3300025728 | Ga0207655_1084598 | Ga0207655_10845982 | 109 |
| 690 | 3300025735 | Ga0207713_1055157 | Ga0207713_10551572 | 109 |
| 691 | 3300025735 | Ga0207713_1104000 | Ga0207713_11040002 | 109 |
| 692 | 3300025934 | Ga0207686_10114636 | Ga0207686_101146362 | 109 |
| 693 | 3300025935 | Ga0207709_10022130 | Ga0207709_100221303 | 109 |
| 694 | 3300027111 | Ga0209281_1000010 | Ga0209281_1000010194 | 109 |
| 695 | 3300027111 | Ga0209281_1003222 | Ga0209281_10032223 | 109 |
| 696 | 3300027111 | Ga0209281_1008557 | Ga0209281_10085572 | 109 |
| 697 | 3300027666 | Ga0209282_1053449 | Ga0209282_10534493 | 109 |
| 698 | 3300027907 | Ga0207428_10464313 | Ga0207428_104643132 | 109 |
| 699 | 3300027907 | Ga0207428_11008923 | Ga0207428_110089231 | 109 |
| 700 | 3300028379 | Ga0268266_10035410 | Ga0268266_100354103 | 109 |
| 701 | 3300028379 | Ga0268266_10489311 | Ga0268266_104893112 | 109 |
| 702 | 3300028786 | Ga0307517_10330548 | Ga0307517_103305482 | 109 |
| 703 | 3300030521 | Ga0307511_10095374 | Ga0307511_100953743 | 109 |
| 704 | 3300030731 | Ga0316177_1109772 | Ga0316177_11097723 | 109 |
| 705 | 3300030733 | Ga0314311_1132065 | Ga0314311_11320652 | 109 |
| 706 | 3300030734 | Ga0316179_1069901 | Ga0316179_10699012 | 109 |
| 707 | 3300030734 | Ga0316179_1072406 | Ga0316179_10724061 | 109 |
| 708 | 3300030735 | Ga0316178_1083052 | Ga0316178_108305216 | 109 |
| 709 | 3300030742 | Ga0316183_1110648 | Ga0316183_11106482 | 109 |
| 710 | 3300030744 | Ga0316181_1073709 | Ga0316181_10737092 | 109 |
| 711 | 3300030744 | Ga0316181_1229307 | Ga0316181_12293073 | 109 |
| 712 | 3300031548 | Ga0307408_100001820 | Ga0307408_1000018206 | 109 |
| 713 | 3300031548 | Ga0307408_100012631 | Ga0307408_1000126313 | 109 |
| 714 | 3300031548 | Ga0307408_100033101 | Ga0307408_1000331015 | 109 |
| 715 | 3300031548 | Ga0307408_100043394 | Ga0307408_1000433942 | 109 |
| 716 | 3300031548 | Ga0307408_100091057 | Ga0307408_1000910573 | 109 |
| 717 | 3300031548 | Ga0307408_100304403 | Ga0307408_1003044032 | 109 |
| 718 | 3300031730 | Ga0307516_10165237 | Ga0307516_101652372 | 109 |
| 719 | 3300031731 | Ga0307405_10002971 | Ga0307405_100029713 | 109 |
| 720 | 3300031731 | Ga0307405_10816712 | Ga0307405_108167122 | 109 |
| 721 | 3300031824 | Ga0307413_10030392 | Ga0307413_100303923 | 109 |
| 722 | 3300031824 | Ga0307413_10035507 | Ga0307413_100355072 | 109 |
| 723 | 3300031901 | Ga0307406_10404673 | Ga0307406_104046732 | 109 |
| 724 | 3300031901 | Ga0307406_11599635 | Ga0307406_115996351 | 109 |
| 725 | 3300031903 | Ga0307407_10394198 | Ga0307407_103941982 | 109 |
| 726 | 3300031903 | Ga0307407_11584211 | Ga0307407_115842112 | 109 |
| 727 | 3300031911 | Ga0307412_10001424 | Ga0307412_100014244 | 109 |
| 728 | 3300031911 | Ga0307412_10005406 | Ga0307412_100054065 | 109 |
| 729 | 3300031911 | Ga0307412_10005742 | Ga0307412_100057425 | 109 |
| 730 | 3300031911 | Ga0307412_10016716 | Ga0307412_100167163 | 109 |
| 731 | 3300031911 | Ga0307412_10028909 | Ga0307412_100289094 | 109 |
| 732 | 3300031911 | Ga0307412_10334663 | Ga0307412_103346632 | 109 |
| 733 | 3300031911 | Ga0307412_10549823 | Ga0307412_105498231 | 109 |
| 734 | 3300031911 | Ga0307412_12100073 | Ga0307412_121000732 | 109 |
| 735 | 3300031995 | Ga0307409_100044538 | Ga0307409_1000445383 | 109 |
| 736 | 3300032002 | Ga0307416_100204640 | Ga0307416_1002046402 | 109 |
| 737 | 3300032002 | Ga0307416_100478207 | Ga0307416_1004782072 | 109 |
| 738 | 3300032004 | Ga0307414_10108449 | Ga0307414_101084492 | 109 |
| 739 | 3300032004 | Ga0307414_10215889 | Ga0307414_102158892 | 109 |
| 740 | 3300032004 | Ga0307414_10225755 | Ga0307414_102257552 | 109 |
| 741 | 3300032004 | Ga0307414_10399640 | Ga0307414_103996401 | 109 |
| 742 | 3300032004 | Ga0307414_10470843 | Ga0307414_104708432 | 109 |
| 743 | 3300032004 | Ga0307414_11274515 | Ga0307414_112745152 | 109 |
| 744 | 3300032005 | Ga0307411_10028832 | Ga0307411_100288322 | 109 |
| 745 | 3300032005 | Ga0307411_10098638 | Ga0307411_100986383 | 109 |
| 746 | 3300032005 | Ga0307411_11721935 | Ga0307411_117219352 | 109 |
| 747 | 3300033180 | Ga0307510_10001784 | Ga0307510_1000178421 | 109 |
| 748 | 3300041405 | Ga0439438_001691 | Ga0439438_001691_5294_5623 | 109 |
| 749 | 3300041405 | Ga0439438_001896 | Ga0439438_001896_4906_5235 | 109 |
| 750 | 3300041405 | Ga0439438_005214 | Ga0439438_005214_258_587 | 109 |
| 751 | 3300041405 | Ga0439438_006476 | Ga0439438_006476_2202_2531 | 109 |
| 752 | 3300041405 | Ga0439438_010012 | Ga0439438_010012_2093_2422 | 109 |
| 753 | 3300041405 | Ga0439438_012538 | Ga0439438_012538_1963_2292 | 109 |
| 754 | 3300041405 | Ga0439438_014142 | Ga0439438_014142_711_1040 | 109 |
| 755 | 3300041405 | Ga0439438_018677 | Ga0439438_018677_1293_1622 | 109 |
| 756 | 3300041407 | Ga0439447_001121 | Ga0439447_001121_5469_5798 | 109 |
| 757 | 3300041407 | Ga0439447_002220 | Ga0439447_002220_1669_1998 | 109 |
| 758 | 3300041407 | Ga0439447_002824 | Ga0439447_002824_5391_5720 | 109 |
| 759 | 3300041407 | Ga0439447_009508 | Ga0439447_009508_370_699 | 109 |
| 760 | 3300041407 | Ga0439447_013121 | Ga0439447_013121_1467_1796 | 109 |
| 761 | 3300041407 | Ga0439447_040010 | Ga0439447_040010_737_1066 | 109 |
| 762 | 3300041408 | Ga0439453_0017923 | Ga0439453_0017923_139_468 | 109 |
| 763 | 3300041410 | Ga0439461_0072053 | Ga0439461_0072053_289_618 | 109 |
| 764 | 3300041411 | Ga0439466_0012003 | Ga0439466_0012003_215_544 | 109 |
| 765 | 3300041411 | Ga0439466_0015802 | Ga0439466_0015802_2242_2571 | 109 |
| 766 | 3300041411 | Ga0439466_0020615 | Ga0439466_0020615_645_974 | 109 |
| 767 | 3300041411 | Ga0439466_0022787 | Ga0439466_0022787_1339_1668 | 109 |
| 768 | 3300041413 | Ga0439465_0013128 | Ga0439465_0013128_371_700 | 109 |
| 769 | 3300041503 | Ga0451847_0095971 | Ga0451847_0095971_65_394 | 109 |
| 770 | 3300041509 | Ga0451843_0170682 | Ga0451843_0170682_224_553 | 109 |
| 771 | 3300041997 | Ga0439431_0038654 | Ga0439431_0038654_431_760 | 109 |
| 772 | 3300041997 | Ga0439431_0051182 | Ga0439431_0051182_609_938 | 109 |
| 773 | 3300042000 | Ga0439437_000171 | Ga0439437_000171_4225_4554 | 109 |
| 774 | 3300042006 | Ga0439432_006745 | Ga0439432_006745_2089_2418 | 109 |
| 775 | 3300042006 | Ga0439432_006900 | Ga0439432_006900_834_1163 | 109 |
| 776 | 3300042006 | Ga0439432_013630 | Ga0439432_013630_165_494 | 109 |
| 777 | 3300042009 | Ga0439451_015770 | Ga0439451_015770_1153_1482 | 109 |
| 778 | 3300042009 | Ga0439451_021244 | Ga0439451_021244_852_1181 | 109 |
| 779 | 3300042009 | Ga0439451_022951 | Ga0439451_022951_839_1168 | 109 |
| 780 | 3300042009 | Ga0439451_046689 | Ga0439451_046689_328_657 | 109 |
| 781 | 3300042009 | Ga0439451_048987 | Ga0439451_048987_70_399 | 109 |
| 782 | 3300042010 | Ga0439452_000207 | Ga0439452_000207_38243_38572 | 109 |
| 783 | 3300042010 | Ga0439452_001453 | Ga0439452_001453_3957_4286 | 109 |
| 784 | 3300042010 | Ga0439452_003681 | Ga0439452_003681_2235_2564 | 109 |
| 785 | 3300042010 | Ga0439452_005870 | Ga0439452_005870_40_369 | 109 |
| 786 | 3300042012 | Ga0439455_0002951 | Ga0439455_0002951_2340_2669 | 109 |
| 787 | 3300042013 | Ga0439456_001007 | Ga0439456_001007_1082_1411 | 109 |
| 788 | 3300042013 | Ga0439456_013066 | Ga0439456_013066_1386_1715 | 109 |
| 789 | 3300042013 | Ga0439456_057998 | Ga0439456_057998_154_483 | 109 |
| 790 | 3300042016 | Ga0439463_003800 | Ga0439463_003800_761_1090 | 109 |
| 791 | 3300042016 | Ga0439463_017076 | Ga0439463_017076_653_982 | 109 |
| 792 | 3300042016 | Ga0439463_025820 | Ga0439463_025820_759_1088 | 109 |
| 793 | 3300042016 | Ga0439463_052478 | Ga0439463_052478_441_770 | 109 |
| 794 | 3300042115 | Ga0450911_000204 | Ga0450911_000204_5396_5725 | 109 |
| 795 | 3300042115 | Ga0450911_001533 | Ga0450911_001533_576_905 | 109 |
| 796 | 3300042115 | Ga0450911_001690 | Ga0450911_001690_706_1035 | 109 |
| 797 | 3300042115 | Ga0450911_019593 | Ga0450911_019593_378_707 | 109 |
| 798 | 3300042115 | Ga0450911_022817 | Ga0450911_022817_297_626 | 109 |
| 799 | 3300042117 | Ga0450913_008618 | Ga0450913_008618_49_378 | 109 |
| 800 | 3300042121 | Ga0450919_000714 | Ga0450919_000714_2018_2347 | 109 |
| 801 | 3300042121 | Ga0450919_001291 | Ga0450919_001291_2354_2683 | 109 |
| 802 | 3300042122 | Ga0450920_008400 | Ga0450920_008400_1097_1426 | 109 |
| 803 | 3300042124 | Ga0450922_000147 | Ga0450922_000147_3033_3362 | 109 |
| 804 | 3300042127 | Ga0450890_001456 | Ga0450890_001456_40_369 | 109 |
| 805 | 3300042137 | Ga0450902_016728 | Ga0450902_016728_473_802 | 109 |
| 806 | 3300042137 | Ga0450902_035238 | Ga0450902_035238_311_640 | 109 |
| 807 | 3300042138 | Ga0450903_003177 | Ga0450903_003177_2279_2608 | 109 |
| 808 | 3300042138 | Ga0450903_022067 | Ga0450903_022067_489_818 | 109 |
| 809 | 3300042138 | Ga0450903_043155 | Ga0450903_043155_293_622 | 109 |
| 810 | 3300042139 | Ga0450904_000466 | Ga0450904_000466_2318_2647 | 109 |
| 811 | 3300042139 | Ga0450904_003311 | Ga0450904_003311_879_1208 | 109 |
| 812 | 3300042142 | Ga0450905_092763 | Ga0450905_092763_16_345 | 109 |
| 813 | 3300042145 | Ga0450906_000358 | Ga0450906_000358_1422_1751 | 109 |
| 814 | 3300042145 | Ga0450906_006543 | Ga0450906_006543_712_1041 | 109 |
| 815 | 3300042146 | Ga0450907_000197 | Ga0450907_000197_20069_20398 | 109 |
| 816 | 3300042146 | Ga0450907_000424 | Ga0450907_000424_8337_8666 | 109 |
| 817 | 3300042146 | Ga0450907_003201 | Ga0450907_003201_439_768 | 109 |
| 818 | 3300042147 | Ga0450910_000448 | Ga0450910_000448_2245_2574 | 109 |
| 819 | 3300042147 | Ga0450910_000974 | Ga0450910_000974_1420_1749 | 109 |
| 820 | 3300042156 | Ga0439446_0003304 | Ga0439446_0003304_600_929 | 109 |
| 821 | 3300042156 | Ga0439446_0014964 | Ga0439446_0014964_312_641 | 109 |
| 822 | 3300042184 | Ga0450908_033066 | Ga0450908_033066_262_591 | 109 |
| 823 | 3300042185 | Ga0450909_001937 | Ga0450909_001937_1834_2163 | 109 |
| 824 | 3300042435 | Ga0439434_0001659 | Ga0439434_0001659_106_435 | 109 |
| 825 | 3300042435 | Ga0439434_0022457 | Ga0439434_0022457_206_535 | 109 |
| 826 | 3300042438 | Ga0439459_0007181 | Ga0439459_0007181_830_1159 | 109 |
| 827 | 3300042439 | Ga0439464_0002872 | Ga0439464_0002872_1977_2306 | 109 |
| 828 | 3300042461 | Ga0439460_0033857 | Ga0439460_0033857_42_371 | 109 |
| 829 | 3300042461 | Ga0439460_0158649 | Ga0439460_0158649_387_716 | 109 |
| 830 | 3300042461 | Ga0439460_0271055 | Ga0439460_0271055_98_427 | 109 |
| 831 | 3300042530 | Ga0450916_003148 | Ga0450916_003148_726_1055 | 109 |
| 832 | 3300042530 | Ga0450916_046562 | Ga0450916_046562_149_478 | 109 |
| 833 | 3300042532 | Ga0450893_0018953 | Ga0450893_0018953_638_967 | 109 |
| 834 | 3300042532 | Ga0450893_0035470 | Ga0450893_0035470_209_538 | 109 |
| 835 | 3300042993 | Ga0439440_0004375 | Ga0439440_0004375_2027_2356 | 109 |
| 836 | 3300042993 | Ga0439440_0010195 | Ga0439440_0010195_312_641 | 109 |
| 837 | 3300046452 | Ga0495617_000127 | Ga0495617_000127_4035_4364 | 109 |
| 838 | 3300046452 | Ga0495617_021559 | Ga0495617_021559_1201_1530 | 109 |
| 839 | 3300046452 | Ga0495617_039352 | Ga0495617_039352_229_558 | 109 |
| 840 | 3300046452 | Ga0495617_065203 | Ga0495617_065203_325_654 | 109 |
| 841 | 3300046452 | Ga0495617_256887 | Ga0495617_256887_81_410 | 109 |
| 842 | 3300046453 | Ga0495627_000074 | Ga0495627_000074_79478_79807 | 109 |
| 843 | 3300046453 | Ga0495627_000733 | Ga0495627_000733_4077_4406 | 109 |
| 844 | 3300046453 | Ga0495627_007975 | Ga0495627_007975_2997_3326 | 109 |
| 845 | 3300046453 | Ga0495627_013168 | Ga0495627_013168_1233_1562 | 109 |
| 846 | 3300046455 | Ga0495603_0138625 | Ga0495603_0138625_630_959 | 109 |
| 847 | 3300046457 | Ga0495590_0006319 | Ga0495590_0006319_194_523 | 109 |
| 848 | 3300046457 | Ga0495590_0090451 | Ga0495590_0090451_496_825 | 109 |
| 849 | 3300046458 | Ga0495591_000351 | Ga0495591_000351_33416_33745 | 109 |
| 850 | 3300046458 | Ga0495591_004699 | Ga0495591_004699_4031_4360 | 109 |
| 851 | 3300046458 | Ga0495591_007840 | Ga0495591_007840_48_377 | 109 |
| 852 | 3300046458 | Ga0495591_009959 | Ga0495591_009959_2377_2706 | 109 |
| 853 | 3300046458 | Ga0495591_017008 | Ga0495591_017008_1426_1755 | 109 |
| 854 | 3300046458 | Ga0495591_020509 | Ga0495591_020509_269_598 | 109 |
| 855 | 3300046458 | Ga0495591_062064 | Ga0495591_062064_618_947 | 109 |
| 856 | 3300046459 | Ga0495629_0130214 | Ga0495629_0130214_548_877 | 109 |
| 857 | 3300046460 | Ga0495638_0008766 | Ga0495638_0008766_3970_4299 | 109 |
| 858 | 3300046460 | Ga0495638_0009529 | Ga0495638_0009529_3630_3959 | 109 |
| 859 | 3300046460 | Ga0495638_0022186 | Ga0495638_0022186_274_603 | 109 |
| 860 | 3300046460 | Ga0495638_0174564 | Ga0495638_0174564_41_370 | 109 |
| 861 | 3300046460 | Ga0495638_0370003 | Ga0495638_0370003_51_380 | 109 |
| 862 | 3300046460 | Ga0495638_0534188 | Ga0495638_0534188_182_511 | 109 |
| 863 | 3300046463 | Ga0495653_0023163 | Ga0495653_0023163_4097_4426 | 109 |
| 864 | 3300046463 | Ga0495653_0028970 | Ga0495653_0028970_1633_1962 | 109 |
| 865 | 3300046463 | Ga0495653_0119539 | Ga0495653_0119539_466_795 | 109 |
| 866 | 3300046463 | Ga0495653_0154263 | Ga0495653_0154263_1184_1513 | 109 |
| 867 | 3300046463 | Ga0495653_0346348 | Ga0495653_0346348_596_925 | 109 |
| 868 | 3300046471 | Ga0495650_0009577 | Ga0495650_0009577_1146_1475 | 109 |
| 869 | 3300046471 | Ga0495650_0013923 | Ga0495650_0013923_2366_2695 | 109 |
| 870 | 3300046471 | Ga0495650_0025032 | Ga0495650_0025032_2447_2776 | 109 |
| 871 | 3300046471 | Ga0495650_0025111 | Ga0495650_0025111_2456_2785 | 109 |
| 872 | 3300046471 | Ga0495650_0053515 | Ga0495650_0053515_265_594 | 109 |
| 873 | 3300046471 | Ga0495650_0068133 | Ga0495650_0068133_843_1172 | 109 |
| 874 | 3300046471 | Ga0495650_0083417 | Ga0495650_0083417_433_762 | 109 |
| 875 | 3300046474 | Ga0495605_0000182 | Ga0495605_0000182_37118_37447 | 109 |
| 876 | 3300046474 | Ga0495605_0000543 | Ga0495605_0000543_4739_5068 | 109 |
| 877 | 3300046474 | Ga0495605_0006153 | Ga0495605_0006153_5392_5721 | 109 |
| 878 | 3300046474 | Ga0495605_0008292 | Ga0495605_0008292_5500_5829 | 109 |
| 879 | 3300046474 | Ga0495605_0014838 | Ga0495605_0014838_1008_1337 | 109 |
| 880 | 3300046474 | Ga0495605_0026615 | Ga0495605_0026615_1390_1719 | 109 |
| 881 | 3300046474 | Ga0495605_0092019 | Ga0495605_0092019_986_1315 | 109 |
| 882 | 3300046474 | Ga0495605_0168874 | Ga0495605_0168874_515_844 | 109 |
| 883 | 3300046474 | Ga0495605_0244601 | Ga0495605_0244601_281_610 | 109 |
| 884 | 3300046491 | Ga0495584_0003206 | Ga0495584_0003206_4769_5098 | 109 |
| 885 | 3300046491 | Ga0495584_0006489 | Ga0495584_0006489_4090_4419 | 109 |
| 886 | 3300046491 | Ga0495584_0011307 | Ga0495584_0011307_4106_4435 | 109 |
| 887 | 3300046491 | Ga0495584_0012444 | Ga0495584_0012444_1010_1339 | 109 |
| 888 | 3300046491 | Ga0495584_0017462 | Ga0495584_0017462_3259_3588 | 109 |
| 889 | 3300046491 | Ga0495584_0029637 | Ga0495584_0029637_1963_2292 | 109 |
| 890 | 3300046491 | Ga0495584_0036106 | Ga0495584_0036106_1372_1701 | 109 |
| 891 | 3300046491 | Ga0495584_0052419 | Ga0495584_0052419_1415_1744 | 109 |
| 892 | 3300046492 | Ga0495585_0007614 | Ga0495585_0007614_4115_4444 | 109 |
| 893 | 3300046492 | Ga0495585_0008396 | Ga0495585_0008396_4175_4504 | 109 |
| 894 | 3300046492 | Ga0495585_0011899 | Ga0495585_0011899_3394_3723 | 109 |
| 895 | 3300046492 | Ga0495585_0019119 | Ga0495585_0019119_872_1201 | 109 |
| 896 | 3300046492 | Ga0495585_0022272 | Ga0495585_0022272_248_577 | 109 |
| 897 | 3300046492 | Ga0495585_0034124 | Ga0495585_0034124_2482_2811 | 109 |
| 898 | 3300046492 | Ga0495585_0048596 | Ga0495585_0048596_1437_1766 | 109 |
| 899 | 3300046492 | Ga0495585_0054031 | Ga0495585_0054031_1817_2146 | 109 |
| 900 | 3300046492 | Ga0495585_0077685 | Ga0495585_0077685_165_494 | 109 |
| 901 | 3300046499 | Ga0495594_0060354 | Ga0495594_0060354_312_641 | 109 |
| 902 | 3300046500 | Ga0495596_0037994 | Ga0495596_0037994_81_410 | 109 |
| 903 | 3300046500 | Ga0495596_0077745 | Ga0495596_0077745_117_446 | 109 |
| 904 | 3300046501 | Ga0495607_0000549 | Ga0495607_0000549_5432_5761 | 109 |
| 905 | 3300046501 | Ga0495607_0000721 | Ga0495607_0000721_30138_30467 | 109 |
| 906 | 3300046501 | Ga0495607_0001083 | Ga0495607_0001083_20508_20837 | 109 |
| 907 | 3300046501 | Ga0495607_0001478 | Ga0495607_0001478_4085_4414 | 109 |
| 908 | 3300046501 | Ga0495607_0012868 | Ga0495607_0012868_1352_1681 | 109 |
| 909 | 3300046501 | Ga0495607_0018822 | Ga0495607_0018822_2365_2694 | 109 |
| 910 | 3300046501 | Ga0495607_0027747 | Ga0495607_0027747_2216_2545 | 109 |
| 911 | 3300046501 | Ga0495607_0068205 | Ga0495607_0068205_278_607 | 109 |
| 912 | 3300046501 | Ga0495607_0092096 | Ga0495607_0092096_937_1266 | 109 |
| 913 | 3300046501 | Ga0495607_0170257 | Ga0495607_0170257_38_367 | 109 |
| 914 | 3300046506 | Ga0495583_0001430 | Ga0495583_0001430_4314_4643 | 109 |
| 915 | 3300046506 | Ga0495583_0002110 | Ga0495583_0002110_4026_4355 | 109 |
| 916 | 3300046506 | Ga0495583_0013261 | Ga0495583_0013261_76_405 | 109 |
| 917 | 3300046506 | Ga0495583_0052437 | Ga0495583_0052437_1417_1746 | 109 |
| 918 | 3300046506 | Ga0495583_0289118 | Ga0495583_0289118_66_395 | 109 |
| 919 | 3300046507 | Ga0495606_0008750 | Ga0495606_0008750_3246_3575 | 109 |
| 920 | 3300046507 | Ga0495606_0015690 | Ga0495606_0015690_1654_1983 | 109 |
| 921 | 3300046507 | Ga0495606_0053644 | Ga0495606_0053644_2091_2420 | 109 |
| 922 | 3300046507 | Ga0495606_0086804 | Ga0495606_0086804_1147_1476 | 109 |
| 923 | 3300046507 | Ga0495606_0132869 | Ga0495606_0132869_970_1299 | 109 |
| 924 | 3300046507 | Ga0495606_0209612 | Ga0495606_0209612_597_926 | 109 |
| 925 | 3300046507 | Ga0495606_0233472 | Ga0495606_0233472_650_979 | 109 |
| 926 | 3300046512 | Ga0495610_0006641 | Ga0495610_0006641_2408_2737 | 109 |
| 927 | 3300046512 | Ga0495610_0011965 | Ga0495610_0011965_987_1316 | 109 |
| 928 | 3300046512 | Ga0495610_0062865 | Ga0495610_0062865_42_371 | 109 |
| 929 | 3300046512 | Ga0495610_0118983 | Ga0495610_0118983_70_399 | 109 |
| 930 | 3300046512 | Ga0495610_0263793 | Ga0495610_0263793_20_349 | 109 |
| 931 | 3300046513 | Ga0495616_0000823 | Ga0495616_0000823_1903_2232 | 109 |
| 932 | 3300046513 | Ga0495616_0003782 | Ga0495616_0003782_5925_6254 | 109 |
| 933 | 3300046513 | Ga0495616_0007448 | Ga0495616_0007448_2351_2680 | 109 |
| 934 | 3300046513 | Ga0495616_0021398 | Ga0495616_0021398_561_890 | 109 |
| 935 | 3300046513 | Ga0495616_0049557 | Ga0495616_0049557_1382_1711 | 109 |
| 936 | 3300046513 | Ga0495616_0065241 | Ga0495616_0065241_131_460 | 109 |
| 937 | 3300046513 | Ga0495616_0079097 | Ga0495616_0079097_1080_1409 | 109 |
| 938 | 3300046515 | Ga0495620_0002112 | Ga0495620_0002112_4115_4444 | 109 |
| 939 | 3300046515 | Ga0495620_0023069 | Ga0495620_0023069_1391_1720 | 109 |
| 940 | 3300046515 | Ga0495620_0038356 | Ga0495620_0038356_1367_1696 | 109 |
| 941 | 3300046515 | Ga0495620_0056662 | Ga0495620_0056662_307_636 | 109 |
| 942 | 3300046515 | Ga0495620_0171733 | Ga0495620_0171733_29_358 | 109 |
| 943 | 3300046517 | Ga0495630_0186104 | Ga0495630_0186104_1032_1361 | 109 |
| 944 | 3300046518 | Ga0495631_0001514 | Ga0495631_0001514_1418_1747 | 109 |
| 945 | 3300046518 | Ga0495631_0002924 | Ga0495631_0002924_4079_4408 | 109 |
| 946 | 3300046519 | Ga0495632_0001004 | Ga0495632_0001004_4339_4668 | 109 |
| 947 | 3300046519 | Ga0495632_0001169 | Ga0495632_0001169_18067_18396 | 109 |
| 948 | 3300046519 | Ga0495632_0003894 | Ga0495632_0003894_3942_4271 | 109 |
| 949 | 3300046519 | Ga0495632_0004016 | Ga0495632_0004016_5518_5847 | 109 |
| 950 | 3300046519 | Ga0495632_0009005 | Ga0495632_0009005_4163_4492 | 109 |
| 951 | 3300046519 | Ga0495632_0022208 | Ga0495632_0022208_1419_1748 | 109 |
| 952 | 3300046519 | Ga0495632_0053322 | Ga0495632_0053322_1211_1540 | 109 |
| 953 | 3300046519 | Ga0495632_0065401 | Ga0495632_0065401_1410_1739 | 109 |
| 954 | 3300046519 | Ga0495632_0066359 | Ga0495632_0066359_1016_1345 | 109 |
| 955 | 3300046519 | Ga0495632_0127958 | Ga0495632_0127958_535_864 | 109 |
| 956 | 3300046519 | Ga0495632_0522548 | Ga0495632_0522548_58_387 | 109 |
| 957 | 3300046520 | Ga0495637_0004413 | Ga0495637_0004413_3289_3618 | 109 |
| 958 | 3300046520 | Ga0495637_0005233 | Ga0495637_0005233_2329_2658 | 109 |
| 959 | 3300046520 | Ga0495637_0014398 | Ga0495637_0014398_1782_2111 | 109 |
| 960 | 3300046520 | Ga0495637_0018333 | Ga0495637_0018333_2890_3219 | 109 |
| 961 | 3300046520 | Ga0495637_0020873 | Ga0495637_0020873_2539_2868 | 109 |
| 962 | 3300046520 | Ga0495637_0028969 | Ga0495637_0028969_611_940 | 109 |
| 963 | 3300046520 | Ga0495637_0030890 | Ga0495637_0030890_1409_1738 | 109 |
| 964 | 3300046520 | Ga0495637_0031897 | Ga0495637_0031897_471_800 | 109 |
| 965 | 3300046520 | Ga0495637_0042927 | Ga0495637_0042927_91_420 | 109 |
| 966 | 3300046520 | Ga0495637_0045825 | Ga0495637_0045825_1409_1738 | 109 |
| 967 | 3300046520 | Ga0495637_0045923 | Ga0495637_0045923_1390_1719 | 109 |
| 968 | 3300046520 | Ga0495637_0080271 | Ga0495637_0080271_867_1196 | 109 |
| 969 | 3300046522 | Ga0495643_0025313 | Ga0495643_0025313_2093_2422 | 109 |
| 970 | 3300046522 | Ga0495643_0115631 | Ga0495643_0115631_982_1311 | 109 |
| 971 | 3300046522 | Ga0495643_0129424 | Ga0495643_0129424_264_593 | 109 |
| 972 | 3300046522 | Ga0495643_0136079 | Ga0495643_0136079_287_616 | 109 |
| 973 | 3300046523 | Ga0495644_0027732 | Ga0495644_0027732_472_801 | 109 |
| 974 | 3300046523 | Ga0495644_0105512 | Ga0495644_0105512_497_826 | 109 |
| 975 | 3300046524 | Ga0495648_0001113 | Ga0495648_0001113_1802_2131 | 109 |
| 976 | 3300046524 | Ga0495648_0007222 | Ga0495648_0007222_3934_4263 | 109 |
| 977 | 3300046524 | Ga0495648_0010337 | Ga0495648_0010337_5372_5701 | 109 |
| 978 | 3300046524 | Ga0495648_0019892 | Ga0495648_0019892_436_765 | 109 |
| 979 | 3300046524 | Ga0495648_0029271 | Ga0495648_0029271_1750_2079 | 109 |
| 980 | 3300046524 | Ga0495648_0084387 | Ga0495648_0084387_1021_1350 | 109 |
| 981 | 3300046524 | Ga0495648_0113600 | Ga0495648_0113600_264_593 | 109 |
| 982 | 3300046524 | Ga0495648_0216408 | Ga0495648_0216408_168_497 | 109 |
| 983 | 3300046524 | Ga0495648_0396484 | Ga0495648_0396484_227_556 | 109 |
| 984 | 3300046526 | Ga0495666_0036672 | Ga0495666_0036672_414_743 | 109 |
| 985 | 3300046526 | Ga0495666_0045910 | Ga0495666_0045910_1588_1917 | 109 |
| 986 | 3300046526 | Ga0495666_0047318 | Ga0495666_0047318_933_1262 | 109 |
| 987 | 3300046528 | Ga0495642_0000398 | Ga0495642_0000398_19022_19351 | 109 |
| 988 | 3300046528 | Ga0495642_0105252 | Ga0495642_0105252_137_466 | 109 |
| 989 | 3300046530 | Ga0495654_0001589 | Ga0495654_0001589_3203_3532 | 109 |
| 990 | 3300046530 | Ga0495654_0008410 | Ga0495654_0008410_1937_2266 | 109 |
| 991 | 3300046530 | Ga0495654_0011659 | Ga0495654_0011659_2946_3275 | 109 |
| 992 | 3300046530 | Ga0495654_0013168 | Ga0495654_0013168_2770_3099 | 109 |
| 993 | 3300046530 | Ga0495654_0071960 | Ga0495654_0071960_1032_1361 | 109 |
| 994 | 3300046530 | Ga0495654_0124604 | Ga0495654_0124604_793_1122 | 109 |
| 995 | 3300046530 | Ga0495654_0142796 | Ga0495654_0142796_694_1023 | 109 |
| 996 | 3300046530 | Ga0495654_0166871 | Ga0495654_0166871_51_380 | 109 |
| 997 | 3300046530 | Ga0495654_0219997 | Ga0495654_0219997_179_508 | 109 |
| 998 | 3300046535 | Ga0495586_0070019 | Ga0495586_0070019_730_1059 | 109 |
| 999 | 3300046536 | Ga0495587_0026110 | Ga0495587_0026110_3191_3520 | 109 |
| 1000 | 3300046536 | Ga0495587_0204982 | Ga0495587_0204982_372_701 | 109 |
| 1001 | 3300046536 | Ga0495587_0411086 | Ga0495587_0411086_15_344 | 109 |
| 1002 | 3300046538 | Ga0495609_0000006 | Ga0495609_0000006_372350_372679 | 109 |
| 1003 | 3300046538 | Ga0495609_0002066 | Ga0495609_0002066_1263_1592 | 109 |
| 1004 | 3300046538 | Ga0495609_0005135 | Ga0495609_0005135_4165_4494 | 109 |
| 1005 | 3300046538 | Ga0495609_0009658 | Ga0495609_0009658_1385_1714 | 109 |
| 1006 | 3300046538 | Ga0495609_0012540 | Ga0495609_0012540_1397_1726 | 109 |
| 1007 | 3300046538 | Ga0495609_0043508 | Ga0495609_0043508_310_639 | 109 |
| 1008 | 3300046538 | Ga0495609_0070601 | Ga0495609_0070601_119_448 | 109 |
| 1009 | 3300046542 | Ga0495597_0000040 | Ga0495597_0000040_33866_34195 | 109 |
| 1010 | 3300046542 | Ga0495597_0009538 | Ga0495597_0009538_4084_4413 | 109 |
| 1011 | 3300046542 | Ga0495597_0011500 | Ga0495597_0011500_3913_4242 | 109 |
| 1012 | 3300046542 | Ga0495597_0015427 | Ga0495597_0015427_2524_2853 | 109 |
| 1013 | 3300046542 | Ga0495597_0065409 | Ga0495597_0065409_1205_1534 | 109 |
| 1014 | 3300046543 | Ga0495645_0109363 | Ga0495645_0109363_1371_1700 | 109 |
| 1015 | 3300046557 | Ga0495622_0003985 | Ga0495622_0003985_4027_4356 | 109 |
| 1016 | 3300046557 | Ga0495622_0005610 | Ga0495622_0005610_4105_4434 | 109 |
| 1017 | 3300046557 | Ga0495622_0155316 | Ga0495622_0155316_504_833 | 109 |
| 1018 | 3300046558 | Ga0495633_0006725 | Ga0495633_0006725_4849_5178 | 109 |
| 1019 | 3300046558 | Ga0495633_0008551 | Ga0495633_0008551_1004_1333 | 109 |
| 1020 | 3300046615 | Ga0495656_0001597 | Ga0495656_0001597_3968_4297 | 109 |
| 1021 | 3300046616 | Ga0495668_0070744 | Ga0495668_0070744_1554_1883 | 109 |
| 1022 | 3300046616 | Ga0495668_0117490 | Ga0495668_0117490_87_416 | 109 |
| 1023 | 3300046616 | Ga0495668_0237894 | Ga0495668_0237894_39_368 | 109 |
| 1024 | 3300046642 | Ga0495634_0004434 | Ga0495634_0004434_3977_4306 | 109 |
| 1025 | 3300046648 | Ga0495611_0000445 | Ga0495611_0000445_20465_20794 | 109 |
| 1026 | 3300046648 | Ga0495611_0111200 | Ga0495611_0111200_445_774 | 109 |
| 1027 | 3300046648 | Ga0495611_0234152 | Ga0495611_0234152_174_503 | 109 |
| 1028 | 3300046660 | Ga0495625_0029183 | Ga0495625_0029183_2323_2652 | 109 |
| 1029 | 3300046660 | Ga0495625_0291444 | Ga0495625_0291444_656_985 | 109 |
| 1030 | 3300046660 | Ga0495625_0296628 | Ga0495625_0296628_596_925 | 109 |
| 1031 | 3300046660 | Ga0495625_0323572 | Ga0495625_0323572_611_940 | 109 |
| 1032 | 3300046660 | Ga0495625_0621818 | Ga0495625_0621818_170_499 | 109 |
| 1033 | 3300046660 | Ga0495625_0684005 | Ga0495625_0684005_58_387 | 109 |
| 1034 | 3300046660 | Ga0495625_0870826 | Ga0495625_0870826_112_441 | 109 |
| 1035 | 3300046663 | Ga0495635_0005516 | Ga0495635_0005516_4328_4657 | 109 |
| 1036 | 3300046663 | Ga0495635_0088686 | Ga0495635_0088686_98_427 | 109 |
| 1037 | 3300046664 | Ga0495659_0003358 | Ga0495659_0003358_4698_5027 | 109 |
| 1038 | 3300046664 | Ga0495659_0004687 | Ga0495659_0004687_1343_1672 | 109 |
| 1039 | 3300046665 | Ga0495661_0000829 | Ga0495661_0000829_24329_24658 | 109 |
| 1040 | 3300046665 | Ga0495661_0057432 | Ga0495661_0057432_386_715 | 109 |
| 1041 | 3300046665 | Ga0495661_0150885 | Ga0495661_0150885_264_593 | 109 |
| 1042 | 3300046665 | Ga0495661_0243446 | Ga0495661_0243446_560_889 | 109 |
| 1043 | 3300046665 | Ga0495661_0441740 | Ga0495661_0441740_196_525 | 109 |
| 1044 | 3300046674 | Ga0495588_0016063 | Ga0495588_0016063_733_1062 | 109 |
| 1045 | 3300046679 | Ga0495623_0010871 | Ga0495623_0010871_3937_4266 | 109 |
| 1046 | 3300046680 | Ga0495646_0010699 | Ga0495646_0010699_1783_2112 | 109 |
| 1047 | 3300046680 | Ga0495646_0012871 | Ga0495646_0012871_830_1159 | 109 |
| 1048 | 3300046684 | Ga0495669_0009785 | Ga0495669_0009785_680_1009 | 109 |
| 1049 | 3300046689 | Ga0495613_0055943 | Ga0495613_0055943_1378_1707 | 109 |
| 1050 | 3300046691 | Ga0495670_0001017 | Ga0495670_0001017_1407_1736 | 109 |
| 1051 | 3300046691 | Ga0495670_0002719 | Ga0495670_0002719_4343_4672 | 109 |
| 1052 | 3300046691 | Ga0495670_0016045 | Ga0495670_0016045_2371_2700 | 109 |
| 1053 | 3300046692 | Ga0495671_0016592 | Ga0495671_0016592_2225_2554 | 109 |
| 1054 | 3300046692 | Ga0495671_0018208 | Ga0495671_0018208_2351_2680 | 109 |
| 1055 | 3300046692 | Ga0495671_0025967 | Ga0495671_0025967_1141_1470 | 109 |
| 1056 | 3300046692 | Ga0495671_0085085 | Ga0495671_0085085_1001_1330 | 109 |
| 1057 | 3300046692 | Ga0495671_0184679 | Ga0495671_0184679_22_351 | 109 |
| 1058 | 3300046692 | Ga0495671_0304593 | Ga0495671_0304593_89_418 | 109 |
| 1059 | 3300046692 | Ga0495671_0612815 | Ga0495671_0612815_51_380 | 109 |
| 1060 | 3300046694 | Ga0495649_0002637 | Ga0495649_0002637_4124_4453 | 109 |
| 1061 | 3300046694 | Ga0495649_0004206 | Ga0495649_0004206_6484_6813 | 109 |
| 1062 | 3300046694 | Ga0495649_0007929 | Ga0495649_0007929_1456_1785 | 109 |
| 1063 | 3300046694 | Ga0495649_0052426 | Ga0495649_0052426_524_853 | 109 |
| 1064 | 3300046694 | Ga0495649_0053433 | Ga0495649_0053433_1336_1665 | 109 |
| 1065 | 3300046694 | Ga0495649_0070785 | Ga0495649_0070785_984_1313 | 109 |
| 1066 | 3300046694 | Ga0495649_0100611 | Ga0495649_0100611_416_745 | 109 |
| 1067 | 3300046694 | Ga0495649_0140078 | Ga0495649_0140078_557_886 | 109 |
| 1068 | 3300046794 | Ga0495589_0001824 | Ga0495589_0001824_10385_10714 | 109 |
| 1069 | 3300046794 | Ga0495589_0002361 | Ga0495589_0002361_6194_6523 | 109 |
| 1070 | 3300046794 | Ga0495589_0009091 | Ga0495589_0009091_2270_2599 | 109 |
| 1071 | 3300046794 | Ga0495589_0009871 | Ga0495589_0009871_1634_1963 | 109 |
| 1072 | 3300046794 | Ga0495589_0060296 | Ga0495589_0060296_132_461 | 109 |
| 1073 | 3300046809 | Ga0495600_0017597 | Ga0495600_0017597_33_362 | 109 |
| 1074 | 3300046809 | Ga0495600_0069543 | Ga0495600_0069543_1567_1896 | 109 |
| 1075 | 3300046810 | Ga0495660_0000240 | Ga0495660_0000240_15413_15742 | 109 |
| 1076 | 3300046810 | Ga0495660_0014751 | Ga0495660_0014751_2730_3059 | 109 |
| 1077 | 3300046810 | Ga0495660_0019195 | Ga0495660_0019195_1353_1682 | 109 |
| 1078 | 3300046810 | Ga0495660_0040889 | Ga0495660_0040889_2160_2489 | 109 |
| 1079 | 3300046810 | Ga0495660_0042103 | Ga0495660_0042103_802_1131 | 109 |
| 1080 | 3300046810 | Ga0495660_0045486 | Ga0495660_0045486_1393_1722 | 109 |
| 1081 | 3300046810 | Ga0495660_0089758 | Ga0495660_0089758_248_577 | 109 |
| 1082 | 3300046810 | Ga0495660_0131102 | Ga0495660_0131102_38_367 | 109 |
| 1083 | 3300047317 | Ga0495604_0019032 | Ga0495604_0019032_2464_2793 | 109 |
| 1084 | 3300047317 | Ga0495604_0020740 | Ga0495604_0020740_836_1165 | 109 |
| 1085 | 3300047318 | Ga0495636_0002597 | Ga0495636_0002597_6136_6465 | 109 |
| 1086 | 3300047318 | Ga0495636_0181027 | Ga0495636_0181027_301_630 | 109 |
| 1087 | 3300047319 | Ga0495674_0303162 | Ga0495674_0303162_886_1215 | 109 |
| 1088 | 3300047320 | Ga0495672_0019644 | Ga0495672_0019644_2840_3169 | 109 |
| 1089 | 3300047320 | Ga0495672_0061162 | Ga0495672_0061162_748_1077 | 109 |
| 1090 | 3300047320 | Ga0495672_0065510 | Ga0495672_0065510_1388_1717 | 109 |
| 1091 | 3300047320 | Ga0495672_0103137 | Ga0495672_0103137_66_395 | 109 |
| 1092 | 3300047320 | Ga0495672_0110864 | Ga0495672_0110864_163_492 | 109 |
| 1093 | 3300047320 | Ga0495672_0281837 | Ga0495672_0281837_390_719 | 109 |
| 1094 | 3300047321 | Ga0495676_0075715 | Ga0495676_0075715_1493_1822 | 109 |
| 1095 | 3300047322 | Ga0495680_0008104 | Ga0495680_0008104_4025_4354 | 109 |
| 1096 | 3300047322 | Ga0495680_0046759 | Ga0495680_0046759_2386_2715 | 109 |
| 1097 | 3300047322 | Ga0495680_0218769 | Ga0495680_0218769_620_949 | 109 |
| 1098 | 3300047322 | Ga0495680_1014014 | Ga0495680_1014014_104_433 | 109 |
| 1099 | 3300047323 | Ga0495683_0003356 | Ga0495683_0003356_4948_5277 | 109 |
| 1100 | 3300047323 | Ga0495683_0040567 | Ga0495683_0040567_1070_1399 | 109 |
| 1101 | 3300047323 | Ga0495683_0050970 | Ga0495683_0050970_1603_1932 | 109 |
| 1102 | 3300047323 | Ga0495683_0241100 | Ga0495683_0241100_331_660 | 109 |
| 1103 | 3300047323 | Ga0495683_0274781 | Ga0495683_0274781_357_686 | 109 |
| 1104 | 3300047444 | Ga0495675_0013933 | Ga0495675_0013933_4160_4489 | 109 |
| 1105 | 3300047444 | Ga0495675_0498524 | Ga0495675_0498524_156_485 | 109 |
| 1106 | 3300047445 | Ga0495677_0007690 | Ga0495677_0007690_1467_1796 | 109 |
| 1107 | 3300047446 | Ga0495679_004383 | Ga0495679_004383_2328_2657 | 109 |
| 1108 | 3300047446 | Ga0495679_017253 | Ga0495679_017253_882_1211 | 109 |
| 1109 | 3300047446 | Ga0495679_046881 | Ga0495679_046881_389_718 | 109 |
| 1110 | 3300047469 | Ga0495673_0003472 | Ga0495673_0003472_6044_6373 | 109 |
| 1111 | 3300047469 | Ga0495673_0005781 | Ga0495673_0005781_3041_3370 | 109 |
| 1112 | 3300047469 | Ga0495673_0006941 | Ga0495673_0006941_4591_4920 | 109 |
| 1113 | 3300047469 | Ga0495673_0011839 | Ga0495673_0011839_4080_4409 | 109 |
| 1114 | 3300047469 | Ga0495673_0025236 | Ga0495673_0025236_1147_1476 | 109 |
| 1115 | 3300047469 | Ga0495673_0041794 | Ga0495673_0041794_206_535 | 109 |
| 1116 | 3300047469 | Ga0495673_0104499 | Ga0495673_0104499_680_1009 | 109 |
| 1117 | 3300047469 | Ga0495673_0105878 | Ga0495673_0105878_743_1072 | 109 |
| 1118 | 3300047470 | Ga0495681_0000762 | Ga0495681_0000762_20472_20801 | 109 |
| 1119 | 3300047470 | Ga0495681_0001492 | Ga0495681_0001492_3949_4278 | 109 |
| 1120 | 3300047470 | Ga0495681_0008925 | Ga0495681_0008925_793_1122 | 109 |
| 1121 | 3300047470 | Ga0495681_0009356 | Ga0495681_0009356_1413_1742 | 109 |
| 1122 | 3300047470 | Ga0495681_0009954 | Ga0495681_0009954_5260_5589 | 109 |
| 1123 | 3300047470 | Ga0495681_0014993 | Ga0495681_0014993_38_367 | 109 |
| 1124 | 3300047470 | Ga0495681_0036180 | Ga0495681_0036180_694_1023 | 109 |
| 1125 | 3300047472 | Ga0495686_0021995 | Ga0495686_0021995_2549_2878 | 109 |
| 1126 | 3300047472 | Ga0495686_0030736 | Ga0495686_0030736_1368_1697 | 109 |
| 1127 | 3300047472 | Ga0495686_0092459 | Ga0495686_0092459_131_460 | 109 |
| 1128 | 3300047673 | Ga0495593_0027293 | Ga0495593_0027293_2562_2891 | 109 |
| 1129 | 3300047673 | Ga0495593_0130000 | Ga0495593_0130000_44_373 | 109 |
| 1130 | 3300048091 | Ga0495626_0004635 | Ga0495626_0004635_4029_4358 | 109 |
| 1131 | 3300048091 | Ga0495626_0032624 | Ga0495626_0032624_1142_1471 | 109 |
| 1132 | 3300048091 | Ga0495626_0058680 | Ga0495626_0058680_1397_1726 | 109 |
| 1133 | 3300048091 | Ga0495626_0090500 | Ga0495626_0090500_327_656 | 109 |
| 1134 | 3300048091 | Ga0495626_0103613 | Ga0495626_0103613_361_690 | 109 |
| 1135 | 3300048091 | Ga0495626_0136738 | Ga0495626_0136738_59_388 | 109 |
| 1136 | 3300048905 | Ga0496102_0001186 | Ga0496102_0001186_19441_19770 | 109 |
| 1137 | 3300048906 | Ga0496103_0017077 | Ga0496103_0017077_91_420 | 109 |
| 1138 | 3300048913 | Ga0496110_0329391 | Ga0496110_0329391_275_604 | 109 |
| 1139 | 3300048913 | Ga0496110_1010618 | Ga0496110_1010618_388_717 | 109 |
| 1140 | 3300048919 | Ga0496116_0001251 | Ga0496116_0001251_23820_24149 | 109 |
| 1141 | 3300048919 | Ga0496116_0071203 | Ga0496116_0071203_1311_1640 | 109 |
| 1142 | 3300048920 | Ga0496117_0074046 | Ga0496117_0074046_1349_1678 | 109 |
| 1143 | 3300048921 | Ga0496118_0081141 | Ga0496118_0081141_635_964 | 109 |
| 1144 | 3300048921 | Ga0496118_0109579 | Ga0496118_0109579_1431_1760 | 109 |
| 1145 | 3300048924 | Ga0496121_0031430 | Ga0496121_0031430_4056_4385 | 109 |
| 1146 | 3300048928 | Ga0496125_0023336 | Ga0496125_0023336_1050_1379 | 109 |
| 1147 | 3300048928 | Ga0496125_0110319 | Ga0496125_0110319_1567_1896 | 109 |
| 1148 | 3300048929 | Ga0496126_0115154 | Ga0496126_0115154_1295_1624 | 109 |
| 1149 | 3300049459 | Ga0495678_002222 | Ga0495678_002222_9150_9479 | 109 |
| 1150 | 3300049459 | Ga0495678_004142 | Ga0495678_004142_2079_2408 | 109 |
| 1151 | 3300049459 | Ga0495678_004588 | Ga0495678_004588_5476_5805 | 109 |
| 1152 | 3300049459 | Ga0495678_009174 | Ga0495678_009174_589_918 | 109 |
| 1153 | 3300049459 | Ga0495678_025348 | Ga0495678_025348_1086_1415 | 109 |
| 1154 | 3300049459 | Ga0495678_049667 | Ga0495678_049667_700_1029 | 109 |
| 1155 | 3300049459 | Ga0495678_055955 | Ga0495678_055955_103_432 | 109 |
| 1156 | 3300049459 | Ga0495678_082907 | Ga0495678_082907_558_887 | 109 |
| 1157 | 3300049459 | Ga0495678_086446 | Ga0495678_086446_619_948 | 109 |
| 1158 | 3300049460 | Ga0495682_0002905 | Ga0495682_0002905_1415_1744 | 109 |
| 1159 | 3300049460 | Ga0495682_0022350 | Ga0495682_0022350_32_361 | 109 |
| 1160 | 3300049460 | Ga0495682_0054116 | Ga0495682_0054116_112_441 | 109 |
| 1161 | 3300049460 | Ga0495682_0055347 | Ga0495682_0055347_38_367 | 109 |
| 1162 | 3300049460 | Ga0495682_0228804 | Ga0495682_0228804_84_413 | 109 |
| 1163 | 3300049530 | Ga0501314_045998 | Ga0501314_045998_177_506 | 109 |
| 1164 | 3300049662 | Ga0501222_068915 | Ga0501222_068915_181_510 | 109 |
| 1165 | 3300049665 | Ga0501227_060804 | Ga0501227_060804_53_382 | 109 |
| 1166 | 3300049758 | Ga0501241_005745 | Ga0501241_005745_1358_1687 | 109 |
| 1167 | 3300049853 | Ga0501226_000005 | Ga0501226_000005_114255_114584 | 109 |
| 1168 | 3300050491 | nmdc:mga00v17_67392_c1 | nmdc:mga00v17_67392_c1_686_1015 | 109 |
| 1169 | 3300053098 | Ga0500650_0478805 | Ga0500650_0478805_182_511 | 109 |
| 1170 | 3300053111 | Ga0500572_001316 | Ga0500572_001316_5251_5580 | 109 |
| 1171 | 3300053126 | Ga0500621_100282 | Ga0500621_100282_193_522 | 109 |
| 1172 | 3300053142 | Ga0500577_0070427 | Ga0500577_0070427_681_1010 | 109 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar