F491193

General Info

Members Datasets Scaffolds Average Seq Length
1172 494 956 108

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|640427133|640488693
Length 114
Sequence ALMRSSMSERNPIPLILTAIGSVVGTVAVLSYYGYLHIAKPEDALLLADYTMLKTVPGEDYRVSLQPASQVAQCIDGVLVLFDTEQKGLTGVLVDNKKRAVRCMEEPVPGGLLR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231016 Pseudomonas sp. GM50 Isolate Nodule
9 2511231018 Pseudomonas sp. GM60 Isolate Nodule
10 2511231019 Pseudomonas sp. GM67 Isolate Nodule
11 2511231021 Pseudomonas sp. GM78 Isolate Nodule
12 2511231022 Pseudomonas sp. GM79 Isolate Nodule
13 2511231023 Pseudomonas sp. GM80 Isolate Nodule
14 2511231024 Pseudomonas sp. GM84 Isolate Nodule
15 2511231031 Pseudomonas sp. GM16 Isolate Nodule
16 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
17 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
18 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
19 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
20 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
21 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
22 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
23 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
24 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
25 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
26 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
27 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
28 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
29 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
30 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
31 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
32 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
33 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
34 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
35 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
36 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
37 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
38 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
39 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
40 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
41 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
42 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
43 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
44 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
45 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
46 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
47 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
48 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
49 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
50 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
51 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
52 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
53 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
54 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
55 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
56 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
57 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
58 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
59 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
60 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
61 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
62 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
63 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
64 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
65 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
66 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
67 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
68 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
69 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
70 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
71 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
72 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
73 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
74 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
75 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
76 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
77 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
78 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
79 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
80 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
81 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
82 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
83 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
84 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
85 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
86 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
87 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
88 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
89 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
90 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
91 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
92 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
93 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
94 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
95 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
96 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
97 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
98 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
99 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
100 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
101 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
102 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
103 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
104 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
105 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
106 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
107 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
108 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
109 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
110 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
111 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
112 2765235841 Pseudomonas putida AA7 Isolate Unclassified
113 2773857670 Pseudomonas sp. 478 Isolate Unclassified
114 2773857673 Pseudomonas sp. 443 Isolate Unclassified
115 2784132063 Pseudomonas sp. 424 Isolate Unclassified
116 2784132072 Pseudomonas sp. 460 Isolate Unclassified
117 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
118 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
119 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
120 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
121 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
122 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
123 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
124 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
125 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
126 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
127 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
128 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
129 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
130 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
131 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
132 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
133 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
134 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
135 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
136 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
137 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
138 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
139 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
140 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
141 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
142 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
143 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
144 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
145 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
146 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
147 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
148 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
149 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
150 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
151 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
152 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
153 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
154 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
155 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
156 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
157 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
158 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
159 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
160 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
161 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
162 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
163 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
164 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
165 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
166 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
167 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
168 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
169 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
170 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
171 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
172 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
173 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
174 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
175 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
176 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
177 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
178 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
179 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
180 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
181 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
182 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
183 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
184 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
185 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
186 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
187 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
188 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
189 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
190 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
191 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
192 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
193 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
194 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
195 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
196 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
197 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
198 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
199 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
200 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
201 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
202 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
203 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
204 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
205 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
206 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
207 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
208 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
209 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
210 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
211 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
212 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
213 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
214 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
215 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
216 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
217 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
218 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
219 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
220 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
221 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
222 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
223 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
224 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
225 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
226 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
227 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
228 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
229 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
230 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
231 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
232 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
233 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
234 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
235 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
236 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
237 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
238 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
239 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
240 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
241 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
242 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
243 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
244 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
245 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
246 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
247 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
248 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
249 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
250 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
251 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
252 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
253 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
254 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
255 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
256 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
257 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
258 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
259 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
265 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
266 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
268 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
270 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
271 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
290 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
298 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
301 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
303 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
304 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
305 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
306 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
307 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
308 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
309 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
310 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
311 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
312 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
313 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
314 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
315 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
316 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
317 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
318 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
319 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
320 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
321 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
322 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
323 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
324 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
325 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
326 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
327 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
328 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
329 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
330 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
331 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
332 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
333 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
334 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
335 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
336 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
337 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
338 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
339 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
340 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
341 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
342 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
343 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
344 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
345 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
346 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
347 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
348 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
349 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
350 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
351 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
352 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
353 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
354 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
355 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
356 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
357 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
358 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
359 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
360 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
361 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
362 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
363 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
364 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
365 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
366 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
367 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
368 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
369 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
370 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
371 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
372 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
373 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
374 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
375 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
376 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
377 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
378 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
379 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
380 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
381 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
382 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
383 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
384 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
385 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
386 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
387 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
388 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
389 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
390 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
391 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
392 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
393 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
394 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
395 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
396 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
397 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
398 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
399 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
400 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
401 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
402 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
403 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
404 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
405 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
406 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
407 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
408 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
409 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
410 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
411 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
412 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
413 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
414 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
415 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
416 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
417 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
418 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
419 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
420 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
421 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
422 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
423 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
424 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
425 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
426 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
427 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
428 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
429 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
430 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
431 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
432 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
433 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
434 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
435 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
436 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
437 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
438 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
439 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
440 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
441 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
442 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
443 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
444 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
445 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
446 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
450 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
451 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
452 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
453 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
454 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
455 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
460 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
461 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
462 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
464 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
465 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
466 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
467 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
468 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
469 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
470 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
471 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
472 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
473 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
474 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
475 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
476 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
477 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
478 8052494512 Pseudomonas putida LD6 Isolate Unclassified
479 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
480 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
481 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
482 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
483 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
484 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
485 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
486 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
487 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
488 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
489 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
490 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
491 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
492 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
493 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
494 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.48
Metatranscriptomes 0.09
Isolates 18.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.03
Nodule 1.88
Rhizoplane 6.31
Rhizosphere 74.66
Stem 0
Stem Tuber 0
Unclassified 12.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_74 2124908027 Bacteria 32492
2 JGI24741J21665_1015229 3300001915 Bacteria 1272
3 JGI25156J39149_1022724 3300002705 Bacteria 1060
4 JGI25162J39368_1000103 3300002737 Bacteria 93730
5 JGI25154J39366_1003627 3300002738 Bacteria 3152
6 JGI25163J39215_1000809 3300002771 Bacteria 7533
7 JGI25164J39214_1000082 3300002772 Bacteria 93730
8 JGI25165J46597_1000185 3300003214 Bacteria 93730
9 Ga0055538_1000073 3300003751 Bacteria 90843
10 Ga0055539_1000109 3300003752 Bacteria 90843
11 Ga0055533_1000117 3300003756 Bacteria 90843
12 Ga0055532_1000120 3300003758 Bacteria 81088
13 Ga0055525_1000156 3300003759 Bacteria 90843
14 Ga0055535_1005421 3300003761 Bacteria 2802
15 Ga0055536_1000331 3300003781 Bacteria 34950
16 Ga0055536_1000454 3300003781 Bacteria 28777
17 Ga0055536_1005665 3300003781 Bacteria 6042
18 Ga0055536_1045992 3300003781 Bacteria 995
19 Ga0055534_1046413 3300003784 Bacteria 626
20 Ga0055530_10000176 3300003791 Bacteria 58667
21 Ga0055530_10000351 3300003791 Bacteria 41661
22 Ga0055530_10000511 3300003791 Bacteria 33798
23 Ga0055530_10001302 3300003791 Bacteria 18793
24 Ga0055540_1000193 3300003792 Bacteria 58670
25 Ga0055540_1000385 3300003792 Bacteria 36787
26 Ga0055540_1005860 3300003792 Bacteria 5033
27 Ga0055531_10001143 3300003794 Bacteria 20543
28 Ga0055531_10001439 3300003794 Bacteria 17565
29 Ga0055531_10114007 3300003794 Bacteria 536
30 Ga0055541_1000074 3300003841 Bacteria 90843
31 Ga0058692_1032544 3300003856 Bacteria 973
32 Ga0065714_10001142 3300005288 Bacteria 1468
33 Ga0065714_10003823 3300005288 Bacteria 7961
34 Ga0065714_10011520 3300005288 Bacteria 2675
35 Ga0065714_10011532 3300005288 Bacteria 2179
36 Ga0065714_10067449 3300005288 Bacteria 5504
37 Ga0065714_10068084 3300005288 Bacteria 4981
38 Ga0065714_10071416 3300005288 Bacteria 3584
39 Ga0065714_10072965 3300005288 Bacteria 3267
40 Ga0065714_10115407 3300005288 Bacteria 1416
41 Ga0065714_10290460 3300005288 Bacteria 709
42 Ga0065714_10342080 3300005288 Bacteria 644
43 Ga0065704_10081940 3300005289 Bacteria 3679
44 Ga0065704_10083727 3300005289 Bacteria 3426
45 Ga0065704_10100411 3300005289 Bacteria 2274
46 Ga0065704_10122646 3300005289 Bacteria 1738
47 Ga0065712_10002535 3300005290 Bacteria 5757
48 Ga0065712_10068159 3300005290 Bacteria 13672
49 Ga0065712_10071669 3300005290 Bacteria 5121
50 Ga0065715_10143679 3300005293 Bacteria 1817
51 Ga0070670_100000780 3300005331 Bacteria 24782
52 Ga0070670_100011171 3300005331 Bacteria 7674
53 Ga0070669_100004365 3300005353 Bacteria 10208
54 Ga0070669_100465722 3300005353 Bacteria 1044
55 Ga0070674_101547987 3300005356 Bacteria 597
56 Ga0070662_100000301 3300005457 Bacteria 29323
57 Ga0070662_100026557 3300005457 Bacteria 4011
58 Ga0068853_100006538 3300005539 Bacteria 9279
59 Ga0070665_100035692 3300005548 Bacteria 5000
60 Ga0070665_100432236 3300005548 Bacteria 1325
61 Ga0070664_100221778 3300005564 Bacteria 1692
62 Ga0068854_100003695 3300005578 Bacteria 9572
63 Ga0068851_10000037 3300005834 Bacteria 97386
64 Ga0075364_10150505 3300006051 Bacteria 1568
65 Ga0075364_10171938 3300006051 Bacteria 1465
66 Ga0075432_10002236 3300006058 Bacteria 6442
67 Ga0075432_10002301 3300006058 Bacteria 6364
68 Ga0075432_10004206 3300006058 Bacteria 4899
69 Ga0075432_10006320 3300006058 Bacteria 4028
70 Ga0075432_10024162 3300006058 Bacteria 2082
71 Ga0075432_10175545 3300006058 Bacteria 836
72 Ga0075362_10233936 3300006177 Bacteria 900
73 Ga0075362_10276515 3300006177 Bacteria 830
74 Ga0075362_10581420 3300006177 Bacteria 578
75 Ga0075369_10005197 3300006186 Bacteria 4848
76 Ga0075436_100042714 3300006914 Bacteria 3127
77 Ga0075436_100187212 3300006914 Bacteria 1464
78 Ga0079104_1000414 3300006946 Bacteria 49214
79 Ga0079104_1119063 3300006946 Bacteria 518
80 Ga0099826_10023577 3300006948 Bacteria 4584
81 Ga0105251_10000061 3300009011 Bacteria 102789
82 Ga0105251_10001136 3300009011 Bacteria 23150
83 Ga0105251_10003445 3300009011 Bacteria 11479
84 Ga0105251_10004028 3300009011 Bacteria 10356
85 Ga0105251_10007385 3300009011 Bacteria 6786
86 Ga0105251_10009942 3300009011 Bacteria 5567
87 Ga0105251_10010616 3300009011 Bacteria 5324
88 Ga0105251_10029477 3300009011 Bacteria 2764
89 Ga0105251_10033357 3300009011 Bacteria 2557
90 Ga0105251_10087819 3300009011 Bacteria 1431
91 Ga0105251_10098651 3300009011 Bacteria 1336
92 Ga0105251_10139833 3300009011 Bacteria 1096
93 Ga0105251_10190125 3300009011 Bacteria 925
94 Ga0105251_10336684 3300009011 Bacteria 687
95 Ga0105251_10408974 3300009011 Bacteria 625
96 Ga0105244_10000272 3300009036 Bacteria 52218
97 Ga0105244_10008012 3300009036 Bacteria 6647
98 Ga0105244_10011554 3300009036 Bacteria 5280
99 Ga0105244_10021963 3300009036 Bacteria 3518
100 Ga0105244_10077072 3300009036 Bacteria 1654
101 Ga0105244_10094795 3300009036 Bacteria 1465
102 Ga0105244_10117921 3300009036 Bacteria 1287
103 Ga0105244_10171466 3300009036 Bacteria 1032
104 Ga0105244_10282450 3300009036 Bacteria 770
105 Ga0105250_10000299 3300009092 Bacteria 39028
106 Ga0105250_10000332 3300009092 Bacteria 36415
107 Ga0105250_10005536 3300009092 Bacteria 5651
108 Ga0105250_10009461 3300009092 Bacteria 4100
109 Ga0105250_10023392 3300009092 Bacteria 2488
110 Ga0105250_10075742 3300009092 Bacteria 1361
111 Ga0105250_10096498 3300009092 Bacteria 1205
112 Ga0105250_10226003 3300009092 Bacteria 795
113 Ga0105243_10045025 3300009148 Bacteria 3465
114 Ga0105243_10049392 3300009148 Bacteria 3319
115 Ga0105243_10051884 3300009148 Bacteria 3246
116 Ga0105243_10096623 3300009148 Bacteria 2444
117 Ga0105243_10195715 3300009148 Bacteria 1769
118 Ga0105242_10184150 3300009176 Bacteria 1844
119 Ga0105248_10134319 3300009177 Bacteria 2792
120 Ga0105237_10137591 3300009545 Bacteria 2437
121 Ga0105249_13092582 3300009553 Bacteria 534
122 Ga0105246_10002077 3300011119 Bacteria 12065
123 Ga0105246_10005375 3300011119 Bacteria 7797
124 Ga0105246_10196123 3300011119 Bacteria 1566
125 Ga0105246_10628915 3300011119 Bacteria 931
126 Ga0157345_1000166 3300012498 Bacteria 10979
127 Ga0157347_1019611 3300012502 Bacteria 782
128 Ga0157373_10001582 3300013100 Bacteria 17385
129 Ga0157373_10006202 3300013100 Bacteria 8933
130 Ga0157373_10021840 3300013100 Bacteria 4644
131 Ga0157373_10033665 3300013100 Bacteria 3685
132 Ga0157373_10053157 3300013100 Bacteria 2880
133 Ga0157373_10150030 3300013100 Bacteria 1640
134 Ga0157373_10169447 3300013100 Bacteria 1536
135 Ga0157373_10180475 3300013100 Bacteria 1486
136 Ga0157373_10879230 3300013100 Bacteria 664
137 Ga0157371_10006271 3300013102 Bacteria 9850
138 Ga0157371_10011479 3300013102 Bacteria 6816
139 Ga0157371_10016205 3300013102 Bacteria 5568
140 Ga0157371_10057216 3300013102 Bacteria 2765
141 Ga0157371_10065540 3300013102 Bacteria 2572
142 Ga0157371_10352185 3300013102 Bacteria 1072
143 Ga0157370_10000846 3300013104 Bacteria 38839
144 Ga0157370_10056348 3300013104 Bacteria 3741
145 Ga0157370_10084574 3300013104 Bacteria 2982
146 Ga0157370_10090355 3300013104 Bacteria 2876
147 Ga0157370_10102773 3300013104 Bacteria 2675
148 Ga0157370_10153170 3300013104 Bacteria 2145
149 Ga0157370_10330107 3300013104 Bacteria 1407
150 Ga0157370_10807467 3300013104 Bacteria 853
151 Ga0157370_11325773 3300013104 Bacteria 648
152 Ga0157370_11728320 3300013104 Bacteria 562
153 Ga0157369_10015829 3300013105 Bacteria 8495
154 Ga0157369_10017783 3300013105 Bacteria 7982
155 Ga0157369_10079337 3300013105 Bacteria 3516
156 Ga0157369_10246969 3300013105 Bacteria 1863
157 Ga0157369_10347004 3300013105 Bacteria 1542
158 Ga0157369_10428520 3300013105 Bacteria 1371
159 Ga0157369_10828348 3300013105 Bacteria 950
160 Ga0157369_11267519 3300013105 Bacteria 752
161 Ga0163162_10012886 3300013306 Bacteria 8165
162 Ga0163162_10062388 3300013306 Bacteria 3767
163 Ga0163162_10097608 3300013306 Bacteria 3027
164 Ga0163162_10957033 3300013306 Bacteria 967
165 Ga0163162_11096331 3300013306 Bacteria 902
166 Ga0163162_12441669 3300013306 Bacteria 601
167 Ga0157372_10001549 3300013307 Bacteria 25023
168 Ga0157372_10004137 3300013307 Bacteria 15535
169 Ga0157375_11290937 3300013308 Bacteria 858
170 Ga0157375_11951224 3300013308 Bacteria 697
171 Ga0182008_10005701 3300014497 Bacteria 7050
172 Ga0182008_10008549 3300014497 Bacteria 5587
173 Ga0182008_10018278 3300014497 Bacteria 3630
174 Ga0182008_10021905 3300014497 Bacteria 3278
175 Ga0182008_10047996 3300014497 Bacteria 2121
176 Ga0182008_10055715 3300014497 Bacteria 1954
177 Ga0182008_10107940 3300014497 Bacteria 1378
178 Ga0182008_10483638 3300014497 Bacteria 678
179 Ga0182006_1000640 3300015261 Bacteria 24816
180 Ga0182006_1001009 3300015261 Bacteria 18405
181 Ga0182006_1012798 3300015261 Bacteria 3661
182 Ga0182006_1030050 3300015261 Bacteria 2199
183 Ga0182006_1041913 3300015261 Bacteria 1796
184 Ga0182006_1057651 3300015261 Bacteria 1476
185 Ga0182007_10004583 3300015262 Bacteria 6244
186 Ga0182007_10019086 3300015262 Bacteria 2471
187 Ga0182005_1002382 3300015265 Bacteria 6765
188 Ga0182005_1011517 3300015265 Bacteria 2518
189 Ga0182005_1030291 3300015265 Bacteria 1474
190 Ga0182005_1107175 3300015265 Bacteria 787
191 Ga0182005_1134649 3300015265 Bacteria 710
192 Ga0163161_10003732 3300017792 Bacteria 10669
193 Ga0163161_10013993 3300017792 Bacteria 5587
194 Ga0163161_10021713 3300017792 Bacteria 4513
195 Ga0163161_10036807 3300017792 Bacteria 3506
196 Ga0163161_10053950 3300017792 Bacteria 2916
197 Ga0163161_10210632 3300017792 Bacteria 1501
198 Ga0163161_10352640 3300017792 Bacteria 1170
199 Ga0209435_100487 3300025206 Bacteria 7849
200 Ga0209760_100194 3300025207 Bacteria 29472
201 Ga0209784_100015 3300025224 Bacteria 482117
202 Ga0209566_100012 3300025225 Bacteria 482281
203 Ga0209674_100027 3300025226 Bacteria 482281
204 Ga0209147_100019 3300025229 Bacteria 482139
205 Ga0209563_100031 3300025230 Bacteria 482281
206 Ga0207427_100038 3300025231 Bacteria 292975
207 Ga0209437_100009 3300025233 Bacteria 915954
208 Ga0209437_106571 3300025233 Bacteria 1930
209 Ga0209258_100296 3300025242 Bacteria 81403
210 Ga0209646_1000292 3300025246 Bacteria 42484
211 Ga0209677_100016 3300025253 Bacteria 482117
212 Ga0209759_1004305 3300025256 Bacteria 5354
213 Ga0209759_1005302 3300025256 Bacteria 4557
214 Ga0209233_1000074 3300025261 Bacteria 357367
215 Ga0209676_1000056 3300025292 Bacteria 361329
216 Ga0209676_1000503 3300025292 Bacteria 61955
217 Ga0209676_1000524 3300025292 Bacteria 60019
218 Ga0209676_1007863 3300025292 Bacteria 4898
219 Ga0209050_1000060 3300025298 Bacteria 321699
220 Ga0209050_1000361 3300025298 Bacteria 87075
221 Ga0209051_1000037 3300025303 Bacteria 321747
222 Ga0209051_1000061 3300025303 Bacteria 253485
223 Ga0209257_1008780 3300025304 Bacteria 5616
224 Ga0207656_10000014 3300025321 Bacteria 146941
225 Ga0207696_1000034 3300025711 Bacteria 350426
226 Ga0207696_1000293 3300025711 Bacteria 58344
227 Ga0207696_1002462 3300025711 Bacteria 9054
228 Ga0207696_1002498 3300025711 Bacteria 8984
229 Ga0207696_1005740 3300025711 Bacteria 5102
230 Ga0207696_1038649 3300025711 Bacteria 1408
231 Ga0207696_1049493 3300025711 Bacteria 1205
232 Ga0207696_1129935 3300025711 Bacteria 677
233 Ga0207696_1134603 3300025711 Bacteria 663
234 Ga0207655_1000005 3300025728 Bacteria 917277
235 Ga0207655_1000015 3300025728 Bacteria 600662
236 Ga0207655_1002284 3300025728 Bacteria 15777
237 Ga0207655_1003175 3300025728 Bacteria 12403
238 Ga0207655_1006185 3300025728 Bacteria 7976
239 Ga0207655_1007329 3300025728 Bacteria 7168
240 Ga0207655_1031840 3300025728 Bacteria 2421
241 Ga0207655_1084598 3300025728 Bacteria 1134
242 Ga0207655_1108755 3300025728 Bacteria 940
243 Ga0207655_1144367 3300025728 Bacteria 760
244 Ga0207713_1000014 3300025735 Bacteria 432450
245 Ga0207713_1000493 3300025735 Bacteria 40740
246 Ga0207713_1000696 3300025735 Bacteria 31509
247 Ga0207713_1007669 3300025735 Bacteria 6317
248 Ga0207713_1007824 3300025735 Bacteria 6234
249 Ga0207713_1022834 3300025735 Bacteria 2958
250 Ga0207713_1030419 3300025735 Bacteria 2404
251 Ga0207713_1037519 3300025735 Bacteria 2065
252 Ga0207713_1055157 3300025735 Bacteria 1553
253 Ga0207713_1104000 3300025735 Bacteria 975
254 Ga0207713_1121328 3300025735 Bacteria 876
255 Ga0207713_1127585 3300025735 Bacteria 846
256 Ga0207713_1146769 3300025735 Bacteria 765
257 Ga0207671_10000019 3300025914 Bacteria 317781
258 Ga0207671_10108147 3300025914 Bacteria 2113
259 Ga0207649_10000002 3300025920 Bacteria 498633
260 Ga0207681_10002090 3300025923 Bacteria 12799
261 Ga0207650_10000337 3300025925 Bacteria 45511
262 Ga0207650_10000421 3300025925 Bacteria 37575
263 Ga0207706_10000136 3300025933 Bacteria 79887
264 Ga0207686_10005889 3300025934 Bacteria 6581
265 Ga0207686_10114636 3300025934 Bacteria 1824
266 Ga0207709_10022130 3300025935 Bacteria 3604
267 Ga0207709_10116462 3300025935 Bacteria 1797
268 Ga0207709_10212157 3300025935 Bacteria 1390
269 Ga0207709_10426065 3300025935 Bacteria 1020
270 Ga0207679_10000006 3300025945 Bacteria 498868
271 Ga0207679_10251297 3300025945 Bacteria 1503
272 Ga0207640_10342229 3300025981 Bacteria 1198
273 Ga0207639_10004918 3300026041 Bacteria 9002
274 Ga0209281_1000010 3300027111 Bacteria 726106
275 Ga0209281_1003222 3300027111 Bacteria 5565
276 Ga0209281_1008557 3300027111 Bacteria 2472
277 Ga0209371_1000095 3300027312 Bacteria 166175
278 Ga0209371_1000414 3300027312 Bacteria 44059
279 Ga0209371_1034274 3300027312 Bacteria 1077
280 Ga0209969_1002749 3300027360 Bacteria 2438
281 Ga0209996_1014712 3300027395 Bacteria 1064
282 Ga0209995_1046387 3300027471 Bacteria 736
283 Ga0209968_1002552 3300027526 Bacteria 2745
284 Ga0209970_1006052 3300027614 Bacteria 1986
285 Ga0209983_1001283 3300027665 Bacteria 5595
286 Ga0209282_1053449 3300027666 Bacteria 2299
287 Ga0209971_1003202 3300027682 Bacteria 3901
288 Ga0209974_10017015 3300027876 Bacteria 2412
289 Ga0209974_10147495 3300027876 Bacteria 847
290 Ga0207428_10115665 3300027907 Bacteria 2060
291 Ga0207428_10464313 3300027907 Bacteria 922
292 Ga0207428_11008923 3300027907 Bacteria 585
293 Ga0268266_10035410 3300028379 Bacteria 4246
294 Ga0268266_10489311 3300028379 Bacteria 1173
295 Ga0307517_10330548 3300028786 Bacteria 838
296 Ga0268256_1000116 3300030500 Bacteria 115451
297 Ga0268256_1000355 3300030500 Bacteria 44059
298 Ga0268256_1038965 3300030500 Bacteria 1077
299 Ga0307511_10095374 3300030521 Bacteria 1988
300 Ga0307511_10165516 3300030521 Bacteria 1229
301 Ga0316177_1109772 3300030731 Bacteria 1988
302 Ga0314311_1132065 3300030733 Bacteria 2392
303 Ga0316179_1069901 3300030734 Bacteria 807
304 Ga0316179_1072406 3300030734 Bacteria 590
305 Ga0316178_1083052 3300030735 Bacteria 21791
306 Ga0316183_1110648 3300030742 Bacteria 1429
307 Ga0316181_1073709 3300030744 Bacteria 4264
308 Ga0316181_1229307 3300030744 Bacteria 2009
309 Ga0307408_100000090 3300031548 Bacteria 100442
310 Ga0307408_100001820 3300031548 Bacteria 15531
311 Ga0307408_100012631 3300031548 Bacteria 5600
312 Ga0307408_100033101 3300031548 Bacteria 3608
313 Ga0307408_100043394 3300031548 Bacteria 3199
314 Ga0307408_100091057 3300031548 Bacteria 2302
315 Ga0307408_100304403 3300031548 Bacteria 1336
316 Ga0307516_10165237 3300031730 Bacteria 1959
317 Ga0307405_10000600 3300031731 Bacteria 13836
318 Ga0307405_10002971 3300031731 Bacteria 7661
319 Ga0307405_10816712 3300031731 Bacteria 782
320 Ga0307413_10030392 3300031824 Bacteria 3034
321 Ga0307413_10035507 3300031824 Bacteria 2860
322 Ga0307406_10404673 3300031901 Bacteria 1083
323 Ga0307406_11599635 3300031901 Bacteria 575
324 Ga0307407_10394198 3300031903 Bacteria 991
325 Ga0307407_11584211 3300031903 Bacteria 519
326 Ga0307412_10001424 3300031911 Bacteria 13333
327 Ga0307412_10005406 3300031911 Bacteria 7168
328 Ga0307412_10005742 3300031911 Bacteria 6975
329 Ga0307412_10016716 3300031911 Bacteria 4376
330 Ga0307412_10028909 3300031911 Bacteria 3474
331 Ga0307412_10334663 3300031911 Bacteria 1209
332 Ga0307412_10549823 3300031911 Bacteria 969
333 Ga0307412_12100073 3300031911 Bacteria 524
334 Ga0307409_100044538 3300031995 Bacteria 3343
335 Ga0307416_100204640 3300032002 Bacteria 1876
336 Ga0307416_100478207 3300032002 Bacteria 1305
337 Ga0307414_10024653 3300032004 Bacteria 3840
338 Ga0307414_10108449 3300032004 Bacteria 2106
339 Ga0307414_10215889 3300032004 Bacteria 1571
340 Ga0307414_10225755 3300032004 Bacteria 1540
341 Ga0307414_10399640 3300032004 Bacteria 1193
342 Ga0307414_10470843 3300032004 Bacteria 1106
343 Ga0307414_11274515 3300032004 Bacteria 681
344 Ga0307411_10028832 3300032005 Bacteria 3380
345 Ga0307411_10098638 3300032005 Bacteria 2059
346 Ga0307411_11721935 3300032005 Bacteria 580
347 Ga0307510_10001784 3300033180 Bacteria 24023
348 Ga0439436_0001968 3300041404 Bacteria 6087
349 Ga0439438_001691 3300041405 Bacteria 9708
350 Ga0439438_001751 3300041405 Bacteria 9541
351 Ga0439438_001896 3300041405 Bacteria 9156
352 Ga0439438_005214 3300041405 Bacteria 4822
353 Ga0439438_006476 3300041405 Bacteria 4121
354 Ga0439438_010012 3300041405 Bacteria 3030
355 Ga0439438_012538 3300041405 Bacteria 2596
356 Ga0439438_014142 3300041405 Bacteria 2382
357 Ga0439438_018677 3300041405 Bacteria 1970
358 Ga0439447_001121 3300041407 Bacteria 9734
359 Ga0439447_001710 3300041407 Bacteria 8057
360 Ga0439447_002220 3300041407 Bacteria 7124
361 Ga0439447_002824 3300041407 Bacteria 6236
362 Ga0439447_007855 3300041407 Bacteria 3346
363 Ga0439447_009508 3300041407 Bacteria 2940
364 Ga0439447_013121 3300041407 Bacteria 2358
365 Ga0439447_040010 3300041407 Bacteria 1145
366 Ga0439453_0017923 3300041408 Bacteria 1248
367 Ga0439461_0072053 3300041410 Bacteria 802
368 Ga0439466_0000163 3300041411 Bacteria 26650
369 Ga0439466_0001747 3300041411 Bacteria 8496
370 Ga0439466_0004531 3300041411 Bacteria 5336
371 Ga0439466_0005958 3300041411 Bacteria 4639
372 Ga0439466_0012003 3300041411 Bacteria 3200
373 Ga0439466_0015802 3300041411 Bacteria 2738
374 Ga0439466_0020529 3300041411 Bacteria 2352
375 Ga0439466_0020615 3300041411 Bacteria 2347
376 Ga0439466_0022787 3300041411 Bacteria 2207
377 Ga0439466_0091343 3300041411 Bacteria 954
378 Ga0439465_0013128 3300041413 Bacteria 2586
379 Ga0451847_0095971 3300041503 Bacteria 677
380 Ga0451843_0170682 3300041509 Bacteria 578
381 Ga0451843_1387418 3300041509 Bacteria 592
382 Ga0439431_0038654 3300041997 Bacteria 1208
383 Ga0439431_0051182 3300041997 Bacteria 1071
384 Ga0439431_0071673 3300041997 Bacteria 924
385 Ga0439437_000171 3300042000 Bacteria 5511
386 Ga0439432_000131 3300042006 Bacteria 24949
387 Ga0439432_002819 3300042006 Bacteria 6481
388 Ga0439432_006745 3300042006 Bacteria 4089
389 Ga0439432_006900 3300042006 Bacteria 4042
390 Ga0439432_013630 3300042006 Bacteria 2762
391 Ga0439432_090129 3300042006 Bacteria 923
392 Ga0439451_015770 3300042009 Bacteria 1523
393 Ga0439451_021244 3300042009 Bacteria 1309
394 Ga0439451_022951 3300042009 Bacteria 1257
395 Ga0439451_046689 3300042009 Bacteria 867
396 Ga0439451_048987 3300042009 Bacteria 845
397 Ga0439452_000207 3300042010 Bacteria 42410
398 Ga0439452_001453 3300042010 Bacteria 9676
399 Ga0439452_003681 3300042010 Bacteria 5306
400 Ga0439452_005021 3300042010 Bacteria 4327
401 Ga0439452_005870 3300042010 Bacteria 3908
402 Ga0439455_0002951 3300042012 Bacteria 3187
403 Ga0439456_000074 3300042013 Bacteria 35473
404 Ga0439456_001007 3300042013 Bacteria 5598
405 Ga0439456_013066 3300042013 Bacteria 1725
406 Ga0439456_057998 3300042013 Bacteria 849
407 Ga0439463_000931 3300042016 Bacteria 8030
408 Ga0439463_003800 3300042016 Bacteria 3807
409 Ga0439463_017076 3300042016 Bacteria 1797
410 Ga0439463_025820 3300042016 Bacteria 1474
411 Ga0439463_052478 3300042016 Bacteria 1040
412 Ga0450911_000204 3300042115 Bacteria 23320
413 Ga0450911_001533 3300042115 Bacteria 5244
414 Ga0450911_001690 3300042115 Bacteria 4873
415 Ga0450911_019593 3300042115 Bacteria 886
416 Ga0450911_022817 3300042115 Bacteria 814
417 Ga0450913_008618 3300042117 Bacteria 788
418 Ga0450919_000714 3300042121 Bacteria 4186
419 Ga0450919_001291 3300042121 Bacteria 3276
420 Ga0450919_024943 3300042121 Bacteria 678
421 Ga0450920_008400 3300042122 Bacteria 1887
422 Ga0450922_000147 3300042124 Bacteria 7412
423 Ga0450890_001456 3300042127 Bacteria 3401
424 Ga0450898_008349 3300042134 Bacteria 1633
425 Ga0450899_013446 3300042135 Bacteria 924
426 Ga0450900_015198 3300042136 Bacteria 1033
427 Ga0450902_000613 3300042137 Bacteria 4521
428 Ga0450902_016728 3300042137 Bacteria 1196
429 Ga0450902_035238 3300042137 Bacteria 846
430 Ga0450903_003177 3300042138 Bacteria 2863
431 Ga0450903_022067 3300042138 Bacteria 982
432 Ga0450903_043155 3300042138 Bacteria 665
433 Ga0450904_000466 3300042139 Bacteria 8021
434 Ga0450904_003311 3300042139 Bacteria 1762
435 Ga0450905_015180 3300042142 Bacteria 1103
436 Ga0450905_088041 3300042142 Bacteria 546
437 Ga0450905_092763 3300042142 Bacteria 535
438 Ga0450906_000358 3300042145 Bacteria 9254
439 Ga0450906_006543 3300042145 Bacteria 2346
440 Ga0450907_000197 3300042146 Bacteria 21929
441 Ga0450907_000424 3300042146 Bacteria 12604
442 Ga0450907_003201 3300042146 Bacteria 2955
443 Ga0450910_000448 3300042147 Bacteria 4872
444 Ga0450910_000974 3300042147 Bacteria 3469
445 Ga0439446_0000313 3300042156 Bacteria 9270
446 Ga0439446_0003304 3300042156 Bacteria 3983
447 Ga0439446_0012156 3300042156 Bacteria 2348
448 Ga0439446_0014964 3300042156 Bacteria 2147
449 Ga0450908_033066 3300042184 Bacteria 896
450 Ga0450909_001937 3300042185 Bacteria 2923
451 Ga0439434_0001659 3300042435 Bacteria 6443
452 Ga0439434_0017329 3300042435 Bacteria 2155
453 Ga0439434_0022457 3300042435 Bacteria 1897
454 Ga0439459_0007181 3300042438 Bacteria 1875
455 Ga0439464_0002872 3300042439 Bacteria 4287
456 Ga0439464_0012530 3300042439 Bacteria 2259
457 Ga0439464_0012958 3300042439 Bacteria 2227
458 Ga0439464_0033449 3300042439 Bacteria 1447
459 Ga0439464_0120884 3300042439 Bacteria 807
460 Ga0439460_0033857 3300042461 Bacteria 1469
461 Ga0439460_0158649 3300042461 Bacteria 757
462 Ga0439460_0271055 3300042461 Bacteria 589
463 Ga0450916_003148 3300042530 Bacteria 1798
464 Ga0450916_046562 3300042530 Bacteria 673
465 Ga0450893_0018953 3300042532 Bacteria 1175
466 Ga0450893_0035470 3300042532 Bacteria 900
467 Ga0450901_007035 3300042533 Bacteria 1158
468 Ga0439440_0002537 3300042993 Bacteria 3457
469 Ga0439440_0004375 3300042993 Bacteria 2772
470 Ga0439440_0010195 3300042993 Bacteria 1959
471 Ga0495617_000127 3300046452 Bacteria 50396
472 Ga0495617_021559 3300046452 Bacteria 2175
473 Ga0495617_039352 3300046452 Bacteria 1581
474 Ga0495617_065203 3300046452 Bacteria 1201
475 Ga0495617_256887 3300046452 Bacteria 537
476 Ga0495627_000074 3300046453 Bacteria 123139
477 Ga0495627_000386 3300046453 Bacteria 40131
478 Ga0495627_000733 3300046453 Bacteria 24765
479 Ga0495627_001977 3300046453 Bacteria 10586
480 Ga0495627_007975 3300046453 Bacteria 4004
481 Ga0495627_013168 3300046453 Bacteria 2914
482 Ga0495603_0079892 3300046455 Bacteria 1917
483 Ga0495603_0138625 3300046455 Bacteria 1415
484 Ga0495590_0006319 3300046457 Bacteria 4636
485 Ga0495590_0090451 3300046457 Bacteria 1082
486 Ga0495591_000351 3300046458 Bacteria 40796
487 Ga0495591_002596 3300046458 Bacteria 9915
488 Ga0495591_004699 3300046458 Bacteria 6555
489 Ga0495591_007840 3300046458 Bacteria 4461
490 Ga0495591_008429 3300046458 Bacteria 4222
491 Ga0495591_009959 3300046458 Bacteria 3729
492 Ga0495591_017008 3300046458 Bacteria 2510
493 Ga0495591_020509 3300046458 Bacteria 2181
494 Ga0495591_062064 3300046458 Bacteria 990
495 Ga0495629_0130214 3300046459 Bacteria 1752
496 Ga0495638_0008766 3300046460 Bacteria 7144
497 Ga0495638_0009529 3300046460 Bacteria 6807
498 Ga0495638_0022186 3300046460 Bacteria 4170
499 Ga0495638_0174564 3300046460 Bacteria 1230
500 Ga0495638_0370003 3300046460 Bacteria 751
501 Ga0495638_0534188 3300046460 Bacteria 585
502 Ga0495653_0023163 3300046463 Bacteria 5021
503 Ga0495653_0028970 3300046463 Bacteria 4425
504 Ga0495653_0119539 3300046463 Bacteria 1880
505 Ga0495653_0154263 3300046463 Bacteria 1601
506 Ga0495653_0346348 3300046463 Bacteria 956
507 Ga0495650_0009577 3300046471 Bacteria 5495
508 Ga0495650_0013923 3300046471 Bacteria 4222
509 Ga0495650_0021060 3300046471 Bacteria 3161
510 Ga0495650_0025032 3300046471 Bacteria 2807
511 Ga0495650_0025111 3300046471 Bacteria 2800
512 Ga0495650_0053515 3300046471 Bacteria 1652
513 Ga0495650_0058133 3300046471 Bacteria 1562
514 Ga0495650_0068133 3300046471 Bacteria 1404
515 Ga0495650_0083417 3300046471 Bacteria 1228
516 Ga0495605_0000182 3300046474 Bacteria 78093
517 Ga0495605_0000362 3300046474 Bacteria 43622
518 Ga0495605_0000543 3300046474 Bacteria 31038
519 Ga0495605_0006153 3300046474 Bacteria 6919
520 Ga0495605_0008292 3300046474 Bacteria 5877
521 Ga0495605_0014838 3300046474 Bacteria 4252
522 Ga0495605_0026615 3300046474 Bacteria 3005
523 Ga0495605_0092019 3300046474 Bacteria 1404
524 Ga0495605_0168874 3300046474 Bacteria 967
525 Ga0495605_0244601 3300046474 Bacteria 769
526 Ga0495584_0003206 3300046491 Bacteria 9104
527 Ga0495584_0006489 3300046491 Bacteria 6116
528 Ga0495584_0011307 3300046491 Bacteria 4571
529 Ga0495584_0012444 3300046491 Bacteria 4343
530 Ga0495584_0017462 3300046491 Bacteria 3652
531 Ga0495584_0029637 3300046491 Bacteria 2774
532 Ga0495584_0036106 3300046491 Bacteria 2496
533 Ga0495584_0052419 3300046491 Bacteria 2053
534 Ga0495585_0007614 3300046492 Bacteria 6615
535 Ga0495585_0008396 3300046492 Bacteria 6261
536 Ga0495585_0011899 3300046492 Bacteria 5138
537 Ga0495585_0019119 3300046492 Bacteria 3953
538 Ga0495585_0022272 3300046492 Bacteria 3637
539 Ga0495585_0034124 3300046492 Bacteria 2876
540 Ga0495585_0048596 3300046492 Bacteria 2358
541 Ga0495585_0054031 3300046492 Bacteria 2221
542 Ga0495585_0077685 3300046492 Bacteria 1802
543 Ga0495594_0000506 3300046499 Bacteria 19879
544 Ga0495594_0060354 3300046499 Bacteria 2097
545 Ga0495596_0037994 3300046500 Bacteria 1903
546 Ga0495596_0077745 3300046500 Bacteria 1288
547 Ga0495607_0000549 3300046501 Bacteria 36677
548 Ga0495607_0000721 3300046501 Bacteria 31777
549 Ga0495607_0001083 3300046501 Bacteria 24864
550 Ga0495607_0001478 3300046501 Bacteria 20905
551 Ga0495607_0012868 3300046501 Bacteria 5503
552 Ga0495607_0015729 3300046501 Bacteria 4896
553 Ga0495607_0018822 3300046501 Bacteria 4392
554 Ga0495607_0027747 3300046501 Bacteria 3497
555 Ga0495607_0068205 3300046501 Bacteria 1995
556 Ga0495607_0092096 3300046501 Bacteria 1640
557 Ga0495607_0097136 3300046501 Bacteria 1585
558 Ga0495607_0170257 3300046501 Bacteria 1100
559 Ga0495607_0236195 3300046501 Bacteria 886
560 Ga0495607_0534086 3300046501 Bacteria 516
561 Ga0495583_0000701 3300046506 Bacteria 43155
562 Ga0495583_0001430 3300046506 Bacteria 24242
563 Ga0495583_0001463 3300046506 Bacteria 23779
564 Ga0495583_0002110 3300046506 Bacteria 17865
565 Ga0495583_0013261 3300046506 Bacteria 4607
566 Ga0495583_0052437 3300046506 Bacteria 1855
567 Ga0495583_0289118 3300046506 Bacteria 652
568 Ga0495606_0000518 3300046507 Bacteria 62348
569 Ga0495606_0008750 3300046507 Bacteria 8702
570 Ga0495606_0015690 3300046507 Bacteria 5819
571 Ga0495606_0016021 3300046507 Bacteria 5740
572 Ga0495606_0053644 3300046507 Bacteria 2615
573 Ga0495606_0086804 3300046507 Bacteria 1932
574 Ga0495606_0132869 3300046507 Bacteria 1477
575 Ga0495606_0209612 3300046507 Bacteria 1104
576 Ga0495606_0233472 3300046507 Bacteria 1029
577 Ga0495610_0006641 3300046512 Bacteria 7894
578 Ga0495610_0011965 3300046512 Bacteria 5259
579 Ga0495610_0013001 3300046512 Bacteria 4972
580 Ga0495610_0026056 3300046512 Bacteria 3127
581 Ga0495610_0050035 3300046512 Bacteria 2042
582 Ga0495610_0054490 3300046512 Bacteria 1932
583 Ga0495610_0062865 3300046512 Bacteria 1760
584 Ga0495610_0118983 3300046512 Bacteria 1160
585 Ga0495610_0263793 3300046512 Bacteria 677
586 Ga0495616_0000823 3300046513 Bacteria 22657
587 Ga0495616_0003782 3300046513 Bacteria 9651
588 Ga0495616_0007448 3300046513 Bacteria 6552
589 Ga0495616_0021398 3300046513 Bacteria 3502
590 Ga0495616_0049557 3300046513 Bacteria 2104
591 Ga0495616_0065241 3300046513 Bacteria 1774
592 Ga0495616_0079097 3300046513 Bacteria 1576
593 Ga0495616_0250496 3300046513 Bacteria 761
594 Ga0495620_0000003 3300046515 Bacteria 345923
595 Ga0495620_0000219 3300046515 Bacteria 43161
596 Ga0495620_0002112 3300046515 Bacteria 11559
597 Ga0495620_0021320 3300046515 Bacteria 3148
598 Ga0495620_0023069 3300046515 Bacteria 2983
599 Ga0495620_0038356 3300046515 Bacteria 2127
600 Ga0495620_0056662 3300046515 Bacteria 1647
601 Ga0495620_0082315 3300046515 Bacteria 1301
602 Ga0495620_0171733 3300046515 Bacteria 840
603 Ga0495630_0186104 3300046517 Bacteria 1584
604 Ga0495631_0001514 3300046518 Bacteria 14016
605 Ga0495631_0002924 3300046518 Bacteria 9463
606 Ga0495631_0007648 3300046518 Bacteria 5488
607 Ga0495631_0088232 3300046518 Bacteria 1335
608 Ga0495632_0000368 3300046519 Bacteria 42948
609 Ga0495632_0001004 3300046519 Bacteria 24462
610 Ga0495632_0001169 3300046519 Bacteria 22351
611 Ga0495632_0003894 3300046519 Bacteria 10373
612 Ga0495632_0004016 3300046519 Bacteria 10165
613 Ga0495632_0006908 3300046519 Bacteria 7212
614 Ga0495632_0009005 3300046519 Bacteria 6054
615 Ga0495632_0009948 3300046519 Bacteria 5680
616 Ga0495632_0015321 3300046519 Bacteria 4304
617 Ga0495632_0022208 3300046519 Bacteria 3403
618 Ga0495632_0053322 3300046519 Bacteria 1986
619 Ga0495632_0065401 3300046519 Bacteria 1756
620 Ga0495632_0066359 3300046519 Bacteria 1741
621 Ga0495632_0127958 3300046519 Bacteria 1183
622 Ga0495632_0522548 3300046519 Bacteria 510
623 Ga0495637_0004413 3300046520 Bacteria 7302
624 Ga0495637_0005233 3300046520 Bacteria 6643
625 Ga0495637_0014398 3300046520 Bacteria 3731
626 Ga0495637_0018333 3300046520 Bacteria 3248
627 Ga0495637_0020873 3300046520 Bacteria 3006
628 Ga0495637_0021522 3300046520 Bacteria 2955
629 Ga0495637_0028969 3300046520 Bacteria 2468
630 Ga0495637_0030890 3300046520 Bacteria 2373
631 Ga0495637_0031897 3300046520 Bacteria 2326
632 Ga0495637_0042927 3300046520 Bacteria 1932
633 Ga0495637_0045825 3300046520 Bacteria 1852
634 Ga0495637_0045923 3300046520 Bacteria 1849
635 Ga0495637_0080271 3300046520 Bacteria 1301
636 Ga0495643_0000116 3300046522 Bacteria 130165
637 Ga0495643_0000890 3300046522 Bacteria 31795
638 Ga0495643_0001490 3300046522 Bacteria 21278
639 Ga0495643_0008981 3300046522 Bacteria 6280
640 Ga0495643_0025313 3300046522 Bacteria 3358
641 Ga0495643_0044794 3300046522 Bacteria 2402
642 Ga0495643_0115631 3300046522 Bacteria 1359
643 Ga0495643_0129424 3300046522 Bacteria 1268
644 Ga0495643_0136079 3300046522 Bacteria 1229
645 Ga0495644_0027732 3300046523 Bacteria 2145
646 Ga0495644_0105512 3300046523 Bacteria 1067
647 Ga0495648_0001113 3300046524 Bacteria 27255
648 Ga0495648_0001580 3300046524 Bacteria 22187
649 Ga0495648_0007222 3300046524 Bacteria 8922
650 Ga0495648_0010337 3300046524 Bacteria 7117
651 Ga0495648_0019892 3300046524 Bacteria 4700
652 Ga0495648_0021013 3300046524 Bacteria 4533
653 Ga0495648_0029271 3300046524 Bacteria 3657
654 Ga0495648_0067596 3300046524 Bacteria 2089
655 Ga0495648_0084387 3300046524 Bacteria 1797
656 Ga0495648_0113600 3300046524 Bacteria 1468
657 Ga0495648_0216408 3300046524 Bacteria 948
658 Ga0495648_0396484 3300046524 Bacteria 618
659 Ga0495666_0036672 3300046526 Bacteria 2387
660 Ga0495666_0045910 3300046526 Bacteria 2106
661 Ga0495666_0047318 3300046526 Bacteria 2071
662 Ga0495642_0000398 3300046528 Bacteria 23371
663 Ga0495642_0105252 3300046528 Bacteria 1203
664 Ga0495654_0000816 3300046530 Bacteria 23764
665 Ga0495654_0001589 3300046530 Bacteria 15411
666 Ga0495654_0008410 3300046530 Bacteria 5702
667 Ga0495654_0008733 3300046530 Bacteria 5582
668 Ga0495654_0011659 3300046530 Bacteria 4748
669 Ga0495654_0013142 3300046530 Bacteria 4433
670 Ga0495654_0013168 3300046530 Bacteria 4430
671 Ga0495654_0027634 3300046530 Bacteria 2906
672 Ga0495654_0071960 3300046530 Bacteria 1637
673 Ga0495654_0124604 3300046530 Bacteria 1162
674 Ga0495654_0142796 3300046530 Bacteria 1065
675 Ga0495654_0166871 3300046530 Bacteria 962
676 Ga0495654_0219997 3300046530 Bacteria 803
677 Ga0495654_0381647 3300046530 Bacteria 562
678 Ga0495586_0070019 3300046535 Bacteria 1915
679 Ga0495587_0026110 3300046536 Bacteria 3563
680 Ga0495587_0204982 3300046536 Bacteria 1114
681 Ga0495587_0411086 3300046536 Bacteria 751
682 Ga0495609_0000006 3300046538 Bacteria 431833
683 Ga0495609_0000317 3300046538 Bacteria 43158
684 Ga0495609_0002066 3300046538 Bacteria 12632
685 Ga0495609_0005135 3300046538 Bacteria 6971
686 Ga0495609_0009658 3300046538 Bacteria 4657
687 Ga0495609_0012540 3300046538 Bacteria 4019
688 Ga0495609_0043508 3300046538 Bacteria 2016
689 Ga0495609_0070601 3300046538 Bacteria 1535
690 Ga0495597_0000040 3300046542 Bacteria 112292
691 Ga0495597_0002162 3300046542 Bacteria 12921
692 Ga0495597_0009538 3300046542 Bacteria 4788
693 Ga0495597_0011500 3300046542 Bacteria 4290
694 Ga0495597_0015427 3300046542 Bacteria 3618
695 Ga0495597_0065409 3300046542 Bacteria 1577
696 Ga0495645_0109363 3300046543 Bacteria 1957
697 Ga0495622_0003985 3300046557 Bacteria 6896
698 Ga0495622_0005610 3300046557 Bacteria 5819
699 Ga0495622_0155316 3300046557 Bacteria 1033
700 Ga0495633_0000476 3300046558 Bacteria 40643
701 Ga0495633_0006725 3300046558 Bacteria 6768
702 Ga0495633_0008551 3300046558 Bacteria 5752
703 Ga0495656_0001597 3300046615 Bacteria 7418
704 Ga0495668_0070744 3300046616 Bacteria 1918
705 Ga0495668_0117490 3300046616 Bacteria 1454
706 Ga0495668_0237894 3300046616 Bacteria 997
707 Ga0495634_0004434 3300046642 Bacteria 11024
708 Ga0495611_0000445 3300046648 Bacteria 25121
709 Ga0495611_0002772 3300046648 Bacteria 7861
710 Ga0495611_0111200 3300046648 Bacteria 1275
711 Ga0495611_0234152 3300046648 Bacteria 853
712 Ga0495625_0029183 3300046660 Bacteria 4128
713 Ga0495625_0078211 3300046660 Bacteria 2309
714 Ga0495625_0291444 3300046660 Bacteria 1047
715 Ga0495625_0296628 3300046660 Bacteria 1035
716 Ga0495625_0323572 3300046660 Bacteria 981
717 Ga0495625_0621818 3300046660 Bacteria 646
718 Ga0495625_0684005 3300046660 Bacteria 607
719 Ga0495625_0870826 3300046660 Bacteria 518
720 Ga0495635_0005516 3300046663 Bacteria 8798
721 Ga0495635_0088686 3300046663 Bacteria 2116
722 Ga0495659_0003358 3300046664 Bacteria 5129
723 Ga0495659_0004687 3300046664 Bacteria 4303
724 Ga0495661_0000232 3300046665 Bacteria 64230
725 Ga0495661_0000829 3300046665 Bacteria 28983
726 Ga0495661_0002086 3300046665 Bacteria 15691
727 Ga0495661_0034184 3300046665 Bacteria 3199
728 Ga0495661_0057432 3300046665 Bacteria 2323
729 Ga0495661_0150885 3300046665 Bacteria 1255
730 Ga0495661_0243446 3300046665 Bacteria 921
731 Ga0495661_0441740 3300046665 Bacteria 627
732 Ga0495588_0016063 3300046674 Bacteria 3612
733 Ga0495623_0010871 3300046679 Bacteria 5892
734 Ga0495646_0010699 3300046680 Bacteria 5828
735 Ga0495646_0012871 3300046680 Bacteria 5318
736 Ga0495669_0009785 3300046684 Bacteria 4048
737 Ga0495613_0055943 3300046689 Bacteria 2897
738 Ga0495670_0001017 3300046691 Bacteria 13618
739 Ga0495670_0002719 3300046691 Bacteria 8735
740 Ga0495670_0004837 3300046691 Bacteria 6612
741 Ga0495670_0016045 3300046691 Bacteria 3682
742 Ga0495671_0003359 3300046692 Bacteria 9874
743 Ga0495671_0007107 3300046692 Bacteria 6411
744 Ga0495671_0016592 3300046692 Bacteria 3929
745 Ga0495671_0018208 3300046692 Bacteria 3729
746 Ga0495671_0019402 3300046692 Bacteria 3595
747 Ga0495671_0025967 3300046692 Bacteria 3040
748 Ga0495671_0085085 3300046692 Bacteria 1549
749 Ga0495671_0184679 3300046692 Bacteria 1012
750 Ga0495671_0304593 3300046692 Bacteria 766
751 Ga0495671_0612815 3300046692 Bacteria 517
752 Ga0495649_0002637 3300046694 Bacteria 12504
753 Ga0495649_0004030 3300046694 Bacteria 9674
754 Ga0495649_0004206 3300046694 Bacteria 9441
755 Ga0495649_0007929 3300046694 Bacteria 6423
756 Ga0495649_0052426 3300046694 Bacteria 2210
757 Ga0495649_0053433 3300046694 Bacteria 2186
758 Ga0495649_0070785 3300046694 Bacteria 1869
759 Ga0495649_0100611 3300046694 Bacteria 1536
760 Ga0495649_0112315 3300046694 Bacteria 1444
761 Ga0495649_0140078 3300046694 Bacteria 1273
762 Ga0495649_0153383 3300046694 Bacteria 1209
763 Ga0495589_0001824 3300046794 Bacteria 12113
764 Ga0495589_0002361 3300046794 Bacteria 10592
765 Ga0495589_0003025 3300046794 Bacteria 9244
766 Ga0495589_0008204 3300046794 Bacteria 5461
767 Ga0495589_0009091 3300046794 Bacteria 5164
768 Ga0495589_0009871 3300046794 Bacteria 4959
769 Ga0495589_0060296 3300046794 Bacteria 1863
770 Ga0495600_0017597 3300046809 Bacteria 4548
771 Ga0495600_0069543 3300046809 Bacteria 2301
772 Ga0495660_0000240 3300046810 Bacteria 53422
773 Ga0495660_0010105 3300046810 Bacteria 5488
774 Ga0495660_0014751 3300046810 Bacteria 4519
775 Ga0495660_0019195 3300046810 Bacteria 3925
776 Ga0495660_0040889 3300046810 Bacteria 2568
777 Ga0495660_0042103 3300046810 Bacteria 2524
778 Ga0495660_0045486 3300046810 Bacteria 2409
779 Ga0495660_0089758 3300046810 Bacteria 1599
780 Ga0495660_0131102 3300046810 Bacteria 1257
781 Ga0495660_0202485 3300046810 Bacteria 947
782 Ga0495604_0019032 3300047317 Bacteria 5499
783 Ga0495604_0020740 3300047317 Bacteria 5247
784 Ga0495636_0002597 3300047318 Bacteria 6944
785 Ga0495636_0181027 3300047318 Bacteria 956
786 Ga0495674_0303162 3300047319 Bacteria 1304
787 Ga0495672_0019644 3300047320 Bacteria 4453
788 Ga0495672_0061162 3300047320 Bacteria 2171
789 Ga0495672_0065510 3300047320 Bacteria 2076
790 Ga0495672_0084182 3300047320 Bacteria 1764
791 Ga0495672_0103137 3300047320 Bacteria 1543
792 Ga0495672_0110864 3300047320 Bacteria 1473
793 Ga0495672_0265430 3300047320 Bacteria 826
794 Ga0495672_0281837 3300047320 Bacteria 794
795 Ga0495676_0075715 3300047321 Bacteria 2572
796 Ga0495680_0008104 3300047322 Bacteria 9575
797 Ga0495680_0046759 3300047322 Bacteria 3409
798 Ga0495680_0218769 3300047322 Bacteria 1360
799 Ga0495680_1014014 3300047322 Bacteria 529
800 Ga0495683_0000289 3300047323 Bacteria 43297
801 Ga0495683_0003356 3300047323 Bacteria 9358
802 Ga0495683_0040567 3300047323 Bacteria 2351
803 Ga0495683_0050970 3300047323 Bacteria 2070
804 Ga0495683_0241100 3300047323 Bacteria 797
805 Ga0495683_0274781 3300047323 Bacteria 731
806 Ga0495675_0013933 3300047444 Bacteria 5084
807 Ga0495675_0498524 3300047444 Bacteria 699
808 Ga0495677_0007690 3300047445 Bacteria 4021
809 Ga0495679_004383 3300047446 Bacteria 6534
810 Ga0495679_006361 3300047446 Bacteria 5095
811 Ga0495679_006417 3300047446 Bacteria 5064
812 Ga0495679_017253 3300047446 Bacteria 2587
813 Ga0495679_017586 3300047446 Bacteria 2557
814 Ga0495679_046881 3300047446 Bacteria 1313
815 Ga0495673_0003472 3300047469 Bacteria 10370
816 Ga0495673_0005327 3300047469 Bacteria 7804
817 Ga0495673_0005781 3300047469 Bacteria 7408
818 Ga0495673_0006941 3300047469 Bacteria 6594
819 Ga0495673_0011839 3300047469 Bacteria 4661
820 Ga0495673_0013122 3300047469 Bacteria 4364
821 Ga0495673_0025236 3300047469 Bacteria 2857
822 Ga0495673_0041794 3300047469 Bacteria 2061
823 Ga0495673_0104499 3300047469 Bacteria 1140
824 Ga0495673_0105878 3300047469 Bacteria 1130
825 Ga0495681_0000762 3300047470 Bacteria 24824
826 Ga0495681_0001492 3300047470 Bacteria 17484
827 Ga0495681_0008925 3300047470 Bacteria 6228
828 Ga0495681_0009356 3300047470 Bacteria 6045
829 Ga0495681_0009954 3300047470 Bacteria 5799
830 Ga0495681_0014993 3300047470 Bacteria 4408
831 Ga0495681_0036180 3300047470 Bacteria 2444
832 Ga0495681_0048475 3300047470 Bacteria 2013
833 Ga0495681_0058080 3300047470 Bacteria 1794
834 Ga0495681_0083985 3300047470 Bacteria 1417
835 Ga0495686_0021995 3300047472 Bacteria 4223
836 Ga0495686_0030736 3300047472 Bacteria 3486
837 Ga0495686_0092459 3300047472 Bacteria 1834
838 Ga0495686_0307783 3300047472 Bacteria 872
839 Ga0495686_0442794 3300047472 Bacteria 691
840 Ga0495593_0027293 3300047673 Bacteria 3143
841 Ga0495593_0130000 3300047673 Bacteria 1278
842 Ga0495626_0004635 3300048091 Bacteria 8357
843 Ga0495626_0032624 3300048091 Bacteria 2499
844 Ga0495626_0058680 3300048091 Bacteria 1757
845 Ga0495626_0090500 3300048091 Bacteria 1345
846 Ga0495626_0103613 3300048091 Bacteria 1238
847 Ga0495626_0136738 3300048091 Bacteria 1041
848 Ga0496102_0001186 3300048905 Bacteria 23689
849 Ga0496103_0017077 3300048906 Bacteria 4339
850 Ga0496110_0314329 3300048913 Bacteria 1426
851 Ga0496110_0329391 3300048913 Bacteria 1391
852 Ga0496110_1010618 3300048913 Bacteria 739
853 Ga0496114_0137484 3300048917 Bacteria 2113
854 Ga0496114_0321493 3300048917 Bacteria 1367
855 Ga0496116_0001251 3300048919 Bacteria 29495
856 Ga0496116_0029406 3300048919 Bacteria 3962
857 Ga0496116_0071203 3300048919 Bacteria 2202
858 Ga0496117_0001478 3300048920 Bacteria 33728
859 Ga0496117_0007829 3300048920 Bacteria 10281
860 Ga0496117_0008263 3300048920 Bacteria 9912
861 Ga0496117_0041468 3300048920 Bacteria 3372
862 Ga0496117_0059427 3300048920 Bacteria 2640
863 Ga0496117_0074046 3300048920 Bacteria 2269
864 Ga0496117_0104654 3300048920 Bacteria 1780
865 Ga0496117_0289699 3300048920 Bacteria 872
866 Ga0496117_0621726 3300048920 Bacteria 502
867 Ga0496118_0004423 3300048921 Bacteria 16676
868 Ga0496118_0076077 3300048921 Bacteria 2389
869 Ga0496118_0081141 3300048921 Bacteria 2278
870 Ga0496118_0084480 3300048921 Bacteria 2214
871 Ga0496118_0088067 3300048921 Bacteria 2149
872 Ga0496118_0109579 3300048921 Bacteria 1837
873 Ga0496119_0000207 3300048922 Bacteria 83748
874 Ga0496119_0037107 3300048922 Bacteria 3170
875 Ga0496119_0125463 3300048922 Bacteria 1405
876 Ga0496119_0142247 3300048922 Bacteria 1294
877 Ga0496119_0270849 3300048922 Bacteria 848
878 Ga0496120_0009849 3300048923 Bacteria 6732
879 Ga0496120_0015054 3300048923 Bacteria 5117
880 Ga0496120_0076271 3300048923 Bacteria 1827
881 Ga0496120_0109051 3300048923 Bacteria 1449
882 Ga0496120_0163695 3300048923 Bacteria 1106
883 Ga0496121_0031430 3300048924 Bacteria 4850
884 Ga0496121_0066698 3300048924 Bacteria 2920
885 Ga0496121_0094464 3300048924 Bacteria 2326
886 Ga0496121_0116495 3300048924 Bacteria 2026
887 Ga0496121_0300810 3300048924 Bacteria 1089
888 Ga0496122_0002127 3300048925 Bacteria 29138
889 Ga0496122_0018595 3300048925 Bacteria 6405
890 Ga0496122_0063303 3300048925 Bacteria 2700
891 Ga0496122_0087950 3300048925 Bacteria 2132
892 Ga0496122_0094718 3300048925 Bacteria 2020
893 Ga0496122_0115168 3300048925 Bacteria 1752
894 Ga0496122_0172038 3300048925 Bacteria 1304
895 Ga0496123_0000387 3300048926 Bacteria 82706
896 Ga0496123_0027794 3300048926 Bacteria 4204
897 Ga0496123_0048509 3300048926 Bacteria 2856
898 Ga0496123_0069293 3300048926 Bacteria 2215
899 Ga0496123_0070799 3300048926 Bacteria 2180
900 Ga0496123_0086236 3300048926 Bacteria 1884
901 Ga0496124_0009462 3300048927 Bacteria 10033
902 Ga0496124_0017418 3300048927 Bacteria 6770
903 Ga0496124_0019452 3300048927 Bacteria 6318
904 Ga0496124_0024971 3300048927 Bacteria 5420
905 Ga0496124_0027845 3300048927 Bacteria 5063
906 Ga0496124_0053505 3300048927 Bacteria 3421
907 Ga0496124_0177850 3300048927 Bacteria 1640
908 Ga0496124_0209443 3300048927 Bacteria 1476
909 Ga0496124_0358988 3300048927 Bacteria 1027
910 Ga0496125_0009616 3300048928 Bacteria 9887
911 Ga0496125_0017334 3300048928 Bacteria 6874
912 Ga0496125_0023336 3300048928 Bacteria 5712
913 Ga0496125_0028811 3300048928 Bacteria 5004
914 Ga0496125_0035744 3300048928 Bacteria 4351
915 Ga0496125_0067834 3300048928 Bacteria 2808
916 Ga0496125_0110319 3300048928 Bacteria 1995
917 Ga0496125_0134073 3300048928 Bacteria 1736
918 Ga0496125_0138426 3300048928 Bacteria 1697
919 Ga0496126_0012460 3300048929 Bacteria 8709
920 Ga0496126_0074611 3300048929 Bacteria 3011
921 Ga0496126_0115154 3300048929 Bacteria 2338
922 Ga0496126_0187901 3300048929 Bacteria 1751
923 Ga0496126_0481092 3300048929 Bacteria 995
924 Ga0495678_000412 3300049459 Bacteria 43250
925 Ga0495678_002222 3300049459 Bacteria 13580
926 Ga0495678_004142 3300049459 Bacteria 8564
927 Ga0495678_004588 3300049459 Bacteria 7944
928 Ga0495678_009174 3300049459 Bacteria 4922
929 Ga0495678_025348 3300049459 Bacteria 2548
930 Ga0495678_049667 3300049459 Bacteria 1629
931 Ga0495678_055955 3300049459 Bacteria 1502
932 Ga0495678_082907 3300049459 Bacteria 1147
933 Ga0495678_086446 3300049459 Bacteria 1114
934 Ga0495682_0000616 3300049460 Bacteria 23944
935 Ga0495682_0002905 3300049460 Bacteria 7863
936 Ga0495682_0022350 3300049460 Bacteria 2365
937 Ga0495682_0054116 3300049460 Bacteria 1457
938 Ga0495682_0055347 3300049460 Bacteria 1438
939 Ga0495682_0228804 3300049460 Bacteria 658
940 Ga0501314_045998 3300049530 Bacteria 518
941 Ga0501032_0702482 3300049569 Bacteria 641
942 Ga0501033_0384040 3300049570 Bacteria 981
943 Ga0501034_0000370 3300049571 Bacteria 76588
944 Ga0501034_0314956 3300049571 Bacteria 1499
945 Ga0501222_068915 3300049662 Bacteria 547
946 Ga0501227_060804 3300049665 Bacteria 968
947 Ga0501241_005745 3300049758 Bacteria 2303
948 Ga0501035_0740385 3300049822 Bacteria 790
949 Ga0501226_000005 3300049853 Bacteria 271019
950 nmdc:mga00v17_67392_c1 3300050491 Bacteria 2211
951 nmdc:mga08x19_482303_c2 3300050514 Bacteria 563
952 Ga0500650_0478805 3300053098 Bacteria 531
953 Ga0500572_001316 3300053111 Bacteria 6921
954 Ga0500621_100282 3300053126 Bacteria 1143
955 Ga0500577_0070427 3300053142 Bacteria 1370
956 Ga0500634_0031621 3300053161 Bacteria 2887

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 3007252601 3007256116 95
2 iso_pu_bacteria 2990196909 2990200347 98
3 3300041411 Ga0439466_0020529 Ga0439466_0020529_1341_1640 99
4 3300042439 Ga0439464_0120884 Ga0439464_0120884_305_604 99
5 3300003856 Ga0058692_1032544 Ga0058692_10325442 100
6 3300009011 Ga0105251_10190125 Ga0105251_101901252 100
7 3300009092 Ga0105250_10075742 Ga0105250_100757422 100
8 3300013102 Ga0157371_10011479 Ga0157371_100114796 100
9 3300013306 Ga0163162_12441669 Ga0163162_124416691 100
10 3300015261 Ga0182006_1012798 Ga0182006_10127982 100
11 3300025711 Ga0207696_1129935 Ga0207696_11299352 100
12 3300025735 Ga0207713_1146769 Ga0207713_11467692 100
13 3300027312 Ga0209371_1000095 Ga0209371_1000095101 100
14 3300030500 Ga0268256_1000116 Ga0268256_100011617 100
15 3300041411 Ga0439466_0091343 Ga0439466_0091343_567_869 100
16 3300042156 Ga0439446_0000313 Ga0439446_0000313_7240_7542 100
17 3300042439 Ga0439464_0033449 Ga0439464_0033449_742_1044 100
18 3300046453 Ga0495627_000386 Ga0495627_000386_36015_36317 100
19 3300046471 Ga0495650_0021060 Ga0495650_0021060_1001_1303 100
20 3300046518 Ga0495631_0007648 Ga0495631_0007648_1623_1925 100
21 3300046519 Ga0495632_0009948 Ga0495632_0009948_1337_1639 100
22 3300046519 Ga0495632_0015321 Ga0495632_0015321_176_478 100
23 3300046530 Ga0495654_0008733 Ga0495654_0008733_1436_1738 100
24 3300046692 Ga0495671_0003359 Ga0495671_0003359_4056_4358 100
25 3300047320 Ga0495672_0265430 Ga0495672_0265430_423_725 100
26 3300048926 Ga0496123_0070799 Ga0496123_0070799_1375_1677 100
27 iso_pu_bacteria 3007315729 3007319793 100
28 3300009011 Ga0105251_10000061 Ga0105251_1000006192 101
29 3300009092 Ga0105250_10000299 Ga0105250_100002997 101
30 3300025711 Ga0207696_1000034 Ga0207696_1000034238 101
31 3300025735 Ga0207713_1000014 Ga0207713_1000014195 101
32 iso_pu_bacteria 2728369097 2729147671 101
33 iso_pu_bacteria 2599185155 2599328419 102
34 iso_pu_bacteria 2826581358 2826584181 102
35 iso_pu_bacteria 2842815866 2842820947 102
36 iso_pu_bacteria 2842849001 2842849643 102
37 3300027360 Ga0209969_1002749 Ga0209969_10027491 103
38 3300027395 Ga0209996_1014712 Ga0209996_10147122 103
39 3300027471 Ga0209995_1046387 Ga0209995_10463872 103
40 3300027526 Ga0209968_1002552 Ga0209968_10025522 103
41 3300027614 Ga0209970_1006052 Ga0209970_10060522 103
42 3300027665 Ga0209983_1001283 Ga0209983_10012835 103
43 3300027682 Ga0209971_1003202 Ga0209971_10032022 103
44 3300027876 Ga0209974_10017015 Ga0209974_100170152 103
45 iso_pu_bacteria 2554235132 2554813604 103
46 iso_pu_bacteria 2600254954 2600447024 103
47 iso_pu_bacteria 2600255389 2602010088 103
48 iso_pu_bacteria 2606217733 2608381224 103
49 iso_pu_bacteria 2808606379 2808943023 103
50 iso_pu_bacteria 2811994881 2812368357 103
51 iso_pu_bacteria 2823421272 2823422584 103
52 iso_pu_bacteria 2923519811 2923522412 103
53 iso_pu_bacteria 651053060 651176742 103
54 iso_pu_bacteria 8034962539 8034966250 103
55 3300009036 Ga0105244_10021963 Ga0105244_100219634 104
56 3300025728 Ga0207655_1031840 Ga0207655_10318402 104
57 iso_pu_bacteria 2511231006 2511266688 104
58 iso_pu_bacteria 2511231024 2511378077 104
59 iso_pu_bacteria 2512047018 2512328575 104
60 iso_pu_bacteria 2554235341 2555668105 104
61 iso_pu_bacteria 2582580891 2583790542 104
62 iso_pu_bacteria 2597489887 2597856319 104
63 iso_pu_bacteria 2597489888 2597862484 104
64 iso_pu_bacteria 2597489889 2597868260 104
65 iso_pu_bacteria 2599185160 2599355104 104
66 iso_pu_bacteria 2599185161 2599361072 104
67 iso_pu_bacteria 2599185162 2599367394 104
68 iso_pu_bacteria 2599185163 2599374184 104
69 iso_pu_bacteria 2599185164 2599380210 104
70 iso_pu_bacteria 2599185165 2599386657 104
71 iso_pu_bacteria 2599185166 2599393042 104
72 iso_pu_bacteria 2599185167 2599396918 104
73 iso_pu_bacteria 2599185168 2599404809 104
74 iso_pu_bacteria 2599185179 2599448896 104
75 iso_pu_bacteria 2599185181 2599461938 104
76 iso_pu_bacteria 2599185182 2599467019 104
77 iso_pu_bacteria 2599185185 2599483426 104
78 iso_pu_bacteria 2599185186 2599490969 104
79 iso_pu_bacteria 2599185189 2599508969 104
80 iso_pu_bacteria 2599185190 2599511345 104
81 iso_pu_bacteria 2599185191 2599517715 104
82 iso_pu_bacteria 2599185257 2599805332 104
83 iso_pu_bacteria 2599185288 2599879803 104
84 iso_pu_bacteria 2599185290 2599890719 104
85 iso_pu_bacteria 2599185303 2599948310 104
86 iso_pu_bacteria 2599185356 2600214560 104
87 iso_pu_bacteria 2600254931 2600364039 104
88 iso_pu_bacteria 2600255296 2601691081 104
89 iso_pu_bacteria 2600255313 2601774735 104
90 iso_pu_bacteria 2619619299 2621301370 104
91 iso_pu_bacteria 2643221571 2643873290 104
92 iso_pu_bacteria 2643221713 2644624164 104
93 iso_pu_bacteria 2667528171 2671097705 104
94 iso_pu_bacteria 2671180172 2671767933 104
95 iso_pu_bacteria 2721755607 2723247376 104
96 iso_pu_bacteria 2738541265 2738673856 104
97 iso_pu_bacteria 2738541282 2738752249 104
98 iso_pu_bacteria 2738541294 2738809265 104
99 iso_pu_bacteria 2738541303 2738861290 104
100 iso_pu_bacteria 2738541309 2738896625 104
101 iso_pu_bacteria 2738543020 2739286466 104
102 iso_pu_bacteria 2738543021 2739291779 104
103 iso_pu_bacteria 2740892503 2743735727 104
104 iso_pu_bacteria 2765235841 2765582284 104
105 iso_pu_bacteria 2808606385 2808975411 104
106 iso_pu_bacteria 2808606388 2808990950 104
107 iso_pu_bacteria 2816332298 2817489262 104
108 iso_pu_bacteria 2818991464 2819702788 104
109 iso_pu_bacteria 2842805378 2842808835 104
110 iso_pu_bacteria 2842826826 2842828873 104
111 iso_pu_bacteria 2842837860 2842842604 104
112 iso_pu_bacteria 2844665904 2844668611 104
113 iso_pu_bacteria 2852612431 2852615353 104
114 iso_pu_bacteria 2852667396 2852670321 104
115 iso_pu_bacteria 2860867994 2860869222 104
116 iso_pu_bacteria 2908446538 2908448076 104
117 iso_pu_bacteria 2912963787 2912964936 104
118 iso_pu_bacteria 2917070673 2917071867 104
119 iso_pu_bacteria 2919155634 2919158838 104
120 iso_pu_bacteria 2923153595 2923154736 104
121 iso_pu_bacteria 2929189879 2929191178 104
122 iso_pu_bacteria 2931390751 2931392182 104
123 iso_pu_bacteria 2935353572 2935354039 104
124 iso_pu_bacteria 2939651529 2939653295 104
125 iso_pu_bacteria 2945928738 2945929393 104
126 iso_pu_bacteria 2945961074 2945961430 104
127 iso_pu_bacteria 2946006987 2946011664 104
128 iso_pu_bacteria 2946027586 2946029420 104
129 iso_pu_bacteria 2947233263 2947236008 104
130 iso_pu_bacteria 2984286254 2984291295 104
131 iso_pu_bacteria 3007395558 3007400264 104
132 iso_pu_bacteria 3007419365 3007420745 104
133 iso_pu_bacteria 637000220 637318483 104
134 iso_pu_bacteria 8015687852 8015688969 104
135 iso_pu_bacteria 8052494512 8052495735 104
136 iso_pu_bacteria 8054285046 8054285795 104
137 iso_pu_bacteria 8054347763 8054348386 104
138 iso_pu_bacteria 8054503363 8054504759 104
139 iso_pu_bacteria 8054929484 8054929545 104
140 iso_pu_bacteria 8055770955 8055772087 104
141 iso_pu_bacteria 8055817908 8055819202 104
142 iso_pu_bacteria 8056131705 8056133122 104
143 iso_pu_bacteria 8056148874 8056149302 104
144 iso_pu_bacteria 8056161164 8056166711 104
145 iso_pu_bacteria 2511231004 2511253999 105
146 iso_pu_bacteria 2511231007 2511273209 105
147 iso_pu_bacteria 2511231008 2511280010 105
148 iso_pu_bacteria 2511231010 2511290026 105
149 iso_pu_bacteria 2511231011 2511295555 105
150 iso_pu_bacteria 2511231016 2511328876 105
151 iso_pu_bacteria 2511231018 2511340979 105
152 iso_pu_bacteria 2511231019 2511343969 105
153 iso_pu_bacteria 2511231021 2511356274 105
154 iso_pu_bacteria 2511231022 2511362263 105
155 iso_pu_bacteria 2511231023 2511367223 105
156 iso_pu_bacteria 2511231031 2511411053 105
157 iso_pu_bacteria 2599185188 2599501187 105
158 iso_pu_bacteria 2599185212 2599613848 105
159 iso_pu_bacteria 2599185248 2599770738 105
160 iso_pu_bacteria 2599185289 2599886616 105
161 iso_pu_bacteria 2599185291 2599896985 105
162 iso_pu_bacteria 2599185300 2599934089 105
163 iso_pu_bacteria 2599185302 2599942989 105
164 iso_pu_bacteria 2599185304 2599953972 105
165 iso_pu_bacteria 2599185305 2599959484 105
166 iso_pu_bacteria 2599185306 2599966270 105
167 iso_pu_bacteria 2599185308 2599978115 105
168 iso_pu_bacteria 2599185309 2599985285 105
169 iso_pu_bacteria 2599185310 2599987209 105
170 iso_pu_bacteria 2599185311 2599995483 105
171 iso_pu_bacteria 2599185312 2599999962 105
172 iso_pu_bacteria 2599185313 2600008777 105
173 iso_pu_bacteria 2599185314 2600012415 105
174 iso_pu_bacteria 2599185315 2600016679 105
175 iso_pu_bacteria 2599185316 2600024908 105
176 iso_pu_bacteria 2599185317 2600029644 105
177 iso_pu_bacteria 2599185318 2600035464 105
178 iso_pu_bacteria 2599185319 2600041311 105
179 iso_pu_bacteria 2599185320 2600045535 105
180 iso_pu_bacteria 2599185321 2600056525 105
181 iso_pu_bacteria 2599185322 2600058439 105
182 iso_pu_bacteria 2599185323 2600063890 105
183 iso_pu_bacteria 2599185324 2600074815 105
184 iso_pu_bacteria 2599185325 2600079492 105
185 iso_pu_bacteria 2600254930 2600358322 105
186 iso_pu_bacteria 2600255318 2601800135 105
187 iso_pu_bacteria 2603880185 2606074599 105
188 iso_pu_bacteria 2603880199 2606127462 105
189 iso_pu_bacteria 2623620443 2624478888 105
190 iso_pu_bacteria 2623620446 2624490395 105
191 iso_pu_bacteria 2643221633 2644189222 105
192 iso_pu_bacteria 2643221650 2644281534 105
193 iso_pu_bacteria 2651869719 2652546813 105
194 iso_pu_bacteria 2667528170 2671094516 105
195 iso_pu_bacteria 2667528176 2671127871 105
196 iso_pu_bacteria 2675903515 2678261617 105
197 iso_pu_bacteria 2713897148 2715752800 105
198 iso_pu_bacteria 2713897149 2715757599 105
199 iso_pu_bacteria 2718217725 2718632772 105
200 iso_pu_bacteria 2738543025 2739312842 105
201 iso_pu_bacteria 2744054620 2745007966 105
202 iso_pu_bacteria 2773857670 2774122226 105
203 iso_pu_bacteria 2773857673 2774136638 105
204 iso_pu_bacteria 2784132063 2784260393 105
205 iso_pu_bacteria 2784132072 2784317585 105
206 iso_pu_bacteria 2791355520 2794594408 105
207 iso_pu_bacteria 2808606361 2808854130 105
208 iso_pu_bacteria 2808606373 2808904890 105
209 iso_pu_bacteria 2808606376 2808923421 105
210 iso_pu_bacteria 2808606377 2808928696 105
211 iso_pu_bacteria 2808606378 2808934162 105
212 iso_pu_bacteria 2808606380 2808945304 105
213 iso_pu_bacteria 2808606381 2808950817 105
214 iso_pu_bacteria 2808606383 2808962437 105
215 iso_pu_bacteria 2808606389 2808997522 105
216 iso_pu_bacteria 2818991456 2819658438 105
217 iso_pu_bacteria 2825651385 2825653660 105
218 iso_pu_bacteria 2842832357 2842835645 105
219 iso_pu_bacteria 2842843487 2842847387 105
220 iso_pu_bacteria 2842854478 2842857216 105
221 iso_pu_bacteria 2852657418 2852662749 105
222 iso_pu_bacteria 2878029506 2878030848 105
223 iso_pu_bacteria 2880230671 2880231763 105
224 iso_pu_bacteria 2904518522 2904520798 105
225 iso_pu_bacteria 2913036834 2913037956 105
226 iso_pu_bacteria 2919063839 2919064641 105
227 iso_pu_bacteria 2919385768 2919385893 105
228 iso_pu_bacteria 2919456309 2919458226 105
229 iso_pu_bacteria 2919481497 2919482865 105
230 iso_pu_bacteria 2919487758 2919490679 105
231 iso_pu_bacteria 2919697872 2919703680 105
232 iso_pu_bacteria 2923586266 2923590919 105
233 iso_pu_bacteria 2929144301 2929145411 105
234 iso_pu_bacteria 2931369376 2931371251 105
235 iso_pu_bacteria 2931396565 2931399519 105
236 iso_pu_bacteria 2939636861 2939637975 105
237 iso_pu_bacteria 2969304461 2969305670 105
238 iso_pu_bacteria 2974289157 2974292703 105
239 iso_pu_bacteria 2988728565 2988732951 105
240 iso_pu_bacteria 2998139840 2998141109 105
241 iso_pu_bacteria 3007614139 3007614190 105
242 iso_pu_bacteria 3007619802 3007622469 105
243 iso_pu_bacteria 3007861166 3007863669 105
244 iso_pu_bacteria 3007866637 3007871305 105
245 iso_pu_bacteria 8019775933 8019781830 105
246 iso_pu_bacteria 8029995093 8029999653 105
247 iso_pu_bacteria 8055878733 8055883906 105
248 iso_pu_bacteria 8056143049 8056147873 105
249 iso_pu_bacteria 8056155041 8056159658 105
250 iso_pu_bacteria 8056166840 8056169944 105
251 iso_pu_bacteria 8056172158 8056176070 105
252 iso_pu_bacteria 8056177738 8056180475 105
253 iso_pu_bacteria 8056569372 8056569760 105
254 3300005290 Ga0065712_10068159 Ga0065712_100681595 106
255 3300009036 Ga0105244_10000272 Ga0105244_1000027232 106
256 3300009148 Ga0105243_10045025 Ga0105243_100450252 106
257 3300025728 Ga0207655_1006185 Ga0207655_10061855 106
258 3300048927 Ga0496124_0053505 Ga0496124_0053505_1784_2104 106
259 3300005288 Ga0065714_10001142 Ga0065714_100011421 107
260 3300031548 Ga0307408_100000090 Ga0307408_10000009086 107
261 3300032004 Ga0307414_10024653 Ga0307414_100246535 107
262 3300041404 Ga0439436_0001968 Ga0439436_0001968_1903_2226 107
263 3300041405 Ga0439438_001751 Ga0439438_001751_4947_5270 107
264 3300041407 Ga0439447_001710 Ga0439447_001710_4121_4444 107
265 3300041411 Ga0439466_0001747 Ga0439466_0001747_4192_4515 107
266 3300041411 Ga0439466_0004531 Ga0439466_0004531_247_570 107
267 3300041997 Ga0439431_0071673 Ga0439431_0071673_85_408 107
268 3300042006 Ga0439432_002819 Ga0439432_002819_2322_2645 107
269 3300042010 Ga0439452_005021 Ga0439452_005021_3695_4018 107
270 3300042121 Ga0450919_024943 Ga0450919_024943_178_501 107
271 3300042156 Ga0439446_0012156 Ga0439446_0012156_423_746 107
272 3300042435 Ga0439434_0017329 Ga0439434_0017329_598_921 107
273 3300042439 Ga0439464_0012530 Ga0439464_0012530_45_368 107
274 3300042439 Ga0439464_0012958 Ga0439464_0012958_1838_2161 107
275 3300049571 Ga0501034_0314956 Ga0501034_0314956_1040_1363 107
276 iso_pu_bacteria 640427133 640488693 107
277 3300001915 JGI24741J21665_1015229 JGI24741J21665_10152293 108
278 3300002705 JGI25156J39149_1022724 JGI25156J39149_10227242 108
279 3300002737 JGI25162J39368_1000103 JGI25162J39368_100010359 108
280 3300002738 JGI25154J39366_1003627 JGI25154J39366_10036274 108
281 3300002771 JGI25163J39215_1000809 JGI25163J39215_10008094 108
282 3300002772 JGI25164J39214_1000082 JGI25164J39214_100008217 108
283 3300003214 JGI25165J46597_1000185 JGI25165J46597_100018517 108
284 3300003751 Ga0055538_1000073 Ga0055538_100007388 108
285 3300003752 Ga0055539_1000109 Ga0055539_100010988 108
286 3300003756 Ga0055533_1000117 Ga0055533_100011788 108
287 3300003758 Ga0055532_1000120 Ga0055532_100012035 108
288 3300003759 Ga0055525_1000156 Ga0055525_100015688 108
289 3300003761 Ga0055535_1005421 Ga0055535_10054214 108
290 3300003781 Ga0055536_1000331 Ga0055536_100033127 108
291 3300003791 Ga0055530_10000351 Ga0055530_1000035118 108
292 3300003791 Ga0055530_10000511 Ga0055530_1000051128 108
293 3300003792 Ga0055540_1005860 Ga0055540_10058602 108
294 3300003841 Ga0055541_1000074 Ga0055541_100007488 108
295 3300005288 Ga0065714_10003823 Ga0065714_100038238 108
296 3300005288 Ga0065714_10068084 Ga0065714_100680842 108
297 3300005288 Ga0065714_10290460 Ga0065714_102904602 108
298 3300005289 Ga0065704_10081940 Ga0065704_100819402 108
299 3300005289 Ga0065704_10100411 Ga0065704_101004114 108
300 3300005289 Ga0065704_10122646 Ga0065704_101226464 108
301 3300005290 Ga0065712_10071669 Ga0065712_100716692 108
302 3300005331 Ga0070670_100000780 Ga0070670_1000007803 108
303 3300005331 Ga0070670_100011171 Ga0070670_1000111717 108
304 3300005353 Ga0070669_100004365 Ga0070669_1000043657 108
305 3300005353 Ga0070669_100465722 Ga0070669_1004657222 108
306 3300005356 Ga0070674_101547987 Ga0070674_1015479871 108
307 3300005457 Ga0070662_100000301 Ga0070662_10000030121 108
308 3300005539 Ga0068853_100006538 Ga0068853_1000065389 108
309 3300005564 Ga0070664_100221778 Ga0070664_1002217783 108
310 3300005578 Ga0068854_100003695 Ga0068854_1000036954 108
311 3300005834 Ga0068851_10000037 Ga0068851_1000003769 108
312 3300006058 Ga0075432_10024162 Ga0075432_100241623 108
313 3300006177 Ga0075362_10276515 Ga0075362_102765152 108
314 3300006914 Ga0075436_100187212 Ga0075436_1001872122 108
315 3300009011 Ga0105251_10001136 Ga0105251_1000113616 108
316 3300009011 Ga0105251_10003445 Ga0105251_1000344511 108
317 3300009011 Ga0105251_10004028 Ga0105251_1000402810 108
318 3300009011 Ga0105251_10009942 Ga0105251_100099423 108
319 3300009011 Ga0105251_10010616 Ga0105251_100106163 108
320 3300009011 Ga0105251_10029477 Ga0105251_100294771 108
321 3300009011 Ga0105251_10033357 Ga0105251_100333572 108
322 3300009011 Ga0105251_10087819 Ga0105251_100878192 108
323 3300009011 Ga0105251_10139833 Ga0105251_101398332 108
324 3300009036 Ga0105244_10011554 Ga0105244_100115543 108
325 3300009036 Ga0105244_10094795 Ga0105244_100947953 108
326 3300009036 Ga0105244_10117921 Ga0105244_101179212 108
327 3300009036 Ga0105244_10282450 Ga0105244_102824502 108
328 3300009092 Ga0105250_10000332 Ga0105250_100003327 108
329 3300009092 Ga0105250_10023392 Ga0105250_100233924 108
330 3300009092 Ga0105250_10096498 Ga0105250_100964982 108
331 3300009092 Ga0105250_10226003 Ga0105250_102260031 108
332 3300009148 Ga0105243_10051884 Ga0105243_100518843 108
333 3300009148 Ga0105243_10096623 Ga0105243_100966234 108
334 3300009148 Ga0105243_10195715 Ga0105243_101957152 108
335 3300009177 Ga0105248_10134319 Ga0105248_101343194 108
336 3300009545 Ga0105237_10137591 Ga0105237_101375912 108
337 3300011119 Ga0105246_10002077 Ga0105246_100020776 108
338 3300011119 Ga0105246_10005375 Ga0105246_100053757 108
339 3300013100 Ga0157373_10021840 Ga0157373_100218401 108
340 3300013100 Ga0157373_10033665 Ga0157373_100336653 108
341 3300013100 Ga0157373_10169447 Ga0157373_101694472 108
342 3300013100 Ga0157373_10180475 Ga0157373_101804752 108
343 3300013102 Ga0157371_10057216 Ga0157371_100572162 108
344 3300013102 Ga0157371_10065540 Ga0157371_100655402 108
345 3300013102 Ga0157371_10352185 Ga0157371_103521852 108
346 3300013104 Ga0157370_10000846 Ga0157370_1000084614 108
347 3300013104 Ga0157370_10090355 Ga0157370_100903555 108
348 3300013104 Ga0157370_10102773 Ga0157370_101027735 108
349 3300013104 Ga0157370_10330107 Ga0157370_103301072 108
350 3300013104 Ga0157370_11728320 Ga0157370_117283201 108
351 3300013105 Ga0157369_10017783 Ga0157369_100177836 108
352 3300013105 Ga0157369_10079337 Ga0157369_100793373 108
353 3300013306 Ga0163162_10062388 Ga0163162_100623882 108
354 3300013306 Ga0163162_10097608 Ga0163162_100976083 108
355 3300013306 Ga0163162_10957033 Ga0163162_109570332 108
356 3300013307 Ga0157372_10004137 Ga0157372_100041376 108
357 3300014497 Ga0182008_10021905 Ga0182008_100219055 108
358 3300014497 Ga0182008_10055715 Ga0182008_100557152 108
359 3300015261 Ga0182006_1000640 Ga0182006_100064023 108
360 3300015265 Ga0182005_1030291 Ga0182005_10302912 108
361 3300017792 Ga0163161_10013993 Ga0163161_100139934 108
362 3300017792 Ga0163161_10021713 Ga0163161_100217135 108
363 3300017792 Ga0163161_10036807 Ga0163161_100368073 108
364 3300017792 Ga0163161_10053950 Ga0163161_100539504 108
365 3300017792 Ga0163161_10352640 Ga0163161_103526402 108
366 3300025206 Ga0209435_100487 Ga0209435_1004874 108
367 3300025207 Ga0209760_100194 Ga0209760_10019417 108
368 3300025224 Ga0209784_100015 Ga0209784_100015120 108
369 3300025225 Ga0209566_100012 Ga0209566_100012120 108
370 3300025226 Ga0209674_100027 Ga0209674_100027120 108
371 3300025229 Ga0209147_100019 Ga0209147_100019120 108
372 3300025230 Ga0209563_100031 Ga0209563_100031120 108
373 3300025231 Ga0207427_100038 Ga0207427_10003817 108
374 3300025233 Ga0209437_100009 Ga0209437_100009644 108
375 3300025233 Ga0209437_106571 Ga0209437_1065712 108
376 3300025242 Ga0209258_100296 Ga0209258_1002964 108
377 3300025246 Ga0209646_1000292 Ga0209646_100029213 108
378 3300025253 Ga0209677_100016 Ga0209677_100016120 108
379 3300025256 Ga0209759_1004305 Ga0209759_10043057 108
380 3300025256 Ga0209759_1005302 Ga0209759_10053022 108
381 3300025261 Ga0209233_1000074 Ga0209233_100007417 108
382 3300025292 Ga0209676_1000056 Ga0209676_100005634 108
383 3300025292 Ga0209676_1000503 Ga0209676_100050324 108
384 3300025298 Ga0209050_1000361 Ga0209050_100036134 108
385 3300025303 Ga0209051_1000061 Ga0209051_100006134 108
386 3300025321 Ga0207656_10000014 Ga0207656_1000001438 108
387 3300025711 Ga0207696_1000293 Ga0207696_100029318 108
388 3300025711 Ga0207696_1002498 Ga0207696_10024987 108
389 3300025711 Ga0207696_1038649 Ga0207696_10386492 108
390 3300025711 Ga0207696_1049493 Ga0207696_10494931 108
391 3300025711 Ga0207696_1134603 Ga0207696_11346032 108
392 3300025728 Ga0207655_1000005 Ga0207655_1000005316 108
393 3300025728 Ga0207655_1000015 Ga0207655_1000015405 108
394 3300025728 Ga0207655_1002284 Ga0207655_10022847 108
395 3300025728 Ga0207655_1003175 Ga0207655_10031759 108
396 3300025728 Ga0207655_1108755 Ga0207655_11087552 108
397 3300025728 Ga0207655_1144367 Ga0207655_11443672 108
398 3300025735 Ga0207713_1000493 Ga0207713_10004937 108
399 3300025735 Ga0207713_1000696 Ga0207713_10006965 108
400 3300025735 Ga0207713_1007669 Ga0207713_10076693 108
401 3300025735 Ga0207713_1007824 Ga0207713_10078243 108
402 3300025735 Ga0207713_1022834 Ga0207713_10228343 108
403 3300025735 Ga0207713_1030419 Ga0207713_10304193 108
404 3300025735 Ga0207713_1037519 Ga0207713_10375191 108
405 3300025735 Ga0207713_1121328 Ga0207713_11213282 108
406 3300025735 Ga0207713_1127585 Ga0207713_11275852 108
407 3300025914 Ga0207671_10000019 Ga0207671_10000019240 108
408 3300025914 Ga0207671_10108147 Ga0207671_101081473 108
409 3300025920 Ga0207649_10000002 Ga0207649_10000002427 108
410 3300025923 Ga0207681_10002090 Ga0207681_100020907 108
411 3300025925 Ga0207650_10000337 Ga0207650_1000033714 108
412 3300025925 Ga0207650_10000421 Ga0207650_100004218 108
413 3300025933 Ga0207706_10000136 Ga0207706_1000013634 108
414 3300025934 Ga0207686_10005889 Ga0207686_100058896 108
415 3300025935 Ga0207709_10116462 Ga0207709_101164623 108
416 3300025935 Ga0207709_10212157 Ga0207709_102121572 108
417 3300025935 Ga0207709_10426065 Ga0207709_104260651 108
418 3300025945 Ga0207679_10000006 Ga0207679_1000000664 108
419 3300025945 Ga0207679_10251297 Ga0207679_102512972 108
420 3300025981 Ga0207640_10342229 Ga0207640_103422292 108
421 3300026041 Ga0207639_10004918 Ga0207639_100049189 108
422 3300027312 Ga0209371_1000414 Ga0209371_10004149 108
423 3300027312 Ga0209371_1034274 Ga0209371_10342742 108
424 3300027876 Ga0209974_10147495 Ga0209974_101474952 108
425 3300027907 Ga0207428_10115665 Ga0207428_101156652 108
426 3300030500 Ga0268256_1000355 Ga0268256_10003559 108
427 3300030500 Ga0268256_1038965 Ga0268256_10389652 108
428 3300030521 Ga0307511_10165516 Ga0307511_101655161 108
429 3300031731 Ga0307405_10000600 Ga0307405_100006005 108
430 3300041407 Ga0439447_007855 Ga0439447_007855_1843_2169 108
431 3300041411 Ga0439466_0000163 Ga0439466_0000163_4043_4369 108
432 3300041411 Ga0439466_0005958 Ga0439466_0005958_1623_1949 108
433 3300041509 Ga0451843_1387418 Ga0451843_1387418_12_338 108
434 3300042006 Ga0439432_000131 Ga0439432_000131_3980_4306 108
435 3300042006 Ga0439432_090129 Ga0439432_090129_184_510 108
436 3300042013 Ga0439456_000074 Ga0439456_000074_1615_1941 108
437 3300042016 Ga0439463_000931 Ga0439463_000931_3972_4298 108
438 3300042134 Ga0450898_008349 Ga0450898_008349_1283_1609 108
439 3300042135 Ga0450899_013446 Ga0450899_013446_341_667 108
440 3300042136 Ga0450900_015198 Ga0450900_015198_615_941 108
441 3300042137 Ga0450902_000613 Ga0450902_000613_122_448 108
442 3300042142 Ga0450905_015180 Ga0450905_015180_694_1020 108
443 3300042142 Ga0450905_088041 Ga0450905_088041_95_421 108
444 3300042533 Ga0450901_007035 Ga0450901_007035_664_990 108
445 3300042993 Ga0439440_0002537 Ga0439440_0002537_1836_2162 108
446 3300046453 Ga0495627_001977 Ga0495627_001977_5509_5835 108
447 3300046455 Ga0495603_0079892 Ga0495603_0079892_1156_1485 108
448 3300046458 Ga0495591_002596 Ga0495591_002596_4097_4423 108
449 3300046458 Ga0495591_008429 Ga0495591_008429_539_868 108
450 3300046471 Ga0495650_0058133 Ga0495650_0058133_674_1003 108
451 3300046474 Ga0495605_0000362 Ga0495605_0000362_4170_4499 108
452 3300046499 Ga0495594_0000506 Ga0495594_0000506_17035_17364 108
453 3300046501 Ga0495607_0015729 Ga0495607_0015729_242_568 108
454 3300046501 Ga0495607_0097136 Ga0495607_0097136_289_615 108
455 3300046501 Ga0495607_0236195 Ga0495607_0236195_13_339 108
456 3300046501 Ga0495607_0534086 Ga0495607_0534086_29_355 108
457 3300046506 Ga0495583_0000701 Ga0495583_0000701_4162_4491 108
458 3300046506 Ga0495583_0001463 Ga0495583_0001463_19342_19668 108
459 3300046507 Ga0495606_0000518 Ga0495606_0000518_21609_21935 108
460 3300046507 Ga0495606_0016021 Ga0495606_0016021_1339_1665 108
461 3300046512 Ga0495610_0013001 Ga0495610_0013001_4144_4473 108
462 3300046512 Ga0495610_0026056 Ga0495610_0026056_1755_2081 108
463 3300046512 Ga0495610_0050035 Ga0495610_0050035_682_1008 108
464 3300046512 Ga0495610_0054490 Ga0495610_0054490_1018_1344 108
465 3300046513 Ga0495616_0250496 Ga0495616_0250496_341_670 108
466 3300046515 Ga0495620_0000003 Ga0495620_0000003_117764_118090 108
467 3300046515 Ga0495620_0000219 Ga0495620_0000219_38666_38995 108
468 3300046515 Ga0495620_0021320 Ga0495620_0021320_1348_1674 108
469 3300046515 Ga0495620_0082315 Ga0495620_0082315_111_437 108
470 3300046518 Ga0495631_0088232 Ga0495631_0088232_841_1167 108
471 3300046519 Ga0495632_0000368 Ga0495632_0000368_4695_5021 108
472 3300046519 Ga0495632_0006908 Ga0495632_0006908_2246_2572 108
473 3300046520 Ga0495637_0021522 Ga0495637_0021522_1010_1339 108
474 3300046522 Ga0495643_0000116 Ga0495643_0000116_38463_38789 108
475 3300046522 Ga0495643_0000890 Ga0495643_0000890_2289_2615 108
476 3300046522 Ga0495643_0001490 Ga0495643_0001490_18789_19115 108
477 3300046522 Ga0495643_0008981 Ga0495643_0008981_1330_1656 108
478 3300046522 Ga0495643_0044794 Ga0495643_0044794_702_1028 108
479 3300046524 Ga0495648_0001580 Ga0495648_0001580_17181_17507 108
480 3300046524 Ga0495648_0021013 Ga0495648_0021013_929_1258 108
481 3300046524 Ga0495648_0067596 Ga0495648_0067596_999_1325 108
482 3300046530 Ga0495654_0000816 Ga0495654_0000816_4120_4446 108
483 3300046530 Ga0495654_0013142 Ga0495654_0013142_1512_1841 108
484 3300046530 Ga0495654_0027634 Ga0495654_0027634_1601_1927 108
485 3300046530 Ga0495654_0381647 Ga0495654_0381647_209_535 108
486 3300046538 Ga0495609_0000317 Ga0495609_0000317_38663_38992 108
487 3300046542 Ga0495597_0002162 Ga0495597_0002162_11061_11390 108
488 3300046558 Ga0495633_0000476 Ga0495633_0000476_38780_39109 108
489 3300046648 Ga0495611_0002772 Ga0495611_0002772_4168_4497 108
490 3300046660 Ga0495625_0078211 Ga0495625_0078211_21_347 108
491 3300046665 Ga0495661_0000232 Ga0495661_0000232_4182_4511 108
492 3300046665 Ga0495661_0002086 Ga0495661_0002086_10477_10803 108
493 3300046665 Ga0495661_0034184 Ga0495661_0034184_1620_1946 108
494 3300046691 Ga0495670_0004837 Ga0495670_0004837_5158_5487 108
495 3300046692 Ga0495671_0007107 Ga0495671_0007107_2055_2381 108
496 3300046692 Ga0495671_0019402 Ga0495671_0019402_1891_2220 108
497 3300046694 Ga0495649_0004030 Ga0495649_0004030_2988_3314 108
498 3300046694 Ga0495649_0112315 Ga0495649_0112315_101_427 108
499 3300046694 Ga0495649_0153383 Ga0495649_0153383_497_823 108
500 3300046794 Ga0495589_0003025 Ga0495589_0003025_1644_1970 108
501 3300046794 Ga0495589_0008204 Ga0495589_0008204_4150_4479 108
502 3300046810 Ga0495660_0010105 Ga0495660_0010105_1454_1783 108
503 3300046810 Ga0495660_0202485 Ga0495660_0202485_250_576 108
504 3300047320 Ga0495672_0084182 Ga0495672_0084182_204_530 108
505 3300047323 Ga0495683_0000289 Ga0495683_0000289_38791_39120 108
506 3300047446 Ga0495679_006361 Ga0495679_006361_3397_3726 108
507 3300047446 Ga0495679_006417 Ga0495679_006417_1142_1468 108
508 3300047446 Ga0495679_017586 Ga0495679_017586_803_1129 108
509 3300047469 Ga0495673_0005327 Ga0495673_0005327_4181_4507 108
510 3300047469 Ga0495673_0013122 Ga0495673_0013122_2429_2758 108
511 3300047470 Ga0495681_0048475 Ga0495681_0048475_1517_1846 108
512 3300047470 Ga0495681_0058080 Ga0495681_0058080_283_609 108
513 3300047470 Ga0495681_0083985 Ga0495681_0083985_146_472 108
514 3300047472 Ga0495686_0307783 Ga0495686_0307783_127_453 108
515 3300047472 Ga0495686_0442794 Ga0495686_0442794_333_659 108
516 3300048913 Ga0496110_0314329 Ga0496110_0314329_1018_1344 108
517 3300048917 Ga0496114_0137484 Ga0496114_0137484_1644_1970 108
518 3300048917 Ga0496114_0321493 Ga0496114_0321493_183_509 108
519 3300048919 Ga0496116_0029406 Ga0496116_0029406_1469_1795 108
520 3300048920 Ga0496117_0001478 Ga0496117_0001478_4589_4915 108
521 3300048920 Ga0496117_0007829 Ga0496117_0007829_5908_6234 108
522 3300048920 Ga0496117_0008263 Ga0496117_0008263_3729_4055 108
523 3300048920 Ga0496117_0041468 Ga0496117_0041468_2122_2448 108
524 3300048920 Ga0496117_0059427 Ga0496117_0059427_1640_1966 108
525 3300048920 Ga0496117_0104654 Ga0496117_0104654_1237_1563 108
526 3300048920 Ga0496117_0289699 Ga0496117_0289699_10_336 108
527 3300048920 Ga0496117_0621726 Ga0496117_0621726_55_384 108
528 3300048921 Ga0496118_0004423 Ga0496118_0004423_11641_11967 108
529 3300048921 Ga0496118_0076077 Ga0496118_0076077_1025_1351 108
530 3300048921 Ga0496118_0084480 Ga0496118_0084480_1214_1540 108
531 3300048921 Ga0496118_0088067 Ga0496118_0088067_220_546 108
532 3300048922 Ga0496119_0000207 Ga0496119_0000207_43990_44316 108
533 3300048922 Ga0496119_0037107 Ga0496119_0037107_939_1265 108
534 3300048922 Ga0496119_0125463 Ga0496119_0125463_738_1064 108
535 3300048922 Ga0496119_0142247 Ga0496119_0142247_583_909 108
536 3300048922 Ga0496119_0270849 Ga0496119_0270849_66_392 108
537 3300048923 Ga0496120_0009849 Ga0496120_0009849_5496_5822 108
538 3300048923 Ga0496120_0015054 Ga0496120_0015054_88_414 108
539 3300048923 Ga0496120_0076271 Ga0496120_0076271_1344_1670 108
540 3300048923 Ga0496120_0109051 Ga0496120_0109051_966_1292 108
541 3300048923 Ga0496120_0163695 Ga0496120_0163695_27_353 108
542 3300048924 Ga0496121_0066698 Ga0496121_0066698_1121_1447 108
543 3300048924 Ga0496121_0094464 Ga0496121_0094464_876_1202 108
544 3300048924 Ga0496121_0116495 Ga0496121_0116495_1513_1839 108
545 3300048924 Ga0496121_0300810 Ga0496121_0300810_653_979 108
546 3300048925 Ga0496122_0002127 Ga0496122_0002127_5070_5396 108
547 3300048925 Ga0496122_0018595 Ga0496122_0018595_5216_5545 108
548 3300048925 Ga0496122_0063303 Ga0496122_0063303_1180_1506 108
549 3300048925 Ga0496122_0087950 Ga0496122_0087950_1663_1989 108
550 3300048925 Ga0496122_0094718 Ga0496122_0094718_696_1022 108
551 3300048925 Ga0496122_0115168 Ga0496122_0115168_886_1212 108
552 3300048925 Ga0496122_0172038 Ga0496122_0172038_639_965 108
553 3300048926 Ga0496123_0000387 Ga0496123_0000387_34186_34512 108
554 3300048926 Ga0496123_0027794 Ga0496123_0027794_984_1313 108
555 3300048926 Ga0496123_0048509 Ga0496123_0048509_1657_1983 108
556 3300048926 Ga0496123_0069293 Ga0496123_0069293_1739_2065 108
557 3300048926 Ga0496123_0086236 Ga0496123_0086236_1405_1731 108
558 3300048927 Ga0496124_0009462 Ga0496124_0009462_4043_4369 108
559 3300048927 Ga0496124_0017418 Ga0496124_0017418_5295_5624 108
560 3300048927 Ga0496124_0019452 Ga0496124_0019452_2769_3095 108
561 3300048927 Ga0496124_0024971 Ga0496124_0024971_1629_1955 108
562 3300048927 Ga0496124_0027845 Ga0496124_0027845_4538_4864 108
563 3300048927 Ga0496124_0177850 Ga0496124_0177850_152_478 108
564 3300048927 Ga0496124_0209443 Ga0496124_0209443_813_1139 108
565 3300048927 Ga0496124_0358988 Ga0496124_0358988_150_476 108
566 3300048928 Ga0496125_0009616 Ga0496125_0009616_5521_5847 108
567 3300048928 Ga0496125_0017334 Ga0496125_0017334_5587_5913 108
568 3300048928 Ga0496125_0028811 Ga0496125_0028811_3287_3613 108
569 3300048928 Ga0496125_0035744 Ga0496125_0035744_947_1273 108
570 3300048928 Ga0496125_0067834 Ga0496125_0067834_991_1317 108
571 3300048928 Ga0496125_0134073 Ga0496125_0134073_1149_1475 108
572 3300048928 Ga0496125_0138426 Ga0496125_0138426_362_688 108
573 3300048929 Ga0496126_0012460 Ga0496126_0012460_5051_5377 108
574 3300048929 Ga0496126_0074611 Ga0496126_0074611_1123_1449 108
575 3300048929 Ga0496126_0187901 Ga0496126_0187901_1066_1392 108
576 3300048929 Ga0496126_0481092 Ga0496126_0481092_643_969 108
577 3300049459 Ga0495678_000412 Ga0495678_000412_4163_4492 108
578 3300049460 Ga0495682_0000616 Ga0495682_0000616_19729_20055 108
579 3300049569 Ga0501032_0702482 Ga0501032_0702482_271_603 108
580 3300049570 Ga0501033_0384040 Ga0501033_0384040_355_687 108
581 3300049571 Ga0501034_0000370 Ga0501034_0000370_37526_37852 108
582 3300049822 Ga0501035_0740385 Ga0501035_0740385_223_555 108
583 3300050514 nmdc:mga08x19_482303_c2 nmdc:mga08x19_482303_c2_118_444 108
584 3300053161 Ga0500634_0031621 Ga0500634_0031621_1230_1556 108
585 2124908027 MRS2a_Contig_74 MRS2a_00596910 109
586 3300003781 Ga0055536_1000454 Ga0055536_100045421 109
587 3300003781 Ga0055536_1005665 Ga0055536_10056652 109
588 3300003781 Ga0055536_1045992 Ga0055536_10459922 109
589 3300003784 Ga0055534_1046413 Ga0055534_10464131 109
590 3300003791 Ga0055530_10000176 Ga0055530_1000017637 109
591 3300003791 Ga0055530_10001302 Ga0055530_100013025 109
592 3300003792 Ga0055540_1000193 Ga0055540_100019337 109
593 3300003792 Ga0055540_1000385 Ga0055540_100038519 109
594 3300003794 Ga0055531_10001143 Ga0055531_100011435 109
595 3300003794 Ga0055531_10001439 Ga0055531_1000143916 109
596 3300003794 Ga0055531_10114007 Ga0055531_101140072 109
597 3300005288 Ga0065714_10011520 Ga0065714_100115201 109
598 3300005288 Ga0065714_10011532 Ga0065714_100115322 109
599 3300005288 Ga0065714_10067449 Ga0065714_100674494 109
600 3300005288 Ga0065714_10071416 Ga0065714_100714164 109
601 3300005288 Ga0065714_10072965 Ga0065714_100729654 109
602 3300005288 Ga0065714_10115407 Ga0065714_101154071 109
603 3300005288 Ga0065714_10342080 Ga0065714_103420802 109
604 3300005289 Ga0065704_10083727 Ga0065704_100837274 109
605 3300005290 Ga0065712_10002535 Ga0065712_100025354 109
606 3300005293 Ga0065715_10143679 Ga0065715_101436793 109
607 3300005457 Ga0070662_100026557 Ga0070662_1000265572 109
608 3300005548 Ga0070665_100035692 Ga0070665_1000356923 109
609 3300005548 Ga0070665_100432236 Ga0070665_1004322362 109
610 3300006051 Ga0075364_10150505 Ga0075364_101505052 109
611 3300006051 Ga0075364_10171938 Ga0075364_101719382 109
612 3300006058 Ga0075432_10002236 Ga0075432_100022363 109
613 3300006058 Ga0075432_10002301 Ga0075432_100023015 109
614 3300006058 Ga0075432_10004206 Ga0075432_100042061 109
615 3300006058 Ga0075432_10006320 Ga0075432_100063203 109
616 3300006058 Ga0075432_10175545 Ga0075432_101755452 109
617 3300006177 Ga0075362_10233936 Ga0075362_102339361 109
618 3300006177 Ga0075362_10581420 Ga0075362_105814202 109
619 3300006186 Ga0075369_10005197 Ga0075369_100051973 109
620 3300006914 Ga0075436_100042714 Ga0075436_1000427143 109
621 3300006946 Ga0079104_1000414 Ga0079104_100041437 109
622 3300006946 Ga0079104_1119063 Ga0079104_11190632 109
623 3300006948 Ga0099826_10023577 Ga0099826_100235773 109
624 3300009011 Ga0105251_10007385 Ga0105251_100073853 109
625 3300009011 Ga0105251_10098651 Ga0105251_100986512 109
626 3300009011 Ga0105251_10336684 Ga0105251_103366842 109
627 3300009011 Ga0105251_10408974 Ga0105251_104089742 109
628 3300009036 Ga0105244_10008012 Ga0105244_100080124 109
629 3300009036 Ga0105244_10077072 Ga0105244_100770722 109
630 3300009036 Ga0105244_10171466 Ga0105244_101714662 109
631 3300009092 Ga0105250_10005536 Ga0105250_100055363 109
632 3300009092 Ga0105250_10009461 Ga0105250_100094615 109
633 3300009148 Ga0105243_10049392 Ga0105243_100493924 109
634 3300009176 Ga0105242_10184150 Ga0105242_101841502 109
635 3300009553 Ga0105249_13092582 Ga0105249_130925822 109
636 3300011119 Ga0105246_10196123 Ga0105246_101961232 109
637 3300011119 Ga0105246_10628915 Ga0105246_106289152 109
638 3300012498 Ga0157345_1000166 Ga0157345_10001669 109
639 3300012502 Ga0157347_1019611 Ga0157347_10196112 109
640 3300013100 Ga0157373_10001582 Ga0157373_1000158216 109
641 3300013100 Ga0157373_10006202 Ga0157373_100062023 109
642 3300013100 Ga0157373_10053157 Ga0157373_100531572 109
643 3300013100 Ga0157373_10150030 Ga0157373_101500302 109
644 3300013100 Ga0157373_10879230 Ga0157373_108792302 109
645 3300013102 Ga0157371_10006271 Ga0157371_100062716 109
646 3300013102 Ga0157371_10016205 Ga0157371_100162055 109
647 3300013104 Ga0157370_10056348 Ga0157370_100563483 109
648 3300013104 Ga0157370_10084574 Ga0157370_100845742 109
649 3300013104 Ga0157370_10153170 Ga0157370_101531702 109
650 3300013104 Ga0157370_10807467 Ga0157370_108074671 109
651 3300013104 Ga0157370_11325773 Ga0157370_113257731 109
652 3300013105 Ga0157369_10015829 Ga0157369_100158293 109
653 3300013105 Ga0157369_10246969 Ga0157369_102469692 109
654 3300013105 Ga0157369_10347004 Ga0157369_103470043 109
655 3300013105 Ga0157369_10428520 Ga0157369_104285202 109
656 3300013105 Ga0157369_10828348 Ga0157369_108283482 109
657 3300013105 Ga0157369_11267519 Ga0157369_112675192 109
658 3300013306 Ga0163162_10012886 Ga0163162_100128869 109
659 3300013306 Ga0163162_11096331 Ga0163162_110963311 109
660 3300013307 Ga0157372_10001549 Ga0157372_100015496 109
661 3300013308 Ga0157375_11290937 Ga0157375_112909371 109
662 3300013308 Ga0157375_11951224 Ga0157375_119512242 109
663 3300014497 Ga0182008_10005701 Ga0182008_100057015 109
664 3300014497 Ga0182008_10008549 Ga0182008_100085491 109
665 3300014497 Ga0182008_10018278 Ga0182008_100182785 109
666 3300014497 Ga0182008_10047996 Ga0182008_100479962 109
667 3300014497 Ga0182008_10107940 Ga0182008_101079402 109
668 3300014497 Ga0182008_10483638 Ga0182008_104836382 109
669 3300015261 Ga0182006_1001009 Ga0182006_10010093 109
670 3300015261 Ga0182006_1030050 Ga0182006_10300503 109
671 3300015261 Ga0182006_1041913 Ga0182006_10419133 109
672 3300015261 Ga0182006_1057651 Ga0182006_10576512 109
673 3300015262 Ga0182007_10004583 Ga0182007_100045837 109
674 3300015262 Ga0182007_10019086 Ga0182007_100190863 109
675 3300015265 Ga0182005_1002382 Ga0182005_10023823 109
676 3300015265 Ga0182005_1011517 Ga0182005_10115174 109
677 3300015265 Ga0182005_1107175 Ga0182005_11071751 109
678 3300015265 Ga0182005_1134649 Ga0182005_11346491 109
679 3300017792 Ga0163161_10003732 Ga0163161_100037329 109
680 3300017792 Ga0163161_10210632 Ga0163161_102106322 109
681 3300025292 Ga0209676_1000524 Ga0209676_100052416 109
682 3300025292 Ga0209676_1007863 Ga0209676_10078635 109
683 3300025298 Ga0209050_1000060 Ga0209050_100006044 109
684 3300025303 Ga0209051_1000037 Ga0209051_100003745 109
685 3300025304 Ga0209257_1008780 Ga0209257_10087803 109
686 3300025711 Ga0207696_1002462 Ga0207696_10024627 109
687 3300025711 Ga0207696_1005740 Ga0207696_10057404 109
688 3300025728 Ga0207655_1007329 Ga0207655_10073295 109
689 3300025728 Ga0207655_1084598 Ga0207655_10845982 109
690 3300025735 Ga0207713_1055157 Ga0207713_10551572 109
691 3300025735 Ga0207713_1104000 Ga0207713_11040002 109
692 3300025934 Ga0207686_10114636 Ga0207686_101146362 109
693 3300025935 Ga0207709_10022130 Ga0207709_100221303 109
694 3300027111 Ga0209281_1000010 Ga0209281_1000010194 109
695 3300027111 Ga0209281_1003222 Ga0209281_10032223 109
696 3300027111 Ga0209281_1008557 Ga0209281_10085572 109
697 3300027666 Ga0209282_1053449 Ga0209282_10534493 109
698 3300027907 Ga0207428_10464313 Ga0207428_104643132 109
699 3300027907 Ga0207428_11008923 Ga0207428_110089231 109
700 3300028379 Ga0268266_10035410 Ga0268266_100354103 109
701 3300028379 Ga0268266_10489311 Ga0268266_104893112 109
702 3300028786 Ga0307517_10330548 Ga0307517_103305482 109
703 3300030521 Ga0307511_10095374 Ga0307511_100953743 109
704 3300030731 Ga0316177_1109772 Ga0316177_11097723 109
705 3300030733 Ga0314311_1132065 Ga0314311_11320652 109
706 3300030734 Ga0316179_1069901 Ga0316179_10699012 109
707 3300030734 Ga0316179_1072406 Ga0316179_10724061 109
708 3300030735 Ga0316178_1083052 Ga0316178_108305216 109
709 3300030742 Ga0316183_1110648 Ga0316183_11106482 109
710 3300030744 Ga0316181_1073709 Ga0316181_10737092 109
711 3300030744 Ga0316181_1229307 Ga0316181_12293073 109
712 3300031548 Ga0307408_100001820 Ga0307408_1000018206 109
713 3300031548 Ga0307408_100012631 Ga0307408_1000126313 109
714 3300031548 Ga0307408_100033101 Ga0307408_1000331015 109
715 3300031548 Ga0307408_100043394 Ga0307408_1000433942 109
716 3300031548 Ga0307408_100091057 Ga0307408_1000910573 109
717 3300031548 Ga0307408_100304403 Ga0307408_1003044032 109
718 3300031730 Ga0307516_10165237 Ga0307516_101652372 109
719 3300031731 Ga0307405_10002971 Ga0307405_100029713 109
720 3300031731 Ga0307405_10816712 Ga0307405_108167122 109
721 3300031824 Ga0307413_10030392 Ga0307413_100303923 109
722 3300031824 Ga0307413_10035507 Ga0307413_100355072 109
723 3300031901 Ga0307406_10404673 Ga0307406_104046732 109
724 3300031901 Ga0307406_11599635 Ga0307406_115996351 109
725 3300031903 Ga0307407_10394198 Ga0307407_103941982 109
726 3300031903 Ga0307407_11584211 Ga0307407_115842112 109
727 3300031911 Ga0307412_10001424 Ga0307412_100014244 109
728 3300031911 Ga0307412_10005406 Ga0307412_100054065 109
729 3300031911 Ga0307412_10005742 Ga0307412_100057425 109
730 3300031911 Ga0307412_10016716 Ga0307412_100167163 109
731 3300031911 Ga0307412_10028909 Ga0307412_100289094 109
732 3300031911 Ga0307412_10334663 Ga0307412_103346632 109
733 3300031911 Ga0307412_10549823 Ga0307412_105498231 109
734 3300031911 Ga0307412_12100073 Ga0307412_121000732 109
735 3300031995 Ga0307409_100044538 Ga0307409_1000445383 109
736 3300032002 Ga0307416_100204640 Ga0307416_1002046402 109
737 3300032002 Ga0307416_100478207 Ga0307416_1004782072 109
738 3300032004 Ga0307414_10108449 Ga0307414_101084492 109
739 3300032004 Ga0307414_10215889 Ga0307414_102158892 109
740 3300032004 Ga0307414_10225755 Ga0307414_102257552 109
741 3300032004 Ga0307414_10399640 Ga0307414_103996401 109
742 3300032004 Ga0307414_10470843 Ga0307414_104708432 109
743 3300032004 Ga0307414_11274515 Ga0307414_112745152 109
744 3300032005 Ga0307411_10028832 Ga0307411_100288322 109
745 3300032005 Ga0307411_10098638 Ga0307411_100986383 109
746 3300032005 Ga0307411_11721935 Ga0307411_117219352 109
747 3300033180 Ga0307510_10001784 Ga0307510_1000178421 109
748 3300041405 Ga0439438_001691 Ga0439438_001691_5294_5623 109
749 3300041405 Ga0439438_001896 Ga0439438_001896_4906_5235 109
750 3300041405 Ga0439438_005214 Ga0439438_005214_258_587 109
751 3300041405 Ga0439438_006476 Ga0439438_006476_2202_2531 109
752 3300041405 Ga0439438_010012 Ga0439438_010012_2093_2422 109
753 3300041405 Ga0439438_012538 Ga0439438_012538_1963_2292 109
754 3300041405 Ga0439438_014142 Ga0439438_014142_711_1040 109
755 3300041405 Ga0439438_018677 Ga0439438_018677_1293_1622 109
756 3300041407 Ga0439447_001121 Ga0439447_001121_5469_5798 109
757 3300041407 Ga0439447_002220 Ga0439447_002220_1669_1998 109
758 3300041407 Ga0439447_002824 Ga0439447_002824_5391_5720 109
759 3300041407 Ga0439447_009508 Ga0439447_009508_370_699 109
760 3300041407 Ga0439447_013121 Ga0439447_013121_1467_1796 109
761 3300041407 Ga0439447_040010 Ga0439447_040010_737_1066 109
762 3300041408 Ga0439453_0017923 Ga0439453_0017923_139_468 109
763 3300041410 Ga0439461_0072053 Ga0439461_0072053_289_618 109
764 3300041411 Ga0439466_0012003 Ga0439466_0012003_215_544 109
765 3300041411 Ga0439466_0015802 Ga0439466_0015802_2242_2571 109
766 3300041411 Ga0439466_0020615 Ga0439466_0020615_645_974 109
767 3300041411 Ga0439466_0022787 Ga0439466_0022787_1339_1668 109
768 3300041413 Ga0439465_0013128 Ga0439465_0013128_371_700 109
769 3300041503 Ga0451847_0095971 Ga0451847_0095971_65_394 109
770 3300041509 Ga0451843_0170682 Ga0451843_0170682_224_553 109
771 3300041997 Ga0439431_0038654 Ga0439431_0038654_431_760 109
772 3300041997 Ga0439431_0051182 Ga0439431_0051182_609_938 109
773 3300042000 Ga0439437_000171 Ga0439437_000171_4225_4554 109
774 3300042006 Ga0439432_006745 Ga0439432_006745_2089_2418 109
775 3300042006 Ga0439432_006900 Ga0439432_006900_834_1163 109
776 3300042006 Ga0439432_013630 Ga0439432_013630_165_494 109
777 3300042009 Ga0439451_015770 Ga0439451_015770_1153_1482 109
778 3300042009 Ga0439451_021244 Ga0439451_021244_852_1181 109
779 3300042009 Ga0439451_022951 Ga0439451_022951_839_1168 109
780 3300042009 Ga0439451_046689 Ga0439451_046689_328_657 109
781 3300042009 Ga0439451_048987 Ga0439451_048987_70_399 109
782 3300042010 Ga0439452_000207 Ga0439452_000207_38243_38572 109
783 3300042010 Ga0439452_001453 Ga0439452_001453_3957_4286 109
784 3300042010 Ga0439452_003681 Ga0439452_003681_2235_2564 109
785 3300042010 Ga0439452_005870 Ga0439452_005870_40_369 109
786 3300042012 Ga0439455_0002951 Ga0439455_0002951_2340_2669 109
787 3300042013 Ga0439456_001007 Ga0439456_001007_1082_1411 109
788 3300042013 Ga0439456_013066 Ga0439456_013066_1386_1715 109
789 3300042013 Ga0439456_057998 Ga0439456_057998_154_483 109
790 3300042016 Ga0439463_003800 Ga0439463_003800_761_1090 109
791 3300042016 Ga0439463_017076 Ga0439463_017076_653_982 109
792 3300042016 Ga0439463_025820 Ga0439463_025820_759_1088 109
793 3300042016 Ga0439463_052478 Ga0439463_052478_441_770 109
794 3300042115 Ga0450911_000204 Ga0450911_000204_5396_5725 109
795 3300042115 Ga0450911_001533 Ga0450911_001533_576_905 109
796 3300042115 Ga0450911_001690 Ga0450911_001690_706_1035 109
797 3300042115 Ga0450911_019593 Ga0450911_019593_378_707 109
798 3300042115 Ga0450911_022817 Ga0450911_022817_297_626 109
799 3300042117 Ga0450913_008618 Ga0450913_008618_49_378 109
800 3300042121 Ga0450919_000714 Ga0450919_000714_2018_2347 109
801 3300042121 Ga0450919_001291 Ga0450919_001291_2354_2683 109
802 3300042122 Ga0450920_008400 Ga0450920_008400_1097_1426 109
803 3300042124 Ga0450922_000147 Ga0450922_000147_3033_3362 109
804 3300042127 Ga0450890_001456 Ga0450890_001456_40_369 109
805 3300042137 Ga0450902_016728 Ga0450902_016728_473_802 109
806 3300042137 Ga0450902_035238 Ga0450902_035238_311_640 109
807 3300042138 Ga0450903_003177 Ga0450903_003177_2279_2608 109
808 3300042138 Ga0450903_022067 Ga0450903_022067_489_818 109
809 3300042138 Ga0450903_043155 Ga0450903_043155_293_622 109
810 3300042139 Ga0450904_000466 Ga0450904_000466_2318_2647 109
811 3300042139 Ga0450904_003311 Ga0450904_003311_879_1208 109
812 3300042142 Ga0450905_092763 Ga0450905_092763_16_345 109
813 3300042145 Ga0450906_000358 Ga0450906_000358_1422_1751 109
814 3300042145 Ga0450906_006543 Ga0450906_006543_712_1041 109
815 3300042146 Ga0450907_000197 Ga0450907_000197_20069_20398 109
816 3300042146 Ga0450907_000424 Ga0450907_000424_8337_8666 109
817 3300042146 Ga0450907_003201 Ga0450907_003201_439_768 109
818 3300042147 Ga0450910_000448 Ga0450910_000448_2245_2574 109
819 3300042147 Ga0450910_000974 Ga0450910_000974_1420_1749 109
820 3300042156 Ga0439446_0003304 Ga0439446_0003304_600_929 109
821 3300042156 Ga0439446_0014964 Ga0439446_0014964_312_641 109
822 3300042184 Ga0450908_033066 Ga0450908_033066_262_591 109
823 3300042185 Ga0450909_001937 Ga0450909_001937_1834_2163 109
824 3300042435 Ga0439434_0001659 Ga0439434_0001659_106_435 109
825 3300042435 Ga0439434_0022457 Ga0439434_0022457_206_535 109
826 3300042438 Ga0439459_0007181 Ga0439459_0007181_830_1159 109
827 3300042439 Ga0439464_0002872 Ga0439464_0002872_1977_2306 109
828 3300042461 Ga0439460_0033857 Ga0439460_0033857_42_371 109
829 3300042461 Ga0439460_0158649 Ga0439460_0158649_387_716 109
830 3300042461 Ga0439460_0271055 Ga0439460_0271055_98_427 109
831 3300042530 Ga0450916_003148 Ga0450916_003148_726_1055 109
832 3300042530 Ga0450916_046562 Ga0450916_046562_149_478 109
833 3300042532 Ga0450893_0018953 Ga0450893_0018953_638_967 109
834 3300042532 Ga0450893_0035470 Ga0450893_0035470_209_538 109
835 3300042993 Ga0439440_0004375 Ga0439440_0004375_2027_2356 109
836 3300042993 Ga0439440_0010195 Ga0439440_0010195_312_641 109
837 3300046452 Ga0495617_000127 Ga0495617_000127_4035_4364 109
838 3300046452 Ga0495617_021559 Ga0495617_021559_1201_1530 109
839 3300046452 Ga0495617_039352 Ga0495617_039352_229_558 109
840 3300046452 Ga0495617_065203 Ga0495617_065203_325_654 109
841 3300046452 Ga0495617_256887 Ga0495617_256887_81_410 109
842 3300046453 Ga0495627_000074 Ga0495627_000074_79478_79807 109
843 3300046453 Ga0495627_000733 Ga0495627_000733_4077_4406 109
844 3300046453 Ga0495627_007975 Ga0495627_007975_2997_3326 109
845 3300046453 Ga0495627_013168 Ga0495627_013168_1233_1562 109
846 3300046455 Ga0495603_0138625 Ga0495603_0138625_630_959 109
847 3300046457 Ga0495590_0006319 Ga0495590_0006319_194_523 109
848 3300046457 Ga0495590_0090451 Ga0495590_0090451_496_825 109
849 3300046458 Ga0495591_000351 Ga0495591_000351_33416_33745 109
850 3300046458 Ga0495591_004699 Ga0495591_004699_4031_4360 109
851 3300046458 Ga0495591_007840 Ga0495591_007840_48_377 109
852 3300046458 Ga0495591_009959 Ga0495591_009959_2377_2706 109
853 3300046458 Ga0495591_017008 Ga0495591_017008_1426_1755 109
854 3300046458 Ga0495591_020509 Ga0495591_020509_269_598 109
855 3300046458 Ga0495591_062064 Ga0495591_062064_618_947 109
856 3300046459 Ga0495629_0130214 Ga0495629_0130214_548_877 109
857 3300046460 Ga0495638_0008766 Ga0495638_0008766_3970_4299 109
858 3300046460 Ga0495638_0009529 Ga0495638_0009529_3630_3959 109
859 3300046460 Ga0495638_0022186 Ga0495638_0022186_274_603 109
860 3300046460 Ga0495638_0174564 Ga0495638_0174564_41_370 109
861 3300046460 Ga0495638_0370003 Ga0495638_0370003_51_380 109
862 3300046460 Ga0495638_0534188 Ga0495638_0534188_182_511 109
863 3300046463 Ga0495653_0023163 Ga0495653_0023163_4097_4426 109
864 3300046463 Ga0495653_0028970 Ga0495653_0028970_1633_1962 109
865 3300046463 Ga0495653_0119539 Ga0495653_0119539_466_795 109
866 3300046463 Ga0495653_0154263 Ga0495653_0154263_1184_1513 109
867 3300046463 Ga0495653_0346348 Ga0495653_0346348_596_925 109
868 3300046471 Ga0495650_0009577 Ga0495650_0009577_1146_1475 109
869 3300046471 Ga0495650_0013923 Ga0495650_0013923_2366_2695 109
870 3300046471 Ga0495650_0025032 Ga0495650_0025032_2447_2776 109
871 3300046471 Ga0495650_0025111 Ga0495650_0025111_2456_2785 109
872 3300046471 Ga0495650_0053515 Ga0495650_0053515_265_594 109
873 3300046471 Ga0495650_0068133 Ga0495650_0068133_843_1172 109
874 3300046471 Ga0495650_0083417 Ga0495650_0083417_433_762 109
875 3300046474 Ga0495605_0000182 Ga0495605_0000182_37118_37447 109
876 3300046474 Ga0495605_0000543 Ga0495605_0000543_4739_5068 109
877 3300046474 Ga0495605_0006153 Ga0495605_0006153_5392_5721 109
878 3300046474 Ga0495605_0008292 Ga0495605_0008292_5500_5829 109
879 3300046474 Ga0495605_0014838 Ga0495605_0014838_1008_1337 109
880 3300046474 Ga0495605_0026615 Ga0495605_0026615_1390_1719 109
881 3300046474 Ga0495605_0092019 Ga0495605_0092019_986_1315 109
882 3300046474 Ga0495605_0168874 Ga0495605_0168874_515_844 109
883 3300046474 Ga0495605_0244601 Ga0495605_0244601_281_610 109
884 3300046491 Ga0495584_0003206 Ga0495584_0003206_4769_5098 109
885 3300046491 Ga0495584_0006489 Ga0495584_0006489_4090_4419 109
886 3300046491 Ga0495584_0011307 Ga0495584_0011307_4106_4435 109
887 3300046491 Ga0495584_0012444 Ga0495584_0012444_1010_1339 109
888 3300046491 Ga0495584_0017462 Ga0495584_0017462_3259_3588 109
889 3300046491 Ga0495584_0029637 Ga0495584_0029637_1963_2292 109
890 3300046491 Ga0495584_0036106 Ga0495584_0036106_1372_1701 109
891 3300046491 Ga0495584_0052419 Ga0495584_0052419_1415_1744 109
892 3300046492 Ga0495585_0007614 Ga0495585_0007614_4115_4444 109
893 3300046492 Ga0495585_0008396 Ga0495585_0008396_4175_4504 109
894 3300046492 Ga0495585_0011899 Ga0495585_0011899_3394_3723 109
895 3300046492 Ga0495585_0019119 Ga0495585_0019119_872_1201 109
896 3300046492 Ga0495585_0022272 Ga0495585_0022272_248_577 109
897 3300046492 Ga0495585_0034124 Ga0495585_0034124_2482_2811 109
898 3300046492 Ga0495585_0048596 Ga0495585_0048596_1437_1766 109
899 3300046492 Ga0495585_0054031 Ga0495585_0054031_1817_2146 109
900 3300046492 Ga0495585_0077685 Ga0495585_0077685_165_494 109
901 3300046499 Ga0495594_0060354 Ga0495594_0060354_312_641 109
902 3300046500 Ga0495596_0037994 Ga0495596_0037994_81_410 109
903 3300046500 Ga0495596_0077745 Ga0495596_0077745_117_446 109
904 3300046501 Ga0495607_0000549 Ga0495607_0000549_5432_5761 109
905 3300046501 Ga0495607_0000721 Ga0495607_0000721_30138_30467 109
906 3300046501 Ga0495607_0001083 Ga0495607_0001083_20508_20837 109
907 3300046501 Ga0495607_0001478 Ga0495607_0001478_4085_4414 109
908 3300046501 Ga0495607_0012868 Ga0495607_0012868_1352_1681 109
909 3300046501 Ga0495607_0018822 Ga0495607_0018822_2365_2694 109
910 3300046501 Ga0495607_0027747 Ga0495607_0027747_2216_2545 109
911 3300046501 Ga0495607_0068205 Ga0495607_0068205_278_607 109
912 3300046501 Ga0495607_0092096 Ga0495607_0092096_937_1266 109
913 3300046501 Ga0495607_0170257 Ga0495607_0170257_38_367 109
914 3300046506 Ga0495583_0001430 Ga0495583_0001430_4314_4643 109
915 3300046506 Ga0495583_0002110 Ga0495583_0002110_4026_4355 109
916 3300046506 Ga0495583_0013261 Ga0495583_0013261_76_405 109
917 3300046506 Ga0495583_0052437 Ga0495583_0052437_1417_1746 109
918 3300046506 Ga0495583_0289118 Ga0495583_0289118_66_395 109
919 3300046507 Ga0495606_0008750 Ga0495606_0008750_3246_3575 109
920 3300046507 Ga0495606_0015690 Ga0495606_0015690_1654_1983 109
921 3300046507 Ga0495606_0053644 Ga0495606_0053644_2091_2420 109
922 3300046507 Ga0495606_0086804 Ga0495606_0086804_1147_1476 109
923 3300046507 Ga0495606_0132869 Ga0495606_0132869_970_1299 109
924 3300046507 Ga0495606_0209612 Ga0495606_0209612_597_926 109
925 3300046507 Ga0495606_0233472 Ga0495606_0233472_650_979 109
926 3300046512 Ga0495610_0006641 Ga0495610_0006641_2408_2737 109
927 3300046512 Ga0495610_0011965 Ga0495610_0011965_987_1316 109
928 3300046512 Ga0495610_0062865 Ga0495610_0062865_42_371 109
929 3300046512 Ga0495610_0118983 Ga0495610_0118983_70_399 109
930 3300046512 Ga0495610_0263793 Ga0495610_0263793_20_349 109
931 3300046513 Ga0495616_0000823 Ga0495616_0000823_1903_2232 109
932 3300046513 Ga0495616_0003782 Ga0495616_0003782_5925_6254 109
933 3300046513 Ga0495616_0007448 Ga0495616_0007448_2351_2680 109
934 3300046513 Ga0495616_0021398 Ga0495616_0021398_561_890 109
935 3300046513 Ga0495616_0049557 Ga0495616_0049557_1382_1711 109
936 3300046513 Ga0495616_0065241 Ga0495616_0065241_131_460 109
937 3300046513 Ga0495616_0079097 Ga0495616_0079097_1080_1409 109
938 3300046515 Ga0495620_0002112 Ga0495620_0002112_4115_4444 109
939 3300046515 Ga0495620_0023069 Ga0495620_0023069_1391_1720 109
940 3300046515 Ga0495620_0038356 Ga0495620_0038356_1367_1696 109
941 3300046515 Ga0495620_0056662 Ga0495620_0056662_307_636 109
942 3300046515 Ga0495620_0171733 Ga0495620_0171733_29_358 109
943 3300046517 Ga0495630_0186104 Ga0495630_0186104_1032_1361 109
944 3300046518 Ga0495631_0001514 Ga0495631_0001514_1418_1747 109
945 3300046518 Ga0495631_0002924 Ga0495631_0002924_4079_4408 109
946 3300046519 Ga0495632_0001004 Ga0495632_0001004_4339_4668 109
947 3300046519 Ga0495632_0001169 Ga0495632_0001169_18067_18396 109
948 3300046519 Ga0495632_0003894 Ga0495632_0003894_3942_4271 109
949 3300046519 Ga0495632_0004016 Ga0495632_0004016_5518_5847 109
950 3300046519 Ga0495632_0009005 Ga0495632_0009005_4163_4492 109
951 3300046519 Ga0495632_0022208 Ga0495632_0022208_1419_1748 109
952 3300046519 Ga0495632_0053322 Ga0495632_0053322_1211_1540 109
953 3300046519 Ga0495632_0065401 Ga0495632_0065401_1410_1739 109
954 3300046519 Ga0495632_0066359 Ga0495632_0066359_1016_1345 109
955 3300046519 Ga0495632_0127958 Ga0495632_0127958_535_864 109
956 3300046519 Ga0495632_0522548 Ga0495632_0522548_58_387 109
957 3300046520 Ga0495637_0004413 Ga0495637_0004413_3289_3618 109
958 3300046520 Ga0495637_0005233 Ga0495637_0005233_2329_2658 109
959 3300046520 Ga0495637_0014398 Ga0495637_0014398_1782_2111 109
960 3300046520 Ga0495637_0018333 Ga0495637_0018333_2890_3219 109
961 3300046520 Ga0495637_0020873 Ga0495637_0020873_2539_2868 109
962 3300046520 Ga0495637_0028969 Ga0495637_0028969_611_940 109
963 3300046520 Ga0495637_0030890 Ga0495637_0030890_1409_1738 109
964 3300046520 Ga0495637_0031897 Ga0495637_0031897_471_800 109
965 3300046520 Ga0495637_0042927 Ga0495637_0042927_91_420 109
966 3300046520 Ga0495637_0045825 Ga0495637_0045825_1409_1738 109
967 3300046520 Ga0495637_0045923 Ga0495637_0045923_1390_1719 109
968 3300046520 Ga0495637_0080271 Ga0495637_0080271_867_1196 109
969 3300046522 Ga0495643_0025313 Ga0495643_0025313_2093_2422 109
970 3300046522 Ga0495643_0115631 Ga0495643_0115631_982_1311 109
971 3300046522 Ga0495643_0129424 Ga0495643_0129424_264_593 109
972 3300046522 Ga0495643_0136079 Ga0495643_0136079_287_616 109
973 3300046523 Ga0495644_0027732 Ga0495644_0027732_472_801 109
974 3300046523 Ga0495644_0105512 Ga0495644_0105512_497_826 109
975 3300046524 Ga0495648_0001113 Ga0495648_0001113_1802_2131 109
976 3300046524 Ga0495648_0007222 Ga0495648_0007222_3934_4263 109
977 3300046524 Ga0495648_0010337 Ga0495648_0010337_5372_5701 109
978 3300046524 Ga0495648_0019892 Ga0495648_0019892_436_765 109
979 3300046524 Ga0495648_0029271 Ga0495648_0029271_1750_2079 109
980 3300046524 Ga0495648_0084387 Ga0495648_0084387_1021_1350 109
981 3300046524 Ga0495648_0113600 Ga0495648_0113600_264_593 109
982 3300046524 Ga0495648_0216408 Ga0495648_0216408_168_497 109
983 3300046524 Ga0495648_0396484 Ga0495648_0396484_227_556 109
984 3300046526 Ga0495666_0036672 Ga0495666_0036672_414_743 109
985 3300046526 Ga0495666_0045910 Ga0495666_0045910_1588_1917 109
986 3300046526 Ga0495666_0047318 Ga0495666_0047318_933_1262 109
987 3300046528 Ga0495642_0000398 Ga0495642_0000398_19022_19351 109
988 3300046528 Ga0495642_0105252 Ga0495642_0105252_137_466 109
989 3300046530 Ga0495654_0001589 Ga0495654_0001589_3203_3532 109
990 3300046530 Ga0495654_0008410 Ga0495654_0008410_1937_2266 109
991 3300046530 Ga0495654_0011659 Ga0495654_0011659_2946_3275 109
992 3300046530 Ga0495654_0013168 Ga0495654_0013168_2770_3099 109
993 3300046530 Ga0495654_0071960 Ga0495654_0071960_1032_1361 109
994 3300046530 Ga0495654_0124604 Ga0495654_0124604_793_1122 109
995 3300046530 Ga0495654_0142796 Ga0495654_0142796_694_1023 109
996 3300046530 Ga0495654_0166871 Ga0495654_0166871_51_380 109
997 3300046530 Ga0495654_0219997 Ga0495654_0219997_179_508 109
998 3300046535 Ga0495586_0070019 Ga0495586_0070019_730_1059 109
999 3300046536 Ga0495587_0026110 Ga0495587_0026110_3191_3520 109
1000 3300046536 Ga0495587_0204982 Ga0495587_0204982_372_701 109
1001 3300046536 Ga0495587_0411086 Ga0495587_0411086_15_344 109
1002 3300046538 Ga0495609_0000006 Ga0495609_0000006_372350_372679 109
1003 3300046538 Ga0495609_0002066 Ga0495609_0002066_1263_1592 109
1004 3300046538 Ga0495609_0005135 Ga0495609_0005135_4165_4494 109
1005 3300046538 Ga0495609_0009658 Ga0495609_0009658_1385_1714 109
1006 3300046538 Ga0495609_0012540 Ga0495609_0012540_1397_1726 109
1007 3300046538 Ga0495609_0043508 Ga0495609_0043508_310_639 109
1008 3300046538 Ga0495609_0070601 Ga0495609_0070601_119_448 109
1009 3300046542 Ga0495597_0000040 Ga0495597_0000040_33866_34195 109
1010 3300046542 Ga0495597_0009538 Ga0495597_0009538_4084_4413 109
1011 3300046542 Ga0495597_0011500 Ga0495597_0011500_3913_4242 109
1012 3300046542 Ga0495597_0015427 Ga0495597_0015427_2524_2853 109
1013 3300046542 Ga0495597_0065409 Ga0495597_0065409_1205_1534 109
1014 3300046543 Ga0495645_0109363 Ga0495645_0109363_1371_1700 109
1015 3300046557 Ga0495622_0003985 Ga0495622_0003985_4027_4356 109
1016 3300046557 Ga0495622_0005610 Ga0495622_0005610_4105_4434 109
1017 3300046557 Ga0495622_0155316 Ga0495622_0155316_504_833 109
1018 3300046558 Ga0495633_0006725 Ga0495633_0006725_4849_5178 109
1019 3300046558 Ga0495633_0008551 Ga0495633_0008551_1004_1333 109
1020 3300046615 Ga0495656_0001597 Ga0495656_0001597_3968_4297 109
1021 3300046616 Ga0495668_0070744 Ga0495668_0070744_1554_1883 109
1022 3300046616 Ga0495668_0117490 Ga0495668_0117490_87_416 109
1023 3300046616 Ga0495668_0237894 Ga0495668_0237894_39_368 109
1024 3300046642 Ga0495634_0004434 Ga0495634_0004434_3977_4306 109
1025 3300046648 Ga0495611_0000445 Ga0495611_0000445_20465_20794 109
1026 3300046648 Ga0495611_0111200 Ga0495611_0111200_445_774 109
1027 3300046648 Ga0495611_0234152 Ga0495611_0234152_174_503 109
1028 3300046660 Ga0495625_0029183 Ga0495625_0029183_2323_2652 109
1029 3300046660 Ga0495625_0291444 Ga0495625_0291444_656_985 109
1030 3300046660 Ga0495625_0296628 Ga0495625_0296628_596_925 109
1031 3300046660 Ga0495625_0323572 Ga0495625_0323572_611_940 109
1032 3300046660 Ga0495625_0621818 Ga0495625_0621818_170_499 109
1033 3300046660 Ga0495625_0684005 Ga0495625_0684005_58_387 109
1034 3300046660 Ga0495625_0870826 Ga0495625_0870826_112_441 109
1035 3300046663 Ga0495635_0005516 Ga0495635_0005516_4328_4657 109
1036 3300046663 Ga0495635_0088686 Ga0495635_0088686_98_427 109
1037 3300046664 Ga0495659_0003358 Ga0495659_0003358_4698_5027 109
1038 3300046664 Ga0495659_0004687 Ga0495659_0004687_1343_1672 109
1039 3300046665 Ga0495661_0000829 Ga0495661_0000829_24329_24658 109
1040 3300046665 Ga0495661_0057432 Ga0495661_0057432_386_715 109
1041 3300046665 Ga0495661_0150885 Ga0495661_0150885_264_593 109
1042 3300046665 Ga0495661_0243446 Ga0495661_0243446_560_889 109
1043 3300046665 Ga0495661_0441740 Ga0495661_0441740_196_525 109
1044 3300046674 Ga0495588_0016063 Ga0495588_0016063_733_1062 109
1045 3300046679 Ga0495623_0010871 Ga0495623_0010871_3937_4266 109
1046 3300046680 Ga0495646_0010699 Ga0495646_0010699_1783_2112 109
1047 3300046680 Ga0495646_0012871 Ga0495646_0012871_830_1159 109
1048 3300046684 Ga0495669_0009785 Ga0495669_0009785_680_1009 109
1049 3300046689 Ga0495613_0055943 Ga0495613_0055943_1378_1707 109
1050 3300046691 Ga0495670_0001017 Ga0495670_0001017_1407_1736 109
1051 3300046691 Ga0495670_0002719 Ga0495670_0002719_4343_4672 109
1052 3300046691 Ga0495670_0016045 Ga0495670_0016045_2371_2700 109
1053 3300046692 Ga0495671_0016592 Ga0495671_0016592_2225_2554 109
1054 3300046692 Ga0495671_0018208 Ga0495671_0018208_2351_2680 109
1055 3300046692 Ga0495671_0025967 Ga0495671_0025967_1141_1470 109
1056 3300046692 Ga0495671_0085085 Ga0495671_0085085_1001_1330 109
1057 3300046692 Ga0495671_0184679 Ga0495671_0184679_22_351 109
1058 3300046692 Ga0495671_0304593 Ga0495671_0304593_89_418 109
1059 3300046692 Ga0495671_0612815 Ga0495671_0612815_51_380 109
1060 3300046694 Ga0495649_0002637 Ga0495649_0002637_4124_4453 109
1061 3300046694 Ga0495649_0004206 Ga0495649_0004206_6484_6813 109
1062 3300046694 Ga0495649_0007929 Ga0495649_0007929_1456_1785 109
1063 3300046694 Ga0495649_0052426 Ga0495649_0052426_524_853 109
1064 3300046694 Ga0495649_0053433 Ga0495649_0053433_1336_1665 109
1065 3300046694 Ga0495649_0070785 Ga0495649_0070785_984_1313 109
1066 3300046694 Ga0495649_0100611 Ga0495649_0100611_416_745 109
1067 3300046694 Ga0495649_0140078 Ga0495649_0140078_557_886 109
1068 3300046794 Ga0495589_0001824 Ga0495589_0001824_10385_10714 109
1069 3300046794 Ga0495589_0002361 Ga0495589_0002361_6194_6523 109
1070 3300046794 Ga0495589_0009091 Ga0495589_0009091_2270_2599 109
1071 3300046794 Ga0495589_0009871 Ga0495589_0009871_1634_1963 109
1072 3300046794 Ga0495589_0060296 Ga0495589_0060296_132_461 109
1073 3300046809 Ga0495600_0017597 Ga0495600_0017597_33_362 109
1074 3300046809 Ga0495600_0069543 Ga0495600_0069543_1567_1896 109
1075 3300046810 Ga0495660_0000240 Ga0495660_0000240_15413_15742 109
1076 3300046810 Ga0495660_0014751 Ga0495660_0014751_2730_3059 109
1077 3300046810 Ga0495660_0019195 Ga0495660_0019195_1353_1682 109
1078 3300046810 Ga0495660_0040889 Ga0495660_0040889_2160_2489 109
1079 3300046810 Ga0495660_0042103 Ga0495660_0042103_802_1131 109
1080 3300046810 Ga0495660_0045486 Ga0495660_0045486_1393_1722 109
1081 3300046810 Ga0495660_0089758 Ga0495660_0089758_248_577 109
1082 3300046810 Ga0495660_0131102 Ga0495660_0131102_38_367 109
1083 3300047317 Ga0495604_0019032 Ga0495604_0019032_2464_2793 109
1084 3300047317 Ga0495604_0020740 Ga0495604_0020740_836_1165 109
1085 3300047318 Ga0495636_0002597 Ga0495636_0002597_6136_6465 109
1086 3300047318 Ga0495636_0181027 Ga0495636_0181027_301_630 109
1087 3300047319 Ga0495674_0303162 Ga0495674_0303162_886_1215 109
1088 3300047320 Ga0495672_0019644 Ga0495672_0019644_2840_3169 109
1089 3300047320 Ga0495672_0061162 Ga0495672_0061162_748_1077 109
1090 3300047320 Ga0495672_0065510 Ga0495672_0065510_1388_1717 109
1091 3300047320 Ga0495672_0103137 Ga0495672_0103137_66_395 109
1092 3300047320 Ga0495672_0110864 Ga0495672_0110864_163_492 109
1093 3300047320 Ga0495672_0281837 Ga0495672_0281837_390_719 109
1094 3300047321 Ga0495676_0075715 Ga0495676_0075715_1493_1822 109
1095 3300047322 Ga0495680_0008104 Ga0495680_0008104_4025_4354 109
1096 3300047322 Ga0495680_0046759 Ga0495680_0046759_2386_2715 109
1097 3300047322 Ga0495680_0218769 Ga0495680_0218769_620_949 109
1098 3300047322 Ga0495680_1014014 Ga0495680_1014014_104_433 109
1099 3300047323 Ga0495683_0003356 Ga0495683_0003356_4948_5277 109
1100 3300047323 Ga0495683_0040567 Ga0495683_0040567_1070_1399 109
1101 3300047323 Ga0495683_0050970 Ga0495683_0050970_1603_1932 109
1102 3300047323 Ga0495683_0241100 Ga0495683_0241100_331_660 109
1103 3300047323 Ga0495683_0274781 Ga0495683_0274781_357_686 109
1104 3300047444 Ga0495675_0013933 Ga0495675_0013933_4160_4489 109
1105 3300047444 Ga0495675_0498524 Ga0495675_0498524_156_485 109
1106 3300047445 Ga0495677_0007690 Ga0495677_0007690_1467_1796 109
1107 3300047446 Ga0495679_004383 Ga0495679_004383_2328_2657 109
1108 3300047446 Ga0495679_017253 Ga0495679_017253_882_1211 109
1109 3300047446 Ga0495679_046881 Ga0495679_046881_389_718 109
1110 3300047469 Ga0495673_0003472 Ga0495673_0003472_6044_6373 109
1111 3300047469 Ga0495673_0005781 Ga0495673_0005781_3041_3370 109
1112 3300047469 Ga0495673_0006941 Ga0495673_0006941_4591_4920 109
1113 3300047469 Ga0495673_0011839 Ga0495673_0011839_4080_4409 109
1114 3300047469 Ga0495673_0025236 Ga0495673_0025236_1147_1476 109
1115 3300047469 Ga0495673_0041794 Ga0495673_0041794_206_535 109
1116 3300047469 Ga0495673_0104499 Ga0495673_0104499_680_1009 109
1117 3300047469 Ga0495673_0105878 Ga0495673_0105878_743_1072 109
1118 3300047470 Ga0495681_0000762 Ga0495681_0000762_20472_20801 109
1119 3300047470 Ga0495681_0001492 Ga0495681_0001492_3949_4278 109
1120 3300047470 Ga0495681_0008925 Ga0495681_0008925_793_1122 109
1121 3300047470 Ga0495681_0009356 Ga0495681_0009356_1413_1742 109
1122 3300047470 Ga0495681_0009954 Ga0495681_0009954_5260_5589 109
1123 3300047470 Ga0495681_0014993 Ga0495681_0014993_38_367 109
1124 3300047470 Ga0495681_0036180 Ga0495681_0036180_694_1023 109
1125 3300047472 Ga0495686_0021995 Ga0495686_0021995_2549_2878 109
1126 3300047472 Ga0495686_0030736 Ga0495686_0030736_1368_1697 109
1127 3300047472 Ga0495686_0092459 Ga0495686_0092459_131_460 109
1128 3300047673 Ga0495593_0027293 Ga0495593_0027293_2562_2891 109
1129 3300047673 Ga0495593_0130000 Ga0495593_0130000_44_373 109
1130 3300048091 Ga0495626_0004635 Ga0495626_0004635_4029_4358 109
1131 3300048091 Ga0495626_0032624 Ga0495626_0032624_1142_1471 109
1132 3300048091 Ga0495626_0058680 Ga0495626_0058680_1397_1726 109
1133 3300048091 Ga0495626_0090500 Ga0495626_0090500_327_656 109
1134 3300048091 Ga0495626_0103613 Ga0495626_0103613_361_690 109
1135 3300048091 Ga0495626_0136738 Ga0495626_0136738_59_388 109
1136 3300048905 Ga0496102_0001186 Ga0496102_0001186_19441_19770 109
1137 3300048906 Ga0496103_0017077 Ga0496103_0017077_91_420 109
1138 3300048913 Ga0496110_0329391 Ga0496110_0329391_275_604 109
1139 3300048913 Ga0496110_1010618 Ga0496110_1010618_388_717 109
1140 3300048919 Ga0496116_0001251 Ga0496116_0001251_23820_24149 109
1141 3300048919 Ga0496116_0071203 Ga0496116_0071203_1311_1640 109
1142 3300048920 Ga0496117_0074046 Ga0496117_0074046_1349_1678 109
1143 3300048921 Ga0496118_0081141 Ga0496118_0081141_635_964 109
1144 3300048921 Ga0496118_0109579 Ga0496118_0109579_1431_1760 109
1145 3300048924 Ga0496121_0031430 Ga0496121_0031430_4056_4385 109
1146 3300048928 Ga0496125_0023336 Ga0496125_0023336_1050_1379 109
1147 3300048928 Ga0496125_0110319 Ga0496125_0110319_1567_1896 109
1148 3300048929 Ga0496126_0115154 Ga0496126_0115154_1295_1624 109
1149 3300049459 Ga0495678_002222 Ga0495678_002222_9150_9479 109
1150 3300049459 Ga0495678_004142 Ga0495678_004142_2079_2408 109
1151 3300049459 Ga0495678_004588 Ga0495678_004588_5476_5805 109
1152 3300049459 Ga0495678_009174 Ga0495678_009174_589_918 109
1153 3300049459 Ga0495678_025348 Ga0495678_025348_1086_1415 109
1154 3300049459 Ga0495678_049667 Ga0495678_049667_700_1029 109
1155 3300049459 Ga0495678_055955 Ga0495678_055955_103_432 109
1156 3300049459 Ga0495678_082907 Ga0495678_082907_558_887 109
1157 3300049459 Ga0495678_086446 Ga0495678_086446_619_948 109
1158 3300049460 Ga0495682_0002905 Ga0495682_0002905_1415_1744 109
1159 3300049460 Ga0495682_0022350 Ga0495682_0022350_32_361 109
1160 3300049460 Ga0495682_0054116 Ga0495682_0054116_112_441 109
1161 3300049460 Ga0495682_0055347 Ga0495682_0055347_38_367 109
1162 3300049460 Ga0495682_0228804 Ga0495682_0228804_84_413 109
1163 3300049530 Ga0501314_045998 Ga0501314_045998_177_506 109
1164 3300049662 Ga0501222_068915 Ga0501222_068915_181_510 109
1165 3300049665 Ga0501227_060804 Ga0501227_060804_53_382 109
1166 3300049758 Ga0501241_005745 Ga0501241_005745_1358_1687 109
1167 3300049853 Ga0501226_000005 Ga0501226_000005_114255_114584 109
1168 3300050491 nmdc:mga00v17_67392_c1 nmdc:mga00v17_67392_c1_686_1015 109
1169 3300053098 Ga0500650_0478805 Ga0500650_0478805_182_511 109
1170 3300053111 Ga0500572_001316 Ga0500572_001316_5251_5580 109
1171 3300053126 Ga0500621_100282 Ga0500621_100282_193_522 109
1172 3300053142 Ga0500577_0070427 Ga0500577_0070427_681_1010 109

Feature Viewer

pLDDT pTM Quality
66.47 0.32 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map