F491118

General Info

Members Datasets Scaffolds Average Seq Length
1168 462 954 330

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0011965|Ga0495686_0011965_606_1787
Length 393
Sequence LSIGAGQRPLAFWEVVFLDIDYDECLLGHDCFLEVRFGCGMEYWSWPSVRGLAAPTIEGGKLTMDAQRAIAELGVLIYPGAQMAAVHGLTDLFGVANRIAAEHQEARLPLLRVSHWQVDGQQAPSRVYDSHPATDDALVAVLIPPSIAGFTEGQAPQPLLRWLRQQHASGATLGGVCVGSLLLAESGLLDGRSATTHWTSAKSFSERYPAIKLKADTPIVDDGDLITTAGLMAWSELGLRLVDRLLGPSIATGTARFLVVEHSDSASECGSNFAPILNHGDASILKVQHWLQSTGATDVSLATMAERAGLEERTFLRRFRAATGLKPTEYCQHLRVGKAREMLEFTNGTIDHIAWTVGYQDPGAFRSTFKKITGLAPSDYRARFGVMPSVATR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231006 Pseudomonas sp. GM17 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231008 Pseudomonas sp. GM21 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231031 Pseudomonas sp. GM16 Isolate Nodule
20 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
21 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
22 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
23 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
24 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
25 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
26 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
27 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
28 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
29 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
30 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
31 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
32 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
33 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
34 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
35 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
36 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
37 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
38 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
39 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
40 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
41 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
42 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
43 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
44 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
45 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
46 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
47 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
48 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
49 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
50 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
51 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
52 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
53 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
54 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
55 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
56 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
57 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
58 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
59 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
60 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
61 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
62 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
63 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
64 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
65 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
66 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
67 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
68 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
69 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
70 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
71 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
72 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
73 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
74 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
75 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
76 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
77 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
78 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
79 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
80 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
81 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
82 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
83 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
84 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
85 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
86 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
87 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
88 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
89 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
90 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
91 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
92 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
93 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
94 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
95 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
96 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
97 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
98 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
99 2643221736 Bosea sp. Root483D1 Isolate Unclassified
100 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
101 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
102 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
103 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
104 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
105 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
106 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
107 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
108 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
109 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
110 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
111 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
112 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
113 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
114 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
115 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
116 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
117 2738543024 Aminobacter sp. AP02 Isolate Unclassified
118 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
119 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
120 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
121 2773857670 Pseudomonas sp. 478 Isolate Unclassified
122 2784132072 Pseudomonas sp. 460 Isolate Unclassified
123 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
124 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
125 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
126 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
127 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
128 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
129 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
130 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
131 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
132 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
133 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
134 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
135 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
136 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
137 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
138 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
139 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
140 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
141 2841760612 Bosea sp. Tri-49 Isolate Nodule
142 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
143 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
144 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
145 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
146 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
147 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
148 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
149 2844104063 Bosea sp. Tri-39 Isolate Nodule
150 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
151 2851182111 Bosea sp. Tri-44 Isolate Nodule
152 2851246043 Bosea sp. Tri-54 Isolate Nodule
153 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
154 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
155 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
156 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
157 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
158 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
159 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
160 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
161 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
162 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
163 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
164 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
165 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
166 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
167 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
168 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
169 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
170 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
171 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
172 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
173 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
174 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
175 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
176 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
177 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
178 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
179 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
180 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
181 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
182 2996887358 Rhizobium sp. R711 Isolate Nodule
183 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
184 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
185 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
186 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
187 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
188 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
189 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
190 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
191 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
192 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
193 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
194 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
195 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
196 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
197 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
198 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
199 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
200 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
201 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
202 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
203 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
204 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
205 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
206 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
207 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
208 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
209 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
210 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
211 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
212 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
213 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
214 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
215 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
216 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
217 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
218 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
219 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
220 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
221 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
222 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
223 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
224 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
225 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
226 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
227 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
228 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
229 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
230 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
231 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
232 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
233 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
234 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
235 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
236 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
237 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
238 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
239 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
240 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
241 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
242 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
243 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
244 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
245 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
246 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
247 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
248 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
249 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
250 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
251 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
257 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
258 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
260 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
263 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
264 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
265 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
266 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
267 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
269 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
270 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
272 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
285 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
287 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
289 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
290 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
291 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
292 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
293 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
294 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
295 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
296 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
297 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
298 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
299 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
300 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
301 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
302 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
303 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
304 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
305 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
306 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
307 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
308 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
309 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
310 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
311 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
312 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
313 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
314 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
315 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
316 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
317 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
318 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
319 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
320 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
321 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
322 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
323 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
324 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
325 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
326 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
327 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
328 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
329 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
330 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
331 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
332 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
333 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
334 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
335 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
336 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
337 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
338 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
339 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
340 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
341 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
342 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
343 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
344 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
345 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
346 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
347 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
348 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
349 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
350 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
351 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
352 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
353 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
354 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
355 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
356 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
357 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
358 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
359 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
360 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
361 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
362 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
363 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
364 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
365 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
366 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
367 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
368 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
369 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
370 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
371 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
372 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
373 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
374 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
375 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
376 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
377 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
378 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
379 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
380 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
381 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
382 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
383 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
384 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
385 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
386 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
387 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
388 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
389 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
390 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
391 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
392 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
393 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
394 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
395 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
396 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
397 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
398 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
399 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
400 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
401 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
402 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
403 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
404 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
405 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
406 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
407 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
408 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
409 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
410 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
411 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
412 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
413 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
416 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
417 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
418 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
419 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
420 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
421 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
422 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
423 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
424 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
425 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
426 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
427 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
428 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
429 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
430 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
431 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
432 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
433 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
434 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
435 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
436 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
437 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
438 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
439 8005258706 Rhizobium sp. R693 Isolate Nodule
440 8005321885 Rhizobium sp. R72 Isolate Nodule
441 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
442 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
443 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
444 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
445 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
446 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
447 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
448 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
449 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
450 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
451 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
452 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
453 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
454 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
455 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
456 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
457 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
458 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
459 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
460 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
461 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
462 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.68
Metatranscriptomes 0
Isolates 18.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.39
Nodule 3
Rhizoplane 6.25
Rhizosphere 74.74
Stem 0
Stem Tuber 0
Unclassified 10.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_518 2124908027 Bacteria 3171
2 SwRhRL2b_contig_3565411 2162886007 Bacteria 2289
3 JGI25162J39368_1000492 3300002737 Bacteria 30025
4 JGI25163J39215_1000502 3300002771 Bacteria 11631
5 JGI25164J39214_1000335 3300002772 Bacteria 30025
6 JGI25152J39213_1001720 3300002773 Bacteria 8968
7 JGI25165J46597_1000619 3300003214 Bacteria 30025
8 Ga0055539_1000055 3300003752 Bacteria 164754
9 Ga0055533_1000067 3300003756 Bacteria 164754
10 Ga0055532_1000053 3300003758 Bacteria 164751
11 Ga0055525_1000103 3300003759 Bacteria 134778
12 Ga0055526_1030489 3300003771 Bacteria 1571
13 Ga0055524_1013619 3300003775 Bacteria 3061
14 Ga0055536_1000343 3300003781 Bacteria 34478
15 Ga0055536_1001220 3300003781 Bacteria 15932
16 Ga0055528_1016217 3300003790 Bacteria 2647
17 Ga0055530_10000488 3300003791 Bacteria 34478
18 Ga0055540_1000330 3300003792 Bacteria 41330
19 Ga0055540_1001256 3300003792 Bacteria 15495
20 Ga0055541_1000042 3300003841 Bacteria 164754
21 Ga0065714_10000038 3300005288 Bacteria 15462
22 Ga0065714_10001531 3300005288 Bacteria 6109
23 Ga0065714_10003060 3300005288 Bacteria 23151
24 Ga0065714_10003242 3300005288 Bacteria 8138
25 Ga0065714_10009002 3300005288 Bacteria 4149
26 Ga0065714_10009362 3300005288 Bacteria 2606
27 Ga0065714_10066240 3300005288 Bacteria 7298
28 Ga0065714_10067366 3300005288 Bacteria 5601
29 Ga0065704_10116722 3300005289 Bacteria 1848
30 Ga0065715_10135535 3300005293 Bacteria 1937
31 Ga0070670_100000686 3300005331 Bacteria 26278
32 Ga0070670_100001050 3300005331 Bacteria 21921
33 Ga0070669_100000417 3300005353 Bacteria 32587
34 Ga0070669_100004388 3300005353 Bacteria 10178
35 Ga0070671_100013114 3300005355 Bacteria 6677
36 Ga0070662_100000042 3300005457 Bacteria 72274
37 Ga0068853_100000410 3300005539 Bacteria 29501
38 Ga0070665_100003740 3300005548 Bacteria 16113
39 Ga0070664_100057833 3300005564 Bacteria 3297
40 Ga0068854_100000848 3300005578 Bacteria 18297
41 Ga0068851_10000002 3300005834 Bacteria 302756
42 Ga0081455_10229093 3300005937 Bacteria 1372
43 Ga0075363_100069823 3300006048 Bacteria 1907
44 Ga0075364_10048649 3300006051 Bacteria 2763
45 Ga0075364_10057723 3300006051 Bacteria 2543
46 Ga0075364_10058760 3300006051 Bacteria 2520
47 Ga0075364_10226851 3300006051 Bacteria 1268
48 Ga0075364_10252974 3300006051 Bacteria 1197
49 Ga0075432_10001106 3300006058 Bacteria 8620
50 Ga0075432_10006002 3300006058 Bacteria 4137
51 Ga0075432_10009531 3300006058 Bacteria 3308
52 Ga0075432_10029812 3300006058 Bacteria 1885
53 Ga0075432_10041556 3300006058 Bacteria 1607
54 Ga0075432_10048138 3300006058 Bacteria 1499
55 Ga0075362_10036157 3300006177 Bacteria 2159
56 Ga0075367_10016661 3300006178 Bacteria 4016
57 Ga0075369_10001246 3300006186 Bacteria 8642
58 Ga0075436_100142219 3300006914 Bacteria 1686
59 Ga0075436_100154198 3300006914 Bacteria 1617
60 Ga0079104_1000630 3300006946 Bacteria 34371
61 Ga0079104_1005862 3300006946 Bacteria 4793
62 Ga0105251_10000993 3300009011 Bacteria 24879
63 Ga0105251_10001237 3300009011 Bacteria 22131
64 Ga0105251_10003205 3300009011 Bacteria 12079
65 Ga0105251_10028517 3300009011 Bacteria 2820
66 Ga0105251_10051916 3300009011 Bacteria 1954
67 Ga0105251_10054015 3300009011 Bacteria 1909
68 Ga0105251_10117644 3300009011 Bacteria 1208
69 Ga0105244_10002463 3300009036 Bacteria 13935
70 Ga0105244_10003334 3300009036 Bacteria 11540
71 Ga0105244_10004721 3300009036 Bacteria 9272
72 Ga0105244_10024554 3300009036 Bacteria 3288
73 Ga0105244_10055491 3300009036 Bacteria 2007
74 Ga0105244_10083449 3300009036 Bacteria 1579
75 Ga0105250_10002717 3300009092 Bacteria 8739
76 Ga0105250_10004247 3300009092 Bacteria 6632
77 Ga0105250_10005681 3300009092 Bacteria 5569
78 Ga0105250_10054437 3300009092 Bacteria 1605
79 Ga0105250_10057456 3300009092 Bacteria 1561
80 Ga0105243_10001260 3300009148 Bacteria 22749
81 Ga0105243_10025139 3300009148 Bacteria 4548
82 Ga0105248_10016614 3300009177 Bacteria 8104
83 Ga0105249_10028752 3300009553 Bacteria 5018
84 Ga0123342_1011774 3300009766 Bacteria 9419
85 Ga0105246_10007251 3300011119 Bacteria 6793
86 Ga0157345_1000115 3300012498 Bacteria 15606
87 Ga0157373_10001015 3300013100 Bacteria 21696
88 Ga0157373_10001607 3300013100 Bacteria 17245
89 Ga0157373_10009756 3300013100 Bacteria 7083
90 Ga0157373_10027253 3300013100 Bacteria 4122
91 Ga0157373_10061003 3300013100 Bacteria 2671
92 Ga0157371_10000814 3300013102 Bacteria 35852
93 Ga0157371_10004031 3300013102 Bacteria 13001
94 Ga0157370_10009735 3300013104 Bacteria 10213
95 Ga0157370_10066492 3300013104 Bacteria 3409
96 Ga0157370_10344396 3300013104 Bacteria 1374
97 Ga0157369_10004956 3300013105 Bacteria 15598
98 Ga0157369_10005603 3300013105 Bacteria 14581
99 Ga0157369_10005935 3300013105 Bacteria 14184
100 Ga0157369_10042424 3300013105 Bacteria 4963
101 Ga0157369_10114601 3300013105 Bacteria 2862
102 Ga0157369_10260983 3300013105 Bacteria 1807
103 Ga0163162_10000325 3300013306 Bacteria 43879
104 Ga0163162_10006109 3300013306 Bacteria 11656
105 Ga0163162_10166932 3300013306 Bacteria 2325
106 Ga0157375_10003957 3300013308 Bacteria 12848
107 Ga0157375_10056934 3300013308 Bacteria 3863
108 Ga0182008_10000307 3300014497 Bacteria 38383
109 Ga0182008_10001497 3300014497 Bacteria 15587
110 Ga0182008_10002601 3300014497 Bacteria 11214
111 Ga0182008_10008338 3300014497 Bacteria 5661
112 Ga0182008_10033038 3300014497 Bacteria 2597
113 Ga0182006_1001277 3300015261 Bacteria 15512
114 Ga0182006_1001440 3300015261 Bacteria 14379
115 Ga0182006_1047730 3300015261 Bacteria 1658
116 Ga0182007_10000322 3300015262 Bacteria 30363
117 Ga0182007_10002159 3300015262 Bacteria 10002
118 Ga0182005_1000297 3300015265 Bacteria 30400
119 Ga0182005_1000792 3300015265 Bacteria 14399
120 Ga0163161_10002472 3300017792 Bacteria 13185
121 Ga0163161_10008714 3300017792 Bacteria 7015
122 Ga0163161_10015992 3300017792 Bacteria 5236
123 Ga0163161_10059330 3300017792 Bacteria 2782
124 Ga0163161_10064500 3300017792 Bacteria 2672
125 Ga0163161_10128371 3300017792 Bacteria 1911
126 Ga0163161_10129873 3300017792 Bacteria 1899
127 Ga0163161_10336882 3300017792 Bacteria 1196
128 Ga0209435_101282 3300025206 Bacteria 3285
129 Ga0209760_100117 3300025207 Bacteria 57229
130 Ga0209784_100060 3300025224 Bacteria 164838
131 Ga0209566_100075 3300025225 Bacteria 164838
132 Ga0209674_100100 3300025226 Bacteria 164838
133 Ga0209147_100096 3300025229 Bacteria 164838
134 Ga0209563_100118 3300025230 Bacteria 131627
135 Ga0209563_101342 3300025230 Bacteria 6702
136 Ga0207427_100063 3300025231 Bacteria 177711
137 Ga0209437_100133 3300025233 Bacteria 178493
138 Ga0209258_100387 3300025242 Bacteria 56263
139 Ga0209646_1000276 3300025246 Bacteria 45523
140 Ga0209677_100057 3300025253 Bacteria 164838
141 Ga0209148_1000655 3300025254 Bacteria 29820
142 Ga0209759_1008685 3300025256 Bacteria 3144
143 Ga0209129_1013860 3300025258 Bacteria 1748
144 Ga0209233_1000133 3300025261 Bacteria 202716
145 Ga0209673_1008376 3300025273 Bacteria 4609
146 Ga0209675_1009983 3300025291 Bacteria 3290
147 Ga0209676_1000314 3300025292 Bacteria 94905
148 Ga0209676_1000337 3300025292 Bacteria 89361
149 Ga0209676_1001824 3300025292 Bacteria 17689
150 Ga0209676_1019562 3300025292 Bacteria 2327
151 Ga0209025_1025577 3300025294 Bacteria 2998
152 Ga0209025_1039287 3300025294 Bacteria 2066
153 Ga0209564_1035769 3300025295 Bacteria 1431
154 Ga0209050_1000080 3300025298 Bacteria 275154
155 Ga0209050_1000106 3300025298 Bacteria 224396
156 Ga0209050_1001281 3300025298 Bacteria 28701
157 Ga0207426_1002536 3300025302 Bacteria 11460
158 Ga0209051_1000260 3300025303 Bacteria 88213
159 Ga0209051_1000283 3300025303 Bacteria 82731
160 Ga0209051_1009473 3300025303 Bacteria 5016
161 Ga0209051_1049555 3300025303 Bacteria 1413
162 Ga0207656_10000010 3300025321 Bacteria 192224
163 Ga0207696_1000339 3300025711 Bacteria 48686
164 Ga0207696_1000587 3300025711 Bacteria 28197
165 Ga0207696_1003503 3300025711 Bacteria 7102
166 Ga0207696_1011320 3300025711 Bacteria 3221
167 Ga0207655_1000606 3300025728 Bacteria 43412
168 Ga0207655_1002582 3300025728 Bacteria 14448
169 Ga0207655_1003282 3300025728 Bacteria 12140
170 Ga0207655_1009574 3300025728 Bacteria 6003
171 Ga0207655_1020665 3300025728 Bacteria 3372
172 Ga0207655_1022240 3300025728 Bacteria 3187
173 Ga0207713_1000261 3300025735 Bacteria 65024
174 Ga0207713_1001277 3300025735 Bacteria 20747
175 Ga0207713_1001528 3300025735 Bacteria 18224
176 Ga0207713_1001865 3300025735 Bacteria 16028
177 Ga0207713_1002361 3300025735 Bacteria 13827
178 Ga0207713_1003890 3300025735 Bacteria 9946
179 Ga0207713_1015282 3300025735 Bacteria 3947
180 Ga0207713_1029955 3300025735 Bacteria 2429
181 Ga0207681_10001197 3300025923 Bacteria 16670
182 Ga0207681_10002487 3300025923 Bacteria 11699
183 Ga0207650_10000278 3300025925 Bacteria 53364
184 Ga0207650_10000324 3300025925 Bacteria 46570
185 Ga0207644_10116047 3300025931 Bacteria 2031
186 Ga0207706_10000128 3300025933 Bacteria 81615
187 Ga0207709_10000030 3300025935 Bacteria 331710
188 Ga0207709_10162495 3300025935 Bacteria 1559
189 Ga0207679_10029236 3300025945 Bacteria 3835
190 Ga0207639_10002029 3300026041 Bacteria 13647
191 Ga0209281_1000070 3300027111 Bacteria 277098
192 Ga0209281_1003455 3300027111 Bacteria 5212
193 Ga0209970_1001473 3300027614 Bacteria 4110
194 Ga0207428_10004708 3300027907 Bacteria 12905
195 Ga0207428_10009676 3300027907 Bacteria 8637
196 Ga0207428_10035747 3300027907 Bacteria 4058
197 Ga0207428_10088080 3300027907 Bacteria 2415
198 Ga0207428_10257673 3300027907 Bacteria 1300
199 Ga0268266_10005512 3300028379 Bacteria 11782
200 Ga0314311_1241414 3300030733 Bacteria 5070
201 Ga0307408_100003846 3300031548 Bacteria 10216
202 Ga0307408_100010120 3300031548 Bacteria 6217
203 Ga0307408_100012131 3300031548 Bacteria 5704
204 Ga0307408_100027993 3300031548 Bacteria 3890
205 Ga0307408_100130512 3300031548 Bacteria 1959
206 Ga0307405_10001496 3300031731 Bacteria 9890
207 Ga0307405_10004726 3300031731 Bacteria 6482
208 Ga0307413_10022062 3300031824 Bacteria 3422
209 Ga0307407_10045261 3300031903 Bacteria 2485
210 Ga0307412_10001694 3300031911 Bacteria 12180
211 Ga0307412_10002511 3300031911 Bacteria 10199
212 Ga0307409_100029505 3300031995 Bacteria 3926
213 Ga0307416_100067168 3300032002 Bacteria 2956
214 Ga0307416_100105112 3300032002 Bacteria 2470
215 Ga0307416_100441505 3300032002 Bacteria 1351
216 Ga0307414_10040299 3300032004 Bacteria 3153
217 Ga0307414_10086020 3300032004 Bacteria 2318
218 Ga0307414_10175184 3300032004 Bacteria 1719
219 Ga0307414_10233692 3300032004 Bacteria 1517
220 Ga0307411_10270466 3300032005 Bacteria 1347
221 Ga0307510_10007351 3300033180 Bacteria 13126
222 Ga0237819_01552 3300038705 Bacteria 5803
223 Ga0439438_000609 3300041405 Bacteria 16125
224 Ga0439438_000664 3300041405 Bacteria 15458
225 Ga0439438_001480 3300041405 Bacteria 10342
226 Ga0439438_002279 3300041405 Bacteria 8224
227 Ga0439438_003128 3300041405 Bacteria 6793
228 Ga0439438_003649 3300041405 Bacteria 6155
229 Ga0439438_004153 3300041405 Bacteria 5645
230 Ga0439438_011195 3300041405 Bacteria 2803
231 Ga0439438_018796 3300041405 Bacteria 1962
232 Ga0439438_037973 3300041405 Bacteria 1258
233 Ga0439447_010414 3300041407 Bacteria 2758
234 Ga0439447_026360 3300041407 Bacteria 1490
235 Ga0439466_0000291 3300041411 Bacteria 19484
236 Ga0439466_0000329 3300041411 Bacteria 18267
237 Ga0439466_0005494 3300041411 Bacteria 4840
238 Ga0439466_0012614 3300041411 Bacteria 3108
239 Ga0439466_0017160 3300041411 Bacteria 2610
240 Ga0439466_0019020 3300041411 Bacteria 2460
241 Ga0439466_0025698 3300041411 Bacteria 2053
242 Ga0439466_0041948 3300041411 Bacteria 1525
243 Ga0439465_0008239 3300041413 Bacteria 3291
244 Ga0439431_0001234 3300041997 Bacteria 5602
245 Ga0439442_009238 3300042002 Bacteria 1994
246 Ga0439445_0003764 3300042004 Bacteria 3406
247 Ga0439445_0012296 3300042004 Bacteria 2054
248 Ga0439445_0043772 3300042004 Bacteria 1195
249 Ga0439432_000354 3300042006 Bacteria 16807
250 Ga0439432_000876 3300042006 Bacteria 11272
251 Ga0439432_001714 3300042006 Bacteria 8204
252 Ga0439432_003883 3300042006 Bacteria 5506
253 Ga0439432_012408 3300042006 Bacteria 2917
254 Ga0439432_017618 3300042006 Bacteria 2395
255 Ga0439432_034886 3300042006 Bacteria 1613
256 Ga0439451_000177 3300042009 Bacteria 11983
257 Ga0439451_001319 3300042009 Bacteria 4892
258 Ga0439451_001576 3300042009 Bacteria 4503
259 Ga0439451_004296 3300042009 Bacteria 2892
260 Ga0439451_005616 3300042009 Bacteria 2561
261 Ga0439451_025113 3300042009 Bacteria 1200
262 Ga0439452_000518 3300042010 Bacteria 20799
263 Ga0439452_002607 3300042010 Bacteria 6602
264 Ga0439452_003167 3300042010 Bacteria 5825
265 Ga0439452_007701 3300042010 Bacteria 3285
266 Ga0439452_007740 3300042010 Bacteria 3272
267 Ga0439452_015367 3300042010 Bacteria 2102
268 Ga0439452_022256 3300042010 Bacteria 1642
269 Ga0439456_002394 3300042013 Bacteria 3781
270 Ga0439456_003523 3300042013 Bacteria 3175
271 Ga0439456_003530 3300042013 Bacteria 3171
272 Ga0439456_003829 3300042013 Bacteria 3054
273 Ga0439463_000006 3300042016 Bacteria 45954
274 Ga0439463_008505 3300042016 Bacteria 2530
275 Ga0439463_009044 3300042016 Bacteria 2452
276 Ga0439463_010036 3300042016 Bacteria 2327
277 Ga0439463_051338 3300042016 Bacteria 1052
278 Ga0450911_000160 3300042115 Bacteria 26844
279 Ga0450911_000430 3300042115 Bacteria 13764
280 Ga0450911_001424 3300042115 Bacteria 5513
281 Ga0450919_000434 3300042121 Bacteria 5167
282 Ga0450919_001134 3300042121 Bacteria 3456
283 Ga0450922_000100 3300042124 Bacteria 8272
284 Ga0450890_003305 3300042127 Bacteria 2149
285 Ga0450891_001060 3300042129 Bacteria 2877
286 Ga0450892_001574 3300042130 Bacteria 2160
287 Ga0450894_000950 3300042131 Bacteria 4565
288 Ga0450898_000742 3300042134 Bacteria 3985
289 Ga0450902_000913 3300042137 Bacteria 3867
290 Ga0450903_002728 3300042138 Bacteria 3107
291 Ga0450903_004965 3300042138 Bacteria 2241
292 Ga0450904_000327 3300042139 Bacteria 10009
293 Ga0450906_000316 3300042145 Bacteria 9754
294 Ga0450906_000483 3300042145 Bacteria 8385
295 Ga0450906_001562 3300042145 Bacteria 5005
296 Ga0450907_000072 3300042146 Bacteria 38960
297 Ga0450907_001112 3300042146 Bacteria 6143
298 Ga0450907_004466 3300042146 Bacteria 2410
299 Ga0450910_000316 3300042147 Bacteria 5628
300 Ga0450910_001276 3300042147 Bacteria 3146
301 Ga0450910_001811 3300042147 Bacteria 2758
302 Ga0439446_0000897 3300042156 Bacteria 6407
303 Ga0439446_0009363 3300042156 Bacteria 2622
304 Ga0450909_001026 3300042185 Bacteria 3837
305 Ga0439434_0000723 3300042435 Bacteria 9438
306 Ga0439460_0001063 3300042461 Bacteria 6393
307 Ga0439460_0001093 3300042461 Bacteria 6316
308 Ga0439460_0025977 3300042461 Bacteria 1635
309 Ga0450918_002822 3300042531 Bacteria 3264
310 Ga0450918_009175 3300042531 Bacteria 1736
311 Ga0450893_0006817 3300042532 Bacteria 1849
312 Ga0439440_0006812 3300042993 Bacteria 2309
313 Ga0495617_000462 3300046452 Bacteria 21788
314 Ga0495617_000817 3300046452 Bacteria 14971
315 Ga0495617_002363 3300046452 Bacteria 7544
316 Ga0495617_007432 3300046452 Bacteria 3801
317 Ga0495617_009730 3300046452 Bacteria 3298
318 Ga0495617_009862 3300046452 Bacteria 3275
319 Ga0495617_024173 3300046452 Bacteria 2050
320 Ga0495617_025088 3300046452 Bacteria 2010
321 Ga0495617_053288 3300046452 Bacteria 1343
322 Ga0495617_057811 3300046452 Bacteria 1285
323 Ga0495617_061930 3300046452 Bacteria 1236
324 Ga0495617_072357 3300046452 Bacteria 1133
325 Ga0495627_000759 3300046453 Bacteria 23979
326 Ga0495627_001265 3300046453 Bacteria 15565
327 Ga0495627_001292 3300046453 Bacteria 15369
328 Ga0495627_002584 3300046453 Bacteria 8568
329 Ga0495627_008351 3300046453 Bacteria 3891
330 Ga0495627_009226 3300046453 Bacteria 3638
331 Ga0495627_055325 3300046453 Bacteria 1184
332 Ga0495603_0013335 3300046455 Bacteria 4971
333 Ga0495603_0022915 3300046455 Bacteria 3779
334 Ga0495590_0000859 3300046457 Bacteria 13675
335 Ga0495590_0000867 3300046457 Bacteria 13612
336 Ga0495590_0011023 3300046457 Bacteria 3388
337 Ga0495590_0021048 3300046457 Bacteria 2314
338 Ga0495590_0026389 3300046457 Bacteria 2039
339 Ga0495590_0054438 3300046457 Bacteria 1397
340 Ga0495590_0072815 3300046457 Bacteria 1207
341 Ga0495590_0097828 3300046457 Bacteria 1041
342 Ga0495591_000156 3300046458 Bacteria 72588
343 Ga0495591_000506 3300046458 Bacteria 30670
344 Ga0495591_001340 3300046458 Bacteria 15469
345 Ga0495591_001352 3300046458 Bacteria 15394
346 Ga0495591_003167 3300046458 Bacteria 8679
347 Ga0495591_006673 3300046458 Bacteria 5045
348 Ga0495591_010940 3300046458 Bacteria 3469
349 Ga0495591_013215 3300046458 Bacteria 3034
350 Ga0495591_015999 3300046458 Bacteria 2629
351 Ga0495591_017249 3300046458 Bacteria 2486
352 Ga0495591_026025 3300046458 Bacteria 1825
353 Ga0495591_047303 3300046458 Bacteria 1191
354 Ga0495629_0006436 3300046459 Bacteria 8709
355 Ga0495629_0290272 3300046459 Bacteria 1121
356 Ga0495638_0001683 3300046460 Bacteria 19564
357 Ga0495638_0002334 3300046460 Bacteria 15593
358 Ga0495638_0004057 3300046460 Bacteria 11228
359 Ga0495638_0004885 3300046460 Bacteria 10078
360 Ga0495638_0008406 3300046460 Bacteria 7321
361 Ga0495638_0009774 3300046460 Bacteria 6699
362 Ga0495638_0017812 3300046460 Bacteria 4728
363 Ga0495638_0046421 3300046460 Bacteria 2728
364 Ga0495638_0050564 3300046460 Bacteria 2595
365 Ga0495638_0055560 3300046460 Bacteria 2458
366 Ga0495638_0065783 3300046460 Bacteria 2230
367 Ga0495638_0069317 3300046460 Bacteria 2161
368 Ga0495638_0074312 3300046460 Bacteria 2073
369 Ga0495653_0011948 3300046463 Bacteria 7091
370 Ga0495653_0090152 3300046463 Bacteria 2244
371 Ga0495650_0004627 3300046471 Bacteria 9334
372 Ga0495650_0019401 3300046471 Bacteria 3347
373 Ga0495650_0019880 3300046471 Bacteria 3289
374 Ga0495650_0020286 3300046471 Bacteria 3244
375 Ga0495650_0024315 3300046471 Bacteria 2862
376 Ga0495650_0025467 3300046471 Bacteria 2772
377 Ga0495650_0025655 3300046471 Bacteria 2756
378 Ga0495650_0032894 3300046471 Bacteria 2314
379 Ga0495650_0061943 3300046471 Bacteria 1496
380 Ga0495650_0062158 3300046471 Bacteria 1493
381 Ga0495605_0000066 3300046474 Bacteria 139260
382 Ga0495605_0002258 3300046474 Bacteria 12029
383 Ga0495605_0003138 3300046474 Bacteria 9955
384 Ga0495605_0006707 3300046474 Bacteria 6588
385 Ga0495605_0008040 3300046474 Bacteria 5972
386 Ga0495605_0010626 3300046474 Bacteria 5146
387 Ga0495605_0018150 3300046474 Bacteria 3776
388 Ga0495605_0041010 3300046474 Bacteria 2307
389 Ga0495605_0045247 3300046474 Bacteria 2170
390 Ga0495605_0061778 3300046474 Bacteria 1791
391 Ga0495605_0085110 3300046474 Bacteria 1473
392 Ga0495639_0000248 3300046475 Bacteria 26780
393 Ga0495639_0002510 3300046475 Bacteria 8006
394 Ga0495639_0026401 3300046475 Bacteria 2567
395 Ga0495584_0000071 3300046491 Bacteria 72115
396 Ga0495584_0000444 3300046491 Bacteria 28477
397 Ga0495584_0001022 3300046491 Bacteria 17470
398 Ga0495584_0002615 3300046491 Bacteria 10149
399 Ga0495584_0002731 3300046491 Bacteria 9886
400 Ga0495584_0007166 3300046491 Bacteria 5824
401 Ga0495584_0007358 3300046491 Bacteria 5743
402 Ga0495584_0008355 3300046491 Bacteria 5361
403 Ga0495584_0008672 3300046491 Bacteria 5261
404 Ga0495584_0016660 3300046491 Bacteria 3747
405 Ga0495584_0020609 3300046491 Bacteria 3348
406 Ga0495584_0025409 3300046491 Bacteria 3003
407 Ga0495584_0032585 3300046491 Bacteria 2637
408 Ga0495584_0067456 3300046491 Bacteria 1798
409 Ga0495585_0002284 3300046492 Bacteria 13833
410 Ga0495585_0004056 3300046492 Bacteria 9632
411 Ga0495585_0004291 3300046492 Bacteria 9281
412 Ga0495585_0004828 3300046492 Bacteria 8654
413 Ga0495585_0009701 3300046492 Bacteria 5763
414 Ga0495585_0018341 3300046492 Bacteria 4037
415 Ga0495585_0018563 3300046492 Bacteria 4011
416 Ga0495585_0021363 3300046492 Bacteria 3716
417 Ga0495585_0029670 3300046492 Bacteria 3112
418 Ga0495585_0029898 3300046492 Bacteria 3099
419 Ga0495585_0039917 3300046492 Bacteria 2637
420 Ga0495585_0054462 3300046492 Bacteria 2211
421 Ga0495585_0116148 3300046492 Bacteria 1419
422 Ga0495585_0143636 3300046492 Bacteria 1248
423 Ga0495594_0013133 3300046499 Bacteria 4318
424 Ga0495594_0014825 3300046499 Bacteria 4089
425 Ga0495594_0022581 3300046499 Bacteria 3366
426 Ga0495596_0000258 3300046500 Bacteria 35383
427 Ga0495596_0040739 3300046500 Bacteria 1833
428 Ga0495607_0001003 3300046501 Bacteria 26008
429 Ga0495607_0002532 3300046501 Bacteria 14789
430 Ga0495607_0002606 3300046501 Bacteria 14492
431 Ga0495607_0003183 3300046501 Bacteria 12683
432 Ga0495607_0010191 3300046501 Bacteria 6323
433 Ga0495607_0011992 3300046501 Bacteria 5737
434 Ga0495607_0016364 3300046501 Bacteria 4786
435 Ga0495607_0019454 3300046501 Bacteria 4314
436 Ga0495607_0028980 3300046501 Bacteria 3410
437 Ga0495607_0028986 3300046501 Bacteria 3409
438 Ga0495607_0029539 3300046501 Bacteria 3372
439 Ga0495607_0030074 3300046501 Bacteria 3338
440 Ga0495607_0037011 3300046501 Bacteria 2934
441 Ga0495607_0066209 3300046501 Bacteria 2034
442 Ga0495607_0072180 3300046501 Bacteria 1922
443 Ga0495607_0104149 3300046501 Bacteria 1514
444 Ga0495583_0001282 3300046506 Bacteria 26263
445 Ga0495583_0003679 3300046506 Bacteria 11419
446 Ga0495583_0004019 3300046506 Bacteria 10839
447 Ga0495583_0004601 3300046506 Bacteria 9768
448 Ga0495583_0005532 3300046506 Bacteria 8551
449 Ga0495583_0020631 3300046506 Bacteria 3407
450 Ga0495606_0003121 3300046507 Bacteria 17989
451 Ga0495606_0003819 3300046507 Bacteria 15627
452 Ga0495606_0007299 3300046507 Bacteria 9951
453 Ga0495606_0007403 3300046507 Bacteria 9843
454 Ga0495606_0016163 3300046507 Bacteria 5706
455 Ga0495606_0022726 3300046507 Bacteria 4558
456 Ga0495606_0027057 3300046507 Bacteria 4073
457 Ga0495606_0029257 3300046507 Bacteria 3871
458 Ga0495606_0037025 3300046507 Bacteria 3316
459 Ga0495606_0086836 3300046507 Bacteria 1932
460 Ga0495610_0003297 3300046512 Bacteria 12701
461 Ga0495610_0003447 3300046512 Bacteria 12314
462 Ga0495610_0004885 3300046512 Bacteria 9745
463 Ga0495610_0005434 3300046512 Bacteria 9055
464 Ga0495610_0008280 3300046512 Bacteria 6755
465 Ga0495610_0011291 3300046512 Bacteria 5472
466 Ga0495610_0016961 3300046512 Bacteria 4169
467 Ga0495610_0034698 3300046512 Bacteria 2596
468 Ga0495610_0036876 3300046512 Bacteria 2494
469 Ga0495610_0039282 3300046512 Bacteria 2395
470 Ga0495610_0050948 3300046512 Bacteria 2018
471 Ga0495610_0087962 3300046512 Bacteria 1413
472 Ga0495616_0001472 3300046513 Bacteria 16351
473 Ga0495616_0003328 3300046513 Bacteria 10325
474 Ga0495616_0003536 3300046513 Bacteria 9987
475 Ga0495616_0003948 3300046513 Bacteria 9444
476 Ga0495616_0029294 3300046513 Bacteria 2908
477 Ga0495620_0000089 3300046515 Bacteria 74701
478 Ga0495620_0000406 3300046515 Bacteria 28771
479 Ga0495620_0001195 3300046515 Bacteria 15882
480 Ga0495620_0003116 3300046515 Bacteria 9523
481 Ga0495620_0003383 3300046515 Bacteria 9127
482 Ga0495620_0005409 3300046515 Bacteria 7128
483 Ga0495620_0008667 3300046515 Bacteria 5451
484 Ga0495620_0018238 3300046515 Bacteria 3478
485 Ga0495620_0018891 3300046515 Bacteria 3404
486 Ga0495620_0019091 3300046515 Bacteria 3381
487 Ga0495620_0048203 3300046515 Bacteria 1830
488 Ga0495628_0084739 3300046516 Bacteria 2459
489 Ga0495630_0053569 3300046517 Bacteria 3021
490 Ga0495630_0066109 3300046517 Bacteria 2717
491 Ga0495631_0000301 3300046518 Bacteria 34657
492 Ga0495631_0001267 3300046518 Bacteria 15587
493 Ga0495631_0015226 3300046518 Bacteria 3691
494 Ga0495631_0020987 3300046518 Bacteria 3045
495 Ga0495631_0032925 3300046518 Bacteria 2332
496 Ga0495631_0039959 3300046518 Bacteria 2079
497 Ga0495631_0134231 3300046518 Bacteria 1063
498 Ga0495632_0001411 3300046519 Bacteria 20070
499 Ga0495632_0002134 3300046519 Bacteria 15363
500 Ga0495632_0002319 3300046519 Bacteria 14645
501 Ga0495632_0002576 3300046519 Bacteria 13699
502 Ga0495632_0005110 3300046519 Bacteria 8764
503 Ga0495632_0010772 3300046519 Bacteria 5387
504 Ga0495632_0017457 3300046519 Bacteria 3959
505 Ga0495632_0019715 3300046519 Bacteria 3668
506 Ga0495632_0019792 3300046519 Bacteria 3659
507 Ga0495632_0022243 3300046519 Bacteria 3400
508 Ga0495632_0023938 3300046519 Bacteria 3253
509 Ga0495632_0025849 3300046519 Bacteria 3099
510 Ga0495632_0026672 3300046519 Bacteria 3038
511 Ga0495632_0027981 3300046519 Bacteria 2945
512 Ga0495632_0080337 3300046519 Bacteria 1555
513 Ga0495637_0000992 3300046520 Bacteria 17932
514 Ga0495637_0001157 3300046520 Bacteria 16164
515 Ga0495637_0001228 3300046520 Bacteria 15539
516 Ga0495637_0002363 3300046520 Bacteria 10455
517 Ga0495637_0002437 3300046520 Bacteria 10272
518 Ga0495637_0002624 3300046520 Bacteria 9856
519 Ga0495637_0002627 3300046520 Bacteria 9845
520 Ga0495637_0005249 3300046520 Bacteria 6627
521 Ga0495637_0013453 3300046520 Bacteria 3881
522 Ga0495637_0018200 3300046520 Bacteria 3261
523 Ga0495637_0020652 3300046520 Bacteria 3027
524 Ga0495637_0030564 3300046520 Bacteria 2389
525 Ga0495637_0033802 3300046520 Bacteria 2243
526 Ga0495637_0037830 3300046520 Bacteria 2092
527 Ga0495637_0082043 3300046520 Bacteria 1284
528 Ga0495643_0002889 3300046522 Bacteria 13024
529 Ga0495643_0003119 3300046522 Bacteria 12381
530 Ga0495643_0009387 3300046522 Bacteria 6082
531 Ga0495643_0015439 3300046522 Bacteria 4513
532 Ga0495643_0020970 3300046522 Bacteria 3757
533 Ga0495643_0027411 3300046522 Bacteria 3202
534 Ga0495643_0034632 3300046522 Bacteria 2785
535 Ga0495643_0054021 3300046522 Bacteria 2152
536 Ga0495643_0072054 3300046522 Bacteria 1812
537 Ga0495643_0089248 3300046522 Bacteria 1592
538 Ga0495643_0116627 3300046522 Bacteria 1352
539 Ga0495643_0142874 3300046522 Bacteria 1192
540 Ga0495644_0000435 3300046523 Bacteria 18422
541 Ga0495644_0005727 3300046523 Bacteria 4849
542 Ga0495644_0009973 3300046523 Bacteria 3659
543 Ga0495644_0042287 3300046523 Bacteria 1716
544 Ga0495644_0042474 3300046523 Bacteria 1712
545 Ga0495644_0044230 3300046523 Bacteria 1675
546 Ga0495648_0000287 3300046524 Bacteria 57221
547 Ga0495648_0001399 3300046524 Bacteria 23701
548 Ga0495648_0002835 3300046524 Bacteria 15601
549 Ga0495648_0003727 3300046524 Bacteria 13292
550 Ga0495648_0004621 3300046524 Bacteria 11704
551 Ga0495648_0017334 3300046524 Bacteria 5151
552 Ga0495648_0033183 3300046524 Bacteria 3375
553 Ga0495648_0036849 3300046524 Bacteria 3148
554 Ga0495648_0053886 3300046524 Bacteria 2433
555 Ga0495648_0054461 3300046524 Bacteria 2416
556 Ga0495648_0063355 3300046524 Bacteria 2183
557 Ga0495648_0067575 3300046524 Bacteria 2090
558 Ga0495648_0074805 3300046524 Bacteria 1950
559 Ga0495648_0150733 3300046524 Bacteria 1213
560 Ga0495666_0001767 3300046526 Bacteria 10666
561 Ga0495666_0007644 3300046526 Bacteria 5407
562 Ga0495666_0030167 3300046526 Bacteria 2663
563 Ga0495666_0072526 3300046526 Bacteria 1635
564 Ga0495642_0000266 3300046528 Bacteria 29529
565 Ga0495642_0001027 3300046528 Bacteria 12995
566 Ga0495642_0001272 3300046528 Bacteria 11411
567 Ga0495652_0197024 3300046529 Bacteria 1532
568 Ga0495654_0002021 3300046530 Bacteria 13330
569 Ga0495654_0002230 3300046530 Bacteria 12555
570 Ga0495654_0002688 3300046530 Bacteria 11250
571 Ga0495654_0003266 3300046530 Bacteria 9999
572 Ga0495654_0003434 3300046530 Bacteria 9712
573 Ga0495654_0003677 3300046530 Bacteria 9309
574 Ga0495654_0007101 3300046530 Bacteria 6299
575 Ga0495654_0015080 3300046530 Bacteria 4107
576 Ga0495654_0017495 3300046530 Bacteria 3768
577 Ga0495654_0024005 3300046530 Bacteria 3154
578 Ga0495654_0025738 3300046530 Bacteria 3030
579 Ga0495654_0029533 3300046530 Bacteria 2795
580 Ga0495654_0045559 3300046530 Bacteria 2163
581 Ga0495654_0056967 3300046530 Bacteria 1888
582 Ga0495654_0061965 3300046530 Bacteria 1794
583 Ga0495654_0080968 3300046530 Bacteria 1522
584 Ga0495654_0113704 3300046530 Bacteria 1232
585 Ga0495654_0128220 3300046530 Bacteria 1141
586 Ga0495586_0018212 3300046535 Bacteria 3738
587 Ga0495587_0004236 3300046536 Bacteria 9484
588 Ga0495609_0000125 3300046538 Bacteria 83190
589 Ga0495609_0001501 3300046538 Bacteria 15398
590 Ga0495609_0001565 3300046538 Bacteria 14969
591 Ga0495609_0005704 3300046538 Bacteria 6482
592 Ga0495609_0006210 3300046538 Bacteria 6140
593 Ga0495609_0013823 3300046538 Bacteria 3805
594 Ga0495609_0028030 3300046538 Bacteria 2571
595 Ga0495609_0035895 3300046538 Bacteria 2241
596 Ga0495609_0054774 3300046538 Bacteria 1770
597 Ga0495609_0090349 3300046538 Bacteria 1332
598 Ga0495597_0002134 3300046542 Bacteria 13096
599 Ga0495597_0003287 3300046542 Bacteria 9572
600 Ga0495597_0003971 3300046542 Bacteria 8316
601 Ga0495597_0007943 3300046542 Bacteria 5345
602 Ga0495597_0015657 3300046542 Bacteria 3588
603 Ga0495597_0024255 3300046542 Bacteria 2801
604 Ga0495597_0029202 3300046542 Bacteria 2519
605 Ga0495597_0041715 3300046542 Bacteria 2048
606 Ga0495645_0058681 3300046543 Bacteria 2792
607 Ga0495622_0000572 3300046557 Bacteria 22065
608 Ga0495622_0000943 3300046557 Bacteria 15618
609 Ga0495622_0001599 3300046557 Bacteria 11190
610 Ga0495622_0013240 3300046557 Bacteria 3828
611 Ga0495622_0014791 3300046557 Bacteria 3626
612 Ga0495622_0024495 3300046557 Bacteria 2818
613 Ga0495622_0097163 3300046557 Bacteria 1351
614 Ga0495633_0001860 3300046558 Bacteria 15492
615 Ga0495633_0003687 3300046558 Bacteria 10110
616 Ga0495633_0011800 3300046558 Bacteria 4687
617 Ga0495633_0031028 3300046558 Bacteria 2594
618 Ga0495656_0032376 3300046615 Bacteria 2127
619 Ga0495668_0001154 3300046616 Bacteria 26997
620 Ga0495668_0004491 3300046616 Bacteria 9879
621 Ga0495668_0073775 3300046616 Bacteria 1873
622 Ga0495668_0099130 3300046616 Bacteria 1594
623 Ga0495668_0105475 3300046616 Bacteria 1541
624 Ga0495634_0001466 3300046642 Bacteria 20925
625 Ga0495611_0000947 3300046648 Bacteria 15547
626 Ga0495611_0001585 3300046648 Bacteria 11118
627 Ga0495611_0003080 3300046648 Bacteria 7405
628 Ga0495611_0070170 3300046648 Bacteria 1601
629 Ga0495611_0107485 3300046648 Bacteria 1297
630 Ga0495625_0008604 3300046660 Bacteria 8687
631 Ga0495625_0015872 3300046660 Bacteria 5945
632 Ga0495625_0021504 3300046660 Bacteria 4967
633 Ga0495625_0022530 3300046660 Bacteria 4829
634 Ga0495625_0033920 3300046660 Bacteria 3769
635 Ga0495625_0040102 3300046660 Bacteria 3418
636 Ga0495625_0042587 3300046660 Bacteria 3298
637 Ga0495625_0049075 3300046660 Bacteria 3035
638 Ga0495625_0102823 3300046660 Bacteria 1960
639 Ga0495625_0139248 3300046660 Bacteria 1638
640 Ga0495635_0002238 3300046663 Bacteria 13147
641 Ga0495635_0004282 3300046663 Bacteria 9878
642 Ga0495659_0000153 3300046664 Bacteria 30457
643 Ga0495659_0001521 3300046664 Bacteria 7847
644 Ga0495659_0016120 3300046664 Bacteria 2462
645 Ga0495659_0033436 3300046664 Bacteria 1805
646 Ga0495661_0000541 3300046665 Bacteria 39054
647 Ga0495661_0000933 3300046665 Bacteria 26623
648 Ga0495661_0007218 3300046665 Bacteria 7747
649 Ga0495661_0020482 3300046665 Bacteria 4316
650 Ga0495661_0022886 3300046665 Bacteria 4061
651 Ga0495661_0024019 3300046665 Bacteria 3949
652 Ga0495661_0028592 3300046665 Bacteria 3566
653 Ga0495661_0030712 3300046665 Bacteria 3418
654 Ga0495661_0033093 3300046665 Bacteria 3262
655 Ga0495661_0055110 3300046665 Bacteria 2384
656 Ga0495661_0082495 3300046665 Bacteria 1850
657 Ga0495661_0149940 3300046665 Bacteria 1260
658 Ga0495588_0002380 3300046674 Bacteria 8048
659 Ga0495588_0003323 3300046674 Bacteria 6980
660 Ga0495588_0019297 3300046674 Bacteria 3338
661 Ga0495623_0004189 3300046679 Bacteria 9503
662 Ga0495623_0004713 3300046679 Bacteria 8960
663 Ga0495669_0010530 3300046684 Bacteria 3909
664 Ga0495669_0010858 3300046684 Bacteria 3856
665 Ga0495669_0145122 3300046684 Bacteria 1121
666 Ga0495613_0012696 3300046689 Bacteria 6263
667 Ga0495613_0071124 3300046689 Bacteria 2536
668 Ga0495613_0083022 3300046689 Bacteria 2327
669 Ga0495670_0000749 3300046691 Bacteria 15553
670 Ga0495670_0001825 3300046691 Bacteria 10473
671 Ga0495670_0002629 3300046691 Bacteria 8864
672 Ga0495670_0004839 3300046691 Bacteria 6611
673 Ga0495670_0015116 3300046691 Bacteria 3797
674 Ga0495670_0016890 3300046691 Bacteria 3587
675 Ga0495670_0021416 3300046691 Bacteria 3188
676 Ga0495670_0022514 3300046691 Bacteria 3111
677 Ga0495670_0025347 3300046691 Bacteria 2933
678 Ga0495670_0037300 3300046691 Bacteria 2423
679 Ga0495671_0000336 3300046692 Bacteria 39246
680 Ga0495671_0000421 3300046692 Bacteria 33756
681 Ga0495671_0001561 3300046692 Bacteria 15202
682 Ga0495671_0003309 3300046692 Bacteria 9958
683 Ga0495671_0003889 3300046692 Bacteria 9068
684 Ga0495671_0004103 3300046692 Bacteria 8783
685 Ga0495671_0005223 3300046692 Bacteria 7631
686 Ga0495671_0017297 3300046692 Bacteria 3838
687 Ga0495671_0018995 3300046692 Bacteria 3638
688 Ga0495671_0023241 3300046692 Bacteria 3240
689 Ga0495671_0026995 3300046692 Bacteria 2970
690 Ga0495671_0028553 3300046692 Bacteria 2872
691 Ga0495671_0029486 3300046692 Bacteria 2817
692 Ga0495671_0037621 3300046692 Bacteria 2446
693 Ga0495671_0041231 3300046692 Bacteria 2325
694 Ga0495649_0000531 3300046694 Bacteria 32369
695 Ga0495649_0001947 3300046694 Bacteria 15009
696 Ga0495649_0002912 3300046694 Bacteria 11838
697 Ga0495649_0003154 3300046694 Bacteria 11263
698 Ga0495649_0003556 3300046694 Bacteria 10467
699 Ga0495649_0004493 3300046694 Bacteria 9102
700 Ga0495649_0004696 3300046694 Bacteria 8867
701 Ga0495649_0004717 3300046694 Bacteria 8850
702 Ga0495649_0005087 3300046694 Bacteria 8443
703 Ga0495649_0024089 3300046694 Bacteria 3397
704 Ga0495649_0026826 3300046694 Bacteria 3199
705 Ga0495649_0027572 3300046694 Bacteria 3150
706 Ga0495649_0044468 3300046694 Bacteria 2424
707 Ga0495589_0001172 3300046794 Bacteria 15616
708 Ga0495589_0001641 3300046794 Bacteria 12818
709 Ga0495589_0002462 3300046794 Bacteria 10381
710 Ga0495589_0002488 3300046794 Bacteria 10312
711 Ga0495589_0002934 3300046794 Bacteria 9408
712 Ga0495589_0003119 3300046794 Bacteria 9064
713 Ga0495589_0004279 3300046794 Bacteria 7631
714 Ga0495589_0007874 3300046794 Bacteria 5578
715 Ga0495589_0103497 3300046794 Bacteria 1376
716 Ga0495600_0003159 3300046809 Bacteria 9645
717 Ga0495660_0003310 3300046810 Bacteria 9998
718 Ga0495660_0007016 3300046810 Bacteria 6641
719 Ga0495660_0008194 3300046810 Bacteria 6131
720 Ga0495660_0009662 3300046810 Bacteria 5621
721 Ga0495660_0022774 3300046810 Bacteria 3574
722 Ga0495660_0024188 3300046810 Bacteria 3460
723 Ga0495660_0041853 3300046810 Bacteria 2533
724 Ga0495660_0044810 3300046810 Bacteria 2431
725 Ga0495660_0050853 3300046810 Bacteria 2256
726 Ga0495660_0054612 3300046810 Bacteria 2163
727 Ga0495660_0089736 3300046810 Bacteria 1600
728 Ga0495660_0116684 3300046810 Bacteria 1355
729 Ga0495660_0160513 3300046810 Bacteria 1103
730 Ga0495581_0004486 3300047315 Bacteria 8070
731 Ga0495581_0051731 3300047315 Bacteria 2372
732 Ga0495604_0008037 3300047317 Bacteria 8359
733 Ga0495604_0102845 3300047317 Bacteria 2096
734 Ga0495636_0011816 3300047318 Bacteria 3458
735 Ga0495674_0035068 3300047319 Bacteria 4529
736 Ga0495672_0001518 3300047320 Bacteria 22741
737 Ga0495672_0002485 3300047320 Bacteria 16892
738 Ga0495672_0002877 3300047320 Bacteria 15250
739 Ga0495672_0003621 3300047320 Bacteria 13103
740 Ga0495672_0004292 3300047320 Bacteria 11754
741 Ga0495672_0005106 3300047320 Bacteria 10477
742 Ga0495672_0007026 3300047320 Bacteria 8546
743 Ga0495672_0013352 3300047320 Bacteria 5671
744 Ga0495672_0016463 3300047320 Bacteria 4980
745 Ga0495672_0017256 3300047320 Bacteria 4832
746 Ga0495672_0063664 3300047320 Bacteria 2115
747 Ga0495672_0064241 3300047320 Bacteria 2102
748 Ga0495676_0004312 3300047321 Bacteria 12993
749 Ga0495680_0007966 3300047322 Bacteria 9661
750 Ga0495680_0008523 3300047322 Bacteria 9314
751 Ga0495680_0075232 3300047322 Bacteria 2562
752 Ga0495680_0101711 3300047322 Bacteria 2140
753 Ga0495680_0110751 3300047322 Bacteria 2034
754 Ga0495683_0000404 3300047323 Bacteria 34663
755 Ga0495683_0002209 3300047323 Bacteria 11908
756 Ga0495683_0003381 3300047323 Bacteria 9319
757 Ga0495683_0004032 3300047323 Bacteria 8432
758 Ga0495683_0004998 3300047323 Bacteria 7428
759 Ga0495683_0013677 3300047323 Bacteria 4239
760 Ga0495683_0015185 3300047323 Bacteria 4010
761 Ga0495683_0019241 3300047323 Bacteria 3525
762 Ga0495683_0026945 3300047323 Bacteria 2940
763 Ga0495683_0027770 3300047323 Bacteria 2893
764 Ga0495683_0042183 3300047323 Bacteria 2300
765 Ga0495683_0050597 3300047323 Bacteria 2079
766 Ga0495687_002981 3300047443 Bacteria 12809
767 Ga0495687_004248 3300047443 Bacteria 9815
768 Ga0495687_015391 3300047443 Bacteria 3892
769 Ga0495687_046819 3300047443 Bacteria 1864
770 Ga0495677_0006133 3300047445 Bacteria 4548
771 Ga0495679_001913 3300047446 Bacteria 11147
772 Ga0495679_001971 3300047446 Bacteria 10940
773 Ga0495679_002920 3300047446 Bacteria 8460
774 Ga0495679_004253 3300047446 Bacteria 6646
775 Ga0495679_005122 3300047446 Bacteria 5877
776 Ga0495679_005781 3300047446 Bacteria 5443
777 Ga0495679_009858 3300047446 Bacteria 3789
778 Ga0495679_023623 3300047446 Bacteria 2082
779 Ga0495679_044514 3300047446 Bacteria 1359
780 Ga0495685_014319 3300047447 Bacteria 2695
781 Ga0495685_014424 3300047447 Bacteria 2685
782 Ga0495673_0000543 3300047469 Bacteria 38551
783 Ga0495673_0000630 3300047469 Bacteria 34694
784 Ga0495673_0000965 3300047469 Bacteria 25969
785 Ga0495673_0001187 3300047469 Bacteria 21906
786 Ga0495673_0002490 3300047469 Bacteria 12896
787 Ga0495673_0002541 3300047469 Bacteria 12731
788 Ga0495673_0002605 3300047469 Bacteria 12548
789 Ga0495673_0003118 3300047469 Bacteria 11099
790 Ga0495673_0004279 3300047469 Bacteria 9005
791 Ga0495673_0004638 3300047469 Bacteria 8553
792 Ga0495673_0008994 3300047469 Bacteria 5559
793 Ga0495673_0009955 3300047469 Bacteria 5209
794 Ga0495673_0018677 3300047469 Bacteria 3490
795 Ga0495673_0019032 3300047469 Bacteria 3447
796 Ga0495673_0019549 3300047469 Bacteria 3391
797 Ga0495673_0029104 3300047469 Bacteria 2610
798 Ga0495673_0033964 3300047469 Bacteria 2361
799 Ga0495673_0036871 3300047469 Bacteria 2238
800 Ga0495673_0037835 3300047469 Bacteria 2201
801 Ga0495673_0051799 3300047469 Bacteria 1796
802 Ga0495681_0001494 3300047470 Bacteria 17464
803 Ga0495681_0001632 3300047470 Bacteria 16655
804 Ga0495681_0002028 3300047470 Bacteria 14778
805 Ga0495681_0003304 3300047470 Bacteria 11234
806 Ga0495681_0003540 3300047470 Bacteria 10866
807 Ga0495681_0004204 3300047470 Bacteria 9871
808 Ga0495681_0004321 3300047470 Bacteria 9721
809 Ga0495681_0007695 3300047470 Bacteria 6838
810 Ga0495681_0008566 3300047470 Bacteria 6398
811 Ga0495681_0009988 3300047470 Bacteria 5782
812 Ga0495681_0010567 3300047470 Bacteria 5582
813 Ga0495681_0013630 3300047470 Bacteria 4705
814 Ga0495681_0026450 3300047470 Bacteria 3019
815 Ga0495681_0028928 3300047470 Bacteria 2842
816 Ga0495681_0036765 3300047470 Bacteria 2418
817 Ga0495681_0038780 3300047470 Bacteria 2332
818 Ga0495681_0112740 3300047470 Bacteria 1175
819 Ga0495686_0006040 3300047472 Bacteria 9398
820 Ga0495686_0010976 3300047472 Bacteria 6409
821 Ga0495686_0011965 3300047472 Bacteria 6098
822 Ga0495686_0013322 3300047472 Bacteria 5708
823 Ga0495686_0027359 3300047472 Bacteria 3724
824 Ga0495593_0026921 3300047673 Bacteria 3169
825 Ga0495593_0029981 3300047673 Bacteria 2979
826 Ga0495593_0036628 3300047673 Bacteria 2659
827 Ga0495614_0142311 3300048089 Bacteria 1066
828 Ga0495626_0000898 3300048091 Bacteria 26374
829 Ga0495626_0001022 3300048091 Bacteria 24045
830 Ga0495626_0001131 3300048091 Bacteria 22336
831 Ga0495626_0002134 3300048091 Bacteria 14317
832 Ga0495626_0002366 3300048091 Bacteria 13216
833 Ga0495626_0004417 3300048091 Bacteria 8645
834 Ga0495626_0004441 3300048091 Bacteria 8608
835 Ga0495626_0008164 3300048091 Bacteria 5768
836 Ga0495626_0009047 3300048091 Bacteria 5400
837 Ga0495626_0018798 3300048091 Bacteria 3462
838 Ga0495626_0029967 3300048091 Bacteria 2626
839 Ga0495626_0040977 3300048091 Bacteria 2184
840 Ga0495626_0054914 3300048091 Bacteria 1828
841 Ga0495626_0093723 3300048091 Bacteria 1317
842 Ga0496102_0001175 3300048905 Bacteria 23868
843 Ga0496102_0191211 3300048905 Bacteria 1929
844 Ga0496102_0390392 3300048905 Bacteria 1309
845 Ga0496103_0003037 3300048906 Bacteria 10337
846 Ga0496103_0043594 3300048906 Bacteria 2763
847 Ga0496104_0143109 3300048907 Bacteria 2297
848 Ga0496104_0343803 3300048907 Bacteria 1405
849 Ga0496105_0024445 3300048908 Bacteria 4908
850 Ga0496105_0091246 3300048908 Bacteria 2516
851 Ga0496110_0058691 3300048913 Bacteria 3389
852 Ga0496110_0128829 3300048913 Bacteria 2284
853 Ga0496110_0311611 3300048913 Bacteria 1433
854 Ga0496113_0094413 3300048916 Bacteria 2311
855 Ga0496113_0096944 3300048916 Bacteria 2281
856 Ga0496116_0000488 3300048919 Bacteria 54504
857 Ga0496116_0001579 3300048919 Bacteria 25081
858 Ga0496116_0002272 3300048919 Bacteria 20373
859 Ga0496116_0008613 3300048919 Bacteria 8826
860 Ga0496116_0054184 3300048919 Bacteria 2644
861 Ga0496116_0057764 3300048919 Bacteria 2534
862 Ga0496116_0102727 3300048919 Bacteria 1703
863 Ga0496117_0000666 3300048920 Bacteria 55020
864 Ga0496117_0001488 3300048920 Bacteria 33593
865 Ga0496117_0004392 3300048920 Bacteria 15622
866 Ga0496117_0012539 3300048920 Bacteria 7462
867 Ga0496117_0034133 3300048920 Bacteria 3839
868 Ga0496117_0058271 3300048920 Bacteria 2676
869 Ga0496117_0078529 3300048920 Bacteria 2178
870 Ga0496117_0107255 3300048920 Bacteria 1750
871 Ga0496118_0010626 3300048921 Bacteria 9088
872 Ga0496118_0020062 3300048921 Bacteria 5943
873 Ga0496118_0022796 3300048921 Bacteria 5459
874 Ga0496118_0026029 3300048921 Bacteria 4996
875 Ga0496118_0031365 3300048921 Bacteria 4407
876 Ga0496118_0051821 3300048921 Bacteria 3136
877 Ga0496119_0007135 3300048922 Bacteria 10140
878 Ga0496119_0007405 3300048922 Bacteria 9896
879 Ga0496120_0005522 3300048923 Bacteria 10060
880 Ga0496120_0005963 3300048923 Bacteria 9493
881 Ga0496120_0027521 3300048923 Bacteria 3495
882 Ga0496121_0000646 3300048924 Bacteria 65142
883 Ga0496121_0000867 3300048924 Bacteria 54641
884 Ga0496121_0059522 3300048924 Bacteria 3148
885 Ga0496121_0079537 3300048924 Bacteria 2602
886 Ga0496121_0086311 3300048924 Bacteria 2466
887 Ga0496121_0097710 3300048924 Bacteria 2275
888 Ga0496121_0103392 3300048924 Bacteria 2191
889 Ga0496122_0002919 3300048925 Bacteria 23335
890 Ga0496122_0007825 3300048925 Bacteria 11741
891 Ga0496122_0008395 3300048925 Bacteria 11155
892 Ga0496122_0009340 3300048925 Bacteria 10356
893 Ga0496122_0028069 3300048925 Bacteria 4790
894 Ga0496122_0030109 3300048925 Bacteria 4557
895 Ga0496122_0047812 3300048925 Bacteria 3297
896 Ga0496122_0063793 3300048925 Bacteria 2685
897 Ga0496123_0002983 3300048926 Bacteria 19648
898 Ga0496123_0006655 3300048926 Bacteria 11143
899 Ga0496123_0015566 3300048926 Bacteria 6231
900 Ga0496123_0025525 3300048926 Bacteria 4452
901 Ga0496123_0041179 3300048926 Bacteria 3205
902 Ga0496123_0057232 3300048926 Bacteria 2539
903 Ga0496124_0000942 3300048927 Bacteria 46610
904 Ga0496124_0003740 3300048927 Bacteria 18340
905 Ga0496124_0039719 3300048927 Bacteria 4076
906 Ga0496124_0055179 3300048927 Bacteria 3359
907 Ga0496124_0057206 3300048927 Bacteria 3287
908 Ga0496124_0061226 3300048927 Bacteria 3155
909 Ga0496124_0089203 3300048927 Bacteria 2518
910 Ga0496124_0093943 3300048927 Bacteria 2440
911 Ga0496124_0117196 3300048927 Bacteria 2133
912 Ga0496124_0134173 3300048927 Bacteria 1962
913 Ga0496124_0206520 3300048927 Bacteria 1489
914 Ga0496125_0001551 3300048928 Bacteria 32793
915 Ga0496125_0008001 3300048928 Bacteria 11166
916 Ga0496125_0014958 3300048928 Bacteria 7534
917 Ga0496125_0025187 3300048928 Bacteria 5454
918 Ga0496125_0034064 3300048928 Bacteria 4495
919 Ga0496125_0044073 3300048928 Bacteria 3778
920 Ga0496125_0046288 3300048928 Bacteria 3650
921 Ga0496126_0019032 3300048929 Bacteria 6777
922 Ga0496126_0033405 3300048929 Bacteria 4840
923 Ga0495678_000300 3300049459 Bacteria 53845
924 Ga0495678_001889 3300049459 Bacteria 15214
925 Ga0495678_002089 3300049459 Bacteria 14194
926 Ga0495678_002203 3300049459 Bacteria 13658
927 Ga0495678_003308 3300049459 Bacteria 10060
928 Ga0495678_003960 3300049459 Bacteria 8860
929 Ga0495678_011718 3300049459 Bacteria 4185
930 Ga0495678_012614 3300049459 Bacteria 4000
931 Ga0495678_015502 3300049459 Bacteria 3503
932 Ga0495678_020149 3300049459 Bacteria 2959
933 Ga0495678_020596 3300049459 Bacteria 2916
934 Ga0495678_035796 3300049459 Bacteria 2031
935 Ga0495678_074284 3300049459 Bacteria 1237
936 Ga0495682_0000023 3300049460 Bacteria 158998
937 Ga0495682_0001116 3300049460 Bacteria 15602
938 Ga0495682_0001401 3300049460 Bacteria 13144
939 Ga0495682_0002657 3300049460 Bacteria 8349
940 Ga0495682_0011604 3300049460 Bacteria 3389
941 Ga0495682_0026699 3300049460 Bacteria 2142
942 Ga0495682_0061707 3300049460 Bacteria 1353
943 Ga0495682_0090746 3300049460 Bacteria 1097
944 Ga0501222_001192 3300049662 Bacteria 3670
945 Ga0501241_000390 3300049758 Bacteria 9595
946 Ga0501269_001103 3300049766 Bacteria 3747
947 Ga0501269_005778 3300049766 Bacteria 1489
948 Ga0501226_000307 3300049853 Bacteria 7361
949 nmdc:mga03683_58397_c1 3300050489 Bacteria 1626
950 nmdc:mga00v17_56393_c1 3300050491 Bacteria 2402
951 nmdc:mga08x19_81902_c1 3300050514 Bacteria 2120
952 Ga0500572_001539 3300053111 Bacteria 6175
953 Ga0500616_0078657 3300053153 Bacteria 1663
954 Ga0500634_0000137 3300053161 Bacteria 26529

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0063664 Ga0495672_0063664_299_1297 283
2 3300046810 Ga0495660_0160513 Ga0495660_0160513_39_1088 288
3 3300053153 Ga0500616_0078657 Ga0500616_0078657_592_1641 288
4 3300048928 Ga0496125_0034064 Ga0496125_0034064_1778_2761 297
5 3300025254 Ga0209148_1000655 Ga0209148_10006559 302
6 3300009148 Ga0105243_10025139 Ga0105243_100251394 307
7 3300046518 Ga0495631_0039959 Ga0495631_0039959_143_1213 308
8 3300046519 Ga0495632_0022243 Ga0495632_0022243_1608_2678 308
9 3300046524 Ga0495648_0000287 Ga0495648_0000287_27700_28770 308
10 3300046530 Ga0495654_0056967 Ga0495654_0056967_253_1323 308
11 3300046648 Ga0495611_0003080 Ga0495611_0003080_852_1922 308
12 3300046665 Ga0495661_0028592 Ga0495661_0028592_1373_2443 308
13 3300046692 Ga0495671_0000421 Ga0495671_0000421_13636_14706 308
14 3300047320 Ga0495672_0016463 Ga0495672_0016463_2419_3489 308
15 3300047469 Ga0495673_0000965 Ga0495673_0000965_19678_20760 308
16 3300047469 Ga0495673_0001187 Ga0495673_0001187_1201_2271 308
17 3300049459 Ga0495678_000300 Ga0495678_000300_42285_43367 308
18 3300009553 Ga0105249_10028752 Ga0105249_100287523 309
19 3300013102 Ga0157371_10000814 Ga0157371_1000081415 309
20 3300048919 Ga0496116_0000488 Ga0496116_0000488_24766_25800 309
21 3300048919 Ga0496116_0054184 Ga0496116_0054184_1372_2457 309
22 3300048920 Ga0496117_0001488 Ga0496117_0001488_19796_20830 309
23 3300048921 Ga0496118_0051821 Ga0496118_0051821_1303_2337 309
24 3300048924 Ga0496121_0000646 Ga0496121_0000646_42601_43686 309
25 3300048924 Ga0496121_0000867 Ga0496121_0000867_24768_25802 309
26 3300048925 Ga0496122_0002919 Ga0496122_0002919_20196_21230 309
27 3300048925 Ga0496122_0009340 Ga0496122_0009340_3181_4266 309
28 3300048926 Ga0496123_0002983 Ga0496123_0002983_17756_18790 309
29 3300048926 Ga0496123_0015566 Ga0496123_0015566_4446_5531 309
30 iso_pu_bacteria 2834578030 2834578501 311
31 3300006058 Ga0075432_10001106 Ga0075432_100011068 315
32 3300027907 Ga0207428_10009676 Ga0207428_100096763 315
33 iso_pu_bacteria 2599185167 2599401257 315
34 iso_pu_bacteria 2599185179 2599452986 315
35 iso_pu_bacteria 2599185190 2599516335 315
36 iso_pu_bacteria 2599185191 2599520148 315
37 iso_pu_bacteria 2599185288 2599881589 315
38 iso_pu_bacteria 2599185290 2599895693 315
39 iso_pu_bacteria 2599185303 2599951894 315
40 iso_pu_bacteria 2643221563 2643832478 315
41 iso_pu_bacteria 2643221608 2644053727 315
42 iso_pu_bacteria 2738541294 2738810141 315
43 iso_pu_bacteria 2738541309 2738897501 315
44 iso_pu_bacteria 2808606385 2808977463 315
45 iso_pu_bacteria 2808606388 2808992879 315
46 iso_pu_bacteria 2834028612 2834033135 315
47 iso_pu_bacteria 2852612431 2852618025 315
48 iso_pu_bacteria 2852667396 2852673083 315
49 iso_pu_bacteria 2931390751 2931396042 315
50 iso_pu_bacteria 2945928738 2945931290 315
51 iso_pu_bacteria 2946027586 2946033258 315
52 iso_pu_bacteria 8054285046 8054290311 315
53 iso_pu_bacteria 8054503363 8054508541 315
54 iso_pu_bacteria 8055817908 8055823514 315
55 iso_pu_bacteria 8056131705 8056136946 315
56 iso_pu_bacteria 8056161164 8056163218 315
57 3300032004 Ga0307414_10086020 Ga0307414_100860202 316
58 3300046501 Ga0495607_0016364 Ga0495607_0016364_2769_3764 316
59 3300046519 Ga0495632_0027981 Ga0495632_0027981_1869_2864 316
60 3300046520 Ga0495637_0002627 Ga0495637_0002627_650_1645 316
61 3300046694 Ga0495649_0003154 Ga0495649_0003154_2266_3261 316
62 3300041405 Ga0439438_003128 Ga0439438_003128_2510_3571 317
63 3300042016 Ga0439463_008505 Ga0439463_008505_668_1660 317
64 3300042115 Ga0450911_001424 Ga0450911_001424_3565_4626 317
65 3300042121 Ga0450919_001134 Ga0450919_001134_2327_3388 317
66 3300042124 Ga0450922_000100 Ga0450922_000100_4368_5429 317
67 3300042145 Ga0450906_001562 Ga0450906_001562_2760_3821 317
68 3300042146 Ga0450907_001112 Ga0450907_001112_4567_5628 317
69 3300042147 Ga0450910_001811 Ga0450910_001811_11_1072 317
70 3300042531 Ga0450918_009175 Ga0450918_009175_599_1660 317
71 3300046520 Ga0495637_0002363 Ga0495637_0002363_649_1644 317
72 3300046694 Ga0495649_0026826 Ga0495649_0026826_418_1413 317
73 3300047470 Ga0495681_0003304 Ga0495681_0003304_7017_8012 317
74 3300005353 Ga0070669_100004388 Ga0070669_1000043886 318
75 3300009011 Ga0105251_10051916 Ga0105251_100519162 318
76 3300009011 Ga0105251_10054015 Ga0105251_100540151 318
77 3300009011 Ga0105251_10117644 Ga0105251_101176442 318
78 3300009036 Ga0105244_10083449 Ga0105244_100834492 318
79 3300025291 Ga0209675_1009983 Ga0209675_10099832 318
80 3300025711 Ga0207696_1000587 Ga0207696_100058721 318
81 3300025735 Ga0207713_1001528 Ga0207713_100152812 318
82 3300025735 Ga0207713_1001865 Ga0207713_10018653 318
83 3300025735 Ga0207713_1029955 Ga0207713_10299552 318
84 3300025923 Ga0207681_10002487 Ga0207681_100024871 318
85 3300027907 Ga0207428_10088080 Ga0207428_100880803 318
86 3300031548 Ga0307408_100010120 Ga0307408_1000101203 318
87 3300041405 Ga0439438_011195 Ga0439438_011195_1043_2035 318
88 3300042013 Ga0439456_003523 Ga0439456_003523_433_1434 318
89 3300042013 Ga0439456_003829 Ga0439456_003829_192_1190 318
90 3300042016 Ga0439463_000006 Ga0439463_000006_33721_34722 318
91 3300042461 Ga0439460_0025977 Ga0439460_0025977_597_1598 318
92 3300046452 Ga0495617_002363 Ga0495617_002363_6375_7367 318
93 3300047320 Ga0495672_0064241 Ga0495672_0064241_940_2001 318
94 3300048927 Ga0496124_0134173 Ga0496124_0134173_935_1930 318
95 iso_pu_bacteria 2738543024 2739305669 318
96 iso_pu_bacteria 8002285264 8002289780 318
97 3300005288 Ga0065714_10067366 Ga0065714_100673665 319
98 3300005289 Ga0065704_10116722 Ga0065704_101167222 319
99 3300005331 Ga0070670_100000686 Ga0070670_1000006866 319
100 3300005331 Ga0070670_100001050 Ga0070670_1000010505 319
101 3300005353 Ga0070669_100000417 Ga0070669_10000041710 319
102 3300005457 Ga0070662_100000042 Ga0070662_10000004227 319
103 3300005539 Ga0068853_100000410 Ga0068853_10000041021 319
104 3300005564 Ga0070664_100057833 Ga0070664_1000578333 319
105 3300005578 Ga0068854_100000848 Ga0068854_10000084813 319
106 3300005834 Ga0068851_10000002 Ga0068851_1000000245 319
107 3300006051 Ga0075364_10057723 Ga0075364_100577233 319
108 3300009011 Ga0105251_10000993 Ga0105251_100009935 319
109 3300009036 Ga0105244_10003334 Ga0105244_100033345 319
110 3300009092 Ga0105250_10005681 Ga0105250_100056815 319
111 3300009177 Ga0105248_10016614 Ga0105248_100166144 319
112 3300013100 Ga0157373_10001607 Ga0157373_100016079 319
113 3300013100 Ga0157373_10027253 Ga0157373_100272535 319
114 3300013104 Ga0157370_10344396 Ga0157370_103443961 319
115 3300013105 Ga0157369_10005935 Ga0157369_100059358 319
116 3300013105 Ga0157369_10042424 Ga0157369_100424245 319
117 3300013306 Ga0163162_10166932 Ga0163162_101669322 319
118 3300013308 Ga0157375_10003957 Ga0157375_100039575 319
119 3300014497 Ga0182008_10000307 Ga0182008_1000030727 319
120 3300017792 Ga0163161_10008714 Ga0163161_100087147 319
121 3300017792 Ga0163161_10059330 Ga0163161_100593303 319
122 3300017792 Ga0163161_10064500 Ga0163161_100645001 319
123 3300017792 Ga0163161_10128371 Ga0163161_101283711 319
124 3300025321 Ga0207656_10000010 Ga0207656_1000001056 319
125 3300025711 Ga0207696_1000339 Ga0207696_10003399 319
126 3300025735 Ga0207713_1000261 Ga0207713_100026164 319
127 3300025923 Ga0207681_10001197 Ga0207681_100011975 319
128 3300025925 Ga0207650_10000278 Ga0207650_1000027810 319
129 3300025925 Ga0207650_10000324 Ga0207650_1000032435 319
130 3300025933 Ga0207706_10000128 Ga0207706_1000012839 319
131 3300025945 Ga0207679_10029236 Ga0207679_100292362 319
132 3300026041 Ga0207639_10002029 Ga0207639_100020298 319
133 3300042016 Ga0439463_051338 Ga0439463_051338_20_1015 319
134 3300042131 Ga0450894_000950 Ga0450894_000950_2266_3225 319
135 3300042134 Ga0450898_000742 Ga0450898_000742_1334_2293 319
136 3300046457 Ga0495590_0000859 Ga0495590_0000859_1313_2305 319
137 3300046474 Ga0495605_0002258 Ga0495605_0002258_1062_2054 319
138 3300046491 Ga0495584_0008355 Ga0495584_0008355_2533_3600 319
139 3300046506 Ga0495583_0001282 Ga0495583_0001282_2688_3647 319
140 3300046512 Ga0495610_0004885 Ga0495610_0004885_2708_3667 319
141 3300046512 Ga0495610_0011291 Ga0495610_0011291_4303_5295 319
142 3300046512 Ga0495610_0039282 Ga0495610_0039282_1287_2246 319
143 3300046515 Ga0495620_0000089 Ga0495620_0000089_34609_35655 319
144 3300046518 Ga0495631_0015226 Ga0495631_0015226_1680_2639 319
145 3300046523 Ga0495644_0042474 Ga0495644_0042474_41_1033 319
146 3300046524 Ga0495648_0074805 Ga0495648_0074805_27_1028 319
147 3300046528 Ga0495642_0000266 Ga0495642_0000266_2922_3914 319
148 3300046530 Ga0495654_0003266 Ga0495654_0003266_6338_7297 319
149 3300046530 Ga0495654_0003434 Ga0495654_0003434_2710_3669 319
150 3300046616 Ga0495668_0073775 Ga0495668_0073775_651_1643 319
151 3300046665 Ga0495661_0000933 Ga0495661_0000933_12080_13039 319
152 3300046674 Ga0495588_0002380 Ga0495588_0002380_6886_7878 319
153 3300046684 Ga0495669_0010858 Ga0495669_0010858_1370_2362 319
154 3300046694 Ga0495649_0002912 Ga0495649_0002912_1605_2597 319
155 3300046794 Ga0495589_0003119 Ga0495589_0003119_1209_2201 319
156 3300047320 Ga0495672_0003621 Ga0495672_0003621_9468_10460 319
157 3300047320 Ga0495672_0013352 Ga0495672_0013352_3634_4695 319
158 3300047446 Ga0495679_001971 Ga0495679_001971_1916_2875 319
159 3300047446 Ga0495679_004253 Ga0495679_004253_3946_4905 319
160 3300047469 Ga0495673_0004638 Ga0495673_0004638_194_1186 319
161 3300048920 Ga0496117_0004392 Ga0496117_0004392_12808_13767 319
162 3300048920 Ga0496117_0012539 Ga0496117_0012539_6309_7268 319
163 3300048921 Ga0496118_0022796 Ga0496118_0022796_1614_2573 319
164 3300048921 Ga0496118_0026029 Ga0496118_0026029_1157_2116 319
165 3300048921 Ga0496118_0031365 Ga0496118_0031365_1614_2573 319
166 3300048922 Ga0496119_0007405 Ga0496119_0007405_6272_7231 319
167 3300048923 Ga0496120_0005522 Ga0496120_0005522_2661_3620 319
168 3300048923 Ga0496120_0027521 Ga0496120_0027521_718_1677 319
169 3300048924 Ga0496121_0059522 Ga0496121_0059522_319_1278 319
170 3300048924 Ga0496121_0086311 Ga0496121_0086311_91_1050 319
171 3300048925 Ga0496122_0008395 Ga0496122_0008395_7606_8565 319
172 3300048925 Ga0496122_0028069 Ga0496122_0028069_1684_2643 319
173 3300048925 Ga0496122_0047812 Ga0496122_0047812_191_1150 319
174 3300048926 Ga0496123_0006655 Ga0496123_0006655_7604_8563 319
175 3300048926 Ga0496123_0025525 Ga0496123_0025525_194_1153 319
176 3300048926 Ga0496123_0041179 Ga0496123_0041179_860_1819 319
177 3300048927 Ga0496124_0057206 Ga0496124_0057206_173_1132 319
178 3300048927 Ga0496124_0061226 Ga0496124_0061226_810_1769 319
179 3300048927 Ga0496124_0093943 Ga0496124_0093943_184_1143 319
180 3300048928 Ga0496125_0008001 Ga0496125_0008001_2594_3553 319
181 3300048928 Ga0496125_0014958 Ga0496125_0014958_6349_7308 319
182 3300048928 Ga0496125_0025187 Ga0496125_0025187_1614_2573 319
183 3300048928 Ga0496125_0046288 Ga0496125_0046288_1078_2037 319
184 3300048929 Ga0496126_0019032 Ga0496126_0019032_1827_2786 319
185 3300049460 Ga0495682_0000023 Ga0495682_0000023_133389_134435 319
186 3300053161 Ga0500634_0000137 Ga0500634_0000137_13597_14556 319
187 iso_pu_bacteria 2597489888 2597866257 319
188 iso_pu_bacteria 2597489889 2597872092 319
189 iso_pu_bacteria 2599185189 2599509734 319
190 iso_pu_bacteria 2600255296 2601693806 319
191 iso_pu_bacteria 2619619299 2621297207 319
192 iso_pu_bacteria 2643221571 2643870797 319
193 iso_pu_bacteria 2643221713 2644621315 319
194 iso_pu_bacteria 2721755607 2723250993 319
195 iso_pu_bacteria 2738541265 2738673050 319
196 iso_pu_bacteria 2738541282 2738751443 319
197 iso_pu_bacteria 2738541303 2738860484 319
198 iso_pu_bacteria 2816332298 2817493675 319
199 iso_pu_bacteria 2842826826 2842829017 319
200 iso_pu_bacteria 2842837860 2842840544 319
201 iso_pu_bacteria 2947233263 2947234046 319
202 iso_pu_bacteria 8054347763 8054352892 319
203 iso_pu_bacteria 8056148874 8056151866 319
204 3300046522 Ga0495643_0020970 Ga0495643_0020970_26_988 320
205 iso_pu_bacteria 2718217725 2718636241 320
206 iso_pu_bacteria 3007619802 3007621601 320
207 3300027614 Ga0209970_1001473 Ga0209970_10014732 321
208 iso_pu_bacteria 2511231023 2511369271 321
209 iso_pu_bacteria 2747842501 2748017586 321
210 iso_pu_bacteria 2818991456 2819659322 321
211 iso_pu_bacteria 2878029506 2878034963 321
212 iso_pu_bacteria 2974289157 2974294463 321
213 iso_pu_bacteria 3007855910 3007860220 321
214 iso_pu_bacteria 3007861166 3007866474 321
215 iso_pu_bacteria 2841911363 2841912697 322
216 iso_pu_bacteria 2841917233 2841923066 322
217 iso_pu_bacteria 2945961074 2945966404 322
218 iso_pu_bacteria 8019769354 8019771205 322
219 iso_pu_bacteria 8057798959 8057803894 322
220 3300003752 Ga0055539_1000055 Ga0055539_1000055122 323
221 3300003756 Ga0055533_1000067 Ga0055533_1000067122 323
222 3300003758 Ga0055532_1000053 Ga0055532_1000053122 323
223 3300003759 Ga0055525_1000103 Ga0055525_100010314 323
224 3300003841 Ga0055541_1000042 Ga0055541_100004255 323
225 3300014497 Ga0182008_10001497 Ga0182008_100014979 323
226 3300015261 Ga0182006_1001277 Ga0182006_10012774 323
227 3300025206 Ga0209435_101282 Ga0209435_1012824 323
228 3300025224 Ga0209784_100060 Ga0209784_10006056 323
229 3300025225 Ga0209566_100075 Ga0209566_10007556 323
230 3300025226 Ga0209674_100100 Ga0209674_10010056 323
231 3300025229 Ga0209147_100096 Ga0209147_10009656 323
232 3300025230 Ga0209563_100118 Ga0209563_100118119 323
233 3300025242 Ga0209258_100387 Ga0209258_10038756 323
234 3300025246 Ga0209646_1000276 Ga0209646_100027641 323
235 3300025253 Ga0209677_100057 Ga0209677_10005756 323
236 3300025256 Ga0209759_1008685 Ga0209759_10086854 323
237 3300042006 Ga0439432_000354 Ga0439432_000354_13013_13984 323
238 3300046452 Ga0495617_000817 Ga0495617_000817_11382_12359 323
239 3300046458 Ga0495591_000156 Ga0495591_000156_67938_68939 323
240 3300046491 Ga0495584_0000071 Ga0495584_0000071_12197_13174 323
241 3300046492 Ga0495585_0039917 Ga0495585_0039917_1371_2348 323
242 3300046501 Ga0495607_0028986 Ga0495607_0028986_2344_3321 323
243 3300046691 Ga0495670_0015116 Ga0495670_0015116_1274_2251 323
244 3300048927 Ga0496124_0055179 Ga0496124_0055179_1777_2823 323
245 iso_pu_bacteria 2510917028 2511186909 323
246 iso_pu_bacteria 2513237138 2513869085 323
247 iso_pu_bacteria 2534681796 2535514832 323
248 iso_pu_bacteria 2582581294 2585201028 323
249 iso_pu_bacteria 2582581867 2585398827 323
250 iso_pu_bacteria 2585427590 2585819053 323
251 iso_pu_bacteria 2808606445 2809219163 323
252 iso_pu_bacteria 2841760612 2841765431 323
253 iso_pu_bacteria 2844104063 2844107041 323
254 iso_pu_bacteria 2851182111 2851186021 323
255 iso_pu_bacteria 2851246043 2851249081 323
256 iso_pu_bacteria 2923556063 2923556448 323
257 iso_pu_bacteria 2996887358 2996888248 323
258 iso_pu_bacteria 3007866637 3007867127 323
259 iso_pu_bacteria 8005258706 8005261200 323
260 iso_pu_bacteria 8005321885 8005322775 323
261 iso_pu_bacteria 8005542996 8005543503 323
262 3300006946 Ga0079104_1005862 Ga0079104_10058623 324
263 3300025728 Ga0207655_1003282 Ga0207655_10032829 324
264 3300032004 Ga0307414_10175184 Ga0307414_101751841 324
265 3300032005 Ga0307411_10270466 Ga0307411_102704661 324
266 3300046457 Ga0495590_0011023 Ga0495590_0011023_1457_2431 324
267 3300046471 Ga0495650_0019401 Ga0495650_0019401_955_1929 324
268 3300046501 Ga0495607_0001003 Ga0495607_0001003_963_1937 324
269 3300046513 Ga0495616_0003948 Ga0495616_0003948_7575_8549 324
270 3300046530 Ga0495654_0061965 Ga0495654_0061965_749_1723 324
271 3300046692 Ga0495671_0026995 Ga0495671_0026995_274_1248 324
272 3300047470 Ga0495681_0004204 Ga0495681_0004204_964_1938 324
273 3300048919 Ga0496116_0008613 Ga0496116_0008613_7713_8687 324
274 3300048925 Ga0496122_0030109 Ga0496122_0030109_96_1070 324
275 3300048926 Ga0496123_0057232 Ga0496123_0057232_140_1114 324
276 3300049460 Ga0495682_0011604 Ga0495682_0011604_958_1932 324
277 3300049758 Ga0501241_000390 Ga0501241_000390_7621_8601 324
278 iso_pu_bacteria 2511231006 2511264645 324
279 iso_pu_bacteria 2852103415 2852104097 324
280 3300003781 Ga0055536_1001220 Ga0055536_10012203 325
281 3300013100 Ga0157373_10061003 Ga0157373_100610033 325
282 3300013102 Ga0157371_10004031 Ga0157371_100040319 325
283 3300013105 Ga0157369_10114601 Ga0157369_101146012 325
284 3300014497 Ga0182008_10002601 Ga0182008_100026013 325
285 3300025230 Ga0209563_101342 Ga0209563_1013422 325
286 3300025292 Ga0209676_1000314 Ga0209676_100031414 325
287 3300025294 Ga0209025_1025577 Ga0209025_10255773 325
288 3300027111 Ga0209281_1003455 Ga0209281_10034554 325
289 3300031548 Ga0307408_100130512 Ga0307408_1001305122 325
290 3300041405 Ga0439438_000609 Ga0439438_000609_14677_15657 325
291 3300042004 Ga0439445_0012296 Ga0439445_0012296_804_1784 325
292 3300042006 Ga0439432_017618 Ga0439432_017618_771_1751 325
293 3300042009 Ga0439451_025113 Ga0439451_025113_207_1187 325
294 3300042010 Ga0439452_000518 Ga0439452_000518_6322_7302 325
295 3300042115 Ga0450911_000160 Ga0450911_000160_1427_2407 325
296 3300046453 Ga0495627_002584 Ga0495627_002584_6653_7633 325
297 3300046458 Ga0495591_010940 Ga0495591_010940_1481_2461 325
298 3300046471 Ga0495650_0062158 Ga0495650_0062158_351_1331 325
299 3300046507 Ga0495606_0027057 Ga0495606_0027057_71_1066 325
300 3300046512 Ga0495610_0003447 Ga0495610_0003447_998_1978 325
301 3300046513 Ga0495616_0001472 Ga0495616_0001472_1001_1981 325
302 3300046519 Ga0495632_0017457 Ga0495632_0017457_764_1744 325
303 3300046524 Ga0495648_0150733 Ga0495648_0150733_114_1094 325
304 3300046530 Ga0495654_0003677 Ga0495654_0003677_7188_8168 325
305 3300046530 Ga0495654_0045559 Ga0495654_0045559_615_1595 325
306 3300046616 Ga0495668_0004491 Ga0495668_0004491_982_1962 325
307 3300046660 Ga0495625_0139248 Ga0495625_0139248_234_1214 325
308 3300047323 Ga0495683_0015185 Ga0495683_0015185_2047_3027 325
309 3300048091 Ga0495626_0004417 Ga0495626_0004417_1001_1981 325
310 3300048091 Ga0495626_0029967 Ga0495626_0029967_1442_2422 325
311 3300048091 Ga0495626_0054914 Ga0495626_0054914_59_1048 325
312 3300048927 Ga0496124_0089203 Ga0496124_0089203_296_1276 325
313 3300049459 Ga0495678_003960 Ga0495678_003960_6882_7862 325
314 iso_pu_bacteria 2511231031 2511415024 325
315 iso_pu_bacteria 2554235341 2555672433 325
316 iso_pu_bacteria 2599185160 2599358113 325
317 iso_pu_bacteria 2599185162 2599370988 325
318 iso_pu_bacteria 2599185163 2599377010 325
319 iso_pu_bacteria 2599185164 2599383278 325
320 iso_pu_bacteria 2599185165 2599389725 325
321 iso_pu_bacteria 2599185166 2599396022 325
322 iso_pu_bacteria 2599185168 2599407862 325
323 iso_pu_bacteria 2599185181 2599464928 325
324 iso_pu_bacteria 2599185182 2599471253 325
325 iso_pu_bacteria 2599185186 2599494157 325
326 iso_pu_bacteria 2599185356 2600217660 325
327 iso_pu_bacteria 2600255313 2601777827 325
328 iso_pu_bacteria 2667528171 2671100650 325
329 iso_pu_bacteria 2713897148 2715752450 325
330 iso_pu_bacteria 2738543025 2739314980 325
331 iso_pu_bacteria 2818991464 2819706317 325
332 iso_pu_bacteria 2842832357 2842836853 325
333 iso_pu_bacteria 2842843487 2842847589 325
334 iso_pu_bacteria 2844665904 2844666606 325
335 iso_pu_bacteria 2917070673 2917076317 325
336 iso_pu_bacteria 2919385768 2919390524 325
337 iso_pu_bacteria 2919487758 2919492645 325
338 iso_pu_bacteria 2923153595 2923159149 325
339 iso_pu_bacteria 2935353572 2935359741 325
340 iso_pu_bacteria 2969304461 2969309790 325
341 iso_pu_bacteria 2998139840 2998145016 325
342 iso_pu_bacteria 3007614139 3007617939 325
343 iso_pu_bacteria 8029995093 8029995880 325
344 iso_pu_bacteria 8056166840 8056171552 325
345 iso_pu_bacteria 8056569372 8056572064 325
346 3300009011 Ga0105251_10001237 Ga0105251_1000123714 326
347 3300009092 Ga0105250_10004247 Ga0105250_100042473 326
348 3300025735 Ga0207713_1003890 Ga0207713_10038908 326
349 3300046453 Ga0495627_000759 Ga0495627_000759_13483_14463 326
350 3300046458 Ga0495591_000506 Ga0495591_000506_16218_17198 326
351 3300046501 Ga0495607_0002532 Ga0495607_0002532_6962_7942 326
352 3300046501 Ga0495607_0066209 Ga0495607_0066209_648_1628 326
353 3300046507 Ga0495606_0007403 Ga0495606_0007403_2737_3717 326
354 3300046512 Ga0495610_0034698 Ga0495610_0034698_1335_2315 326
355 3300046515 Ga0495620_0000406 Ga0495620_0000406_14384_15364 326
356 3300046519 Ga0495632_0001411 Ga0495632_0001411_13440_14420 326
357 3300046522 Ga0495643_0027411 Ga0495643_0027411_141_1121 326
358 3300046665 Ga0495661_0000541 Ga0495661_0000541_24602_25582 326
359 3300046794 Ga0495589_0002462 Ga0495589_0002462_6670_7650 326
360 3300047446 Ga0495679_002920 Ga0495679_002920_3108_4088 326
361 3300047470 Ga0495681_0007695 Ga0495681_0007695_4737_5717 326
362 3300047470 Ga0495681_0010567 Ga0495681_0010567_711_1691 326
363 3300047470 Ga0495681_0026450 Ga0495681_0026450_1249_2229 326
364 3300048920 Ga0496117_0000666 Ga0496117_0000666_51258_52238 326
365 3300048922 Ga0496119_0007135 Ga0496119_0007135_6318_7298 326
366 3300048923 Ga0496120_0005963 Ga0496120_0005963_2752_3732 326
367 3300048927 Ga0496124_0003740 Ga0496124_0003740_14586_15566 326
368 3300048928 Ga0496125_0001551 Ga0496125_0001551_29041_30021 326
369 3300048929 Ga0496126_0033405 Ga0496126_0033405_1090_2070 326
370 iso_pu_bacteria 2511231008 2511278745 326
371 iso_pu_bacteria 2511231012 2511299107 326
372 iso_pu_bacteria 2511231014 2511312725 326
373 iso_pu_bacteria 2511231015 2511318157 326
374 iso_pu_bacteria 2511231017 2511331979 326
375 iso_pu_bacteria 2511231019 2511347004 326
376 iso_pu_bacteria 2511231020 2511353048 326
377 iso_pu_bacteria 2511231021 2511359709 326
378 iso_pu_bacteria 2511231156 2511827258 326
379 iso_pu_bacteria 2599185188 2599504977 326
380 iso_pu_bacteria 2599185212 2599615563 326
381 iso_pu_bacteria 2599185248 2599773528 326
382 iso_pu_bacteria 2599185289 2599889971 326
383 iso_pu_bacteria 2599185291 2599901694 326
384 iso_pu_bacteria 2599185300 2599930537 326
385 iso_pu_bacteria 2599185302 2599944928 326
386 iso_pu_bacteria 2599185304 2599955343 326
387 iso_pu_bacteria 2599185305 2599962835 326
388 iso_pu_bacteria 2599185308 2599978963 326
389 iso_pu_bacteria 2599185309 2599984075 326
390 iso_pu_bacteria 2599185310 2599990204 326
391 iso_pu_bacteria 2599185311 2599996903 326
392 iso_pu_bacteria 2599185312 2600001857 326
393 iso_pu_bacteria 2599185313 2600009226 326
394 iso_pu_bacteria 2599185314 2600012923 326
395 iso_pu_bacteria 2599185315 2600020774 326
396 iso_pu_bacteria 2599185316 2600025770 326
397 iso_pu_bacteria 2599185317 2600031050 326
398 iso_pu_bacteria 2599185318 2600038411 326
399 iso_pu_bacteria 2599185319 2600043743 326
400 iso_pu_bacteria 2599185320 2600048738 326
401 iso_pu_bacteria 2599185321 2600055554 326
402 iso_pu_bacteria 2599185322 2600061996 326
403 iso_pu_bacteria 2599185323 2600067236 326
404 iso_pu_bacteria 2599185324 2600073330 326
405 iso_pu_bacteria 2599185325 2600079881 326
406 iso_pu_bacteria 2600254930 2600360959 326
407 iso_pu_bacteria 2600255318 2601800612 326
408 iso_pu_bacteria 2603880185 2606078580 326
409 iso_pu_bacteria 2603880199 2606125760 326
410 iso_pu_bacteria 2623620443 2624483025 326
411 iso_pu_bacteria 2643221565 2643844996 326
412 iso_pu_bacteria 2643221589 2643957703 326
413 iso_pu_bacteria 2643221602 2644025819 326
414 iso_pu_bacteria 2643221633 2644188174 326
415 iso_pu_bacteria 2643221650 2644286668 326
416 iso_pu_bacteria 2643221736 2644744193 326
417 iso_pu_bacteria 2667528170 2671094209 326
418 iso_pu_bacteria 2667528176 2671129710 326
419 iso_pu_bacteria 2713897149 2715759201 326
420 iso_pu_bacteria 2738543004 2739200480 326
421 iso_pu_bacteria 2738543015 2739262161 326
422 iso_pu_bacteria 2773857670 2774121931 326
423 iso_pu_bacteria 2784132072 2784314594 326
424 iso_pu_bacteria 2791355520 2794595157 326
425 iso_pu_bacteria 2808606361 2808858051 326
426 iso_pu_bacteria 2808606376 2808926174 326
427 iso_pu_bacteria 2808606377 2808932344 326
428 iso_pu_bacteria 2808606378 2808938222 326
429 iso_pu_bacteria 2808606380 2808948275 326
430 iso_pu_bacteria 2808606381 2808954465 326
431 iso_pu_bacteria 2808606383 2808966581 326
432 iso_pu_bacteria 2808606389 2809001411 326
433 iso_pu_bacteria 2825651385 2825655484 326
434 iso_pu_bacteria 2860339153 2860344014 326
435 iso_pu_bacteria 2904550169 2904554173 326
436 iso_pu_bacteria 2913036834 2913042175 326
437 iso_pu_bacteria 2919063839 2919067659 326
438 iso_pu_bacteria 2919456309 2919461628 326
439 iso_pu_bacteria 2919481497 2919486004 326
440 iso_pu_bacteria 2929144301 2929149563 326
441 iso_pu_bacteria 2931369376 2931373034 326
442 iso_pu_bacteria 2939636861 2939641949 326
443 iso_pu_bacteria 3007511990 3007516805 326
444 iso_pu_bacteria 3007718800 3007721282 326
445 iso_pu_bacteria 8011350971 8011356628 326
446 iso_pu_bacteria 8056125926 8056131231 326
447 iso_pu_bacteria 8056143049 8056148382 326
448 iso_pu_bacteria 8056172158 8056172221 326
449 iso_pu_bacteria 8056177738 8056179306 326
450 iso_pu_bacteria 8057529695 8057532398 326
451 3300002773 JGI25152J39213_1001720 JGI25152J39213_10017203 327
452 3300003771 Ga0055526_1030489 Ga0055526_10304892 327
453 3300003775 Ga0055524_1013619 Ga0055524_10136192 327
454 3300003790 Ga0055528_1016217 Ga0055528_10162172 327
455 3300005355 Ga0070671_100013114 Ga0070671_1000131142 327
456 3300005937 Ga0081455_10229093 Ga0081455_102290931 327
457 3300006178 Ga0075367_10016661 Ga0075367_100166612 327
458 3300006186 Ga0075369_10001246 Ga0075369_100012465 327
459 3300009766 Ga0123342_1011774 Ga0123342_10117748 327
460 3300025258 Ga0209129_1013860 Ga0209129_10138602 327
461 3300025273 Ga0209673_1008376 Ga0209673_10083763 327
462 3300025294 Ga0209025_1039287 Ga0209025_10392872 327
463 3300025295 Ga0209564_1035769 Ga0209564_10357691 327
464 3300025302 Ga0207426_1002536 Ga0207426_10025364 327
465 3300025303 Ga0209051_1049555 Ga0209051_10495551 327
466 3300025931 Ga0207644_10116047 Ga0207644_101160471 327
467 3300042139 Ga0450904_000327 Ga0450904_000327_7949_8935 327
468 3300047443 Ga0495687_046819 Ga0495687_046819_687_1673 327
469 3300048905 Ga0496102_0390392 Ga0496102_0390392_172_1158 327
470 3300048906 Ga0496103_0043594 Ga0496103_0043594_905_1891 327
471 3300048907 Ga0496104_0143109 Ga0496104_0143109_942_1928 327
472 3300048908 Ga0496105_0024445 Ga0496105_0024445_1943_2929 327
473 3300048916 Ga0496113_0094413 Ga0496113_0094413_625_1611 327
474 3300048919 Ga0496116_0102727 Ga0496116_0102727_380_1366 327
475 3300048924 Ga0496121_0097710 Ga0496121_0097710_834_1820 327
476 3300048925 Ga0496122_0063793 Ga0496122_0063793_1378_2364 327
477 3300048927 Ga0496124_0117196 Ga0496124_0117196_134_1120 327
478 iso_pu_bacteria 2511231004 2511253660 327
479 iso_pu_bacteria 2511231007 2511269447 327
480 iso_pu_bacteria 2511231016 2511325892 327
481 iso_pu_bacteria 2511231018 2511341088 327
482 iso_pu_bacteria 2511231022 2511364628 327
483 iso_pu_bacteria 2512047018 2512327942 327
484 iso_pu_bacteria 2582580891 2583794851 327
485 iso_pu_bacteria 2597489887 2597860505 327
486 iso_pu_bacteria 2599185185 2599486643 327
487 iso_pu_bacteria 2599185257 2599807222 327
488 iso_pu_bacteria 2600254931 2600367888 327
489 iso_pu_bacteria 2623620446 2624494553 327
490 iso_pu_bacteria 2671180172 2671773218 327
491 iso_pu_bacteria 2740892503 2743740058 327
492 iso_pu_bacteria 2919697872 2919701347 327
493 iso_pu_bacteria 2931396565 2931397678 327
494 iso_pu_bacteria 2984286254 2984287008 327
495 iso_pu_bacteria 3007395558 3007398795 327
496 iso_pu_bacteria 8015687852 8015693237 327
497 iso_pu_bacteria 8019775933 8019780488 327
498 iso_pu_bacteria 8055770955 8055776487 327
499 3300015265 Ga0182005_1000297 Ga0182005_100029721 328
500 3300046460 Ga0495638_0004057 Ga0495638_0004057_1968_2963 328
501 3300048921 Ga0496118_0020062 Ga0496118_0020062_124_1122 328
502 3300002737 JGI25162J39368_1000492 JGI25162J39368_100049214 329
503 3300002771 JGI25163J39215_1000502 JGI25163J39215_100050211 329
504 3300002772 JGI25164J39214_1000335 JGI25164J39214_100033514 329
505 3300003214 JGI25165J46597_1000619 JGI25165J46597_100061916 329
506 3300005548 Ga0070665_100003740 Ga0070665_1000037407 329
507 3300006051 Ga0075364_10058760 Ga0075364_100587602 329
508 3300009092 Ga0105250_10002717 Ga0105250_100027173 329
509 3300012498 Ga0157345_1000115 Ga0157345_10001153 329
510 3300013100 Ga0157373_10001015 Ga0157373_100010159 329
511 3300013105 Ga0157369_10004956 Ga0157369_100049563 329
512 3300013105 Ga0157369_10005603 Ga0157369_1000560313 329
513 3300013306 Ga0163162_10000325 Ga0163162_100003257 329
514 3300013308 Ga0157375_10056934 Ga0157375_100569343 329
515 3300017792 Ga0163161_10002472 Ga0163161_100024729 329
516 3300025207 Ga0209760_100117 Ga0209760_1001176 329
517 3300025231 Ga0207427_100063 Ga0207427_100063148 329
518 3300025233 Ga0209437_100133 Ga0209437_10013335 329
519 3300025261 Ga0209233_1000133 Ga0209233_100013363 329
520 3300025711 Ga0207696_1003503 Ga0207696_10035035 329
521 3300025728 Ga0207655_1009574 Ga0207655_10095743 329
522 3300025728 Ga0207655_1020665 Ga0207655_10206652 329
523 3300028379 Ga0268266_10005512 Ga0268266_1000551210 329
524 3300032002 Ga0307416_100105112 Ga0307416_1001051123 329
525 3300033180 Ga0307510_10007351 Ga0307510_1000735110 329
526 3300041405 Ga0439438_001480 Ga0439438_001480_8719_9777 329
527 3300041405 Ga0439438_004153 Ga0439438_004153_4176_5177 329
528 3300041407 Ga0439447_010414 Ga0439447_010414_967_1968 329
529 3300041407 Ga0439447_026360 Ga0439447_026360_381_1439 329
530 3300041411 Ga0439466_0000329 Ga0439466_0000329_7918_8976 329
531 3300041411 Ga0439466_0019020 Ga0439466_0019020_98_1099 329
532 3300042002 Ga0439442_009238 Ga0439442_009238_860_1861 329
533 3300042010 Ga0439452_022256 Ga0439452_022256_112_1101 329
534 3300042013 Ga0439456_002394 Ga0439456_002394_972_1973 329
535 3300042145 Ga0450906_000316 Ga0450906_000316_7828_8829 329
536 3300042531 Ga0450918_002822 Ga0450918_002822_1345_2346 329
537 3300046452 Ga0495617_007432 Ga0495617_007432_1438_2439 329
538 3300046452 Ga0495617_009862 Ga0495617_009862_1514_2515 329
539 3300046452 Ga0495617_025088 Ga0495617_025088_935_1936 329
540 3300046452 Ga0495617_053288 Ga0495617_053288_319_1320 329
541 3300046452 Ga0495617_061930 Ga0495617_061930_166_1167 329
542 3300046452 Ga0495617_072357 Ga0495617_072357_96_1097 329
543 3300046453 Ga0495627_001265 Ga0495627_001265_1003_2004 329
544 3300046453 Ga0495627_001292 Ga0495627_001292_990_1991 329
545 3300046453 Ga0495627_055325 Ga0495627_055325_168_1169 329
546 3300046457 Ga0495590_0072815 Ga0495590_0072815_104_1105 329
547 3300046458 Ga0495591_001352 Ga0495591_001352_13387_14388 329
548 3300046458 Ga0495591_003167 Ga0495591_003167_6677_7678 329
549 3300046458 Ga0495591_015999 Ga0495591_015999_1353_2354 329
550 3300046458 Ga0495591_026025 Ga0495591_026025_751_1752 329
551 3300046459 Ga0495629_0290272 Ga0495629_0290272_57_1058 329
552 3300046460 Ga0495638_0004885 Ga0495638_0004885_8040_9041 329
553 3300046460 Ga0495638_0046421 Ga0495638_0046421_1002_2003 329
554 3300046460 Ga0495638_0074312 Ga0495638_0074312_72_1073 329
555 3300046463 Ga0495653_0090152 Ga0495653_0090152_220_1221 329
556 3300046471 Ga0495650_0019880 Ga0495650_0019880_921_1922 329
557 3300046471 Ga0495650_0025655 Ga0495650_0025655_973_1974 329
558 3300046474 Ga0495605_0003138 Ga0495605_0003138_7979_8980 329
559 3300046474 Ga0495605_0010626 Ga0495605_0010626_3888_4931 329
560 3300046474 Ga0495605_0061778 Ga0495605_0061778_779_1780 329
561 3300046474 Ga0495605_0085110 Ga0495605_0085110_183_1184 329
562 3300046491 Ga0495584_0007166 Ga0495584_0007166_1003_2004 329
563 3300046491 Ga0495584_0020609 Ga0495584_0020609_995_1996 329
564 3300046491 Ga0495584_0032585 Ga0495584_0032585_485_1486 329
565 3300046491 Ga0495584_0067456 Ga0495584_0067456_769_1770 329
566 3300046492 Ga0495585_0004291 Ga0495585_0004291_195_1196 329
567 3300046492 Ga0495585_0004828 Ga0495585_0004828_990_1991 329
568 3300046492 Ga0495585_0009701 Ga0495585_0009701_3772_4773 329
569 3300046492 Ga0495585_0054462 Ga0495585_0054462_176_1177 329
570 3300046492 Ga0495585_0143636 Ga0495585_0143636_195_1196 329
571 3300046500 Ga0495596_0040739 Ga0495596_0040739_809_1810 329
572 3300046501 Ga0495607_0003183 Ga0495607_0003183_10826_11827 329
573 3300046501 Ga0495607_0029539 Ga0495607_0029539_1009_2010 329
574 3300046501 Ga0495607_0037011 Ga0495607_0037011_741_1742 329
575 3300046501 Ga0495607_0104149 Ga0495607_0104149_433_1434 329
576 3300046506 Ga0495583_0004601 Ga0495583_0004601_745_1746 329
577 3300046507 Ga0495606_0003819 Ga0495606_0003819_1004_2005 329
578 3300046507 Ga0495606_0007299 Ga0495606_0007299_991_1992 329
579 3300046507 Ga0495606_0022726 Ga0495606_0022726_970_1971 329
580 3300046512 Ga0495610_0003297 Ga0495610_0003297_1001_2002 329
581 3300046513 Ga0495616_0003328 Ga0495616_0003328_8339_9340 329
582 3300046513 Ga0495616_0003536 Ga0495616_0003536_943_1944 329
583 3300046515 Ga0495620_0001195 Ga0495620_0001195_1409_2410 329
584 3300046515 Ga0495620_0018891 Ga0495620_0018891_948_1949 329
585 3300046515 Ga0495620_0019091 Ga0495620_0019091_1414_2415 329
586 3300046515 Ga0495620_0048203 Ga0495620_0048203_197_1198 329
587 3300046518 Ga0495631_0001267 Ga0495631_0001267_979_1980 329
588 3300046518 Ga0495631_0032925 Ga0495631_0032925_736_1737 329
589 3300046518 Ga0495631_0134231 Ga0495631_0134231_23_1024 329
590 3300046519 Ga0495632_0002134 Ga0495632_0002134_1227_2228 329
591 3300046519 Ga0495632_0023938 Ga0495632_0023938_1267_2268 329
592 3300046519 Ga0495632_0026672 Ga0495632_0026672_762_1763 329
593 3300046520 Ga0495637_0001228 Ga0495637_0001228_1002_2003 329
594 3300046520 Ga0495637_0002624 Ga0495637_0002624_968_1969 329
595 3300046520 Ga0495637_0018200 Ga0495637_0018200_1284_2285 329
596 3300046520 Ga0495637_0020652 Ga0495637_0020652_1023_2024 329
597 3300046520 Ga0495637_0030564 Ga0495637_0030564_1192_2193 329
598 3300046522 Ga0495643_0002889 Ga0495643_0002889_11021_12022 329
599 3300046522 Ga0495643_0015439 Ga0495643_0015439_2561_3562 329
600 3300046522 Ga0495643_0054021 Ga0495643_0054021_163_1164 329
601 3300046522 Ga0495643_0142874 Ga0495643_0142874_51_1052 329
602 3300046523 Ga0495644_0009973 Ga0495644_0009973_1692_2693 329
603 3300046524 Ga0495648_0003727 Ga0495648_0003727_968_1969 329
604 3300046524 Ga0495648_0036849 Ga0495648_0036849_952_1953 329
605 3300046530 Ga0495654_0029533 Ga0495654_0029533_775_1776 329
606 3300046530 Ga0495654_0080968 Ga0495654_0080968_224_1225 329
607 3300046530 Ga0495654_0113704 Ga0495654_0113704_16_1017 329
608 3300046538 Ga0495609_0001501 Ga0495609_0001501_1006_2007 329
609 3300046538 Ga0495609_0006210 Ga0495609_0006210_4140_5141 329
610 3300046538 Ga0495609_0035895 Ga0495609_0035895_850_1851 329
611 3300046538 Ga0495609_0054774 Ga0495609_0054774_729_1730 329
612 3300046542 Ga0495597_0002134 Ga0495597_0002134_997_1998 329
613 3300046542 Ga0495597_0041715 Ga0495597_0041715_93_1094 329
614 3300046557 Ga0495622_0000943 Ga0495622_0000943_997_1998 329
615 3300046558 Ga0495633_0001860 Ga0495633_0001860_945_1946 329
616 3300046616 Ga0495668_0099130 Ga0495668_0099130_556_1557 329
617 3300046616 Ga0495668_0105475 Ga0495668_0105475_327_1328 329
618 3300046648 Ga0495611_0000947 Ga0495611_0000947_13545_14546 329
619 3300046648 Ga0495611_0070170 Ga0495611_0070170_442_1443 329
620 3300046660 Ga0495625_0008604 Ga0495625_0008604_6719_7720 329
621 3300046660 Ga0495625_0040102 Ga0495625_0040102_1450_2451 329
622 3300046665 Ga0495661_0024019 Ga0495661_0024019_2765_3766 329
623 3300046665 Ga0495661_0033093 Ga0495661_0033093_763_1764 329
624 3300046665 Ga0495661_0149940 Ga0495661_0149940_215_1216 329
625 3300046691 Ga0495670_0000749 Ga0495670_0000749_13550_14551 329
626 3300046692 Ga0495671_0001561 Ga0495671_0001561_994_1995 329
627 3300046692 Ga0495671_0003309 Ga0495671_0003309_7926_8927 329
628 3300046692 Ga0495671_0018995 Ga0495671_0018995_1692_2693 329
629 3300046692 Ga0495671_0041231 Ga0495671_0041231_371_1372 329
630 3300046694 Ga0495649_0004493 Ga0495649_0004493_7324_8325 329
631 3300046694 Ga0495649_0004696 Ga0495649_0004696_6865_7866 329
632 3300046694 Ga0495649_0005087 Ga0495649_0005087_6427_7428 329
633 3300046694 Ga0495649_0024089 Ga0495649_0024089_967_1968 329
634 3300046694 Ga0495649_0027572 Ga0495649_0027572_1157_2158 329
635 3300046794 Ga0495589_0001172 Ga0495589_0001172_13392_14393 329
636 3300046794 Ga0495589_0103497 Ga0495589_0103497_196_1197 329
637 3300046810 Ga0495660_0003310 Ga0495660_0003310_995_1996 329
638 3300046810 Ga0495660_0009662 Ga0495660_0009662_1004_2005 329
639 3300046810 Ga0495660_0022774 Ga0495660_0022774_1793_2794 329
640 3300046810 Ga0495660_0041853 Ga0495660_0041853_968_1969 329
641 3300046810 Ga0495660_0054612 Ga0495660_0054612_645_1646 329
642 3300047320 Ga0495672_0017256 Ga0495672_0017256_3020_4021 329
643 3300047321 Ga0495676_0004312 Ga0495676_0004312_976_1977 329
644 3300047323 Ga0495683_0004032 Ga0495683_0004032_185_1186 329
645 3300047323 Ga0495683_0026945 Ga0495683_0026945_1161_2162 329
646 3300047446 Ga0495679_005122 Ga0495679_005122_3937_4938 329
647 3300047446 Ga0495679_005781 Ga0495679_005781_3453_4454 329
648 3300047446 Ga0495679_023623 Ga0495679_023623_1000_2001 329
649 3300047469 Ga0495673_0019032 Ga0495673_0019032_1445_2446 329
650 3300047469 Ga0495673_0019549 Ga0495673_0019549_1441_2442 329
651 3300047469 Ga0495673_0029104 Ga0495673_0029104_328_1329 329
652 3300047469 Ga0495673_0033964 Ga0495673_0033964_370_1371 329
653 3300047470 Ga0495681_0001494 Ga0495681_0001494_1019_2020 329
654 3300047470 Ga0495681_0004321 Ga0495681_0004321_984_1985 329
655 3300047472 Ga0495686_0006040 Ga0495686_0006040_7436_8437 329
656 3300047472 Ga0495686_0013322 Ga0495686_0013322_945_1946 329
657 3300048091 Ga0495626_0009047 Ga0495626_0009047_661_1662 329
658 3300048091 Ga0495626_0040977 Ga0495626_0040977_991_1992 329
659 3300048091 Ga0495626_0093723 Ga0495626_0093723_27_1028 329
660 3300048919 Ga0496116_0001579 Ga0496116_0001579_1344_2345 329
661 3300049459 Ga0495678_001889 Ga0495678_001889_1004_2005 329
662 3300049459 Ga0495678_003308 Ga0495678_003308_1035_2036 329
663 3300049459 Ga0495678_035796 Ga0495678_035796_38_1039 329
664 3300049459 Ga0495678_074284 Ga0495678_074284_172_1173 329
665 3300049460 Ga0495682_0001401 Ga0495682_0001401_11142_12143 329
666 3300049460 Ga0495682_0026699 Ga0495682_0026699_289_1290 329
667 3300053111 Ga0500572_001539 Ga0500572_001539_4178_5179 329
668 iso_pu_bacteria 2842805378 2842807754 329
669 2162886007 SwRhRL2b_contig_3565411 SwRhRL2b_0314.00007940 330
670 3300003792 Ga0055540_1000330 Ga0055540_100033023 330
671 3300005288 Ga0065714_10000038 Ga0065714_100000381 330
672 3300005288 Ga0065714_10003060 Ga0065714_1000306012 330
673 3300005288 Ga0065714_10003242 Ga0065714_100032423 330
674 3300005288 Ga0065714_10009002 Ga0065714_100090022 330
675 3300005288 Ga0065714_10009362 Ga0065714_100093622 330
676 3300005288 Ga0065714_10066240 Ga0065714_100662404 330
677 3300005293 Ga0065715_10135535 Ga0065715_101355352 330
678 3300006048 Ga0075363_100069823 Ga0075363_1000698231 330
679 3300006051 Ga0075364_10048649 Ga0075364_100486492 330
680 3300006051 Ga0075364_10226851 Ga0075364_102268511 330
681 3300006051 Ga0075364_10252974 Ga0075364_102529741 330
682 3300006058 Ga0075432_10006002 Ga0075432_100060022 330
683 3300006058 Ga0075432_10009531 Ga0075432_100095313 330
684 3300006058 Ga0075432_10041556 Ga0075432_100415561 330
685 3300006058 Ga0075432_10048138 Ga0075432_100481381 330
686 3300006177 Ga0075362_10036157 Ga0075362_100361572 330
687 3300006914 Ga0075436_100142219 Ga0075436_1001422191 330
688 3300006914 Ga0075436_100154198 Ga0075436_1001541981 330
689 3300006946 Ga0079104_1000630 Ga0079104_100063025 330
690 3300009011 Ga0105251_10003205 Ga0105251_100032054 330
691 3300009011 Ga0105251_10028517 Ga0105251_100285173 330
692 3300009036 Ga0105244_10002463 Ga0105244_100024638 330
693 3300009036 Ga0105244_10024554 Ga0105244_100245542 330
694 3300009036 Ga0105244_10055491 Ga0105244_100554912 330
695 3300009092 Ga0105250_10054437 Ga0105250_100544372 330
696 3300009092 Ga0105250_10057456 Ga0105250_100574561 330
697 3300009148 Ga0105243_10001260 Ga0105243_1000126010 330
698 3300011119 Ga0105246_10007251 Ga0105246_100072517 330
699 3300013100 Ga0157373_10009756 Ga0157373_100097564 330
700 3300013104 Ga0157370_10009735 Ga0157370_100097354 330
701 3300013105 Ga0157369_10260983 Ga0157369_102609832 330
702 3300013306 Ga0163162_10006109 Ga0163162_1000610912 330
703 3300014497 Ga0182008_10008338 Ga0182008_100083385 330
704 3300014497 Ga0182008_10033038 Ga0182008_100330382 330
705 3300015261 Ga0182006_1047730 Ga0182006_10477302 330
706 3300015262 Ga0182007_10002159 Ga0182007_100021592 330
707 3300017792 Ga0163161_10015992 Ga0163161_100159923 330
708 3300017792 Ga0163161_10129873 Ga0163161_101298732 330
709 3300017792 Ga0163161_10336882 Ga0163161_103368821 330
710 3300025292 Ga0209676_1001824 Ga0209676_10018242 330
711 3300025292 Ga0209676_1019562 Ga0209676_10195621 330
712 3300025298 Ga0209050_1000080 Ga0209050_100008012 330
713 3300025298 Ga0209050_1001281 Ga0209050_10012815 330
714 3300025303 Ga0209051_1000283 Ga0209051_100028313 330
715 3300025303 Ga0209051_1009473 Ga0209051_10094734 330
716 3300025711 Ga0207696_1011320 Ga0207696_10113202 330
717 3300025728 Ga0207655_1000606 Ga0207655_100060618 330
718 3300025728 Ga0207655_1022240 Ga0207655_10222403 330
719 3300025735 Ga0207713_1001277 Ga0207713_100127712 330
720 3300025735 Ga0207713_1002361 Ga0207713_10023614 330
721 3300025735 Ga0207713_1015282 Ga0207713_10152821 330
722 3300025935 Ga0207709_10000030 Ga0207709_1000003036 330
723 3300025935 Ga0207709_10162495 Ga0207709_101624951 330
724 3300027111 Ga0209281_1000070 Ga0209281_10000708 330
725 3300027907 Ga0207428_10004708 Ga0207428_100047089 330
726 3300027907 Ga0207428_10035747 Ga0207428_100357472 330
727 3300027907 Ga0207428_10257673 Ga0207428_102576732 330
728 3300030733 Ga0314311_1241414 Ga0314311_12414145 330
729 3300031548 Ga0307408_100003846 Ga0307408_1000038463 330
730 3300031548 Ga0307408_100012131 Ga0307408_1000121312 330
731 3300031548 Ga0307408_100027993 Ga0307408_1000279932 330
732 3300031731 Ga0307405_10001496 Ga0307405_100014968 330
733 3300031731 Ga0307405_10004726 Ga0307405_100047265 330
734 3300031824 Ga0307413_10022062 Ga0307413_100220623 330
735 3300031903 Ga0307407_10045261 Ga0307407_100452612 330
736 3300031911 Ga0307412_10001694 Ga0307412_100016943 330
737 3300031911 Ga0307412_10002511 Ga0307412_100025117 330
738 3300031995 Ga0307409_100029505 Ga0307409_1000295054 330
739 3300032002 Ga0307416_100067168 Ga0307416_1000671681 330
740 3300032002 Ga0307416_100441505 Ga0307416_1004415051 330
741 3300032004 Ga0307414_10040299 Ga0307414_100402993 330
742 3300032004 Ga0307414_10233692 Ga0307414_102336922 330
743 3300038705 Ga0237819_01552 Ga0237819_01552_2747_3742 330
744 3300041405 Ga0439438_000664 Ga0439438_000664_3311_4306 330
745 3300041405 Ga0439438_002279 Ga0439438_002279_1088_2080 330
746 3300041405 Ga0439438_003649 Ga0439438_003649_1848_2840 330
747 3300041405 Ga0439438_018796 Ga0439438_018796_99_1160 330
748 3300041405 Ga0439438_037973 Ga0439438_037973_44_1036 330
749 3300041411 Ga0439466_0012614 Ga0439466_0012614_1314_2411 330
750 3300041411 Ga0439466_0041948 Ga0439466_0041948_372_1367 330
751 3300041997 Ga0439431_0001234 Ga0439431_0001234_3558_4550 330
752 3300042004 Ga0439445_0003764 Ga0439445_0003764_1346_2338 330
753 3300042004 Ga0439445_0043772 Ga0439445_0043772_180_1172 330
754 3300042006 Ga0439432_001714 Ga0439432_001714_6075_7067 330
755 3300042006 Ga0439432_003883 Ga0439432_003883_4269_5261 330
756 3300042009 Ga0439451_004296 Ga0439451_004296_308_1303 330
757 3300042009 Ga0439451_005616 Ga0439451_005616_342_1334 330
758 3300042010 Ga0439452_003167 Ga0439452_003167_2665_3657 330
759 3300042010 Ga0439452_007740 Ga0439452_007740_1998_2990 330
760 3300042010 Ga0439452_015367 Ga0439452_015367_119_1111 330
761 3300042016 Ga0439463_009044 Ga0439463_009044_427_1422 330
762 3300042016 Ga0439463_010036 Ga0439463_010036_734_1729 330
763 3300042115 Ga0450911_000430 Ga0450911_000430_9881_10873 330
764 3300042129 Ga0450891_001060 Ga0450891_001060_1032_2027 330
765 3300042137 Ga0450902_000913 Ga0450902_000913_2411_3403 330
766 3300042138 Ga0450903_002728 Ga0450903_002728_575_1567 330
767 3300042138 Ga0450903_004965 Ga0450903_004965_1011_2003 330
768 3300042146 Ga0450907_000072 Ga0450907_000072_23814_24806 330
769 3300042147 Ga0450910_000316 Ga0450910_000316_3613_4605 330
770 3300042147 Ga0450910_001276 Ga0450910_001276_801_1793 330
771 3300042156 Ga0439446_0009363 Ga0439446_0009363_680_1672 330
772 3300042185 Ga0450909_001026 Ga0450909_001026_1105_2100 330
773 3300042435 Ga0439434_0000723 Ga0439434_0000723_7437_8429 330
774 3300042461 Ga0439460_0001093 Ga0439460_0001093_4643_5635 330
775 3300042993 Ga0439440_0006812 Ga0439440_0006812_86_1081 330
776 3300046452 Ga0495617_009730 Ga0495617_009730_1351_2343 330
777 3300046452 Ga0495617_024173 Ga0495617_024173_26_1021 330
778 3300046452 Ga0495617_057811 Ga0495617_057811_160_1152 330
779 3300046453 Ga0495627_008351 Ga0495627_008351_1162_2154 330
780 3300046453 Ga0495627_009226 Ga0495627_009226_1246_2244 330
781 3300046455 Ga0495603_0013335 Ga0495603_0013335_403_1395 330
782 3300046455 Ga0495603_0022915 Ga0495603_0022915_2558_3550 330
783 3300046457 Ga0495590_0021048 Ga0495590_0021048_1025_2020 330
784 3300046457 Ga0495590_0026389 Ga0495590_0026389_559_1551 330
785 3300046457 Ga0495590_0054438 Ga0495590_0054438_177_1169 330
786 3300046457 Ga0495590_0097828 Ga0495590_0097828_27_1019 330
787 3300046458 Ga0495591_001340 Ga0495591_001340_1006_2028 330
788 3300046458 Ga0495591_006673 Ga0495591_006673_3012_4073 330
789 3300046458 Ga0495591_013215 Ga0495591_013215_1752_2747 330
790 3300046458 Ga0495591_017249 Ga0495591_017249_48_1040 330
791 3300046458 Ga0495591_047303 Ga0495591_047303_112_1104 330
792 3300046460 Ga0495638_0001683 Ga0495638_0001683_16819_17811 330
793 3300046460 Ga0495638_0002334 Ga0495638_0002334_13236_14228 330
794 3300046460 Ga0495638_0009774 Ga0495638_0009774_1061_2053 330
795 3300046460 Ga0495638_0017812 Ga0495638_0017812_1490_2488 330
796 3300046460 Ga0495638_0050564 Ga0495638_0050564_358_1350 330
797 3300046460 Ga0495638_0055560 Ga0495638_0055560_1296_2288 330
798 3300046460 Ga0495638_0065783 Ga0495638_0065783_1060_2055 330
799 3300046460 Ga0495638_0069317 Ga0495638_0069317_260_1252 330
800 3300046471 Ga0495650_0020286 Ga0495650_0020286_226_1218 330
801 3300046471 Ga0495650_0024315 Ga0495650_0024315_825_1820 330
802 3300046471 Ga0495650_0025467 Ga0495650_0025467_1036_2097 330
803 3300046471 Ga0495650_0032894 Ga0495650_0032894_400_1392 330
804 3300046471 Ga0495650_0061943 Ga0495650_0061943_48_1109 330
805 3300046474 Ga0495605_0006707 Ga0495605_0006707_2970_3962 330
806 3300046474 Ga0495605_0008040 Ga0495605_0008040_3734_4795 330
807 3300046474 Ga0495605_0045247 Ga0495605_0045247_1006_2067 330
808 3300046475 Ga0495639_0026401 Ga0495639_0026401_639_1631 330
809 3300046491 Ga0495584_0001022 Ga0495584_0001022_6533_7594 330
810 3300046491 Ga0495584_0002615 Ga0495584_0002615_7336_8328 330
811 3300046491 Ga0495584_0002731 Ga0495584_0002731_2183_3175 330
812 3300046491 Ga0495584_0007358 Ga0495584_0007358_1105_2097 330
813 3300046491 Ga0495584_0008672 Ga0495584_0008672_1196_2188 330
814 3300046491 Ga0495584_0016660 Ga0495584_0016660_2536_3597 330
815 3300046491 Ga0495584_0025409 Ga0495584_0025409_1834_2826 330
816 3300046492 Ga0495585_0002284 Ga0495585_0002284_3420_4481 330
817 3300046492 Ga0495585_0004056 Ga0495585_0004056_1743_2735 330
818 3300046492 Ga0495585_0018341 Ga0495585_0018341_2265_3257 330
819 3300046492 Ga0495585_0018563 Ga0495585_0018563_1215_2207 330
820 3300046492 Ga0495585_0021363 Ga0495585_0021363_1632_2624 330
821 3300046492 Ga0495585_0029670 Ga0495585_0029670_2064_3059 330
822 3300046492 Ga0495585_0029898 Ga0495585_0029898_1061_2056 330
823 3300046499 Ga0495594_0014825 Ga0495594_0014825_1132_2124 330
824 3300046500 Ga0495596_0000258 Ga0495596_0000258_26237_27229 330
825 3300046501 Ga0495607_0010191 Ga0495607_0010191_1052_2044 330
826 3300046501 Ga0495607_0011992 Ga0495607_0011992_1980_2972 330
827 3300046501 Ga0495607_0019454 Ga0495607_0019454_2192_3253 330
828 3300046501 Ga0495607_0028980 Ga0495607_0028980_1264_2256 330
829 3300046501 Ga0495607_0030074 Ga0495607_0030074_1286_2281 330
830 3300046501 Ga0495607_0072180 Ga0495607_0072180_47_1039 330
831 3300046506 Ga0495583_0003679 Ga0495583_0003679_4984_5976 330
832 3300046506 Ga0495583_0004019 Ga0495583_0004019_910_1971 330
833 3300046506 Ga0495583_0020631 Ga0495583_0020631_99_1160 330
834 3300046507 Ga0495606_0003121 Ga0495606_0003121_14940_15932 330
835 3300046507 Ga0495606_0016163 Ga0495606_0016163_2277_3269 330
836 3300046507 Ga0495606_0029257 Ga0495606_0029257_1818_2810 330
837 3300046507 Ga0495606_0037025 Ga0495606_0037025_1432_2427 330
838 3300046507 Ga0495606_0086836 Ga0495606_0086836_25_1017 330
839 3300046512 Ga0495610_0005434 Ga0495610_0005434_7069_8061 330
840 3300046512 Ga0495610_0008280 Ga0495610_0008280_1776_2837 330
841 3300046512 Ga0495610_0016961 Ga0495610_0016961_1591_2652 330
842 3300046512 Ga0495610_0036876 Ga0495610_0036876_1442_2434 330
843 3300046512 Ga0495610_0050948 Ga0495610_0050948_729_1724 330
844 3300046512 Ga0495610_0087962 Ga0495610_0087962_402_1394 330
845 3300046513 Ga0495616_0029294 Ga0495616_0029294_1126_2118 330
846 3300046515 Ga0495620_0003116 Ga0495620_0003116_974_1966 330
847 3300046515 Ga0495620_0003383 Ga0495620_0003383_2451_3512 330
848 3300046515 Ga0495620_0008667 Ga0495620_0008667_559_1554 330
849 3300046515 Ga0495620_0018238 Ga0495620_0018238_1057_2049 330
850 3300046516 Ga0495628_0084739 Ga0495628_0084739_499_1560 330
851 3300046517 Ga0495630_0053569 Ga0495630_0053569_645_1649 330
852 3300046518 Ga0495631_0000301 Ga0495631_0000301_23699_24694 330
853 3300046519 Ga0495632_0002319 Ga0495632_0002319_10313_11305 330
854 3300046519 Ga0495632_0005110 Ga0495632_0005110_6704_7696 330
855 3300046519 Ga0495632_0010772 Ga0495632_0010772_812_1804 330
856 3300046519 Ga0495632_0019715 Ga0495632_0019715_92_1153 330
857 3300046519 Ga0495632_0019792 Ga0495632_0019792_1302_2294 330
858 3300046519 Ga0495632_0025849 Ga0495632_0025849_1286_2347 330
859 3300046519 Ga0495632_0080337 Ga0495632_0080337_462_1454 330
860 3300046520 Ga0495637_0001157 Ga0495637_0001157_10043_11035 330
861 3300046520 Ga0495637_0002437 Ga0495637_0002437_2958_4019 330
862 3300046520 Ga0495637_0005249 Ga0495637_0005249_4334_5326 330
863 3300046520 Ga0495637_0013453 Ga0495637_0013453_269_1261 330
864 3300046520 Ga0495637_0033802 Ga0495637_0033802_716_1777 330
865 3300046522 Ga0495643_0003119 Ga0495643_0003119_5522_6526 330
866 3300046522 Ga0495643_0009387 Ga0495643_0009387_5020_6012 330
867 3300046522 Ga0495643_0034632 Ga0495643_0034632_1108_2100 330
868 3300046522 Ga0495643_0072054 Ga0495643_0072054_57_1049 330
869 3300046522 Ga0495643_0089248 Ga0495643_0089248_334_1326 330
870 3300046522 Ga0495643_0116627 Ga0495643_0116627_245_1237 330
871 3300046523 Ga0495644_0000435 Ga0495644_0000435_14611_15603 330
872 3300046523 Ga0495644_0005727 Ga0495644_0005727_1020_2012 330
873 3300046523 Ga0495644_0042287 Ga0495644_0042287_513_1505 330
874 3300046523 Ga0495644_0044230 Ga0495644_0044230_140_1132 330
875 3300046524 Ga0495648_0001399 Ga0495648_0001399_20534_21526 330
876 3300046524 Ga0495648_0002835 Ga0495648_0002835_13585_14607 330
877 3300046524 Ga0495648_0004621 Ga0495648_0004621_9855_10850 330
878 3300046524 Ga0495648_0017334 Ga0495648_0017334_1846_2838 330
879 3300046524 Ga0495648_0033183 Ga0495648_0033183_928_1920 330
880 3300046524 Ga0495648_0053886 Ga0495648_0053886_656_1648 330
881 3300046524 Ga0495648_0054461 Ga0495648_0054461_39_1031 330
882 3300046524 Ga0495648_0067575 Ga0495648_0067575_1031_2023 330
883 3300046526 Ga0495666_0001767 Ga0495666_0001767_2697_3701 330
884 3300046526 Ga0495666_0072526 Ga0495666_0072526_183_1175 330
885 3300046528 Ga0495642_0001272 Ga0495642_0001272_6861_7853 330
886 3300046529 Ga0495652_0197024 Ga0495652_0197024_376_1437 330
887 3300046530 Ga0495654_0002021 Ga0495654_0002021_11124_12185 330
888 3300046530 Ga0495654_0002230 Ga0495654_0002230_2575_3636 330
889 3300046530 Ga0495654_0002688 Ga0495654_0002688_1200_2192 330
890 3300046530 Ga0495654_0007101 Ga0495654_0007101_1872_2933 330
891 3300046530 Ga0495654_0015080 Ga0495654_0015080_2177_3172 330
892 3300046530 Ga0495654_0017495 Ga0495654_0017495_2547_3539 330
893 3300046530 Ga0495654_0024005 Ga0495654_0024005_1257_2249 330
894 3300046530 Ga0495654_0025738 Ga0495654_0025738_1824_2819 330
895 3300046530 Ga0495654_0128220 Ga0495654_0128220_93_1085 330
896 3300046538 Ga0495609_0005704 Ga0495609_0005704_2150_3142 330
897 3300046538 Ga0495609_0013823 Ga0495609_0013823_949_1944 330
898 3300046538 Ga0495609_0028030 Ga0495609_0028030_304_1296 330
899 3300046538 Ga0495609_0090349 Ga0495609_0090349_156_1148 330
900 3300046542 Ga0495597_0003971 Ga0495597_0003971_1473_2465 330
901 3300046542 Ga0495597_0007943 Ga0495597_0007943_173_1165 330
902 3300046542 Ga0495597_0015657 Ga0495597_0015657_1217_2209 330
903 3300046542 Ga0495597_0024255 Ga0495597_0024255_438_1430 330
904 3300046542 Ga0495597_0029202 Ga0495597_0029202_64_1125 330
905 3300046557 Ga0495622_0001599 Ga0495622_0001599_1698_2690 330
906 3300046557 Ga0495622_0014791 Ga0495622_0014791_1599_2660 330
907 3300046557 Ga0495622_0024495 Ga0495622_0024495_483_1478 330
908 3300046558 Ga0495633_0003687 Ga0495633_0003687_995_1990 330
909 3300046558 Ga0495633_0011800 Ga0495633_0011800_898_1890 330
910 3300046615 Ga0495656_0032376 Ga0495656_0032376_895_1887 330
911 3300046616 Ga0495668_0001154 Ga0495668_0001154_23328_24320 330
912 3300046642 Ga0495634_0001466 Ga0495634_0001466_9493_10554 330
913 3300046648 Ga0495611_0107485 Ga0495611_0107485_196_1188 330
914 3300046660 Ga0495625_0015872 Ga0495625_0015872_2276_3268 330
915 3300046660 Ga0495625_0021504 Ga0495625_0021504_1060_2052 330
916 3300046660 Ga0495625_0022530 Ga0495625_0022530_1010_2002 330
917 3300046660 Ga0495625_0033920 Ga0495625_0033920_2157_3152 330
918 3300046660 Ga0495625_0049075 Ga0495625_0049075_610_1608 330
919 3300046660 Ga0495625_0102823 Ga0495625_0102823_922_1914 330
920 3300046663 Ga0495635_0002238 Ga0495635_0002238_6904_7965 330
921 3300046664 Ga0495659_0016120 Ga0495659_0016120_1397_2389 330
922 3300046665 Ga0495661_0007218 Ga0495661_0007218_1408_2400 330
923 3300046665 Ga0495661_0022886 Ga0495661_0022886_1823_2815 330
924 3300046665 Ga0495661_0030712 Ga0495661_0030712_2182_3177 330
925 3300046665 Ga0495661_0055110 Ga0495661_0055110_1179_2171 330
926 3300046665 Ga0495661_0082495 Ga0495661_0082495_334_1326 330
927 3300046674 Ga0495588_0003323 Ga0495588_0003323_1069_2061 330
928 3300046674 Ga0495588_0019297 Ga0495588_0019297_880_1941 330
929 3300046679 Ga0495623_0004189 Ga0495623_0004189_2660_3664 330
930 3300046679 Ga0495623_0004713 Ga0495623_0004713_6962_8023 330
931 3300046684 Ga0495669_0010530 Ga0495669_0010530_2006_2998 330
932 3300046684 Ga0495669_0145122 Ga0495669_0145122_45_1037 330
933 3300046689 Ga0495613_0071124 Ga0495613_0071124_1265_2260 330
934 3300046689 Ga0495613_0083022 Ga0495613_0083022_1126_2187 330
935 3300046691 Ga0495670_0002629 Ga0495670_0002629_6453_7445 330
936 3300046691 Ga0495670_0004839 Ga0495670_0004839_4835_5827 330
937 3300046691 Ga0495670_0016890 Ga0495670_0016890_1288_2280 330
938 3300046691 Ga0495670_0021416 Ga0495670_0021416_961_1953 330
939 3300046691 Ga0495670_0022514 Ga0495670_0022514_1060_2121 330
940 3300046691 Ga0495670_0025347 Ga0495670_0025347_1874_2869 330
941 3300046692 Ga0495671_0003889 Ga0495671_0003889_1452_2444 330
942 3300046692 Ga0495671_0004103 Ga0495671_0004103_2535_3539 330
943 3300046692 Ga0495671_0005223 Ga0495671_0005223_3790_4782 330
944 3300046692 Ga0495671_0017297 Ga0495671_0017297_2145_3140 330
945 3300046692 Ga0495671_0023241 Ga0495671_0023241_1121_2113 330
946 3300046692 Ga0495671_0028553 Ga0495671_0028553_939_1931 330
947 3300046692 Ga0495671_0029486 Ga0495671_0029486_1371_2432 330
948 3300046692 Ga0495671_0037621 Ga0495671_0037621_1040_2101 330
949 3300046694 Ga0495649_0000531 Ga0495649_0000531_3372_4385 330
950 3300046694 Ga0495649_0003556 Ga0495649_0003556_1338_2330 330
951 3300046694 Ga0495649_0044468 Ga0495649_0044468_233_1228 330
952 3300046794 Ga0495589_0002934 Ga0495589_0002934_6759_7751 330
953 3300046794 Ga0495589_0004279 Ga0495589_0004279_5426_6418 330
954 3300046794 Ga0495589_0007874 Ga0495589_0007874_3622_4614 330
955 3300046810 Ga0495660_0007016 Ga0495660_0007016_2515_3507 330
956 3300046810 Ga0495660_0008194 Ga0495660_0008194_1451_2443 330
957 3300046810 Ga0495660_0024188 Ga0495660_0024188_311_1303 330
958 3300046810 Ga0495660_0044810 Ga0495660_0044810_175_1167 330
959 3300046810 Ga0495660_0050853 Ga0495660_0050853_21_1013 330
960 3300046810 Ga0495660_0116684 Ga0495660_0116684_346_1338 330
961 3300047317 Ga0495604_0102845 Ga0495604_0102845_380_1441 330
962 3300047319 Ga0495674_0035068 Ga0495674_0035068_2533_3594 330
963 3300047320 Ga0495672_0002485 Ga0495672_0002485_2665_3657 330
964 3300047320 Ga0495672_0005106 Ga0495672_0005106_8250_9242 330
965 3300047320 Ga0495672_0007026 Ga0495672_0007026_106_1098 330
966 3300047322 Ga0495680_0008523 Ga0495680_0008523_7236_8297 330
967 3300047322 Ga0495680_0075232 Ga0495680_0075232_1448_2440 330
968 3300047322 Ga0495680_0101711 Ga0495680_0101711_802_1806 330
969 3300047322 Ga0495680_0110751 Ga0495680_0110751_919_1911 330
970 3300047323 Ga0495683_0000404 Ga0495683_0000404_9971_10966 330
971 3300047323 Ga0495683_0002209 Ga0495683_0002209_9206_10198 330
972 3300047323 Ga0495683_0003381 Ga0495683_0003381_1626_2618 330
973 3300047323 Ga0495683_0004998 Ga0495683_0004998_1201_2193 330
974 3300047323 Ga0495683_0013677 Ga0495683_0013677_976_1968 330
975 3300047323 Ga0495683_0027770 Ga0495683_0027770_1624_2616 330
976 3300047323 Ga0495683_0050597 Ga0495683_0050597_855_1847 330
977 3300047443 Ga0495687_004248 Ga0495687_004248_6158_7150 330
978 3300047445 Ga0495677_0006133 Ga0495677_0006133_2625_3617 330
979 3300047446 Ga0495679_001913 Ga0495679_001913_317_1309 330
980 3300047446 Ga0495679_009858 Ga0495679_009858_979_2040 330
981 3300047446 Ga0495679_044514 Ga0495679_044514_296_1288 330
982 3300047447 Ga0495685_014424 Ga0495685_014424_1500_2492 330
983 3300047469 Ga0495673_0000630 Ga0495673_0000630_10019_11014 330
984 3300047469 Ga0495673_0002541 Ga0495673_0002541_9630_10622 330
985 3300047469 Ga0495673_0002605 Ga0495673_0002605_1864_2856 330
986 3300047469 Ga0495673_0003118 Ga0495673_0003118_1228_2289 330
987 3300047469 Ga0495673_0004279 Ga0495673_0004279_103_1095 330
988 3300047469 Ga0495673_0009955 Ga0495673_0009955_2006_2998 330
989 3300047469 Ga0495673_0018677 Ga0495673_0018677_1337_2329 330
990 3300047469 Ga0495673_0036871 Ga0495673_0036871_912_1904 330
991 3300047469 Ga0495673_0037835 Ga0495673_0037835_1095_2156 330
992 3300047470 Ga0495681_0001632 Ga0495681_0001632_1035_2027 330
993 3300047470 Ga0495681_0003540 Ga0495681_0003540_2000_2992 330
994 3300047470 Ga0495681_0008566 Ga0495681_0008566_3009_4001 330
995 3300047470 Ga0495681_0009988 Ga0495681_0009988_4120_5112 330
996 3300047470 Ga0495681_0013630 Ga0495681_0013630_1175_2179 330
997 3300047470 Ga0495681_0028928 Ga0495681_0028928_1443_2504 330
998 3300047470 Ga0495681_0036765 Ga0495681_0036765_560_1552 330
999 3300047470 Ga0495681_0038780 Ga0495681_0038780_1259_2254 330
1000 3300047470 Ga0495681_0112740 Ga0495681_0112740_77_1069 330
1001 3300047472 Ga0495686_0010976 Ga0495686_0010976_1352_2413 330
1002 3300047472 Ga0495686_0011965 Ga0495686_0011965_606_1787 330
1003 3300047472 Ga0495686_0027359 Ga0495686_0027359_1402_2394 330
1004 3300047673 Ga0495593_0026921 Ga0495593_0026921_1994_2986 330
1005 3300047673 Ga0495593_0036628 Ga0495593_0036628_217_1221 330
1006 3300048089 Ga0495614_0142311 Ga0495614_0142311_11_1003 330
1007 3300048091 Ga0495626_0000898 Ga0495626_0000898_1427_2419 330
1008 3300048091 Ga0495626_0001022 Ga0495626_0001022_888_1880 330
1009 3300048091 Ga0495626_0001131 Ga0495626_0001131_17896_18957 330
1010 3300048091 Ga0495626_0004441 Ga0495626_0004441_2578_3639 330
1011 3300048091 Ga0495626_0008164 Ga0495626_0008164_2150_3142 330
1012 3300048905 Ga0496102_0001175 Ga0496102_0001175_12363_13424 330
1013 3300048906 Ga0496103_0003037 Ga0496103_0003037_2392_3453 330
1014 3300048908 Ga0496105_0091246 Ga0496105_0091246_357_1352 330
1015 3300048913 Ga0496110_0058691 Ga0496110_0058691_2086_3078 330
1016 3300048913 Ga0496110_0128829 Ga0496110_0128829_136_1128 330
1017 3300048913 Ga0496110_0311611 Ga0496110_0311611_231_1223 330
1018 3300048916 Ga0496113_0096944 Ga0496113_0096944_26_1018 330
1019 3300048919 Ga0496116_0057764 Ga0496116_0057764_1384_2445 330
1020 3300048920 Ga0496117_0058271 Ga0496117_0058271_1564_2556 330
1021 3300048920 Ga0496117_0078529 Ga0496117_0078529_98_1159 330
1022 3300048920 Ga0496117_0107255 Ga0496117_0107255_419_1414 330
1023 3300048921 Ga0496118_0010626 Ga0496118_0010626_7009_8070 330
1024 3300048924 Ga0496121_0079537 Ga0496121_0079537_1385_2380 330
1025 3300048927 Ga0496124_0000942 Ga0496124_0000942_26869_27861 330
1026 3300048927 Ga0496124_0039719 Ga0496124_0039719_501_1493 330
1027 3300048927 Ga0496124_0206520 Ga0496124_0206520_370_1362 330
1028 3300048928 Ga0496125_0044073 Ga0496125_0044073_1907_2902 330
1029 3300049459 Ga0495678_011718 Ga0495678_011718_1375_2367 330
1030 3300049459 Ga0495678_012614 Ga0495678_012614_1073_2065 330
1031 3300049459 Ga0495678_015502 Ga0495678_015502_419_1480 330
1032 3300049459 Ga0495678_020149 Ga0495678_020149_778_1770 330
1033 3300049459 Ga0495678_020596 Ga0495678_020596_1390_2382 330
1034 3300049460 Ga0495682_0001116 Ga0495682_0001116_8747_9739 330
1035 3300049460 Ga0495682_0002657 Ga0495682_0002657_6121_7113 330
1036 3300049460 Ga0495682_0061707 Ga0495682_0061707_166_1230 330
1037 3300049662 Ga0501222_001192 Ga0501222_001192_2453_3448 330
1038 3300049766 Ga0501269_001103 Ga0501269_001103_2552_3553 330
1039 3300049766 Ga0501269_005778 Ga0501269_005778_413_1453 330
1040 3300049853 Ga0501226_000307 Ga0501226_000307_6214_7209 330
1041 3300050489 nmdc:mga03683_58397_c1 nmdc:mga03683_58397_c1_528_1520 330
1042 3300050491 nmdc:mga00v17_56393_c1 nmdc:mga00v17_56393_c1_1138_2199 330
1043 3300050514 nmdc:mga08x19_81902_c1 nmdc:mga08x19_81902_c1_148_1140 330
1044 iso_pu_bacteria 2738543020 2739286128 330
1045 iso_pu_bacteria 2738543021 2739291441 330
1046 2124908027 MRS2a_Contig_518 MRS2a_00398930 331
1047 3300003781 Ga0055536_1000343 Ga0055536_100034310 331
1048 3300003791 Ga0055530_10000488 Ga0055530_1000048817 331
1049 3300003792 Ga0055540_1001256 Ga0055540_10012567 331
1050 3300005288 Ga0065714_10001531 Ga0065714_100015315 331
1051 3300006058 Ga0075432_10029812 Ga0075432_100298122 331
1052 3300009036 Ga0105244_10004721 Ga0105244_100047217 331
1053 3300013104 Ga0157370_10066492 Ga0157370_100664922 331
1054 3300015261 Ga0182006_1001440 Ga0182006_100144010 331
1055 3300015262 Ga0182007_10000322 Ga0182007_1000032221 331
1056 3300015265 Ga0182005_1000792 Ga0182005_10007923 331
1057 3300025292 Ga0209676_1000337 Ga0209676_100033769 331
1058 3300025298 Ga0209050_1000106 Ga0209050_100010617 331
1059 3300025303 Ga0209051_1000260 Ga0209051_100026068 331
1060 3300025728 Ga0207655_1002582 Ga0207655_100258212 331
1061 3300041411 Ga0439466_0000291 Ga0439466_0000291_4003_5010 331
1062 3300041411 Ga0439466_0005494 Ga0439466_0005494_1269_2276 331
1063 3300041411 Ga0439466_0017160 Ga0439466_0017160_938_1933 331
1064 3300041411 Ga0439466_0025698 Ga0439466_0025698_81_1076 331
1065 3300041413 Ga0439465_0008239 Ga0439465_0008239_1004_1999 331
1066 3300042006 Ga0439432_000876 Ga0439432_000876_7890_8885 331
1067 3300042006 Ga0439432_012408 Ga0439432_012408_1169_2164 331
1068 3300042006 Ga0439432_034886 Ga0439432_034886_561_1568 331
1069 3300042009 Ga0439451_000177 Ga0439451_000177_1085_2080 331
1070 3300042009 Ga0439451_001319 Ga0439451_001319_2230_3237 331
1071 3300042009 Ga0439451_001576 Ga0439451_001576_1610_2605 331
1072 3300042010 Ga0439452_002607 Ga0439452_002607_822_1886 331
1073 3300042010 Ga0439452_007701 Ga0439452_007701_1568_2563 331
1074 3300042013 Ga0439456_003530 Ga0439456_003530_2056_3051 331
1075 3300042121 Ga0450919_000434 Ga0450919_000434_134_1129 331
1076 3300042127 Ga0450890_003305 Ga0450890_003305_1100_2095 331
1077 3300042130 Ga0450892_001574 Ga0450892_001574_107_1102 331
1078 3300042145 Ga0450906_000483 Ga0450906_000483_437_1432 331
1079 3300042146 Ga0450907_004466 Ga0450907_004466_269_1264 331
1080 3300042156 Ga0439446_0000897 Ga0439446_0000897_4661_5656 331
1081 3300042461 Ga0439460_0001063 Ga0439460_0001063_1919_2914 331
1082 3300042532 Ga0450893_0006817 Ga0450893_0006817_719_1714 331
1083 3300046452 Ga0495617_000462 Ga0495617_000462_990_1985 331
1084 3300046457 Ga0495590_0000867 Ga0495590_0000867_994_1989 331
1085 3300046459 Ga0495629_0006436 Ga0495629_0006436_6238_7233 331
1086 3300046460 Ga0495638_0008406 Ga0495638_0008406_2312_3307 331
1087 3300046463 Ga0495653_0011948 Ga0495653_0011948_3565_4560 331
1088 3300046471 Ga0495650_0004627 Ga0495650_0004627_8278_9273 331
1089 3300046474 Ga0495605_0000066 Ga0495605_0000066_116173_117171 331
1090 3300046474 Ga0495605_0018150 Ga0495605_0018150_1783_2778 331
1091 3300046474 Ga0495605_0041010 Ga0495605_0041010_1203_2198 331
1092 3300046475 Ga0495639_0000248 Ga0495639_0000248_1030_2025 331
1093 3300046475 Ga0495639_0002510 Ga0495639_0002510_6103_7098 331
1094 3300046491 Ga0495584_0000444 Ga0495584_0000444_14762_15757 331
1095 3300046492 Ga0495585_0116148 Ga0495585_0116148_332_1327 331
1096 3300046499 Ga0495594_0013133 Ga0495594_0013133_2257_3252 331
1097 3300046499 Ga0495594_0022581 Ga0495594_0022581_1479_2474 331
1098 3300046501 Ga0495607_0002606 Ga0495607_0002606_2629_3624 331
1099 3300046506 Ga0495583_0005532 Ga0495583_0005532_6529_7524 331
1100 3300046515 Ga0495620_0005409 Ga0495620_0005409_4958_5965 331
1101 3300046517 Ga0495630_0066109 Ga0495630_0066109_362_1357 331
1102 3300046518 Ga0495631_0020987 Ga0495631_0020987_78_1073 331
1103 3300046519 Ga0495632_0002576 Ga0495632_0002576_1030_2025 331
1104 3300046520 Ga0495637_0000992 Ga0495637_0000992_1089_2084 331
1105 3300046520 Ga0495637_0037830 Ga0495637_0037830_334_1341 331
1106 3300046520 Ga0495637_0082043 Ga0495637_0082043_205_1200 331
1107 3300046524 Ga0495648_0063355 Ga0495648_0063355_880_1944 331
1108 3300046526 Ga0495666_0007644 Ga0495666_0007644_3574_4569 331
1109 3300046526 Ga0495666_0030167 Ga0495666_0030167_265_1260 331
1110 3300046528 Ga0495642_0001027 Ga0495642_0001027_1002_1997 331
1111 3300046535 Ga0495586_0018212 Ga0495586_0018212_1758_2753 331
1112 3300046536 Ga0495587_0004236 Ga0495587_0004236_3600_4595 331
1113 3300046538 Ga0495609_0000125 Ga0495609_0000125_67465_68463 331
1114 3300046538 Ga0495609_0001565 Ga0495609_0001565_4769_5764 331
1115 3300046542 Ga0495597_0003287 Ga0495597_0003287_1183_2247 331
1116 3300046543 Ga0495645_0058681 Ga0495645_0058681_437_1432 331
1117 3300046557 Ga0495622_0000572 Ga0495622_0000572_20048_21043 331
1118 3300046557 Ga0495622_0013240 Ga0495622_0013240_2106_3113 331
1119 3300046557 Ga0495622_0097163 Ga0495622_0097163_148_1143 331
1120 3300046558 Ga0495633_0031028 Ga0495633_0031028_67_1062 331
1121 3300046648 Ga0495611_0001585 Ga0495611_0001585_801_1796 331
1122 3300046660 Ga0495625_0042587 Ga0495625_0042587_42_1037 331
1123 3300046663 Ga0495635_0004282 Ga0495635_0004282_5314_6309 331
1124 3300046664 Ga0495659_0000153 Ga0495659_0000153_8446_9441 331
1125 3300046664 Ga0495659_0001521 Ga0495659_0001521_933_1928 331
1126 3300046664 Ga0495659_0033436 Ga0495659_0033436_99_1094 331
1127 3300046665 Ga0495661_0020482 Ga0495661_0020482_706_1701 331
1128 3300046689 Ga0495613_0012696 Ga0495613_0012696_1379_2374 331
1129 3300046691 Ga0495670_0001825 Ga0495670_0001825_8401_9396 331
1130 3300046691 Ga0495670_0037300 Ga0495670_0037300_33_1028 331
1131 3300046692 Ga0495671_0000336 Ga0495671_0000336_16488_17483 331
1132 3300046694 Ga0495649_0001947 Ga0495649_0001947_8962_9957 331
1133 3300046694 Ga0495649_0004717 Ga0495649_0004717_1019_2014 331
1134 3300046794 Ga0495589_0001641 Ga0495589_0001641_925_1989 331
1135 3300046794 Ga0495589_0002488 Ga0495589_0002488_1014_2009 331
1136 3300046809 Ga0495600_0003159 Ga0495600_0003159_3753_4748 331
1137 3300046810 Ga0495660_0089736 Ga0495660_0089736_362_1369 331
1138 3300047315 Ga0495581_0004486 Ga0495581_0004486_983_1978 331
1139 3300047315 Ga0495581_0051731 Ga0495581_0051731_1081_2076 331
1140 3300047317 Ga0495604_0008037 Ga0495604_0008037_3294_4289 331
1141 3300047318 Ga0495636_0011816 Ga0495636_0011816_1750_2745 331
1142 3300047320 Ga0495672_0001518 Ga0495672_0001518_11889_12884 331
1143 3300047320 Ga0495672_0002877 Ga0495672_0002877_3360_4355 331
1144 3300047320 Ga0495672_0004292 Ga0495672_0004292_3969_4970 331
1145 3300047322 Ga0495680_0007966 Ga0495680_0007966_3247_4242 331
1146 3300047323 Ga0495683_0019241 Ga0495683_0019241_1685_2680 331
1147 3300047323 Ga0495683_0042183 Ga0495683_0042183_11_1006 331
1148 3300047443 Ga0495687_002981 Ga0495687_002981_997_1992 331
1149 3300047443 Ga0495687_015391 Ga0495687_015391_1020_2015 331
1150 3300047447 Ga0495685_014319 Ga0495685_014319_733_1728 331
1151 3300047469 Ga0495673_0000543 Ga0495673_0000543_5208_6215 331
1152 3300047469 Ga0495673_0002490 Ga0495673_0002490_1005_2000 331
1153 3300047469 Ga0495673_0008994 Ga0495673_0008994_2857_3855 331
1154 3300047469 Ga0495673_0051799 Ga0495673_0051799_662_1732 331
1155 3300047470 Ga0495681_0002028 Ga0495681_0002028_12057_13055 331
1156 3300047673 Ga0495593_0029981 Ga0495593_0029981_1059_2054 331
1157 3300048091 Ga0495626_0002134 Ga0495626_0002134_1008_2003 331
1158 3300048091 Ga0495626_0002366 Ga0495626_0002366_1404_2399 331
1159 3300048091 Ga0495626_0018798 Ga0495626_0018798_2426_3421 331
1160 3300048905 Ga0496102_0191211 Ga0496102_0191211_918_1913 331
1161 3300048907 Ga0496104_0343803 Ga0496104_0343803_167_1231 331
1162 3300048919 Ga0496116_0002272 Ga0496116_0002272_1117_2112 331
1163 3300048920 Ga0496117_0034133 Ga0496117_0034133_959_1954 331
1164 3300048924 Ga0496121_0103392 Ga0496121_0103392_1021_2016 331
1165 3300048925 Ga0496122_0007825 Ga0496122_0007825_1009_2004 331
1166 3300049459 Ga0495678_002089 Ga0495678_002089_638_1708 331
1167 3300049459 Ga0495678_002203 Ga0495678_002203_10897_11892 331
1168 3300049460 Ga0495682_0090746 Ga0495682_0090746_76_1071 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

304

383

0.98

PF01965

DJ-1_PfpI

DJ-1/PfpI family

118

244

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.9504 207 307
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9186 207 306
3mn2-assembly2.cif.gz_B the crystal structure of a probable arac family transcriptional regulator from rhodopseudomonas palustris cga009 0.9169 207 307
3mkl-assembly1.cif.gz_A crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 0.9005 207 307
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.897 202 306
ID Description Score Start End Superfamily
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9986 262 305 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9927 257 309 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9668 262 305 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9595 250 309 1.10.10.60
3lsgC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9569 262 305 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A4Q1SIF5-F1-model_v4 AraC family transcriptional regulator 0.9657 207 309 GO:0003700
GO:0043565
AF-A0A1G4VZP0-F1-model_v4 AraC-type DNA-binding protein 0.9618 207 306 GO:0003700
GO:0043565
AF-A0A1V2S9E3-F1-model_v4 deleted 0.9602 207 306
AF-A0A2E8CW25-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9595 206 304 GO:0003700
GO:0043565
AF-A0A536L2X9-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9586 206 306 GO:0003700
GO:0043565

Feature Viewer

pLDDT pTM Quality
83.28 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map