F491118
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1168 | 462 | 954 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0011965|Ga0495686_0011965_606_1787 |
| Length | 393 |
| Sequence | LSIGAGQRPLAFWEVVFLDIDYDECLLGHDCFLEVRFGCGMEYWSWPSVRGLAAPTIEGGKLTMDAQRAIAELGVLIYPGAQMAAVHGLTDLFGVANRIAAEHQEARLPLLRVSHWQVDGQQAPSRVYDSHPATDDALVAVLIPPSIAGFTEGQAPQPLLRWLRQQHASGATLGGVCVGSLLLAESGLLDGRSATTHWTSAKSFSERYPAIKLKADTPIVDDGDLITTAGLMAWSELGLRLVDRLLGPSIATGTARFLVVEHSDSASECGSNFAPILNHGDASILKVQHWLQSTGATDVSLATMAERAGLEERTFLRRFRAATGLKPTEYCQHLRVGKAREMLEFTNGTIDHIAWTVGYQDPGAFRSTFKKITGLAPSDYRARFGVMPSVATR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 4 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 5 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 6 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 7 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 8 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 9 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 10 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 11 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 12 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 13 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 14 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 15 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 16 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 17 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 18 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 19 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 20 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 21 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 22 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 23 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 24 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 25 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 26 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 27 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 28 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 29 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 30 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 31 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 32 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 33 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 34 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 35 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 36 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 37 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 38 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 39 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 40 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 41 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 42 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 43 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 44 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 45 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 46 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 47 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 48 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 49 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 50 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 51 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 52 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 53 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 54 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 55 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 56 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 57 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 58 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 59 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 60 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 61 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 62 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 63 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 64 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 65 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 66 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 67 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 68 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 69 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 70 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 71 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 72 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 73 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 74 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 75 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 76 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 77 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 78 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 79 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 80 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 81 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 82 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 83 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 84 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 85 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 86 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 87 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 88 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 89 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 90 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 91 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 92 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 93 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 94 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 95 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 96 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 97 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 98 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 99 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 100 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 101 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 102 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 103 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 104 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 105 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 106 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 107 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 108 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 109 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 110 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 111 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 112 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 113 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 114 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 115 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 116 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 117 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 118 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 119 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 120 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 121 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 122 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 123 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 124 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 125 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 126 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 127 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 128 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 129 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 130 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 131 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 132 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 133 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 134 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 135 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 136 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 137 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 138 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 139 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 140 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 141 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 142 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 143 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 144 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 145 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 146 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 147 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 148 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 149 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 150 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 151 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 152 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 153 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 154 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 155 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 156 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 157 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 158 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 159 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 160 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 161 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 162 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 163 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 164 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 165 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 166 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 167 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 168 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 169 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 170 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 171 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 172 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 173 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 174 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 175 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 176 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 177 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 178 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 179 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 180 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 181 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 182 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 183 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 184 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 185 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 186 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 187 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 188 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 189 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 190 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 191 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 192 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 193 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 194 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 195 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 196 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 197 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 198 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 199 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 200 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 201 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 202 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 203 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 204 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 205 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 206 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 207 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 208 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 209 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 210 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 211 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 216 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 219 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 220 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 221 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 222 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 223 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 224 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 225 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 226 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 227 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 228 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 229 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 236 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 238 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 245 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 246 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 247 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 248 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 250 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 260 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 263 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 264 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 266 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 267 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 270 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 285 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 287 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 289 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 290 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 291 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 292 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 293 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 294 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 295 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 296 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 297 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 298 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 299 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 300 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 301 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 302 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 303 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 304 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 305 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 306 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 307 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 308 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 309 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 310 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 311 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 312 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 313 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 314 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 315 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 316 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 317 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 318 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 319 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 320 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 321 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 322 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 323 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 324 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 325 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 326 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 327 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 328 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 329 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 330 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 331 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 332 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 333 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 410 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 411 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 412 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 413 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 414 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 415 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 416 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 417 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 418 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 419 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 420 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 421 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 422 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 423 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 424 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 425 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 426 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 429 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 430 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 431 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 432 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 433 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 434 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 436 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 437 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 438 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 439 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 440 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 441 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 442 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 443 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 444 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 445 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 446 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 447 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 448 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 449 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 450 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 451 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 452 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 453 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 454 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 455 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 456 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 457 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 458 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 459 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 460 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 461 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 462 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.68 |
| Metatranscriptomes | 0 |
| Isolates | 18.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.39 |
| Nodule | 3 |
| Rhizoplane | 6.25 |
| Rhizosphere | 74.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_518 | 2124908027 | Bacteria | 3171 |
| 2 | SwRhRL2b_contig_3565411 | 2162886007 | Bacteria | 2289 |
| 3 | JGI25162J39368_1000492 | 3300002737 | Bacteria | 30025 |
| 4 | JGI25163J39215_1000502 | 3300002771 | Bacteria | 11631 |
| 5 | JGI25164J39214_1000335 | 3300002772 | Bacteria | 30025 |
| 6 | JGI25152J39213_1001720 | 3300002773 | Bacteria | 8968 |
| 7 | JGI25165J46597_1000619 | 3300003214 | Bacteria | 30025 |
| 8 | Ga0055539_1000055 | 3300003752 | Bacteria | 164754 |
| 9 | Ga0055533_1000067 | 3300003756 | Bacteria | 164754 |
| 10 | Ga0055532_1000053 | 3300003758 | Bacteria | 164751 |
| 11 | Ga0055525_1000103 | 3300003759 | Bacteria | 134778 |
| 12 | Ga0055526_1030489 | 3300003771 | Bacteria | 1571 |
| 13 | Ga0055524_1013619 | 3300003775 | Bacteria | 3061 |
| 14 | Ga0055536_1000343 | 3300003781 | Bacteria | 34478 |
| 15 | Ga0055536_1001220 | 3300003781 | Bacteria | 15932 |
| 16 | Ga0055528_1016217 | 3300003790 | Bacteria | 2647 |
| 17 | Ga0055530_10000488 | 3300003791 | Bacteria | 34478 |
| 18 | Ga0055540_1000330 | 3300003792 | Bacteria | 41330 |
| 19 | Ga0055540_1001256 | 3300003792 | Bacteria | 15495 |
| 20 | Ga0055541_1000042 | 3300003841 | Bacteria | 164754 |
| 21 | Ga0065714_10000038 | 3300005288 | Bacteria | 15462 |
| 22 | Ga0065714_10001531 | 3300005288 | Bacteria | 6109 |
| 23 | Ga0065714_10003060 | 3300005288 | Bacteria | 23151 |
| 24 | Ga0065714_10003242 | 3300005288 | Bacteria | 8138 |
| 25 | Ga0065714_10009002 | 3300005288 | Bacteria | 4149 |
| 26 | Ga0065714_10009362 | 3300005288 | Bacteria | 2606 |
| 27 | Ga0065714_10066240 | 3300005288 | Bacteria | 7298 |
| 28 | Ga0065714_10067366 | 3300005288 | Bacteria | 5601 |
| 29 | Ga0065704_10116722 | 3300005289 | Bacteria | 1848 |
| 30 | Ga0065715_10135535 | 3300005293 | Bacteria | 1937 |
| 31 | Ga0070670_100000686 | 3300005331 | Bacteria | 26278 |
| 32 | Ga0070670_100001050 | 3300005331 | Bacteria | 21921 |
| 33 | Ga0070669_100000417 | 3300005353 | Bacteria | 32587 |
| 34 | Ga0070669_100004388 | 3300005353 | Bacteria | 10178 |
| 35 | Ga0070671_100013114 | 3300005355 | Bacteria | 6677 |
| 36 | Ga0070662_100000042 | 3300005457 | Bacteria | 72274 |
| 37 | Ga0068853_100000410 | 3300005539 | Bacteria | 29501 |
| 38 | Ga0070665_100003740 | 3300005548 | Bacteria | 16113 |
| 39 | Ga0070664_100057833 | 3300005564 | Bacteria | 3297 |
| 40 | Ga0068854_100000848 | 3300005578 | Bacteria | 18297 |
| 41 | Ga0068851_10000002 | 3300005834 | Bacteria | 302756 |
| 42 | Ga0081455_10229093 | 3300005937 | Bacteria | 1372 |
| 43 | Ga0075363_100069823 | 3300006048 | Bacteria | 1907 |
| 44 | Ga0075364_10048649 | 3300006051 | Bacteria | 2763 |
| 45 | Ga0075364_10057723 | 3300006051 | Bacteria | 2543 |
| 46 | Ga0075364_10058760 | 3300006051 | Bacteria | 2520 |
| 47 | Ga0075364_10226851 | 3300006051 | Bacteria | 1268 |
| 48 | Ga0075364_10252974 | 3300006051 | Bacteria | 1197 |
| 49 | Ga0075432_10001106 | 3300006058 | Bacteria | 8620 |
| 50 | Ga0075432_10006002 | 3300006058 | Bacteria | 4137 |
| 51 | Ga0075432_10009531 | 3300006058 | Bacteria | 3308 |
| 52 | Ga0075432_10029812 | 3300006058 | Bacteria | 1885 |
| 53 | Ga0075432_10041556 | 3300006058 | Bacteria | 1607 |
| 54 | Ga0075432_10048138 | 3300006058 | Bacteria | 1499 |
| 55 | Ga0075362_10036157 | 3300006177 | Bacteria | 2159 |
| 56 | Ga0075367_10016661 | 3300006178 | Bacteria | 4016 |
| 57 | Ga0075369_10001246 | 3300006186 | Bacteria | 8642 |
| 58 | Ga0075436_100142219 | 3300006914 | Bacteria | 1686 |
| 59 | Ga0075436_100154198 | 3300006914 | Bacteria | 1617 |
| 60 | Ga0079104_1000630 | 3300006946 | Bacteria | 34371 |
| 61 | Ga0079104_1005862 | 3300006946 | Bacteria | 4793 |
| 62 | Ga0105251_10000993 | 3300009011 | Bacteria | 24879 |
| 63 | Ga0105251_10001237 | 3300009011 | Bacteria | 22131 |
| 64 | Ga0105251_10003205 | 3300009011 | Bacteria | 12079 |
| 65 | Ga0105251_10028517 | 3300009011 | Bacteria | 2820 |
| 66 | Ga0105251_10051916 | 3300009011 | Bacteria | 1954 |
| 67 | Ga0105251_10054015 | 3300009011 | Bacteria | 1909 |
| 68 | Ga0105251_10117644 | 3300009011 | Bacteria | 1208 |
| 69 | Ga0105244_10002463 | 3300009036 | Bacteria | 13935 |
| 70 | Ga0105244_10003334 | 3300009036 | Bacteria | 11540 |
| 71 | Ga0105244_10004721 | 3300009036 | Bacteria | 9272 |
| 72 | Ga0105244_10024554 | 3300009036 | Bacteria | 3288 |
| 73 | Ga0105244_10055491 | 3300009036 | Bacteria | 2007 |
| 74 | Ga0105244_10083449 | 3300009036 | Bacteria | 1579 |
| 75 | Ga0105250_10002717 | 3300009092 | Bacteria | 8739 |
| 76 | Ga0105250_10004247 | 3300009092 | Bacteria | 6632 |
| 77 | Ga0105250_10005681 | 3300009092 | Bacteria | 5569 |
| 78 | Ga0105250_10054437 | 3300009092 | Bacteria | 1605 |
| 79 | Ga0105250_10057456 | 3300009092 | Bacteria | 1561 |
| 80 | Ga0105243_10001260 | 3300009148 | Bacteria | 22749 |
| 81 | Ga0105243_10025139 | 3300009148 | Bacteria | 4548 |
| 82 | Ga0105248_10016614 | 3300009177 | Bacteria | 8104 |
| 83 | Ga0105249_10028752 | 3300009553 | Bacteria | 5018 |
| 84 | Ga0123342_1011774 | 3300009766 | Bacteria | 9419 |
| 85 | Ga0105246_10007251 | 3300011119 | Bacteria | 6793 |
| 86 | Ga0157345_1000115 | 3300012498 | Bacteria | 15606 |
| 87 | Ga0157373_10001015 | 3300013100 | Bacteria | 21696 |
| 88 | Ga0157373_10001607 | 3300013100 | Bacteria | 17245 |
| 89 | Ga0157373_10009756 | 3300013100 | Bacteria | 7083 |
| 90 | Ga0157373_10027253 | 3300013100 | Bacteria | 4122 |
| 91 | Ga0157373_10061003 | 3300013100 | Bacteria | 2671 |
| 92 | Ga0157371_10000814 | 3300013102 | Bacteria | 35852 |
| 93 | Ga0157371_10004031 | 3300013102 | Bacteria | 13001 |
| 94 | Ga0157370_10009735 | 3300013104 | Bacteria | 10213 |
| 95 | Ga0157370_10066492 | 3300013104 | Bacteria | 3409 |
| 96 | Ga0157370_10344396 | 3300013104 | Bacteria | 1374 |
| 97 | Ga0157369_10004956 | 3300013105 | Bacteria | 15598 |
| 98 | Ga0157369_10005603 | 3300013105 | Bacteria | 14581 |
| 99 | Ga0157369_10005935 | 3300013105 | Bacteria | 14184 |
| 100 | Ga0157369_10042424 | 3300013105 | Bacteria | 4963 |
| 101 | Ga0157369_10114601 | 3300013105 | Bacteria | 2862 |
| 102 | Ga0157369_10260983 | 3300013105 | Bacteria | 1807 |
| 103 | Ga0163162_10000325 | 3300013306 | Bacteria | 43879 |
| 104 | Ga0163162_10006109 | 3300013306 | Bacteria | 11656 |
| 105 | Ga0163162_10166932 | 3300013306 | Bacteria | 2325 |
| 106 | Ga0157375_10003957 | 3300013308 | Bacteria | 12848 |
| 107 | Ga0157375_10056934 | 3300013308 | Bacteria | 3863 |
| 108 | Ga0182008_10000307 | 3300014497 | Bacteria | 38383 |
| 109 | Ga0182008_10001497 | 3300014497 | Bacteria | 15587 |
| 110 | Ga0182008_10002601 | 3300014497 | Bacteria | 11214 |
| 111 | Ga0182008_10008338 | 3300014497 | Bacteria | 5661 |
| 112 | Ga0182008_10033038 | 3300014497 | Bacteria | 2597 |
| 113 | Ga0182006_1001277 | 3300015261 | Bacteria | 15512 |
| 114 | Ga0182006_1001440 | 3300015261 | Bacteria | 14379 |
| 115 | Ga0182006_1047730 | 3300015261 | Bacteria | 1658 |
| 116 | Ga0182007_10000322 | 3300015262 | Bacteria | 30363 |
| 117 | Ga0182007_10002159 | 3300015262 | Bacteria | 10002 |
| 118 | Ga0182005_1000297 | 3300015265 | Bacteria | 30400 |
| 119 | Ga0182005_1000792 | 3300015265 | Bacteria | 14399 |
| 120 | Ga0163161_10002472 | 3300017792 | Bacteria | 13185 |
| 121 | Ga0163161_10008714 | 3300017792 | Bacteria | 7015 |
| 122 | Ga0163161_10015992 | 3300017792 | Bacteria | 5236 |
| 123 | Ga0163161_10059330 | 3300017792 | Bacteria | 2782 |
| 124 | Ga0163161_10064500 | 3300017792 | Bacteria | 2672 |
| 125 | Ga0163161_10128371 | 3300017792 | Bacteria | 1911 |
| 126 | Ga0163161_10129873 | 3300017792 | Bacteria | 1899 |
| 127 | Ga0163161_10336882 | 3300017792 | Bacteria | 1196 |
| 128 | Ga0209435_101282 | 3300025206 | Bacteria | 3285 |
| 129 | Ga0209760_100117 | 3300025207 | Bacteria | 57229 |
| 130 | Ga0209784_100060 | 3300025224 | Bacteria | 164838 |
| 131 | Ga0209566_100075 | 3300025225 | Bacteria | 164838 |
| 132 | Ga0209674_100100 | 3300025226 | Bacteria | 164838 |
| 133 | Ga0209147_100096 | 3300025229 | Bacteria | 164838 |
| 134 | Ga0209563_100118 | 3300025230 | Bacteria | 131627 |
| 135 | Ga0209563_101342 | 3300025230 | Bacteria | 6702 |
| 136 | Ga0207427_100063 | 3300025231 | Bacteria | 177711 |
| 137 | Ga0209437_100133 | 3300025233 | Bacteria | 178493 |
| 138 | Ga0209258_100387 | 3300025242 | Bacteria | 56263 |
| 139 | Ga0209646_1000276 | 3300025246 | Bacteria | 45523 |
| 140 | Ga0209677_100057 | 3300025253 | Bacteria | 164838 |
| 141 | Ga0209148_1000655 | 3300025254 | Bacteria | 29820 |
| 142 | Ga0209759_1008685 | 3300025256 | Bacteria | 3144 |
| 143 | Ga0209129_1013860 | 3300025258 | Bacteria | 1748 |
| 144 | Ga0209233_1000133 | 3300025261 | Bacteria | 202716 |
| 145 | Ga0209673_1008376 | 3300025273 | Bacteria | 4609 |
| 146 | Ga0209675_1009983 | 3300025291 | Bacteria | 3290 |
| 147 | Ga0209676_1000314 | 3300025292 | Bacteria | 94905 |
| 148 | Ga0209676_1000337 | 3300025292 | Bacteria | 89361 |
| 149 | Ga0209676_1001824 | 3300025292 | Bacteria | 17689 |
| 150 | Ga0209676_1019562 | 3300025292 | Bacteria | 2327 |
| 151 | Ga0209025_1025577 | 3300025294 | Bacteria | 2998 |
| 152 | Ga0209025_1039287 | 3300025294 | Bacteria | 2066 |
| 153 | Ga0209564_1035769 | 3300025295 | Bacteria | 1431 |
| 154 | Ga0209050_1000080 | 3300025298 | Bacteria | 275154 |
| 155 | Ga0209050_1000106 | 3300025298 | Bacteria | 224396 |
| 156 | Ga0209050_1001281 | 3300025298 | Bacteria | 28701 |
| 157 | Ga0207426_1002536 | 3300025302 | Bacteria | 11460 |
| 158 | Ga0209051_1000260 | 3300025303 | Bacteria | 88213 |
| 159 | Ga0209051_1000283 | 3300025303 | Bacteria | 82731 |
| 160 | Ga0209051_1009473 | 3300025303 | Bacteria | 5016 |
| 161 | Ga0209051_1049555 | 3300025303 | Bacteria | 1413 |
| 162 | Ga0207656_10000010 | 3300025321 | Bacteria | 192224 |
| 163 | Ga0207696_1000339 | 3300025711 | Bacteria | 48686 |
| 164 | Ga0207696_1000587 | 3300025711 | Bacteria | 28197 |
| 165 | Ga0207696_1003503 | 3300025711 | Bacteria | 7102 |
| 166 | Ga0207696_1011320 | 3300025711 | Bacteria | 3221 |
| 167 | Ga0207655_1000606 | 3300025728 | Bacteria | 43412 |
| 168 | Ga0207655_1002582 | 3300025728 | Bacteria | 14448 |
| 169 | Ga0207655_1003282 | 3300025728 | Bacteria | 12140 |
| 170 | Ga0207655_1009574 | 3300025728 | Bacteria | 6003 |
| 171 | Ga0207655_1020665 | 3300025728 | Bacteria | 3372 |
| 172 | Ga0207655_1022240 | 3300025728 | Bacteria | 3187 |
| 173 | Ga0207713_1000261 | 3300025735 | Bacteria | 65024 |
| 174 | Ga0207713_1001277 | 3300025735 | Bacteria | 20747 |
| 175 | Ga0207713_1001528 | 3300025735 | Bacteria | 18224 |
| 176 | Ga0207713_1001865 | 3300025735 | Bacteria | 16028 |
| 177 | Ga0207713_1002361 | 3300025735 | Bacteria | 13827 |
| 178 | Ga0207713_1003890 | 3300025735 | Bacteria | 9946 |
| 179 | Ga0207713_1015282 | 3300025735 | Bacteria | 3947 |
| 180 | Ga0207713_1029955 | 3300025735 | Bacteria | 2429 |
| 181 | Ga0207681_10001197 | 3300025923 | Bacteria | 16670 |
| 182 | Ga0207681_10002487 | 3300025923 | Bacteria | 11699 |
| 183 | Ga0207650_10000278 | 3300025925 | Bacteria | 53364 |
| 184 | Ga0207650_10000324 | 3300025925 | Bacteria | 46570 |
| 185 | Ga0207644_10116047 | 3300025931 | Bacteria | 2031 |
| 186 | Ga0207706_10000128 | 3300025933 | Bacteria | 81615 |
| 187 | Ga0207709_10000030 | 3300025935 | Bacteria | 331710 |
| 188 | Ga0207709_10162495 | 3300025935 | Bacteria | 1559 |
| 189 | Ga0207679_10029236 | 3300025945 | Bacteria | 3835 |
| 190 | Ga0207639_10002029 | 3300026041 | Bacteria | 13647 |
| 191 | Ga0209281_1000070 | 3300027111 | Bacteria | 277098 |
| 192 | Ga0209281_1003455 | 3300027111 | Bacteria | 5212 |
| 193 | Ga0209970_1001473 | 3300027614 | Bacteria | 4110 |
| 194 | Ga0207428_10004708 | 3300027907 | Bacteria | 12905 |
| 195 | Ga0207428_10009676 | 3300027907 | Bacteria | 8637 |
| 196 | Ga0207428_10035747 | 3300027907 | Bacteria | 4058 |
| 197 | Ga0207428_10088080 | 3300027907 | Bacteria | 2415 |
| 198 | Ga0207428_10257673 | 3300027907 | Bacteria | 1300 |
| 199 | Ga0268266_10005512 | 3300028379 | Bacteria | 11782 |
| 200 | Ga0314311_1241414 | 3300030733 | Bacteria | 5070 |
| 201 | Ga0307408_100003846 | 3300031548 | Bacteria | 10216 |
| 202 | Ga0307408_100010120 | 3300031548 | Bacteria | 6217 |
| 203 | Ga0307408_100012131 | 3300031548 | Bacteria | 5704 |
| 204 | Ga0307408_100027993 | 3300031548 | Bacteria | 3890 |
| 205 | Ga0307408_100130512 | 3300031548 | Bacteria | 1959 |
| 206 | Ga0307405_10001496 | 3300031731 | Bacteria | 9890 |
| 207 | Ga0307405_10004726 | 3300031731 | Bacteria | 6482 |
| 208 | Ga0307413_10022062 | 3300031824 | Bacteria | 3422 |
| 209 | Ga0307407_10045261 | 3300031903 | Bacteria | 2485 |
| 210 | Ga0307412_10001694 | 3300031911 | Bacteria | 12180 |
| 211 | Ga0307412_10002511 | 3300031911 | Bacteria | 10199 |
| 212 | Ga0307409_100029505 | 3300031995 | Bacteria | 3926 |
| 213 | Ga0307416_100067168 | 3300032002 | Bacteria | 2956 |
| 214 | Ga0307416_100105112 | 3300032002 | Bacteria | 2470 |
| 215 | Ga0307416_100441505 | 3300032002 | Bacteria | 1351 |
| 216 | Ga0307414_10040299 | 3300032004 | Bacteria | 3153 |
| 217 | Ga0307414_10086020 | 3300032004 | Bacteria | 2318 |
| 218 | Ga0307414_10175184 | 3300032004 | Bacteria | 1719 |
| 219 | Ga0307414_10233692 | 3300032004 | Bacteria | 1517 |
| 220 | Ga0307411_10270466 | 3300032005 | Bacteria | 1347 |
| 221 | Ga0307510_10007351 | 3300033180 | Bacteria | 13126 |
| 222 | Ga0237819_01552 | 3300038705 | Bacteria | 5803 |
| 223 | Ga0439438_000609 | 3300041405 | Bacteria | 16125 |
| 224 | Ga0439438_000664 | 3300041405 | Bacteria | 15458 |
| 225 | Ga0439438_001480 | 3300041405 | Bacteria | 10342 |
| 226 | Ga0439438_002279 | 3300041405 | Bacteria | 8224 |
| 227 | Ga0439438_003128 | 3300041405 | Bacteria | 6793 |
| 228 | Ga0439438_003649 | 3300041405 | Bacteria | 6155 |
| 229 | Ga0439438_004153 | 3300041405 | Bacteria | 5645 |
| 230 | Ga0439438_011195 | 3300041405 | Bacteria | 2803 |
| 231 | Ga0439438_018796 | 3300041405 | Bacteria | 1962 |
| 232 | Ga0439438_037973 | 3300041405 | Bacteria | 1258 |
| 233 | Ga0439447_010414 | 3300041407 | Bacteria | 2758 |
| 234 | Ga0439447_026360 | 3300041407 | Bacteria | 1490 |
| 235 | Ga0439466_0000291 | 3300041411 | Bacteria | 19484 |
| 236 | Ga0439466_0000329 | 3300041411 | Bacteria | 18267 |
| 237 | Ga0439466_0005494 | 3300041411 | Bacteria | 4840 |
| 238 | Ga0439466_0012614 | 3300041411 | Bacteria | 3108 |
| 239 | Ga0439466_0017160 | 3300041411 | Bacteria | 2610 |
| 240 | Ga0439466_0019020 | 3300041411 | Bacteria | 2460 |
| 241 | Ga0439466_0025698 | 3300041411 | Bacteria | 2053 |
| 242 | Ga0439466_0041948 | 3300041411 | Bacteria | 1525 |
| 243 | Ga0439465_0008239 | 3300041413 | Bacteria | 3291 |
| 244 | Ga0439431_0001234 | 3300041997 | Bacteria | 5602 |
| 245 | Ga0439442_009238 | 3300042002 | Bacteria | 1994 |
| 246 | Ga0439445_0003764 | 3300042004 | Bacteria | 3406 |
| 247 | Ga0439445_0012296 | 3300042004 | Bacteria | 2054 |
| 248 | Ga0439445_0043772 | 3300042004 | Bacteria | 1195 |
| 249 | Ga0439432_000354 | 3300042006 | Bacteria | 16807 |
| 250 | Ga0439432_000876 | 3300042006 | Bacteria | 11272 |
| 251 | Ga0439432_001714 | 3300042006 | Bacteria | 8204 |
| 252 | Ga0439432_003883 | 3300042006 | Bacteria | 5506 |
| 253 | Ga0439432_012408 | 3300042006 | Bacteria | 2917 |
| 254 | Ga0439432_017618 | 3300042006 | Bacteria | 2395 |
| 255 | Ga0439432_034886 | 3300042006 | Bacteria | 1613 |
| 256 | Ga0439451_000177 | 3300042009 | Bacteria | 11983 |
| 257 | Ga0439451_001319 | 3300042009 | Bacteria | 4892 |
| 258 | Ga0439451_001576 | 3300042009 | Bacteria | 4503 |
| 259 | Ga0439451_004296 | 3300042009 | Bacteria | 2892 |
| 260 | Ga0439451_005616 | 3300042009 | Bacteria | 2561 |
| 261 | Ga0439451_025113 | 3300042009 | Bacteria | 1200 |
| 262 | Ga0439452_000518 | 3300042010 | Bacteria | 20799 |
| 263 | Ga0439452_002607 | 3300042010 | Bacteria | 6602 |
| 264 | Ga0439452_003167 | 3300042010 | Bacteria | 5825 |
| 265 | Ga0439452_007701 | 3300042010 | Bacteria | 3285 |
| 266 | Ga0439452_007740 | 3300042010 | Bacteria | 3272 |
| 267 | Ga0439452_015367 | 3300042010 | Bacteria | 2102 |
| 268 | Ga0439452_022256 | 3300042010 | Bacteria | 1642 |
| 269 | Ga0439456_002394 | 3300042013 | Bacteria | 3781 |
| 270 | Ga0439456_003523 | 3300042013 | Bacteria | 3175 |
| 271 | Ga0439456_003530 | 3300042013 | Bacteria | 3171 |
| 272 | Ga0439456_003829 | 3300042013 | Bacteria | 3054 |
| 273 | Ga0439463_000006 | 3300042016 | Bacteria | 45954 |
| 274 | Ga0439463_008505 | 3300042016 | Bacteria | 2530 |
| 275 | Ga0439463_009044 | 3300042016 | Bacteria | 2452 |
| 276 | Ga0439463_010036 | 3300042016 | Bacteria | 2327 |
| 277 | Ga0439463_051338 | 3300042016 | Bacteria | 1052 |
| 278 | Ga0450911_000160 | 3300042115 | Bacteria | 26844 |
| 279 | Ga0450911_000430 | 3300042115 | Bacteria | 13764 |
| 280 | Ga0450911_001424 | 3300042115 | Bacteria | 5513 |
| 281 | Ga0450919_000434 | 3300042121 | Bacteria | 5167 |
| 282 | Ga0450919_001134 | 3300042121 | Bacteria | 3456 |
| 283 | Ga0450922_000100 | 3300042124 | Bacteria | 8272 |
| 284 | Ga0450890_003305 | 3300042127 | Bacteria | 2149 |
| 285 | Ga0450891_001060 | 3300042129 | Bacteria | 2877 |
| 286 | Ga0450892_001574 | 3300042130 | Bacteria | 2160 |
| 287 | Ga0450894_000950 | 3300042131 | Bacteria | 4565 |
| 288 | Ga0450898_000742 | 3300042134 | Bacteria | 3985 |
| 289 | Ga0450902_000913 | 3300042137 | Bacteria | 3867 |
| 290 | Ga0450903_002728 | 3300042138 | Bacteria | 3107 |
| 291 | Ga0450903_004965 | 3300042138 | Bacteria | 2241 |
| 292 | Ga0450904_000327 | 3300042139 | Bacteria | 10009 |
| 293 | Ga0450906_000316 | 3300042145 | Bacteria | 9754 |
| 294 | Ga0450906_000483 | 3300042145 | Bacteria | 8385 |
| 295 | Ga0450906_001562 | 3300042145 | Bacteria | 5005 |
| 296 | Ga0450907_000072 | 3300042146 | Bacteria | 38960 |
| 297 | Ga0450907_001112 | 3300042146 | Bacteria | 6143 |
| 298 | Ga0450907_004466 | 3300042146 | Bacteria | 2410 |
| 299 | Ga0450910_000316 | 3300042147 | Bacteria | 5628 |
| 300 | Ga0450910_001276 | 3300042147 | Bacteria | 3146 |
| 301 | Ga0450910_001811 | 3300042147 | Bacteria | 2758 |
| 302 | Ga0439446_0000897 | 3300042156 | Bacteria | 6407 |
| 303 | Ga0439446_0009363 | 3300042156 | Bacteria | 2622 |
| 304 | Ga0450909_001026 | 3300042185 | Bacteria | 3837 |
| 305 | Ga0439434_0000723 | 3300042435 | Bacteria | 9438 |
| 306 | Ga0439460_0001063 | 3300042461 | Bacteria | 6393 |
| 307 | Ga0439460_0001093 | 3300042461 | Bacteria | 6316 |
| 308 | Ga0439460_0025977 | 3300042461 | Bacteria | 1635 |
| 309 | Ga0450918_002822 | 3300042531 | Bacteria | 3264 |
| 310 | Ga0450918_009175 | 3300042531 | Bacteria | 1736 |
| 311 | Ga0450893_0006817 | 3300042532 | Bacteria | 1849 |
| 312 | Ga0439440_0006812 | 3300042993 | Bacteria | 2309 |
| 313 | Ga0495617_000462 | 3300046452 | Bacteria | 21788 |
| 314 | Ga0495617_000817 | 3300046452 | Bacteria | 14971 |
| 315 | Ga0495617_002363 | 3300046452 | Bacteria | 7544 |
| 316 | Ga0495617_007432 | 3300046452 | Bacteria | 3801 |
| 317 | Ga0495617_009730 | 3300046452 | Bacteria | 3298 |
| 318 | Ga0495617_009862 | 3300046452 | Bacteria | 3275 |
| 319 | Ga0495617_024173 | 3300046452 | Bacteria | 2050 |
| 320 | Ga0495617_025088 | 3300046452 | Bacteria | 2010 |
| 321 | Ga0495617_053288 | 3300046452 | Bacteria | 1343 |
| 322 | Ga0495617_057811 | 3300046452 | Bacteria | 1285 |
| 323 | Ga0495617_061930 | 3300046452 | Bacteria | 1236 |
| 324 | Ga0495617_072357 | 3300046452 | Bacteria | 1133 |
| 325 | Ga0495627_000759 | 3300046453 | Bacteria | 23979 |
| 326 | Ga0495627_001265 | 3300046453 | Bacteria | 15565 |
| 327 | Ga0495627_001292 | 3300046453 | Bacteria | 15369 |
| 328 | Ga0495627_002584 | 3300046453 | Bacteria | 8568 |
| 329 | Ga0495627_008351 | 3300046453 | Bacteria | 3891 |
| 330 | Ga0495627_009226 | 3300046453 | Bacteria | 3638 |
| 331 | Ga0495627_055325 | 3300046453 | Bacteria | 1184 |
| 332 | Ga0495603_0013335 | 3300046455 | Bacteria | 4971 |
| 333 | Ga0495603_0022915 | 3300046455 | Bacteria | 3779 |
| 334 | Ga0495590_0000859 | 3300046457 | Bacteria | 13675 |
| 335 | Ga0495590_0000867 | 3300046457 | Bacteria | 13612 |
| 336 | Ga0495590_0011023 | 3300046457 | Bacteria | 3388 |
| 337 | Ga0495590_0021048 | 3300046457 | Bacteria | 2314 |
| 338 | Ga0495590_0026389 | 3300046457 | Bacteria | 2039 |
| 339 | Ga0495590_0054438 | 3300046457 | Bacteria | 1397 |
| 340 | Ga0495590_0072815 | 3300046457 | Bacteria | 1207 |
| 341 | Ga0495590_0097828 | 3300046457 | Bacteria | 1041 |
| 342 | Ga0495591_000156 | 3300046458 | Bacteria | 72588 |
| 343 | Ga0495591_000506 | 3300046458 | Bacteria | 30670 |
| 344 | Ga0495591_001340 | 3300046458 | Bacteria | 15469 |
| 345 | Ga0495591_001352 | 3300046458 | Bacteria | 15394 |
| 346 | Ga0495591_003167 | 3300046458 | Bacteria | 8679 |
| 347 | Ga0495591_006673 | 3300046458 | Bacteria | 5045 |
| 348 | Ga0495591_010940 | 3300046458 | Bacteria | 3469 |
| 349 | Ga0495591_013215 | 3300046458 | Bacteria | 3034 |
| 350 | Ga0495591_015999 | 3300046458 | Bacteria | 2629 |
| 351 | Ga0495591_017249 | 3300046458 | Bacteria | 2486 |
| 352 | Ga0495591_026025 | 3300046458 | Bacteria | 1825 |
| 353 | Ga0495591_047303 | 3300046458 | Bacteria | 1191 |
| 354 | Ga0495629_0006436 | 3300046459 | Bacteria | 8709 |
| 355 | Ga0495629_0290272 | 3300046459 | Bacteria | 1121 |
| 356 | Ga0495638_0001683 | 3300046460 | Bacteria | 19564 |
| 357 | Ga0495638_0002334 | 3300046460 | Bacteria | 15593 |
| 358 | Ga0495638_0004057 | 3300046460 | Bacteria | 11228 |
| 359 | Ga0495638_0004885 | 3300046460 | Bacteria | 10078 |
| 360 | Ga0495638_0008406 | 3300046460 | Bacteria | 7321 |
| 361 | Ga0495638_0009774 | 3300046460 | Bacteria | 6699 |
| 362 | Ga0495638_0017812 | 3300046460 | Bacteria | 4728 |
| 363 | Ga0495638_0046421 | 3300046460 | Bacteria | 2728 |
| 364 | Ga0495638_0050564 | 3300046460 | Bacteria | 2595 |
| 365 | Ga0495638_0055560 | 3300046460 | Bacteria | 2458 |
| 366 | Ga0495638_0065783 | 3300046460 | Bacteria | 2230 |
| 367 | Ga0495638_0069317 | 3300046460 | Bacteria | 2161 |
| 368 | Ga0495638_0074312 | 3300046460 | Bacteria | 2073 |
| 369 | Ga0495653_0011948 | 3300046463 | Bacteria | 7091 |
| 370 | Ga0495653_0090152 | 3300046463 | Bacteria | 2244 |
| 371 | Ga0495650_0004627 | 3300046471 | Bacteria | 9334 |
| 372 | Ga0495650_0019401 | 3300046471 | Bacteria | 3347 |
| 373 | Ga0495650_0019880 | 3300046471 | Bacteria | 3289 |
| 374 | Ga0495650_0020286 | 3300046471 | Bacteria | 3244 |
| 375 | Ga0495650_0024315 | 3300046471 | Bacteria | 2862 |
| 376 | Ga0495650_0025467 | 3300046471 | Bacteria | 2772 |
| 377 | Ga0495650_0025655 | 3300046471 | Bacteria | 2756 |
| 378 | Ga0495650_0032894 | 3300046471 | Bacteria | 2314 |
| 379 | Ga0495650_0061943 | 3300046471 | Bacteria | 1496 |
| 380 | Ga0495650_0062158 | 3300046471 | Bacteria | 1493 |
| 381 | Ga0495605_0000066 | 3300046474 | Bacteria | 139260 |
| 382 | Ga0495605_0002258 | 3300046474 | Bacteria | 12029 |
| 383 | Ga0495605_0003138 | 3300046474 | Bacteria | 9955 |
| 384 | Ga0495605_0006707 | 3300046474 | Bacteria | 6588 |
| 385 | Ga0495605_0008040 | 3300046474 | Bacteria | 5972 |
| 386 | Ga0495605_0010626 | 3300046474 | Bacteria | 5146 |
| 387 | Ga0495605_0018150 | 3300046474 | Bacteria | 3776 |
| 388 | Ga0495605_0041010 | 3300046474 | Bacteria | 2307 |
| 389 | Ga0495605_0045247 | 3300046474 | Bacteria | 2170 |
| 390 | Ga0495605_0061778 | 3300046474 | Bacteria | 1791 |
| 391 | Ga0495605_0085110 | 3300046474 | Bacteria | 1473 |
| 392 | Ga0495639_0000248 | 3300046475 | Bacteria | 26780 |
| 393 | Ga0495639_0002510 | 3300046475 | Bacteria | 8006 |
| 394 | Ga0495639_0026401 | 3300046475 | Bacteria | 2567 |
| 395 | Ga0495584_0000071 | 3300046491 | Bacteria | 72115 |
| 396 | Ga0495584_0000444 | 3300046491 | Bacteria | 28477 |
| 397 | Ga0495584_0001022 | 3300046491 | Bacteria | 17470 |
| 398 | Ga0495584_0002615 | 3300046491 | Bacteria | 10149 |
| 399 | Ga0495584_0002731 | 3300046491 | Bacteria | 9886 |
| 400 | Ga0495584_0007166 | 3300046491 | Bacteria | 5824 |
| 401 | Ga0495584_0007358 | 3300046491 | Bacteria | 5743 |
| 402 | Ga0495584_0008355 | 3300046491 | Bacteria | 5361 |
| 403 | Ga0495584_0008672 | 3300046491 | Bacteria | 5261 |
| 404 | Ga0495584_0016660 | 3300046491 | Bacteria | 3747 |
| 405 | Ga0495584_0020609 | 3300046491 | Bacteria | 3348 |
| 406 | Ga0495584_0025409 | 3300046491 | Bacteria | 3003 |
| 407 | Ga0495584_0032585 | 3300046491 | Bacteria | 2637 |
| 408 | Ga0495584_0067456 | 3300046491 | Bacteria | 1798 |
| 409 | Ga0495585_0002284 | 3300046492 | Bacteria | 13833 |
| 410 | Ga0495585_0004056 | 3300046492 | Bacteria | 9632 |
| 411 | Ga0495585_0004291 | 3300046492 | Bacteria | 9281 |
| 412 | Ga0495585_0004828 | 3300046492 | Bacteria | 8654 |
| 413 | Ga0495585_0009701 | 3300046492 | Bacteria | 5763 |
| 414 | Ga0495585_0018341 | 3300046492 | Bacteria | 4037 |
| 415 | Ga0495585_0018563 | 3300046492 | Bacteria | 4011 |
| 416 | Ga0495585_0021363 | 3300046492 | Bacteria | 3716 |
| 417 | Ga0495585_0029670 | 3300046492 | Bacteria | 3112 |
| 418 | Ga0495585_0029898 | 3300046492 | Bacteria | 3099 |
| 419 | Ga0495585_0039917 | 3300046492 | Bacteria | 2637 |
| 420 | Ga0495585_0054462 | 3300046492 | Bacteria | 2211 |
| 421 | Ga0495585_0116148 | 3300046492 | Bacteria | 1419 |
| 422 | Ga0495585_0143636 | 3300046492 | Bacteria | 1248 |
| 423 | Ga0495594_0013133 | 3300046499 | Bacteria | 4318 |
| 424 | Ga0495594_0014825 | 3300046499 | Bacteria | 4089 |
| 425 | Ga0495594_0022581 | 3300046499 | Bacteria | 3366 |
| 426 | Ga0495596_0000258 | 3300046500 | Bacteria | 35383 |
| 427 | Ga0495596_0040739 | 3300046500 | Bacteria | 1833 |
| 428 | Ga0495607_0001003 | 3300046501 | Bacteria | 26008 |
| 429 | Ga0495607_0002532 | 3300046501 | Bacteria | 14789 |
| 430 | Ga0495607_0002606 | 3300046501 | Bacteria | 14492 |
| 431 | Ga0495607_0003183 | 3300046501 | Bacteria | 12683 |
| 432 | Ga0495607_0010191 | 3300046501 | Bacteria | 6323 |
| 433 | Ga0495607_0011992 | 3300046501 | Bacteria | 5737 |
| 434 | Ga0495607_0016364 | 3300046501 | Bacteria | 4786 |
| 435 | Ga0495607_0019454 | 3300046501 | Bacteria | 4314 |
| 436 | Ga0495607_0028980 | 3300046501 | Bacteria | 3410 |
| 437 | Ga0495607_0028986 | 3300046501 | Bacteria | 3409 |
| 438 | Ga0495607_0029539 | 3300046501 | Bacteria | 3372 |
| 439 | Ga0495607_0030074 | 3300046501 | Bacteria | 3338 |
| 440 | Ga0495607_0037011 | 3300046501 | Bacteria | 2934 |
| 441 | Ga0495607_0066209 | 3300046501 | Bacteria | 2034 |
| 442 | Ga0495607_0072180 | 3300046501 | Bacteria | 1922 |
| 443 | Ga0495607_0104149 | 3300046501 | Bacteria | 1514 |
| 444 | Ga0495583_0001282 | 3300046506 | Bacteria | 26263 |
| 445 | Ga0495583_0003679 | 3300046506 | Bacteria | 11419 |
| 446 | Ga0495583_0004019 | 3300046506 | Bacteria | 10839 |
| 447 | Ga0495583_0004601 | 3300046506 | Bacteria | 9768 |
| 448 | Ga0495583_0005532 | 3300046506 | Bacteria | 8551 |
| 449 | Ga0495583_0020631 | 3300046506 | Bacteria | 3407 |
| 450 | Ga0495606_0003121 | 3300046507 | Bacteria | 17989 |
| 451 | Ga0495606_0003819 | 3300046507 | Bacteria | 15627 |
| 452 | Ga0495606_0007299 | 3300046507 | Bacteria | 9951 |
| 453 | Ga0495606_0007403 | 3300046507 | Bacteria | 9843 |
| 454 | Ga0495606_0016163 | 3300046507 | Bacteria | 5706 |
| 455 | Ga0495606_0022726 | 3300046507 | Bacteria | 4558 |
| 456 | Ga0495606_0027057 | 3300046507 | Bacteria | 4073 |
| 457 | Ga0495606_0029257 | 3300046507 | Bacteria | 3871 |
| 458 | Ga0495606_0037025 | 3300046507 | Bacteria | 3316 |
| 459 | Ga0495606_0086836 | 3300046507 | Bacteria | 1932 |
| 460 | Ga0495610_0003297 | 3300046512 | Bacteria | 12701 |
| 461 | Ga0495610_0003447 | 3300046512 | Bacteria | 12314 |
| 462 | Ga0495610_0004885 | 3300046512 | Bacteria | 9745 |
| 463 | Ga0495610_0005434 | 3300046512 | Bacteria | 9055 |
| 464 | Ga0495610_0008280 | 3300046512 | Bacteria | 6755 |
| 465 | Ga0495610_0011291 | 3300046512 | Bacteria | 5472 |
| 466 | Ga0495610_0016961 | 3300046512 | Bacteria | 4169 |
| 467 | Ga0495610_0034698 | 3300046512 | Bacteria | 2596 |
| 468 | Ga0495610_0036876 | 3300046512 | Bacteria | 2494 |
| 469 | Ga0495610_0039282 | 3300046512 | Bacteria | 2395 |
| 470 | Ga0495610_0050948 | 3300046512 | Bacteria | 2018 |
| 471 | Ga0495610_0087962 | 3300046512 | Bacteria | 1413 |
| 472 | Ga0495616_0001472 | 3300046513 | Bacteria | 16351 |
| 473 | Ga0495616_0003328 | 3300046513 | Bacteria | 10325 |
| 474 | Ga0495616_0003536 | 3300046513 | Bacteria | 9987 |
| 475 | Ga0495616_0003948 | 3300046513 | Bacteria | 9444 |
| 476 | Ga0495616_0029294 | 3300046513 | Bacteria | 2908 |
| 477 | Ga0495620_0000089 | 3300046515 | Bacteria | 74701 |
| 478 | Ga0495620_0000406 | 3300046515 | Bacteria | 28771 |
| 479 | Ga0495620_0001195 | 3300046515 | Bacteria | 15882 |
| 480 | Ga0495620_0003116 | 3300046515 | Bacteria | 9523 |
| 481 | Ga0495620_0003383 | 3300046515 | Bacteria | 9127 |
| 482 | Ga0495620_0005409 | 3300046515 | Bacteria | 7128 |
| 483 | Ga0495620_0008667 | 3300046515 | Bacteria | 5451 |
| 484 | Ga0495620_0018238 | 3300046515 | Bacteria | 3478 |
| 485 | Ga0495620_0018891 | 3300046515 | Bacteria | 3404 |
| 486 | Ga0495620_0019091 | 3300046515 | Bacteria | 3381 |
| 487 | Ga0495620_0048203 | 3300046515 | Bacteria | 1830 |
| 488 | Ga0495628_0084739 | 3300046516 | Bacteria | 2459 |
| 489 | Ga0495630_0053569 | 3300046517 | Bacteria | 3021 |
| 490 | Ga0495630_0066109 | 3300046517 | Bacteria | 2717 |
| 491 | Ga0495631_0000301 | 3300046518 | Bacteria | 34657 |
| 492 | Ga0495631_0001267 | 3300046518 | Bacteria | 15587 |
| 493 | Ga0495631_0015226 | 3300046518 | Bacteria | 3691 |
| 494 | Ga0495631_0020987 | 3300046518 | Bacteria | 3045 |
| 495 | Ga0495631_0032925 | 3300046518 | Bacteria | 2332 |
| 496 | Ga0495631_0039959 | 3300046518 | Bacteria | 2079 |
| 497 | Ga0495631_0134231 | 3300046518 | Bacteria | 1063 |
| 498 | Ga0495632_0001411 | 3300046519 | Bacteria | 20070 |
| 499 | Ga0495632_0002134 | 3300046519 | Bacteria | 15363 |
| 500 | Ga0495632_0002319 | 3300046519 | Bacteria | 14645 |
| 501 | Ga0495632_0002576 | 3300046519 | Bacteria | 13699 |
| 502 | Ga0495632_0005110 | 3300046519 | Bacteria | 8764 |
| 503 | Ga0495632_0010772 | 3300046519 | Bacteria | 5387 |
| 504 | Ga0495632_0017457 | 3300046519 | Bacteria | 3959 |
| 505 | Ga0495632_0019715 | 3300046519 | Bacteria | 3668 |
| 506 | Ga0495632_0019792 | 3300046519 | Bacteria | 3659 |
| 507 | Ga0495632_0022243 | 3300046519 | Bacteria | 3400 |
| 508 | Ga0495632_0023938 | 3300046519 | Bacteria | 3253 |
| 509 | Ga0495632_0025849 | 3300046519 | Bacteria | 3099 |
| 510 | Ga0495632_0026672 | 3300046519 | Bacteria | 3038 |
| 511 | Ga0495632_0027981 | 3300046519 | Bacteria | 2945 |
| 512 | Ga0495632_0080337 | 3300046519 | Bacteria | 1555 |
| 513 | Ga0495637_0000992 | 3300046520 | Bacteria | 17932 |
| 514 | Ga0495637_0001157 | 3300046520 | Bacteria | 16164 |
| 515 | Ga0495637_0001228 | 3300046520 | Bacteria | 15539 |
| 516 | Ga0495637_0002363 | 3300046520 | Bacteria | 10455 |
| 517 | Ga0495637_0002437 | 3300046520 | Bacteria | 10272 |
| 518 | Ga0495637_0002624 | 3300046520 | Bacteria | 9856 |
| 519 | Ga0495637_0002627 | 3300046520 | Bacteria | 9845 |
| 520 | Ga0495637_0005249 | 3300046520 | Bacteria | 6627 |
| 521 | Ga0495637_0013453 | 3300046520 | Bacteria | 3881 |
| 522 | Ga0495637_0018200 | 3300046520 | Bacteria | 3261 |
| 523 | Ga0495637_0020652 | 3300046520 | Bacteria | 3027 |
| 524 | Ga0495637_0030564 | 3300046520 | Bacteria | 2389 |
| 525 | Ga0495637_0033802 | 3300046520 | Bacteria | 2243 |
| 526 | Ga0495637_0037830 | 3300046520 | Bacteria | 2092 |
| 527 | Ga0495637_0082043 | 3300046520 | Bacteria | 1284 |
| 528 | Ga0495643_0002889 | 3300046522 | Bacteria | 13024 |
| 529 | Ga0495643_0003119 | 3300046522 | Bacteria | 12381 |
| 530 | Ga0495643_0009387 | 3300046522 | Bacteria | 6082 |
| 531 | Ga0495643_0015439 | 3300046522 | Bacteria | 4513 |
| 532 | Ga0495643_0020970 | 3300046522 | Bacteria | 3757 |
| 533 | Ga0495643_0027411 | 3300046522 | Bacteria | 3202 |
| 534 | Ga0495643_0034632 | 3300046522 | Bacteria | 2785 |
| 535 | Ga0495643_0054021 | 3300046522 | Bacteria | 2152 |
| 536 | Ga0495643_0072054 | 3300046522 | Bacteria | 1812 |
| 537 | Ga0495643_0089248 | 3300046522 | Bacteria | 1592 |
| 538 | Ga0495643_0116627 | 3300046522 | Bacteria | 1352 |
| 539 | Ga0495643_0142874 | 3300046522 | Bacteria | 1192 |
| 540 | Ga0495644_0000435 | 3300046523 | Bacteria | 18422 |
| 541 | Ga0495644_0005727 | 3300046523 | Bacteria | 4849 |
| 542 | Ga0495644_0009973 | 3300046523 | Bacteria | 3659 |
| 543 | Ga0495644_0042287 | 3300046523 | Bacteria | 1716 |
| 544 | Ga0495644_0042474 | 3300046523 | Bacteria | 1712 |
| 545 | Ga0495644_0044230 | 3300046523 | Bacteria | 1675 |
| 546 | Ga0495648_0000287 | 3300046524 | Bacteria | 57221 |
| 547 | Ga0495648_0001399 | 3300046524 | Bacteria | 23701 |
| 548 | Ga0495648_0002835 | 3300046524 | Bacteria | 15601 |
| 549 | Ga0495648_0003727 | 3300046524 | Bacteria | 13292 |
| 550 | Ga0495648_0004621 | 3300046524 | Bacteria | 11704 |
| 551 | Ga0495648_0017334 | 3300046524 | Bacteria | 5151 |
| 552 | Ga0495648_0033183 | 3300046524 | Bacteria | 3375 |
| 553 | Ga0495648_0036849 | 3300046524 | Bacteria | 3148 |
| 554 | Ga0495648_0053886 | 3300046524 | Bacteria | 2433 |
| 555 | Ga0495648_0054461 | 3300046524 | Bacteria | 2416 |
| 556 | Ga0495648_0063355 | 3300046524 | Bacteria | 2183 |
| 557 | Ga0495648_0067575 | 3300046524 | Bacteria | 2090 |
| 558 | Ga0495648_0074805 | 3300046524 | Bacteria | 1950 |
| 559 | Ga0495648_0150733 | 3300046524 | Bacteria | 1213 |
| 560 | Ga0495666_0001767 | 3300046526 | Bacteria | 10666 |
| 561 | Ga0495666_0007644 | 3300046526 | Bacteria | 5407 |
| 562 | Ga0495666_0030167 | 3300046526 | Bacteria | 2663 |
| 563 | Ga0495666_0072526 | 3300046526 | Bacteria | 1635 |
| 564 | Ga0495642_0000266 | 3300046528 | Bacteria | 29529 |
| 565 | Ga0495642_0001027 | 3300046528 | Bacteria | 12995 |
| 566 | Ga0495642_0001272 | 3300046528 | Bacteria | 11411 |
| 567 | Ga0495652_0197024 | 3300046529 | Bacteria | 1532 |
| 568 | Ga0495654_0002021 | 3300046530 | Bacteria | 13330 |
| 569 | Ga0495654_0002230 | 3300046530 | Bacteria | 12555 |
| 570 | Ga0495654_0002688 | 3300046530 | Bacteria | 11250 |
| 571 | Ga0495654_0003266 | 3300046530 | Bacteria | 9999 |
| 572 | Ga0495654_0003434 | 3300046530 | Bacteria | 9712 |
| 573 | Ga0495654_0003677 | 3300046530 | Bacteria | 9309 |
| 574 | Ga0495654_0007101 | 3300046530 | Bacteria | 6299 |
| 575 | Ga0495654_0015080 | 3300046530 | Bacteria | 4107 |
| 576 | Ga0495654_0017495 | 3300046530 | Bacteria | 3768 |
| 577 | Ga0495654_0024005 | 3300046530 | Bacteria | 3154 |
| 578 | Ga0495654_0025738 | 3300046530 | Bacteria | 3030 |
| 579 | Ga0495654_0029533 | 3300046530 | Bacteria | 2795 |
| 580 | Ga0495654_0045559 | 3300046530 | Bacteria | 2163 |
| 581 | Ga0495654_0056967 | 3300046530 | Bacteria | 1888 |
| 582 | Ga0495654_0061965 | 3300046530 | Bacteria | 1794 |
| 583 | Ga0495654_0080968 | 3300046530 | Bacteria | 1522 |
| 584 | Ga0495654_0113704 | 3300046530 | Bacteria | 1232 |
| 585 | Ga0495654_0128220 | 3300046530 | Bacteria | 1141 |
| 586 | Ga0495586_0018212 | 3300046535 | Bacteria | 3738 |
| 587 | Ga0495587_0004236 | 3300046536 | Bacteria | 9484 |
| 588 | Ga0495609_0000125 | 3300046538 | Bacteria | 83190 |
| 589 | Ga0495609_0001501 | 3300046538 | Bacteria | 15398 |
| 590 | Ga0495609_0001565 | 3300046538 | Bacteria | 14969 |
| 591 | Ga0495609_0005704 | 3300046538 | Bacteria | 6482 |
| 592 | Ga0495609_0006210 | 3300046538 | Bacteria | 6140 |
| 593 | Ga0495609_0013823 | 3300046538 | Bacteria | 3805 |
| 594 | Ga0495609_0028030 | 3300046538 | Bacteria | 2571 |
| 595 | Ga0495609_0035895 | 3300046538 | Bacteria | 2241 |
| 596 | Ga0495609_0054774 | 3300046538 | Bacteria | 1770 |
| 597 | Ga0495609_0090349 | 3300046538 | Bacteria | 1332 |
| 598 | Ga0495597_0002134 | 3300046542 | Bacteria | 13096 |
| 599 | Ga0495597_0003287 | 3300046542 | Bacteria | 9572 |
| 600 | Ga0495597_0003971 | 3300046542 | Bacteria | 8316 |
| 601 | Ga0495597_0007943 | 3300046542 | Bacteria | 5345 |
| 602 | Ga0495597_0015657 | 3300046542 | Bacteria | 3588 |
| 603 | Ga0495597_0024255 | 3300046542 | Bacteria | 2801 |
| 604 | Ga0495597_0029202 | 3300046542 | Bacteria | 2519 |
| 605 | Ga0495597_0041715 | 3300046542 | Bacteria | 2048 |
| 606 | Ga0495645_0058681 | 3300046543 | Bacteria | 2792 |
| 607 | Ga0495622_0000572 | 3300046557 | Bacteria | 22065 |
| 608 | Ga0495622_0000943 | 3300046557 | Bacteria | 15618 |
| 609 | Ga0495622_0001599 | 3300046557 | Bacteria | 11190 |
| 610 | Ga0495622_0013240 | 3300046557 | Bacteria | 3828 |
| 611 | Ga0495622_0014791 | 3300046557 | Bacteria | 3626 |
| 612 | Ga0495622_0024495 | 3300046557 | Bacteria | 2818 |
| 613 | Ga0495622_0097163 | 3300046557 | Bacteria | 1351 |
| 614 | Ga0495633_0001860 | 3300046558 | Bacteria | 15492 |
| 615 | Ga0495633_0003687 | 3300046558 | Bacteria | 10110 |
| 616 | Ga0495633_0011800 | 3300046558 | Bacteria | 4687 |
| 617 | Ga0495633_0031028 | 3300046558 | Bacteria | 2594 |
| 618 | Ga0495656_0032376 | 3300046615 | Bacteria | 2127 |
| 619 | Ga0495668_0001154 | 3300046616 | Bacteria | 26997 |
| 620 | Ga0495668_0004491 | 3300046616 | Bacteria | 9879 |
| 621 | Ga0495668_0073775 | 3300046616 | Bacteria | 1873 |
| 622 | Ga0495668_0099130 | 3300046616 | Bacteria | 1594 |
| 623 | Ga0495668_0105475 | 3300046616 | Bacteria | 1541 |
| 624 | Ga0495634_0001466 | 3300046642 | Bacteria | 20925 |
| 625 | Ga0495611_0000947 | 3300046648 | Bacteria | 15547 |
| 626 | Ga0495611_0001585 | 3300046648 | Bacteria | 11118 |
| 627 | Ga0495611_0003080 | 3300046648 | Bacteria | 7405 |
| 628 | Ga0495611_0070170 | 3300046648 | Bacteria | 1601 |
| 629 | Ga0495611_0107485 | 3300046648 | Bacteria | 1297 |
| 630 | Ga0495625_0008604 | 3300046660 | Bacteria | 8687 |
| 631 | Ga0495625_0015872 | 3300046660 | Bacteria | 5945 |
| 632 | Ga0495625_0021504 | 3300046660 | Bacteria | 4967 |
| 633 | Ga0495625_0022530 | 3300046660 | Bacteria | 4829 |
| 634 | Ga0495625_0033920 | 3300046660 | Bacteria | 3769 |
| 635 | Ga0495625_0040102 | 3300046660 | Bacteria | 3418 |
| 636 | Ga0495625_0042587 | 3300046660 | Bacteria | 3298 |
| 637 | Ga0495625_0049075 | 3300046660 | Bacteria | 3035 |
| 638 | Ga0495625_0102823 | 3300046660 | Bacteria | 1960 |
| 639 | Ga0495625_0139248 | 3300046660 | Bacteria | 1638 |
| 640 | Ga0495635_0002238 | 3300046663 | Bacteria | 13147 |
| 641 | Ga0495635_0004282 | 3300046663 | Bacteria | 9878 |
| 642 | Ga0495659_0000153 | 3300046664 | Bacteria | 30457 |
| 643 | Ga0495659_0001521 | 3300046664 | Bacteria | 7847 |
| 644 | Ga0495659_0016120 | 3300046664 | Bacteria | 2462 |
| 645 | Ga0495659_0033436 | 3300046664 | Bacteria | 1805 |
| 646 | Ga0495661_0000541 | 3300046665 | Bacteria | 39054 |
| 647 | Ga0495661_0000933 | 3300046665 | Bacteria | 26623 |
| 648 | Ga0495661_0007218 | 3300046665 | Bacteria | 7747 |
| 649 | Ga0495661_0020482 | 3300046665 | Bacteria | 4316 |
| 650 | Ga0495661_0022886 | 3300046665 | Bacteria | 4061 |
| 651 | Ga0495661_0024019 | 3300046665 | Bacteria | 3949 |
| 652 | Ga0495661_0028592 | 3300046665 | Bacteria | 3566 |
| 653 | Ga0495661_0030712 | 3300046665 | Bacteria | 3418 |
| 654 | Ga0495661_0033093 | 3300046665 | Bacteria | 3262 |
| 655 | Ga0495661_0055110 | 3300046665 | Bacteria | 2384 |
| 656 | Ga0495661_0082495 | 3300046665 | Bacteria | 1850 |
| 657 | Ga0495661_0149940 | 3300046665 | Bacteria | 1260 |
| 658 | Ga0495588_0002380 | 3300046674 | Bacteria | 8048 |
| 659 | Ga0495588_0003323 | 3300046674 | Bacteria | 6980 |
| 660 | Ga0495588_0019297 | 3300046674 | Bacteria | 3338 |
| 661 | Ga0495623_0004189 | 3300046679 | Bacteria | 9503 |
| 662 | Ga0495623_0004713 | 3300046679 | Bacteria | 8960 |
| 663 | Ga0495669_0010530 | 3300046684 | Bacteria | 3909 |
| 664 | Ga0495669_0010858 | 3300046684 | Bacteria | 3856 |
| 665 | Ga0495669_0145122 | 3300046684 | Bacteria | 1121 |
| 666 | Ga0495613_0012696 | 3300046689 | Bacteria | 6263 |
| 667 | Ga0495613_0071124 | 3300046689 | Bacteria | 2536 |
| 668 | Ga0495613_0083022 | 3300046689 | Bacteria | 2327 |
| 669 | Ga0495670_0000749 | 3300046691 | Bacteria | 15553 |
| 670 | Ga0495670_0001825 | 3300046691 | Bacteria | 10473 |
| 671 | Ga0495670_0002629 | 3300046691 | Bacteria | 8864 |
| 672 | Ga0495670_0004839 | 3300046691 | Bacteria | 6611 |
| 673 | Ga0495670_0015116 | 3300046691 | Bacteria | 3797 |
| 674 | Ga0495670_0016890 | 3300046691 | Bacteria | 3587 |
| 675 | Ga0495670_0021416 | 3300046691 | Bacteria | 3188 |
| 676 | Ga0495670_0022514 | 3300046691 | Bacteria | 3111 |
| 677 | Ga0495670_0025347 | 3300046691 | Bacteria | 2933 |
| 678 | Ga0495670_0037300 | 3300046691 | Bacteria | 2423 |
| 679 | Ga0495671_0000336 | 3300046692 | Bacteria | 39246 |
| 680 | Ga0495671_0000421 | 3300046692 | Bacteria | 33756 |
| 681 | Ga0495671_0001561 | 3300046692 | Bacteria | 15202 |
| 682 | Ga0495671_0003309 | 3300046692 | Bacteria | 9958 |
| 683 | Ga0495671_0003889 | 3300046692 | Bacteria | 9068 |
| 684 | Ga0495671_0004103 | 3300046692 | Bacteria | 8783 |
| 685 | Ga0495671_0005223 | 3300046692 | Bacteria | 7631 |
| 686 | Ga0495671_0017297 | 3300046692 | Bacteria | 3838 |
| 687 | Ga0495671_0018995 | 3300046692 | Bacteria | 3638 |
| 688 | Ga0495671_0023241 | 3300046692 | Bacteria | 3240 |
| 689 | Ga0495671_0026995 | 3300046692 | Bacteria | 2970 |
| 690 | Ga0495671_0028553 | 3300046692 | Bacteria | 2872 |
| 691 | Ga0495671_0029486 | 3300046692 | Bacteria | 2817 |
| 692 | Ga0495671_0037621 | 3300046692 | Bacteria | 2446 |
| 693 | Ga0495671_0041231 | 3300046692 | Bacteria | 2325 |
| 694 | Ga0495649_0000531 | 3300046694 | Bacteria | 32369 |
| 695 | Ga0495649_0001947 | 3300046694 | Bacteria | 15009 |
| 696 | Ga0495649_0002912 | 3300046694 | Bacteria | 11838 |
| 697 | Ga0495649_0003154 | 3300046694 | Bacteria | 11263 |
| 698 | Ga0495649_0003556 | 3300046694 | Bacteria | 10467 |
| 699 | Ga0495649_0004493 | 3300046694 | Bacteria | 9102 |
| 700 | Ga0495649_0004696 | 3300046694 | Bacteria | 8867 |
| 701 | Ga0495649_0004717 | 3300046694 | Bacteria | 8850 |
| 702 | Ga0495649_0005087 | 3300046694 | Bacteria | 8443 |
| 703 | Ga0495649_0024089 | 3300046694 | Bacteria | 3397 |
| 704 | Ga0495649_0026826 | 3300046694 | Bacteria | 3199 |
| 705 | Ga0495649_0027572 | 3300046694 | Bacteria | 3150 |
| 706 | Ga0495649_0044468 | 3300046694 | Bacteria | 2424 |
| 707 | Ga0495589_0001172 | 3300046794 | Bacteria | 15616 |
| 708 | Ga0495589_0001641 | 3300046794 | Bacteria | 12818 |
| 709 | Ga0495589_0002462 | 3300046794 | Bacteria | 10381 |
| 710 | Ga0495589_0002488 | 3300046794 | Bacteria | 10312 |
| 711 | Ga0495589_0002934 | 3300046794 | Bacteria | 9408 |
| 712 | Ga0495589_0003119 | 3300046794 | Bacteria | 9064 |
| 713 | Ga0495589_0004279 | 3300046794 | Bacteria | 7631 |
| 714 | Ga0495589_0007874 | 3300046794 | Bacteria | 5578 |
| 715 | Ga0495589_0103497 | 3300046794 | Bacteria | 1376 |
| 716 | Ga0495600_0003159 | 3300046809 | Bacteria | 9645 |
| 717 | Ga0495660_0003310 | 3300046810 | Bacteria | 9998 |
| 718 | Ga0495660_0007016 | 3300046810 | Bacteria | 6641 |
| 719 | Ga0495660_0008194 | 3300046810 | Bacteria | 6131 |
| 720 | Ga0495660_0009662 | 3300046810 | Bacteria | 5621 |
| 721 | Ga0495660_0022774 | 3300046810 | Bacteria | 3574 |
| 722 | Ga0495660_0024188 | 3300046810 | Bacteria | 3460 |
| 723 | Ga0495660_0041853 | 3300046810 | Bacteria | 2533 |
| 724 | Ga0495660_0044810 | 3300046810 | Bacteria | 2431 |
| 725 | Ga0495660_0050853 | 3300046810 | Bacteria | 2256 |
| 726 | Ga0495660_0054612 | 3300046810 | Bacteria | 2163 |
| 727 | Ga0495660_0089736 | 3300046810 | Bacteria | 1600 |
| 728 | Ga0495660_0116684 | 3300046810 | Bacteria | 1355 |
| 729 | Ga0495660_0160513 | 3300046810 | Bacteria | 1103 |
| 730 | Ga0495581_0004486 | 3300047315 | Bacteria | 8070 |
| 731 | Ga0495581_0051731 | 3300047315 | Bacteria | 2372 |
| 732 | Ga0495604_0008037 | 3300047317 | Bacteria | 8359 |
| 733 | Ga0495604_0102845 | 3300047317 | Bacteria | 2096 |
| 734 | Ga0495636_0011816 | 3300047318 | Bacteria | 3458 |
| 735 | Ga0495674_0035068 | 3300047319 | Bacteria | 4529 |
| 736 | Ga0495672_0001518 | 3300047320 | Bacteria | 22741 |
| 737 | Ga0495672_0002485 | 3300047320 | Bacteria | 16892 |
| 738 | Ga0495672_0002877 | 3300047320 | Bacteria | 15250 |
| 739 | Ga0495672_0003621 | 3300047320 | Bacteria | 13103 |
| 740 | Ga0495672_0004292 | 3300047320 | Bacteria | 11754 |
| 741 | Ga0495672_0005106 | 3300047320 | Bacteria | 10477 |
| 742 | Ga0495672_0007026 | 3300047320 | Bacteria | 8546 |
| 743 | Ga0495672_0013352 | 3300047320 | Bacteria | 5671 |
| 744 | Ga0495672_0016463 | 3300047320 | Bacteria | 4980 |
| 745 | Ga0495672_0017256 | 3300047320 | Bacteria | 4832 |
| 746 | Ga0495672_0063664 | 3300047320 | Bacteria | 2115 |
| 747 | Ga0495672_0064241 | 3300047320 | Bacteria | 2102 |
| 748 | Ga0495676_0004312 | 3300047321 | Bacteria | 12993 |
| 749 | Ga0495680_0007966 | 3300047322 | Bacteria | 9661 |
| 750 | Ga0495680_0008523 | 3300047322 | Bacteria | 9314 |
| 751 | Ga0495680_0075232 | 3300047322 | Bacteria | 2562 |
| 752 | Ga0495680_0101711 | 3300047322 | Bacteria | 2140 |
| 753 | Ga0495680_0110751 | 3300047322 | Bacteria | 2034 |
| 754 | Ga0495683_0000404 | 3300047323 | Bacteria | 34663 |
| 755 | Ga0495683_0002209 | 3300047323 | Bacteria | 11908 |
| 756 | Ga0495683_0003381 | 3300047323 | Bacteria | 9319 |
| 757 | Ga0495683_0004032 | 3300047323 | Bacteria | 8432 |
| 758 | Ga0495683_0004998 | 3300047323 | Bacteria | 7428 |
| 759 | Ga0495683_0013677 | 3300047323 | Bacteria | 4239 |
| 760 | Ga0495683_0015185 | 3300047323 | Bacteria | 4010 |
| 761 | Ga0495683_0019241 | 3300047323 | Bacteria | 3525 |
| 762 | Ga0495683_0026945 | 3300047323 | Bacteria | 2940 |
| 763 | Ga0495683_0027770 | 3300047323 | Bacteria | 2893 |
| 764 | Ga0495683_0042183 | 3300047323 | Bacteria | 2300 |
| 765 | Ga0495683_0050597 | 3300047323 | Bacteria | 2079 |
| 766 | Ga0495687_002981 | 3300047443 | Bacteria | 12809 |
| 767 | Ga0495687_004248 | 3300047443 | Bacteria | 9815 |
| 768 | Ga0495687_015391 | 3300047443 | Bacteria | 3892 |
| 769 | Ga0495687_046819 | 3300047443 | Bacteria | 1864 |
| 770 | Ga0495677_0006133 | 3300047445 | Bacteria | 4548 |
| 771 | Ga0495679_001913 | 3300047446 | Bacteria | 11147 |
| 772 | Ga0495679_001971 | 3300047446 | Bacteria | 10940 |
| 773 | Ga0495679_002920 | 3300047446 | Bacteria | 8460 |
| 774 | Ga0495679_004253 | 3300047446 | Bacteria | 6646 |
| 775 | Ga0495679_005122 | 3300047446 | Bacteria | 5877 |
| 776 | Ga0495679_005781 | 3300047446 | Bacteria | 5443 |
| 777 | Ga0495679_009858 | 3300047446 | Bacteria | 3789 |
| 778 | Ga0495679_023623 | 3300047446 | Bacteria | 2082 |
| 779 | Ga0495679_044514 | 3300047446 | Bacteria | 1359 |
| 780 | Ga0495685_014319 | 3300047447 | Bacteria | 2695 |
| 781 | Ga0495685_014424 | 3300047447 | Bacteria | 2685 |
| 782 | Ga0495673_0000543 | 3300047469 | Bacteria | 38551 |
| 783 | Ga0495673_0000630 | 3300047469 | Bacteria | 34694 |
| 784 | Ga0495673_0000965 | 3300047469 | Bacteria | 25969 |
| 785 | Ga0495673_0001187 | 3300047469 | Bacteria | 21906 |
| 786 | Ga0495673_0002490 | 3300047469 | Bacteria | 12896 |
| 787 | Ga0495673_0002541 | 3300047469 | Bacteria | 12731 |
| 788 | Ga0495673_0002605 | 3300047469 | Bacteria | 12548 |
| 789 | Ga0495673_0003118 | 3300047469 | Bacteria | 11099 |
| 790 | Ga0495673_0004279 | 3300047469 | Bacteria | 9005 |
| 791 | Ga0495673_0004638 | 3300047469 | Bacteria | 8553 |
| 792 | Ga0495673_0008994 | 3300047469 | Bacteria | 5559 |
| 793 | Ga0495673_0009955 | 3300047469 | Bacteria | 5209 |
| 794 | Ga0495673_0018677 | 3300047469 | Bacteria | 3490 |
| 795 | Ga0495673_0019032 | 3300047469 | Bacteria | 3447 |
| 796 | Ga0495673_0019549 | 3300047469 | Bacteria | 3391 |
| 797 | Ga0495673_0029104 | 3300047469 | Bacteria | 2610 |
| 798 | Ga0495673_0033964 | 3300047469 | Bacteria | 2361 |
| 799 | Ga0495673_0036871 | 3300047469 | Bacteria | 2238 |
| 800 | Ga0495673_0037835 | 3300047469 | Bacteria | 2201 |
| 801 | Ga0495673_0051799 | 3300047469 | Bacteria | 1796 |
| 802 | Ga0495681_0001494 | 3300047470 | Bacteria | 17464 |
| 803 | Ga0495681_0001632 | 3300047470 | Bacteria | 16655 |
| 804 | Ga0495681_0002028 | 3300047470 | Bacteria | 14778 |
| 805 | Ga0495681_0003304 | 3300047470 | Bacteria | 11234 |
| 806 | Ga0495681_0003540 | 3300047470 | Bacteria | 10866 |
| 807 | Ga0495681_0004204 | 3300047470 | Bacteria | 9871 |
| 808 | Ga0495681_0004321 | 3300047470 | Bacteria | 9721 |
| 809 | Ga0495681_0007695 | 3300047470 | Bacteria | 6838 |
| 810 | Ga0495681_0008566 | 3300047470 | Bacteria | 6398 |
| 811 | Ga0495681_0009988 | 3300047470 | Bacteria | 5782 |
| 812 | Ga0495681_0010567 | 3300047470 | Bacteria | 5582 |
| 813 | Ga0495681_0013630 | 3300047470 | Bacteria | 4705 |
| 814 | Ga0495681_0026450 | 3300047470 | Bacteria | 3019 |
| 815 | Ga0495681_0028928 | 3300047470 | Bacteria | 2842 |
| 816 | Ga0495681_0036765 | 3300047470 | Bacteria | 2418 |
| 817 | Ga0495681_0038780 | 3300047470 | Bacteria | 2332 |
| 818 | Ga0495681_0112740 | 3300047470 | Bacteria | 1175 |
| 819 | Ga0495686_0006040 | 3300047472 | Bacteria | 9398 |
| 820 | Ga0495686_0010976 | 3300047472 | Bacteria | 6409 |
| 821 | Ga0495686_0011965 | 3300047472 | Bacteria | 6098 |
| 822 | Ga0495686_0013322 | 3300047472 | Bacteria | 5708 |
| 823 | Ga0495686_0027359 | 3300047472 | Bacteria | 3724 |
| 824 | Ga0495593_0026921 | 3300047673 | Bacteria | 3169 |
| 825 | Ga0495593_0029981 | 3300047673 | Bacteria | 2979 |
| 826 | Ga0495593_0036628 | 3300047673 | Bacteria | 2659 |
| 827 | Ga0495614_0142311 | 3300048089 | Bacteria | 1066 |
| 828 | Ga0495626_0000898 | 3300048091 | Bacteria | 26374 |
| 829 | Ga0495626_0001022 | 3300048091 | Bacteria | 24045 |
| 830 | Ga0495626_0001131 | 3300048091 | Bacteria | 22336 |
| 831 | Ga0495626_0002134 | 3300048091 | Bacteria | 14317 |
| 832 | Ga0495626_0002366 | 3300048091 | Bacteria | 13216 |
| 833 | Ga0495626_0004417 | 3300048091 | Bacteria | 8645 |
| 834 | Ga0495626_0004441 | 3300048091 | Bacteria | 8608 |
| 835 | Ga0495626_0008164 | 3300048091 | Bacteria | 5768 |
| 836 | Ga0495626_0009047 | 3300048091 | Bacteria | 5400 |
| 837 | Ga0495626_0018798 | 3300048091 | Bacteria | 3462 |
| 838 | Ga0495626_0029967 | 3300048091 | Bacteria | 2626 |
| 839 | Ga0495626_0040977 | 3300048091 | Bacteria | 2184 |
| 840 | Ga0495626_0054914 | 3300048091 | Bacteria | 1828 |
| 841 | Ga0495626_0093723 | 3300048091 | Bacteria | 1317 |
| 842 | Ga0496102_0001175 | 3300048905 | Bacteria | 23868 |
| 843 | Ga0496102_0191211 | 3300048905 | Bacteria | 1929 |
| 844 | Ga0496102_0390392 | 3300048905 | Bacteria | 1309 |
| 845 | Ga0496103_0003037 | 3300048906 | Bacteria | 10337 |
| 846 | Ga0496103_0043594 | 3300048906 | Bacteria | 2763 |
| 847 | Ga0496104_0143109 | 3300048907 | Bacteria | 2297 |
| 848 | Ga0496104_0343803 | 3300048907 | Bacteria | 1405 |
| 849 | Ga0496105_0024445 | 3300048908 | Bacteria | 4908 |
| 850 | Ga0496105_0091246 | 3300048908 | Bacteria | 2516 |
| 851 | Ga0496110_0058691 | 3300048913 | Bacteria | 3389 |
| 852 | Ga0496110_0128829 | 3300048913 | Bacteria | 2284 |
| 853 | Ga0496110_0311611 | 3300048913 | Bacteria | 1433 |
| 854 | Ga0496113_0094413 | 3300048916 | Bacteria | 2311 |
| 855 | Ga0496113_0096944 | 3300048916 | Bacteria | 2281 |
| 856 | Ga0496116_0000488 | 3300048919 | Bacteria | 54504 |
| 857 | Ga0496116_0001579 | 3300048919 | Bacteria | 25081 |
| 858 | Ga0496116_0002272 | 3300048919 | Bacteria | 20373 |
| 859 | Ga0496116_0008613 | 3300048919 | Bacteria | 8826 |
| 860 | Ga0496116_0054184 | 3300048919 | Bacteria | 2644 |
| 861 | Ga0496116_0057764 | 3300048919 | Bacteria | 2534 |
| 862 | Ga0496116_0102727 | 3300048919 | Bacteria | 1703 |
| 863 | Ga0496117_0000666 | 3300048920 | Bacteria | 55020 |
| 864 | Ga0496117_0001488 | 3300048920 | Bacteria | 33593 |
| 865 | Ga0496117_0004392 | 3300048920 | Bacteria | 15622 |
| 866 | Ga0496117_0012539 | 3300048920 | Bacteria | 7462 |
| 867 | Ga0496117_0034133 | 3300048920 | Bacteria | 3839 |
| 868 | Ga0496117_0058271 | 3300048920 | Bacteria | 2676 |
| 869 | Ga0496117_0078529 | 3300048920 | Bacteria | 2178 |
| 870 | Ga0496117_0107255 | 3300048920 | Bacteria | 1750 |
| 871 | Ga0496118_0010626 | 3300048921 | Bacteria | 9088 |
| 872 | Ga0496118_0020062 | 3300048921 | Bacteria | 5943 |
| 873 | Ga0496118_0022796 | 3300048921 | Bacteria | 5459 |
| 874 | Ga0496118_0026029 | 3300048921 | Bacteria | 4996 |
| 875 | Ga0496118_0031365 | 3300048921 | Bacteria | 4407 |
| 876 | Ga0496118_0051821 | 3300048921 | Bacteria | 3136 |
| 877 | Ga0496119_0007135 | 3300048922 | Bacteria | 10140 |
| 878 | Ga0496119_0007405 | 3300048922 | Bacteria | 9896 |
| 879 | Ga0496120_0005522 | 3300048923 | Bacteria | 10060 |
| 880 | Ga0496120_0005963 | 3300048923 | Bacteria | 9493 |
| 881 | Ga0496120_0027521 | 3300048923 | Bacteria | 3495 |
| 882 | Ga0496121_0000646 | 3300048924 | Bacteria | 65142 |
| 883 | Ga0496121_0000867 | 3300048924 | Bacteria | 54641 |
| 884 | Ga0496121_0059522 | 3300048924 | Bacteria | 3148 |
| 885 | Ga0496121_0079537 | 3300048924 | Bacteria | 2602 |
| 886 | Ga0496121_0086311 | 3300048924 | Bacteria | 2466 |
| 887 | Ga0496121_0097710 | 3300048924 | Bacteria | 2275 |
| 888 | Ga0496121_0103392 | 3300048924 | Bacteria | 2191 |
| 889 | Ga0496122_0002919 | 3300048925 | Bacteria | 23335 |
| 890 | Ga0496122_0007825 | 3300048925 | Bacteria | 11741 |
| 891 | Ga0496122_0008395 | 3300048925 | Bacteria | 11155 |
| 892 | Ga0496122_0009340 | 3300048925 | Bacteria | 10356 |
| 893 | Ga0496122_0028069 | 3300048925 | Bacteria | 4790 |
| 894 | Ga0496122_0030109 | 3300048925 | Bacteria | 4557 |
| 895 | Ga0496122_0047812 | 3300048925 | Bacteria | 3297 |
| 896 | Ga0496122_0063793 | 3300048925 | Bacteria | 2685 |
| 897 | Ga0496123_0002983 | 3300048926 | Bacteria | 19648 |
| 898 | Ga0496123_0006655 | 3300048926 | Bacteria | 11143 |
| 899 | Ga0496123_0015566 | 3300048926 | Bacteria | 6231 |
| 900 | Ga0496123_0025525 | 3300048926 | Bacteria | 4452 |
| 901 | Ga0496123_0041179 | 3300048926 | Bacteria | 3205 |
| 902 | Ga0496123_0057232 | 3300048926 | Bacteria | 2539 |
| 903 | Ga0496124_0000942 | 3300048927 | Bacteria | 46610 |
| 904 | Ga0496124_0003740 | 3300048927 | Bacteria | 18340 |
| 905 | Ga0496124_0039719 | 3300048927 | Bacteria | 4076 |
| 906 | Ga0496124_0055179 | 3300048927 | Bacteria | 3359 |
| 907 | Ga0496124_0057206 | 3300048927 | Bacteria | 3287 |
| 908 | Ga0496124_0061226 | 3300048927 | Bacteria | 3155 |
| 909 | Ga0496124_0089203 | 3300048927 | Bacteria | 2518 |
| 910 | Ga0496124_0093943 | 3300048927 | Bacteria | 2440 |
| 911 | Ga0496124_0117196 | 3300048927 | Bacteria | 2133 |
| 912 | Ga0496124_0134173 | 3300048927 | Bacteria | 1962 |
| 913 | Ga0496124_0206520 | 3300048927 | Bacteria | 1489 |
| 914 | Ga0496125_0001551 | 3300048928 | Bacteria | 32793 |
| 915 | Ga0496125_0008001 | 3300048928 | Bacteria | 11166 |
| 916 | Ga0496125_0014958 | 3300048928 | Bacteria | 7534 |
| 917 | Ga0496125_0025187 | 3300048928 | Bacteria | 5454 |
| 918 | Ga0496125_0034064 | 3300048928 | Bacteria | 4495 |
| 919 | Ga0496125_0044073 | 3300048928 | Bacteria | 3778 |
| 920 | Ga0496125_0046288 | 3300048928 | Bacteria | 3650 |
| 921 | Ga0496126_0019032 | 3300048929 | Bacteria | 6777 |
| 922 | Ga0496126_0033405 | 3300048929 | Bacteria | 4840 |
| 923 | Ga0495678_000300 | 3300049459 | Bacteria | 53845 |
| 924 | Ga0495678_001889 | 3300049459 | Bacteria | 15214 |
| 925 | Ga0495678_002089 | 3300049459 | Bacteria | 14194 |
| 926 | Ga0495678_002203 | 3300049459 | Bacteria | 13658 |
| 927 | Ga0495678_003308 | 3300049459 | Bacteria | 10060 |
| 928 | Ga0495678_003960 | 3300049459 | Bacteria | 8860 |
| 929 | Ga0495678_011718 | 3300049459 | Bacteria | 4185 |
| 930 | Ga0495678_012614 | 3300049459 | Bacteria | 4000 |
| 931 | Ga0495678_015502 | 3300049459 | Bacteria | 3503 |
| 932 | Ga0495678_020149 | 3300049459 | Bacteria | 2959 |
| 933 | Ga0495678_020596 | 3300049459 | Bacteria | 2916 |
| 934 | Ga0495678_035796 | 3300049459 | Bacteria | 2031 |
| 935 | Ga0495678_074284 | 3300049459 | Bacteria | 1237 |
| 936 | Ga0495682_0000023 | 3300049460 | Bacteria | 158998 |
| 937 | Ga0495682_0001116 | 3300049460 | Bacteria | 15602 |
| 938 | Ga0495682_0001401 | 3300049460 | Bacteria | 13144 |
| 939 | Ga0495682_0002657 | 3300049460 | Bacteria | 8349 |
| 940 | Ga0495682_0011604 | 3300049460 | Bacteria | 3389 |
| 941 | Ga0495682_0026699 | 3300049460 | Bacteria | 2142 |
| 942 | Ga0495682_0061707 | 3300049460 | Bacteria | 1353 |
| 943 | Ga0495682_0090746 | 3300049460 | Bacteria | 1097 |
| 944 | Ga0501222_001192 | 3300049662 | Bacteria | 3670 |
| 945 | Ga0501241_000390 | 3300049758 | Bacteria | 9595 |
| 946 | Ga0501269_001103 | 3300049766 | Bacteria | 3747 |
| 947 | Ga0501269_005778 | 3300049766 | Bacteria | 1489 |
| 948 | Ga0501226_000307 | 3300049853 | Bacteria | 7361 |
| 949 | nmdc:mga03683_58397_c1 | 3300050489 | Bacteria | 1626 |
| 950 | nmdc:mga00v17_56393_c1 | 3300050491 | Bacteria | 2402 |
| 951 | nmdc:mga08x19_81902_c1 | 3300050514 | Bacteria | 2120 |
| 952 | Ga0500572_001539 | 3300053111 | Bacteria | 6175 |
| 953 | Ga0500616_0078657 | 3300053153 | Bacteria | 1663 |
| 954 | Ga0500634_0000137 | 3300053161 | Bacteria | 26529 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047320 | Ga0495672_0063664 | Ga0495672_0063664_299_1297 | 283 |
| 2 | 3300046810 | Ga0495660_0160513 | Ga0495660_0160513_39_1088 | 288 |
| 3 | 3300053153 | Ga0500616_0078657 | Ga0500616_0078657_592_1641 | 288 |
| 4 | 3300048928 | Ga0496125_0034064 | Ga0496125_0034064_1778_2761 | 297 |
| 5 | 3300025254 | Ga0209148_1000655 | Ga0209148_10006559 | 302 |
| 6 | 3300009148 | Ga0105243_10025139 | Ga0105243_100251394 | 307 |
| 7 | 3300046518 | Ga0495631_0039959 | Ga0495631_0039959_143_1213 | 308 |
| 8 | 3300046519 | Ga0495632_0022243 | Ga0495632_0022243_1608_2678 | 308 |
| 9 | 3300046524 | Ga0495648_0000287 | Ga0495648_0000287_27700_28770 | 308 |
| 10 | 3300046530 | Ga0495654_0056967 | Ga0495654_0056967_253_1323 | 308 |
| 11 | 3300046648 | Ga0495611_0003080 | Ga0495611_0003080_852_1922 | 308 |
| 12 | 3300046665 | Ga0495661_0028592 | Ga0495661_0028592_1373_2443 | 308 |
| 13 | 3300046692 | Ga0495671_0000421 | Ga0495671_0000421_13636_14706 | 308 |
| 14 | 3300047320 | Ga0495672_0016463 | Ga0495672_0016463_2419_3489 | 308 |
| 15 | 3300047469 | Ga0495673_0000965 | Ga0495673_0000965_19678_20760 | 308 |
| 16 | 3300047469 | Ga0495673_0001187 | Ga0495673_0001187_1201_2271 | 308 |
| 17 | 3300049459 | Ga0495678_000300 | Ga0495678_000300_42285_43367 | 308 |
| 18 | 3300009553 | Ga0105249_10028752 | Ga0105249_100287523 | 309 |
| 19 | 3300013102 | Ga0157371_10000814 | Ga0157371_1000081415 | 309 |
| 20 | 3300048919 | Ga0496116_0000488 | Ga0496116_0000488_24766_25800 | 309 |
| 21 | 3300048919 | Ga0496116_0054184 | Ga0496116_0054184_1372_2457 | 309 |
| 22 | 3300048920 | Ga0496117_0001488 | Ga0496117_0001488_19796_20830 | 309 |
| 23 | 3300048921 | Ga0496118_0051821 | Ga0496118_0051821_1303_2337 | 309 |
| 24 | 3300048924 | Ga0496121_0000646 | Ga0496121_0000646_42601_43686 | 309 |
| 25 | 3300048924 | Ga0496121_0000867 | Ga0496121_0000867_24768_25802 | 309 |
| 26 | 3300048925 | Ga0496122_0002919 | Ga0496122_0002919_20196_21230 | 309 |
| 27 | 3300048925 | Ga0496122_0009340 | Ga0496122_0009340_3181_4266 | 309 |
| 28 | 3300048926 | Ga0496123_0002983 | Ga0496123_0002983_17756_18790 | 309 |
| 29 | 3300048926 | Ga0496123_0015566 | Ga0496123_0015566_4446_5531 | 309 |
| 30 | iso_pu_bacteria | 2834578030 | 2834578501 | 311 |
| 31 | 3300006058 | Ga0075432_10001106 | Ga0075432_100011068 | 315 |
| 32 | 3300027907 | Ga0207428_10009676 | Ga0207428_100096763 | 315 |
| 33 | iso_pu_bacteria | 2599185167 | 2599401257 | 315 |
| 34 | iso_pu_bacteria | 2599185179 | 2599452986 | 315 |
| 35 | iso_pu_bacteria | 2599185190 | 2599516335 | 315 |
| 36 | iso_pu_bacteria | 2599185191 | 2599520148 | 315 |
| 37 | iso_pu_bacteria | 2599185288 | 2599881589 | 315 |
| 38 | iso_pu_bacteria | 2599185290 | 2599895693 | 315 |
| 39 | iso_pu_bacteria | 2599185303 | 2599951894 | 315 |
| 40 | iso_pu_bacteria | 2643221563 | 2643832478 | 315 |
| 41 | iso_pu_bacteria | 2643221608 | 2644053727 | 315 |
| 42 | iso_pu_bacteria | 2738541294 | 2738810141 | 315 |
| 43 | iso_pu_bacteria | 2738541309 | 2738897501 | 315 |
| 44 | iso_pu_bacteria | 2808606385 | 2808977463 | 315 |
| 45 | iso_pu_bacteria | 2808606388 | 2808992879 | 315 |
| 46 | iso_pu_bacteria | 2834028612 | 2834033135 | 315 |
| 47 | iso_pu_bacteria | 2852612431 | 2852618025 | 315 |
| 48 | iso_pu_bacteria | 2852667396 | 2852673083 | 315 |
| 49 | iso_pu_bacteria | 2931390751 | 2931396042 | 315 |
| 50 | iso_pu_bacteria | 2945928738 | 2945931290 | 315 |
| 51 | iso_pu_bacteria | 2946027586 | 2946033258 | 315 |
| 52 | iso_pu_bacteria | 8054285046 | 8054290311 | 315 |
| 53 | iso_pu_bacteria | 8054503363 | 8054508541 | 315 |
| 54 | iso_pu_bacteria | 8055817908 | 8055823514 | 315 |
| 55 | iso_pu_bacteria | 8056131705 | 8056136946 | 315 |
| 56 | iso_pu_bacteria | 8056161164 | 8056163218 | 315 |
| 57 | 3300032004 | Ga0307414_10086020 | Ga0307414_100860202 | 316 |
| 58 | 3300046501 | Ga0495607_0016364 | Ga0495607_0016364_2769_3764 | 316 |
| 59 | 3300046519 | Ga0495632_0027981 | Ga0495632_0027981_1869_2864 | 316 |
| 60 | 3300046520 | Ga0495637_0002627 | Ga0495637_0002627_650_1645 | 316 |
| 61 | 3300046694 | Ga0495649_0003154 | Ga0495649_0003154_2266_3261 | 316 |
| 62 | 3300041405 | Ga0439438_003128 | Ga0439438_003128_2510_3571 | 317 |
| 63 | 3300042016 | Ga0439463_008505 | Ga0439463_008505_668_1660 | 317 |
| 64 | 3300042115 | Ga0450911_001424 | Ga0450911_001424_3565_4626 | 317 |
| 65 | 3300042121 | Ga0450919_001134 | Ga0450919_001134_2327_3388 | 317 |
| 66 | 3300042124 | Ga0450922_000100 | Ga0450922_000100_4368_5429 | 317 |
| 67 | 3300042145 | Ga0450906_001562 | Ga0450906_001562_2760_3821 | 317 |
| 68 | 3300042146 | Ga0450907_001112 | Ga0450907_001112_4567_5628 | 317 |
| 69 | 3300042147 | Ga0450910_001811 | Ga0450910_001811_11_1072 | 317 |
| 70 | 3300042531 | Ga0450918_009175 | Ga0450918_009175_599_1660 | 317 |
| 71 | 3300046520 | Ga0495637_0002363 | Ga0495637_0002363_649_1644 | 317 |
| 72 | 3300046694 | Ga0495649_0026826 | Ga0495649_0026826_418_1413 | 317 |
| 73 | 3300047470 | Ga0495681_0003304 | Ga0495681_0003304_7017_8012 | 317 |
| 74 | 3300005353 | Ga0070669_100004388 | Ga0070669_1000043886 | 318 |
| 75 | 3300009011 | Ga0105251_10051916 | Ga0105251_100519162 | 318 |
| 76 | 3300009011 | Ga0105251_10054015 | Ga0105251_100540151 | 318 |
| 77 | 3300009011 | Ga0105251_10117644 | Ga0105251_101176442 | 318 |
| 78 | 3300009036 | Ga0105244_10083449 | Ga0105244_100834492 | 318 |
| 79 | 3300025291 | Ga0209675_1009983 | Ga0209675_10099832 | 318 |
| 80 | 3300025711 | Ga0207696_1000587 | Ga0207696_100058721 | 318 |
| 81 | 3300025735 | Ga0207713_1001528 | Ga0207713_100152812 | 318 |
| 82 | 3300025735 | Ga0207713_1001865 | Ga0207713_10018653 | 318 |
| 83 | 3300025735 | Ga0207713_1029955 | Ga0207713_10299552 | 318 |
| 84 | 3300025923 | Ga0207681_10002487 | Ga0207681_100024871 | 318 |
| 85 | 3300027907 | Ga0207428_10088080 | Ga0207428_100880803 | 318 |
| 86 | 3300031548 | Ga0307408_100010120 | Ga0307408_1000101203 | 318 |
| 87 | 3300041405 | Ga0439438_011195 | Ga0439438_011195_1043_2035 | 318 |
| 88 | 3300042013 | Ga0439456_003523 | Ga0439456_003523_433_1434 | 318 |
| 89 | 3300042013 | Ga0439456_003829 | Ga0439456_003829_192_1190 | 318 |
| 90 | 3300042016 | Ga0439463_000006 | Ga0439463_000006_33721_34722 | 318 |
| 91 | 3300042461 | Ga0439460_0025977 | Ga0439460_0025977_597_1598 | 318 |
| 92 | 3300046452 | Ga0495617_002363 | Ga0495617_002363_6375_7367 | 318 |
| 93 | 3300047320 | Ga0495672_0064241 | Ga0495672_0064241_940_2001 | 318 |
| 94 | 3300048927 | Ga0496124_0134173 | Ga0496124_0134173_935_1930 | 318 |
| 95 | iso_pu_bacteria | 2738543024 | 2739305669 | 318 |
| 96 | iso_pu_bacteria | 8002285264 | 8002289780 | 318 |
| 97 | 3300005288 | Ga0065714_10067366 | Ga0065714_100673665 | 319 |
| 98 | 3300005289 | Ga0065704_10116722 | Ga0065704_101167222 | 319 |
| 99 | 3300005331 | Ga0070670_100000686 | Ga0070670_1000006866 | 319 |
| 100 | 3300005331 | Ga0070670_100001050 | Ga0070670_1000010505 | 319 |
| 101 | 3300005353 | Ga0070669_100000417 | Ga0070669_10000041710 | 319 |
| 102 | 3300005457 | Ga0070662_100000042 | Ga0070662_10000004227 | 319 |
| 103 | 3300005539 | Ga0068853_100000410 | Ga0068853_10000041021 | 319 |
| 104 | 3300005564 | Ga0070664_100057833 | Ga0070664_1000578333 | 319 |
| 105 | 3300005578 | Ga0068854_100000848 | Ga0068854_10000084813 | 319 |
| 106 | 3300005834 | Ga0068851_10000002 | Ga0068851_1000000245 | 319 |
| 107 | 3300006051 | Ga0075364_10057723 | Ga0075364_100577233 | 319 |
| 108 | 3300009011 | Ga0105251_10000993 | Ga0105251_100009935 | 319 |
| 109 | 3300009036 | Ga0105244_10003334 | Ga0105244_100033345 | 319 |
| 110 | 3300009092 | Ga0105250_10005681 | Ga0105250_100056815 | 319 |
| 111 | 3300009177 | Ga0105248_10016614 | Ga0105248_100166144 | 319 |
| 112 | 3300013100 | Ga0157373_10001607 | Ga0157373_100016079 | 319 |
| 113 | 3300013100 | Ga0157373_10027253 | Ga0157373_100272535 | 319 |
| 114 | 3300013104 | Ga0157370_10344396 | Ga0157370_103443961 | 319 |
| 115 | 3300013105 | Ga0157369_10005935 | Ga0157369_100059358 | 319 |
| 116 | 3300013105 | Ga0157369_10042424 | Ga0157369_100424245 | 319 |
| 117 | 3300013306 | Ga0163162_10166932 | Ga0163162_101669322 | 319 |
| 118 | 3300013308 | Ga0157375_10003957 | Ga0157375_100039575 | 319 |
| 119 | 3300014497 | Ga0182008_10000307 | Ga0182008_1000030727 | 319 |
| 120 | 3300017792 | Ga0163161_10008714 | Ga0163161_100087147 | 319 |
| 121 | 3300017792 | Ga0163161_10059330 | Ga0163161_100593303 | 319 |
| 122 | 3300017792 | Ga0163161_10064500 | Ga0163161_100645001 | 319 |
| 123 | 3300017792 | Ga0163161_10128371 | Ga0163161_101283711 | 319 |
| 124 | 3300025321 | Ga0207656_10000010 | Ga0207656_1000001056 | 319 |
| 125 | 3300025711 | Ga0207696_1000339 | Ga0207696_10003399 | 319 |
| 126 | 3300025735 | Ga0207713_1000261 | Ga0207713_100026164 | 319 |
| 127 | 3300025923 | Ga0207681_10001197 | Ga0207681_100011975 | 319 |
| 128 | 3300025925 | Ga0207650_10000278 | Ga0207650_1000027810 | 319 |
| 129 | 3300025925 | Ga0207650_10000324 | Ga0207650_1000032435 | 319 |
| 130 | 3300025933 | Ga0207706_10000128 | Ga0207706_1000012839 | 319 |
| 131 | 3300025945 | Ga0207679_10029236 | Ga0207679_100292362 | 319 |
| 132 | 3300026041 | Ga0207639_10002029 | Ga0207639_100020298 | 319 |
| 133 | 3300042016 | Ga0439463_051338 | Ga0439463_051338_20_1015 | 319 |
| 134 | 3300042131 | Ga0450894_000950 | Ga0450894_000950_2266_3225 | 319 |
| 135 | 3300042134 | Ga0450898_000742 | Ga0450898_000742_1334_2293 | 319 |
| 136 | 3300046457 | Ga0495590_0000859 | Ga0495590_0000859_1313_2305 | 319 |
| 137 | 3300046474 | Ga0495605_0002258 | Ga0495605_0002258_1062_2054 | 319 |
| 138 | 3300046491 | Ga0495584_0008355 | Ga0495584_0008355_2533_3600 | 319 |
| 139 | 3300046506 | Ga0495583_0001282 | Ga0495583_0001282_2688_3647 | 319 |
| 140 | 3300046512 | Ga0495610_0004885 | Ga0495610_0004885_2708_3667 | 319 |
| 141 | 3300046512 | Ga0495610_0011291 | Ga0495610_0011291_4303_5295 | 319 |
| 142 | 3300046512 | Ga0495610_0039282 | Ga0495610_0039282_1287_2246 | 319 |
| 143 | 3300046515 | Ga0495620_0000089 | Ga0495620_0000089_34609_35655 | 319 |
| 144 | 3300046518 | Ga0495631_0015226 | Ga0495631_0015226_1680_2639 | 319 |
| 145 | 3300046523 | Ga0495644_0042474 | Ga0495644_0042474_41_1033 | 319 |
| 146 | 3300046524 | Ga0495648_0074805 | Ga0495648_0074805_27_1028 | 319 |
| 147 | 3300046528 | Ga0495642_0000266 | Ga0495642_0000266_2922_3914 | 319 |
| 148 | 3300046530 | Ga0495654_0003266 | Ga0495654_0003266_6338_7297 | 319 |
| 149 | 3300046530 | Ga0495654_0003434 | Ga0495654_0003434_2710_3669 | 319 |
| 150 | 3300046616 | Ga0495668_0073775 | Ga0495668_0073775_651_1643 | 319 |
| 151 | 3300046665 | Ga0495661_0000933 | Ga0495661_0000933_12080_13039 | 319 |
| 152 | 3300046674 | Ga0495588_0002380 | Ga0495588_0002380_6886_7878 | 319 |
| 153 | 3300046684 | Ga0495669_0010858 | Ga0495669_0010858_1370_2362 | 319 |
| 154 | 3300046694 | Ga0495649_0002912 | Ga0495649_0002912_1605_2597 | 319 |
| 155 | 3300046794 | Ga0495589_0003119 | Ga0495589_0003119_1209_2201 | 319 |
| 156 | 3300047320 | Ga0495672_0003621 | Ga0495672_0003621_9468_10460 | 319 |
| 157 | 3300047320 | Ga0495672_0013352 | Ga0495672_0013352_3634_4695 | 319 |
| 158 | 3300047446 | Ga0495679_001971 | Ga0495679_001971_1916_2875 | 319 |
| 159 | 3300047446 | Ga0495679_004253 | Ga0495679_004253_3946_4905 | 319 |
| 160 | 3300047469 | Ga0495673_0004638 | Ga0495673_0004638_194_1186 | 319 |
| 161 | 3300048920 | Ga0496117_0004392 | Ga0496117_0004392_12808_13767 | 319 |
| 162 | 3300048920 | Ga0496117_0012539 | Ga0496117_0012539_6309_7268 | 319 |
| 163 | 3300048921 | Ga0496118_0022796 | Ga0496118_0022796_1614_2573 | 319 |
| 164 | 3300048921 | Ga0496118_0026029 | Ga0496118_0026029_1157_2116 | 319 |
| 165 | 3300048921 | Ga0496118_0031365 | Ga0496118_0031365_1614_2573 | 319 |
| 166 | 3300048922 | Ga0496119_0007405 | Ga0496119_0007405_6272_7231 | 319 |
| 167 | 3300048923 | Ga0496120_0005522 | Ga0496120_0005522_2661_3620 | 319 |
| 168 | 3300048923 | Ga0496120_0027521 | Ga0496120_0027521_718_1677 | 319 |
| 169 | 3300048924 | Ga0496121_0059522 | Ga0496121_0059522_319_1278 | 319 |
| 170 | 3300048924 | Ga0496121_0086311 | Ga0496121_0086311_91_1050 | 319 |
| 171 | 3300048925 | Ga0496122_0008395 | Ga0496122_0008395_7606_8565 | 319 |
| 172 | 3300048925 | Ga0496122_0028069 | Ga0496122_0028069_1684_2643 | 319 |
| 173 | 3300048925 | Ga0496122_0047812 | Ga0496122_0047812_191_1150 | 319 |
| 174 | 3300048926 | Ga0496123_0006655 | Ga0496123_0006655_7604_8563 | 319 |
| 175 | 3300048926 | Ga0496123_0025525 | Ga0496123_0025525_194_1153 | 319 |
| 176 | 3300048926 | Ga0496123_0041179 | Ga0496123_0041179_860_1819 | 319 |
| 177 | 3300048927 | Ga0496124_0057206 | Ga0496124_0057206_173_1132 | 319 |
| 178 | 3300048927 | Ga0496124_0061226 | Ga0496124_0061226_810_1769 | 319 |
| 179 | 3300048927 | Ga0496124_0093943 | Ga0496124_0093943_184_1143 | 319 |
| 180 | 3300048928 | Ga0496125_0008001 | Ga0496125_0008001_2594_3553 | 319 |
| 181 | 3300048928 | Ga0496125_0014958 | Ga0496125_0014958_6349_7308 | 319 |
| 182 | 3300048928 | Ga0496125_0025187 | Ga0496125_0025187_1614_2573 | 319 |
| 183 | 3300048928 | Ga0496125_0046288 | Ga0496125_0046288_1078_2037 | 319 |
| 184 | 3300048929 | Ga0496126_0019032 | Ga0496126_0019032_1827_2786 | 319 |
| 185 | 3300049460 | Ga0495682_0000023 | Ga0495682_0000023_133389_134435 | 319 |
| 186 | 3300053161 | Ga0500634_0000137 | Ga0500634_0000137_13597_14556 | 319 |
| 187 | iso_pu_bacteria | 2597489888 | 2597866257 | 319 |
| 188 | iso_pu_bacteria | 2597489889 | 2597872092 | 319 |
| 189 | iso_pu_bacteria | 2599185189 | 2599509734 | 319 |
| 190 | iso_pu_bacteria | 2600255296 | 2601693806 | 319 |
| 191 | iso_pu_bacteria | 2619619299 | 2621297207 | 319 |
| 192 | iso_pu_bacteria | 2643221571 | 2643870797 | 319 |
| 193 | iso_pu_bacteria | 2643221713 | 2644621315 | 319 |
| 194 | iso_pu_bacteria | 2721755607 | 2723250993 | 319 |
| 195 | iso_pu_bacteria | 2738541265 | 2738673050 | 319 |
| 196 | iso_pu_bacteria | 2738541282 | 2738751443 | 319 |
| 197 | iso_pu_bacteria | 2738541303 | 2738860484 | 319 |
| 198 | iso_pu_bacteria | 2816332298 | 2817493675 | 319 |
| 199 | iso_pu_bacteria | 2842826826 | 2842829017 | 319 |
| 200 | iso_pu_bacteria | 2842837860 | 2842840544 | 319 |
| 201 | iso_pu_bacteria | 2947233263 | 2947234046 | 319 |
| 202 | iso_pu_bacteria | 8054347763 | 8054352892 | 319 |
| 203 | iso_pu_bacteria | 8056148874 | 8056151866 | 319 |
| 204 | 3300046522 | Ga0495643_0020970 | Ga0495643_0020970_26_988 | 320 |
| 205 | iso_pu_bacteria | 2718217725 | 2718636241 | 320 |
| 206 | iso_pu_bacteria | 3007619802 | 3007621601 | 320 |
| 207 | 3300027614 | Ga0209970_1001473 | Ga0209970_10014732 | 321 |
| 208 | iso_pu_bacteria | 2511231023 | 2511369271 | 321 |
| 209 | iso_pu_bacteria | 2747842501 | 2748017586 | 321 |
| 210 | iso_pu_bacteria | 2818991456 | 2819659322 | 321 |
| 211 | iso_pu_bacteria | 2878029506 | 2878034963 | 321 |
| 212 | iso_pu_bacteria | 2974289157 | 2974294463 | 321 |
| 213 | iso_pu_bacteria | 3007855910 | 3007860220 | 321 |
| 214 | iso_pu_bacteria | 3007861166 | 3007866474 | 321 |
| 215 | iso_pu_bacteria | 2841911363 | 2841912697 | 322 |
| 216 | iso_pu_bacteria | 2841917233 | 2841923066 | 322 |
| 217 | iso_pu_bacteria | 2945961074 | 2945966404 | 322 |
| 218 | iso_pu_bacteria | 8019769354 | 8019771205 | 322 |
| 219 | iso_pu_bacteria | 8057798959 | 8057803894 | 322 |
| 220 | 3300003752 | Ga0055539_1000055 | Ga0055539_1000055122 | 323 |
| 221 | 3300003756 | Ga0055533_1000067 | Ga0055533_1000067122 | 323 |
| 222 | 3300003758 | Ga0055532_1000053 | Ga0055532_1000053122 | 323 |
| 223 | 3300003759 | Ga0055525_1000103 | Ga0055525_100010314 | 323 |
| 224 | 3300003841 | Ga0055541_1000042 | Ga0055541_100004255 | 323 |
| 225 | 3300014497 | Ga0182008_10001497 | Ga0182008_100014979 | 323 |
| 226 | 3300015261 | Ga0182006_1001277 | Ga0182006_10012774 | 323 |
| 227 | 3300025206 | Ga0209435_101282 | Ga0209435_1012824 | 323 |
| 228 | 3300025224 | Ga0209784_100060 | Ga0209784_10006056 | 323 |
| 229 | 3300025225 | Ga0209566_100075 | Ga0209566_10007556 | 323 |
| 230 | 3300025226 | Ga0209674_100100 | Ga0209674_10010056 | 323 |
| 231 | 3300025229 | Ga0209147_100096 | Ga0209147_10009656 | 323 |
| 232 | 3300025230 | Ga0209563_100118 | Ga0209563_100118119 | 323 |
| 233 | 3300025242 | Ga0209258_100387 | Ga0209258_10038756 | 323 |
| 234 | 3300025246 | Ga0209646_1000276 | Ga0209646_100027641 | 323 |
| 235 | 3300025253 | Ga0209677_100057 | Ga0209677_10005756 | 323 |
| 236 | 3300025256 | Ga0209759_1008685 | Ga0209759_10086854 | 323 |
| 237 | 3300042006 | Ga0439432_000354 | Ga0439432_000354_13013_13984 | 323 |
| 238 | 3300046452 | Ga0495617_000817 | Ga0495617_000817_11382_12359 | 323 |
| 239 | 3300046458 | Ga0495591_000156 | Ga0495591_000156_67938_68939 | 323 |
| 240 | 3300046491 | Ga0495584_0000071 | Ga0495584_0000071_12197_13174 | 323 |
| 241 | 3300046492 | Ga0495585_0039917 | Ga0495585_0039917_1371_2348 | 323 |
| 242 | 3300046501 | Ga0495607_0028986 | Ga0495607_0028986_2344_3321 | 323 |
| 243 | 3300046691 | Ga0495670_0015116 | Ga0495670_0015116_1274_2251 | 323 |
| 244 | 3300048927 | Ga0496124_0055179 | Ga0496124_0055179_1777_2823 | 323 |
| 245 | iso_pu_bacteria | 2510917028 | 2511186909 | 323 |
| 246 | iso_pu_bacteria | 2513237138 | 2513869085 | 323 |
| 247 | iso_pu_bacteria | 2534681796 | 2535514832 | 323 |
| 248 | iso_pu_bacteria | 2582581294 | 2585201028 | 323 |
| 249 | iso_pu_bacteria | 2582581867 | 2585398827 | 323 |
| 250 | iso_pu_bacteria | 2585427590 | 2585819053 | 323 |
| 251 | iso_pu_bacteria | 2808606445 | 2809219163 | 323 |
| 252 | iso_pu_bacteria | 2841760612 | 2841765431 | 323 |
| 253 | iso_pu_bacteria | 2844104063 | 2844107041 | 323 |
| 254 | iso_pu_bacteria | 2851182111 | 2851186021 | 323 |
| 255 | iso_pu_bacteria | 2851246043 | 2851249081 | 323 |
| 256 | iso_pu_bacteria | 2923556063 | 2923556448 | 323 |
| 257 | iso_pu_bacteria | 2996887358 | 2996888248 | 323 |
| 258 | iso_pu_bacteria | 3007866637 | 3007867127 | 323 |
| 259 | iso_pu_bacteria | 8005258706 | 8005261200 | 323 |
| 260 | iso_pu_bacteria | 8005321885 | 8005322775 | 323 |
| 261 | iso_pu_bacteria | 8005542996 | 8005543503 | 323 |
| 262 | 3300006946 | Ga0079104_1005862 | Ga0079104_10058623 | 324 |
| 263 | 3300025728 | Ga0207655_1003282 | Ga0207655_10032829 | 324 |
| 264 | 3300032004 | Ga0307414_10175184 | Ga0307414_101751841 | 324 |
| 265 | 3300032005 | Ga0307411_10270466 | Ga0307411_102704661 | 324 |
| 266 | 3300046457 | Ga0495590_0011023 | Ga0495590_0011023_1457_2431 | 324 |
| 267 | 3300046471 | Ga0495650_0019401 | Ga0495650_0019401_955_1929 | 324 |
| 268 | 3300046501 | Ga0495607_0001003 | Ga0495607_0001003_963_1937 | 324 |
| 269 | 3300046513 | Ga0495616_0003948 | Ga0495616_0003948_7575_8549 | 324 |
| 270 | 3300046530 | Ga0495654_0061965 | Ga0495654_0061965_749_1723 | 324 |
| 271 | 3300046692 | Ga0495671_0026995 | Ga0495671_0026995_274_1248 | 324 |
| 272 | 3300047470 | Ga0495681_0004204 | Ga0495681_0004204_964_1938 | 324 |
| 273 | 3300048919 | Ga0496116_0008613 | Ga0496116_0008613_7713_8687 | 324 |
| 274 | 3300048925 | Ga0496122_0030109 | Ga0496122_0030109_96_1070 | 324 |
| 275 | 3300048926 | Ga0496123_0057232 | Ga0496123_0057232_140_1114 | 324 |
| 276 | 3300049460 | Ga0495682_0011604 | Ga0495682_0011604_958_1932 | 324 |
| 277 | 3300049758 | Ga0501241_000390 | Ga0501241_000390_7621_8601 | 324 |
| 278 | iso_pu_bacteria | 2511231006 | 2511264645 | 324 |
| 279 | iso_pu_bacteria | 2852103415 | 2852104097 | 324 |
| 280 | 3300003781 | Ga0055536_1001220 | Ga0055536_10012203 | 325 |
| 281 | 3300013100 | Ga0157373_10061003 | Ga0157373_100610033 | 325 |
| 282 | 3300013102 | Ga0157371_10004031 | Ga0157371_100040319 | 325 |
| 283 | 3300013105 | Ga0157369_10114601 | Ga0157369_101146012 | 325 |
| 284 | 3300014497 | Ga0182008_10002601 | Ga0182008_100026013 | 325 |
| 285 | 3300025230 | Ga0209563_101342 | Ga0209563_1013422 | 325 |
| 286 | 3300025292 | Ga0209676_1000314 | Ga0209676_100031414 | 325 |
| 287 | 3300025294 | Ga0209025_1025577 | Ga0209025_10255773 | 325 |
| 288 | 3300027111 | Ga0209281_1003455 | Ga0209281_10034554 | 325 |
| 289 | 3300031548 | Ga0307408_100130512 | Ga0307408_1001305122 | 325 |
| 290 | 3300041405 | Ga0439438_000609 | Ga0439438_000609_14677_15657 | 325 |
| 291 | 3300042004 | Ga0439445_0012296 | Ga0439445_0012296_804_1784 | 325 |
| 292 | 3300042006 | Ga0439432_017618 | Ga0439432_017618_771_1751 | 325 |
| 293 | 3300042009 | Ga0439451_025113 | Ga0439451_025113_207_1187 | 325 |
| 294 | 3300042010 | Ga0439452_000518 | Ga0439452_000518_6322_7302 | 325 |
| 295 | 3300042115 | Ga0450911_000160 | Ga0450911_000160_1427_2407 | 325 |
| 296 | 3300046453 | Ga0495627_002584 | Ga0495627_002584_6653_7633 | 325 |
| 297 | 3300046458 | Ga0495591_010940 | Ga0495591_010940_1481_2461 | 325 |
| 298 | 3300046471 | Ga0495650_0062158 | Ga0495650_0062158_351_1331 | 325 |
| 299 | 3300046507 | Ga0495606_0027057 | Ga0495606_0027057_71_1066 | 325 |
| 300 | 3300046512 | Ga0495610_0003447 | Ga0495610_0003447_998_1978 | 325 |
| 301 | 3300046513 | Ga0495616_0001472 | Ga0495616_0001472_1001_1981 | 325 |
| 302 | 3300046519 | Ga0495632_0017457 | Ga0495632_0017457_764_1744 | 325 |
| 303 | 3300046524 | Ga0495648_0150733 | Ga0495648_0150733_114_1094 | 325 |
| 304 | 3300046530 | Ga0495654_0003677 | Ga0495654_0003677_7188_8168 | 325 |
| 305 | 3300046530 | Ga0495654_0045559 | Ga0495654_0045559_615_1595 | 325 |
| 306 | 3300046616 | Ga0495668_0004491 | Ga0495668_0004491_982_1962 | 325 |
| 307 | 3300046660 | Ga0495625_0139248 | Ga0495625_0139248_234_1214 | 325 |
| 308 | 3300047323 | Ga0495683_0015185 | Ga0495683_0015185_2047_3027 | 325 |
| 309 | 3300048091 | Ga0495626_0004417 | Ga0495626_0004417_1001_1981 | 325 |
| 310 | 3300048091 | Ga0495626_0029967 | Ga0495626_0029967_1442_2422 | 325 |
| 311 | 3300048091 | Ga0495626_0054914 | Ga0495626_0054914_59_1048 | 325 |
| 312 | 3300048927 | Ga0496124_0089203 | Ga0496124_0089203_296_1276 | 325 |
| 313 | 3300049459 | Ga0495678_003960 | Ga0495678_003960_6882_7862 | 325 |
| 314 | iso_pu_bacteria | 2511231031 | 2511415024 | 325 |
| 315 | iso_pu_bacteria | 2554235341 | 2555672433 | 325 |
| 316 | iso_pu_bacteria | 2599185160 | 2599358113 | 325 |
| 317 | iso_pu_bacteria | 2599185162 | 2599370988 | 325 |
| 318 | iso_pu_bacteria | 2599185163 | 2599377010 | 325 |
| 319 | iso_pu_bacteria | 2599185164 | 2599383278 | 325 |
| 320 | iso_pu_bacteria | 2599185165 | 2599389725 | 325 |
| 321 | iso_pu_bacteria | 2599185166 | 2599396022 | 325 |
| 322 | iso_pu_bacteria | 2599185168 | 2599407862 | 325 |
| 323 | iso_pu_bacteria | 2599185181 | 2599464928 | 325 |
| 324 | iso_pu_bacteria | 2599185182 | 2599471253 | 325 |
| 325 | iso_pu_bacteria | 2599185186 | 2599494157 | 325 |
| 326 | iso_pu_bacteria | 2599185356 | 2600217660 | 325 |
| 327 | iso_pu_bacteria | 2600255313 | 2601777827 | 325 |
| 328 | iso_pu_bacteria | 2667528171 | 2671100650 | 325 |
| 329 | iso_pu_bacteria | 2713897148 | 2715752450 | 325 |
| 330 | iso_pu_bacteria | 2738543025 | 2739314980 | 325 |
| 331 | iso_pu_bacteria | 2818991464 | 2819706317 | 325 |
| 332 | iso_pu_bacteria | 2842832357 | 2842836853 | 325 |
| 333 | iso_pu_bacteria | 2842843487 | 2842847589 | 325 |
| 334 | iso_pu_bacteria | 2844665904 | 2844666606 | 325 |
| 335 | iso_pu_bacteria | 2917070673 | 2917076317 | 325 |
| 336 | iso_pu_bacteria | 2919385768 | 2919390524 | 325 |
| 337 | iso_pu_bacteria | 2919487758 | 2919492645 | 325 |
| 338 | iso_pu_bacteria | 2923153595 | 2923159149 | 325 |
| 339 | iso_pu_bacteria | 2935353572 | 2935359741 | 325 |
| 340 | iso_pu_bacteria | 2969304461 | 2969309790 | 325 |
| 341 | iso_pu_bacteria | 2998139840 | 2998145016 | 325 |
| 342 | iso_pu_bacteria | 3007614139 | 3007617939 | 325 |
| 343 | iso_pu_bacteria | 8029995093 | 8029995880 | 325 |
| 344 | iso_pu_bacteria | 8056166840 | 8056171552 | 325 |
| 345 | iso_pu_bacteria | 8056569372 | 8056572064 | 325 |
| 346 | 3300009011 | Ga0105251_10001237 | Ga0105251_1000123714 | 326 |
| 347 | 3300009092 | Ga0105250_10004247 | Ga0105250_100042473 | 326 |
| 348 | 3300025735 | Ga0207713_1003890 | Ga0207713_10038908 | 326 |
| 349 | 3300046453 | Ga0495627_000759 | Ga0495627_000759_13483_14463 | 326 |
| 350 | 3300046458 | Ga0495591_000506 | Ga0495591_000506_16218_17198 | 326 |
| 351 | 3300046501 | Ga0495607_0002532 | Ga0495607_0002532_6962_7942 | 326 |
| 352 | 3300046501 | Ga0495607_0066209 | Ga0495607_0066209_648_1628 | 326 |
| 353 | 3300046507 | Ga0495606_0007403 | Ga0495606_0007403_2737_3717 | 326 |
| 354 | 3300046512 | Ga0495610_0034698 | Ga0495610_0034698_1335_2315 | 326 |
| 355 | 3300046515 | Ga0495620_0000406 | Ga0495620_0000406_14384_15364 | 326 |
| 356 | 3300046519 | Ga0495632_0001411 | Ga0495632_0001411_13440_14420 | 326 |
| 357 | 3300046522 | Ga0495643_0027411 | Ga0495643_0027411_141_1121 | 326 |
| 358 | 3300046665 | Ga0495661_0000541 | Ga0495661_0000541_24602_25582 | 326 |
| 359 | 3300046794 | Ga0495589_0002462 | Ga0495589_0002462_6670_7650 | 326 |
| 360 | 3300047446 | Ga0495679_002920 | Ga0495679_002920_3108_4088 | 326 |
| 361 | 3300047470 | Ga0495681_0007695 | Ga0495681_0007695_4737_5717 | 326 |
| 362 | 3300047470 | Ga0495681_0010567 | Ga0495681_0010567_711_1691 | 326 |
| 363 | 3300047470 | Ga0495681_0026450 | Ga0495681_0026450_1249_2229 | 326 |
| 364 | 3300048920 | Ga0496117_0000666 | Ga0496117_0000666_51258_52238 | 326 |
| 365 | 3300048922 | Ga0496119_0007135 | Ga0496119_0007135_6318_7298 | 326 |
| 366 | 3300048923 | Ga0496120_0005963 | Ga0496120_0005963_2752_3732 | 326 |
| 367 | 3300048927 | Ga0496124_0003740 | Ga0496124_0003740_14586_15566 | 326 |
| 368 | 3300048928 | Ga0496125_0001551 | Ga0496125_0001551_29041_30021 | 326 |
| 369 | 3300048929 | Ga0496126_0033405 | Ga0496126_0033405_1090_2070 | 326 |
| 370 | iso_pu_bacteria | 2511231008 | 2511278745 | 326 |
| 371 | iso_pu_bacteria | 2511231012 | 2511299107 | 326 |
| 372 | iso_pu_bacteria | 2511231014 | 2511312725 | 326 |
| 373 | iso_pu_bacteria | 2511231015 | 2511318157 | 326 |
| 374 | iso_pu_bacteria | 2511231017 | 2511331979 | 326 |
| 375 | iso_pu_bacteria | 2511231019 | 2511347004 | 326 |
| 376 | iso_pu_bacteria | 2511231020 | 2511353048 | 326 |
| 377 | iso_pu_bacteria | 2511231021 | 2511359709 | 326 |
| 378 | iso_pu_bacteria | 2511231156 | 2511827258 | 326 |
| 379 | iso_pu_bacteria | 2599185188 | 2599504977 | 326 |
| 380 | iso_pu_bacteria | 2599185212 | 2599615563 | 326 |
| 381 | iso_pu_bacteria | 2599185248 | 2599773528 | 326 |
| 382 | iso_pu_bacteria | 2599185289 | 2599889971 | 326 |
| 383 | iso_pu_bacteria | 2599185291 | 2599901694 | 326 |
| 384 | iso_pu_bacteria | 2599185300 | 2599930537 | 326 |
| 385 | iso_pu_bacteria | 2599185302 | 2599944928 | 326 |
| 386 | iso_pu_bacteria | 2599185304 | 2599955343 | 326 |
| 387 | iso_pu_bacteria | 2599185305 | 2599962835 | 326 |
| 388 | iso_pu_bacteria | 2599185308 | 2599978963 | 326 |
| 389 | iso_pu_bacteria | 2599185309 | 2599984075 | 326 |
| 390 | iso_pu_bacteria | 2599185310 | 2599990204 | 326 |
| 391 | iso_pu_bacteria | 2599185311 | 2599996903 | 326 |
| 392 | iso_pu_bacteria | 2599185312 | 2600001857 | 326 |
| 393 | iso_pu_bacteria | 2599185313 | 2600009226 | 326 |
| 394 | iso_pu_bacteria | 2599185314 | 2600012923 | 326 |
| 395 | iso_pu_bacteria | 2599185315 | 2600020774 | 326 |
| 396 | iso_pu_bacteria | 2599185316 | 2600025770 | 326 |
| 397 | iso_pu_bacteria | 2599185317 | 2600031050 | 326 |
| 398 | iso_pu_bacteria | 2599185318 | 2600038411 | 326 |
| 399 | iso_pu_bacteria | 2599185319 | 2600043743 | 326 |
| 400 | iso_pu_bacteria | 2599185320 | 2600048738 | 326 |
| 401 | iso_pu_bacteria | 2599185321 | 2600055554 | 326 |
| 402 | iso_pu_bacteria | 2599185322 | 2600061996 | 326 |
| 403 | iso_pu_bacteria | 2599185323 | 2600067236 | 326 |
| 404 | iso_pu_bacteria | 2599185324 | 2600073330 | 326 |
| 405 | iso_pu_bacteria | 2599185325 | 2600079881 | 326 |
| 406 | iso_pu_bacteria | 2600254930 | 2600360959 | 326 |
| 407 | iso_pu_bacteria | 2600255318 | 2601800612 | 326 |
| 408 | iso_pu_bacteria | 2603880185 | 2606078580 | 326 |
| 409 | iso_pu_bacteria | 2603880199 | 2606125760 | 326 |
| 410 | iso_pu_bacteria | 2623620443 | 2624483025 | 326 |
| 411 | iso_pu_bacteria | 2643221565 | 2643844996 | 326 |
| 412 | iso_pu_bacteria | 2643221589 | 2643957703 | 326 |
| 413 | iso_pu_bacteria | 2643221602 | 2644025819 | 326 |
| 414 | iso_pu_bacteria | 2643221633 | 2644188174 | 326 |
| 415 | iso_pu_bacteria | 2643221650 | 2644286668 | 326 |
| 416 | iso_pu_bacteria | 2643221736 | 2644744193 | 326 |
| 417 | iso_pu_bacteria | 2667528170 | 2671094209 | 326 |
| 418 | iso_pu_bacteria | 2667528176 | 2671129710 | 326 |
| 419 | iso_pu_bacteria | 2713897149 | 2715759201 | 326 |
| 420 | iso_pu_bacteria | 2738543004 | 2739200480 | 326 |
| 421 | iso_pu_bacteria | 2738543015 | 2739262161 | 326 |
| 422 | iso_pu_bacteria | 2773857670 | 2774121931 | 326 |
| 423 | iso_pu_bacteria | 2784132072 | 2784314594 | 326 |
| 424 | iso_pu_bacteria | 2791355520 | 2794595157 | 326 |
| 425 | iso_pu_bacteria | 2808606361 | 2808858051 | 326 |
| 426 | iso_pu_bacteria | 2808606376 | 2808926174 | 326 |
| 427 | iso_pu_bacteria | 2808606377 | 2808932344 | 326 |
| 428 | iso_pu_bacteria | 2808606378 | 2808938222 | 326 |
| 429 | iso_pu_bacteria | 2808606380 | 2808948275 | 326 |
| 430 | iso_pu_bacteria | 2808606381 | 2808954465 | 326 |
| 431 | iso_pu_bacteria | 2808606383 | 2808966581 | 326 |
| 432 | iso_pu_bacteria | 2808606389 | 2809001411 | 326 |
| 433 | iso_pu_bacteria | 2825651385 | 2825655484 | 326 |
| 434 | iso_pu_bacteria | 2860339153 | 2860344014 | 326 |
| 435 | iso_pu_bacteria | 2904550169 | 2904554173 | 326 |
| 436 | iso_pu_bacteria | 2913036834 | 2913042175 | 326 |
| 437 | iso_pu_bacteria | 2919063839 | 2919067659 | 326 |
| 438 | iso_pu_bacteria | 2919456309 | 2919461628 | 326 |
| 439 | iso_pu_bacteria | 2919481497 | 2919486004 | 326 |
| 440 | iso_pu_bacteria | 2929144301 | 2929149563 | 326 |
| 441 | iso_pu_bacteria | 2931369376 | 2931373034 | 326 |
| 442 | iso_pu_bacteria | 2939636861 | 2939641949 | 326 |
| 443 | iso_pu_bacteria | 3007511990 | 3007516805 | 326 |
| 444 | iso_pu_bacteria | 3007718800 | 3007721282 | 326 |
| 445 | iso_pu_bacteria | 8011350971 | 8011356628 | 326 |
| 446 | iso_pu_bacteria | 8056125926 | 8056131231 | 326 |
| 447 | iso_pu_bacteria | 8056143049 | 8056148382 | 326 |
| 448 | iso_pu_bacteria | 8056172158 | 8056172221 | 326 |
| 449 | iso_pu_bacteria | 8056177738 | 8056179306 | 326 |
| 450 | iso_pu_bacteria | 8057529695 | 8057532398 | 326 |
| 451 | 3300002773 | JGI25152J39213_1001720 | JGI25152J39213_10017203 | 327 |
| 452 | 3300003771 | Ga0055526_1030489 | Ga0055526_10304892 | 327 |
| 453 | 3300003775 | Ga0055524_1013619 | Ga0055524_10136192 | 327 |
| 454 | 3300003790 | Ga0055528_1016217 | Ga0055528_10162172 | 327 |
| 455 | 3300005355 | Ga0070671_100013114 | Ga0070671_1000131142 | 327 |
| 456 | 3300005937 | Ga0081455_10229093 | Ga0081455_102290931 | 327 |
| 457 | 3300006178 | Ga0075367_10016661 | Ga0075367_100166612 | 327 |
| 458 | 3300006186 | Ga0075369_10001246 | Ga0075369_100012465 | 327 |
| 459 | 3300009766 | Ga0123342_1011774 | Ga0123342_10117748 | 327 |
| 460 | 3300025258 | Ga0209129_1013860 | Ga0209129_10138602 | 327 |
| 461 | 3300025273 | Ga0209673_1008376 | Ga0209673_10083763 | 327 |
| 462 | 3300025294 | Ga0209025_1039287 | Ga0209025_10392872 | 327 |
| 463 | 3300025295 | Ga0209564_1035769 | Ga0209564_10357691 | 327 |
| 464 | 3300025302 | Ga0207426_1002536 | Ga0207426_10025364 | 327 |
| 465 | 3300025303 | Ga0209051_1049555 | Ga0209051_10495551 | 327 |
| 466 | 3300025931 | Ga0207644_10116047 | Ga0207644_101160471 | 327 |
| 467 | 3300042139 | Ga0450904_000327 | Ga0450904_000327_7949_8935 | 327 |
| 468 | 3300047443 | Ga0495687_046819 | Ga0495687_046819_687_1673 | 327 |
| 469 | 3300048905 | Ga0496102_0390392 | Ga0496102_0390392_172_1158 | 327 |
| 470 | 3300048906 | Ga0496103_0043594 | Ga0496103_0043594_905_1891 | 327 |
| 471 | 3300048907 | Ga0496104_0143109 | Ga0496104_0143109_942_1928 | 327 |
| 472 | 3300048908 | Ga0496105_0024445 | Ga0496105_0024445_1943_2929 | 327 |
| 473 | 3300048916 | Ga0496113_0094413 | Ga0496113_0094413_625_1611 | 327 |
| 474 | 3300048919 | Ga0496116_0102727 | Ga0496116_0102727_380_1366 | 327 |
| 475 | 3300048924 | Ga0496121_0097710 | Ga0496121_0097710_834_1820 | 327 |
| 476 | 3300048925 | Ga0496122_0063793 | Ga0496122_0063793_1378_2364 | 327 |
| 477 | 3300048927 | Ga0496124_0117196 | Ga0496124_0117196_134_1120 | 327 |
| 478 | iso_pu_bacteria | 2511231004 | 2511253660 | 327 |
| 479 | iso_pu_bacteria | 2511231007 | 2511269447 | 327 |
| 480 | iso_pu_bacteria | 2511231016 | 2511325892 | 327 |
| 481 | iso_pu_bacteria | 2511231018 | 2511341088 | 327 |
| 482 | iso_pu_bacteria | 2511231022 | 2511364628 | 327 |
| 483 | iso_pu_bacteria | 2512047018 | 2512327942 | 327 |
| 484 | iso_pu_bacteria | 2582580891 | 2583794851 | 327 |
| 485 | iso_pu_bacteria | 2597489887 | 2597860505 | 327 |
| 486 | iso_pu_bacteria | 2599185185 | 2599486643 | 327 |
| 487 | iso_pu_bacteria | 2599185257 | 2599807222 | 327 |
| 488 | iso_pu_bacteria | 2600254931 | 2600367888 | 327 |
| 489 | iso_pu_bacteria | 2623620446 | 2624494553 | 327 |
| 490 | iso_pu_bacteria | 2671180172 | 2671773218 | 327 |
| 491 | iso_pu_bacteria | 2740892503 | 2743740058 | 327 |
| 492 | iso_pu_bacteria | 2919697872 | 2919701347 | 327 |
| 493 | iso_pu_bacteria | 2931396565 | 2931397678 | 327 |
| 494 | iso_pu_bacteria | 2984286254 | 2984287008 | 327 |
| 495 | iso_pu_bacteria | 3007395558 | 3007398795 | 327 |
| 496 | iso_pu_bacteria | 8015687852 | 8015693237 | 327 |
| 497 | iso_pu_bacteria | 8019775933 | 8019780488 | 327 |
| 498 | iso_pu_bacteria | 8055770955 | 8055776487 | 327 |
| 499 | 3300015265 | Ga0182005_1000297 | Ga0182005_100029721 | 328 |
| 500 | 3300046460 | Ga0495638_0004057 | Ga0495638_0004057_1968_2963 | 328 |
| 501 | 3300048921 | Ga0496118_0020062 | Ga0496118_0020062_124_1122 | 328 |
| 502 | 3300002737 | JGI25162J39368_1000492 | JGI25162J39368_100049214 | 329 |
| 503 | 3300002771 | JGI25163J39215_1000502 | JGI25163J39215_100050211 | 329 |
| 504 | 3300002772 | JGI25164J39214_1000335 | JGI25164J39214_100033514 | 329 |
| 505 | 3300003214 | JGI25165J46597_1000619 | JGI25165J46597_100061916 | 329 |
| 506 | 3300005548 | Ga0070665_100003740 | Ga0070665_1000037407 | 329 |
| 507 | 3300006051 | Ga0075364_10058760 | Ga0075364_100587602 | 329 |
| 508 | 3300009092 | Ga0105250_10002717 | Ga0105250_100027173 | 329 |
| 509 | 3300012498 | Ga0157345_1000115 | Ga0157345_10001153 | 329 |
| 510 | 3300013100 | Ga0157373_10001015 | Ga0157373_100010159 | 329 |
| 511 | 3300013105 | Ga0157369_10004956 | Ga0157369_100049563 | 329 |
| 512 | 3300013105 | Ga0157369_10005603 | Ga0157369_1000560313 | 329 |
| 513 | 3300013306 | Ga0163162_10000325 | Ga0163162_100003257 | 329 |
| 514 | 3300013308 | Ga0157375_10056934 | Ga0157375_100569343 | 329 |
| 515 | 3300017792 | Ga0163161_10002472 | Ga0163161_100024729 | 329 |
| 516 | 3300025207 | Ga0209760_100117 | Ga0209760_1001176 | 329 |
| 517 | 3300025231 | Ga0207427_100063 | Ga0207427_100063148 | 329 |
| 518 | 3300025233 | Ga0209437_100133 | Ga0209437_10013335 | 329 |
| 519 | 3300025261 | Ga0209233_1000133 | Ga0209233_100013363 | 329 |
| 520 | 3300025711 | Ga0207696_1003503 | Ga0207696_10035035 | 329 |
| 521 | 3300025728 | Ga0207655_1009574 | Ga0207655_10095743 | 329 |
| 522 | 3300025728 | Ga0207655_1020665 | Ga0207655_10206652 | 329 |
| 523 | 3300028379 | Ga0268266_10005512 | Ga0268266_1000551210 | 329 |
| 524 | 3300032002 | Ga0307416_100105112 | Ga0307416_1001051123 | 329 |
| 525 | 3300033180 | Ga0307510_10007351 | Ga0307510_1000735110 | 329 |
| 526 | 3300041405 | Ga0439438_001480 | Ga0439438_001480_8719_9777 | 329 |
| 527 | 3300041405 | Ga0439438_004153 | Ga0439438_004153_4176_5177 | 329 |
| 528 | 3300041407 | Ga0439447_010414 | Ga0439447_010414_967_1968 | 329 |
| 529 | 3300041407 | Ga0439447_026360 | Ga0439447_026360_381_1439 | 329 |
| 530 | 3300041411 | Ga0439466_0000329 | Ga0439466_0000329_7918_8976 | 329 |
| 531 | 3300041411 | Ga0439466_0019020 | Ga0439466_0019020_98_1099 | 329 |
| 532 | 3300042002 | Ga0439442_009238 | Ga0439442_009238_860_1861 | 329 |
| 533 | 3300042010 | Ga0439452_022256 | Ga0439452_022256_112_1101 | 329 |
| 534 | 3300042013 | Ga0439456_002394 | Ga0439456_002394_972_1973 | 329 |
| 535 | 3300042145 | Ga0450906_000316 | Ga0450906_000316_7828_8829 | 329 |
| 536 | 3300042531 | Ga0450918_002822 | Ga0450918_002822_1345_2346 | 329 |
| 537 | 3300046452 | Ga0495617_007432 | Ga0495617_007432_1438_2439 | 329 |
| 538 | 3300046452 | Ga0495617_009862 | Ga0495617_009862_1514_2515 | 329 |
| 539 | 3300046452 | Ga0495617_025088 | Ga0495617_025088_935_1936 | 329 |
| 540 | 3300046452 | Ga0495617_053288 | Ga0495617_053288_319_1320 | 329 |
| 541 | 3300046452 | Ga0495617_061930 | Ga0495617_061930_166_1167 | 329 |
| 542 | 3300046452 | Ga0495617_072357 | Ga0495617_072357_96_1097 | 329 |
| 543 | 3300046453 | Ga0495627_001265 | Ga0495627_001265_1003_2004 | 329 |
| 544 | 3300046453 | Ga0495627_001292 | Ga0495627_001292_990_1991 | 329 |
| 545 | 3300046453 | Ga0495627_055325 | Ga0495627_055325_168_1169 | 329 |
| 546 | 3300046457 | Ga0495590_0072815 | Ga0495590_0072815_104_1105 | 329 |
| 547 | 3300046458 | Ga0495591_001352 | Ga0495591_001352_13387_14388 | 329 |
| 548 | 3300046458 | Ga0495591_003167 | Ga0495591_003167_6677_7678 | 329 |
| 549 | 3300046458 | Ga0495591_015999 | Ga0495591_015999_1353_2354 | 329 |
| 550 | 3300046458 | Ga0495591_026025 | Ga0495591_026025_751_1752 | 329 |
| 551 | 3300046459 | Ga0495629_0290272 | Ga0495629_0290272_57_1058 | 329 |
| 552 | 3300046460 | Ga0495638_0004885 | Ga0495638_0004885_8040_9041 | 329 |
| 553 | 3300046460 | Ga0495638_0046421 | Ga0495638_0046421_1002_2003 | 329 |
| 554 | 3300046460 | Ga0495638_0074312 | Ga0495638_0074312_72_1073 | 329 |
| 555 | 3300046463 | Ga0495653_0090152 | Ga0495653_0090152_220_1221 | 329 |
| 556 | 3300046471 | Ga0495650_0019880 | Ga0495650_0019880_921_1922 | 329 |
| 557 | 3300046471 | Ga0495650_0025655 | Ga0495650_0025655_973_1974 | 329 |
| 558 | 3300046474 | Ga0495605_0003138 | Ga0495605_0003138_7979_8980 | 329 |
| 559 | 3300046474 | Ga0495605_0010626 | Ga0495605_0010626_3888_4931 | 329 |
| 560 | 3300046474 | Ga0495605_0061778 | Ga0495605_0061778_779_1780 | 329 |
| 561 | 3300046474 | Ga0495605_0085110 | Ga0495605_0085110_183_1184 | 329 |
| 562 | 3300046491 | Ga0495584_0007166 | Ga0495584_0007166_1003_2004 | 329 |
| 563 | 3300046491 | Ga0495584_0020609 | Ga0495584_0020609_995_1996 | 329 |
| 564 | 3300046491 | Ga0495584_0032585 | Ga0495584_0032585_485_1486 | 329 |
| 565 | 3300046491 | Ga0495584_0067456 | Ga0495584_0067456_769_1770 | 329 |
| 566 | 3300046492 | Ga0495585_0004291 | Ga0495585_0004291_195_1196 | 329 |
| 567 | 3300046492 | Ga0495585_0004828 | Ga0495585_0004828_990_1991 | 329 |
| 568 | 3300046492 | Ga0495585_0009701 | Ga0495585_0009701_3772_4773 | 329 |
| 569 | 3300046492 | Ga0495585_0054462 | Ga0495585_0054462_176_1177 | 329 |
| 570 | 3300046492 | Ga0495585_0143636 | Ga0495585_0143636_195_1196 | 329 |
| 571 | 3300046500 | Ga0495596_0040739 | Ga0495596_0040739_809_1810 | 329 |
| 572 | 3300046501 | Ga0495607_0003183 | Ga0495607_0003183_10826_11827 | 329 |
| 573 | 3300046501 | Ga0495607_0029539 | Ga0495607_0029539_1009_2010 | 329 |
| 574 | 3300046501 | Ga0495607_0037011 | Ga0495607_0037011_741_1742 | 329 |
| 575 | 3300046501 | Ga0495607_0104149 | Ga0495607_0104149_433_1434 | 329 |
| 576 | 3300046506 | Ga0495583_0004601 | Ga0495583_0004601_745_1746 | 329 |
| 577 | 3300046507 | Ga0495606_0003819 | Ga0495606_0003819_1004_2005 | 329 |
| 578 | 3300046507 | Ga0495606_0007299 | Ga0495606_0007299_991_1992 | 329 |
| 579 | 3300046507 | Ga0495606_0022726 | Ga0495606_0022726_970_1971 | 329 |
| 580 | 3300046512 | Ga0495610_0003297 | Ga0495610_0003297_1001_2002 | 329 |
| 581 | 3300046513 | Ga0495616_0003328 | Ga0495616_0003328_8339_9340 | 329 |
| 582 | 3300046513 | Ga0495616_0003536 | Ga0495616_0003536_943_1944 | 329 |
| 583 | 3300046515 | Ga0495620_0001195 | Ga0495620_0001195_1409_2410 | 329 |
| 584 | 3300046515 | Ga0495620_0018891 | Ga0495620_0018891_948_1949 | 329 |
| 585 | 3300046515 | Ga0495620_0019091 | Ga0495620_0019091_1414_2415 | 329 |
| 586 | 3300046515 | Ga0495620_0048203 | Ga0495620_0048203_197_1198 | 329 |
| 587 | 3300046518 | Ga0495631_0001267 | Ga0495631_0001267_979_1980 | 329 |
| 588 | 3300046518 | Ga0495631_0032925 | Ga0495631_0032925_736_1737 | 329 |
| 589 | 3300046518 | Ga0495631_0134231 | Ga0495631_0134231_23_1024 | 329 |
| 590 | 3300046519 | Ga0495632_0002134 | Ga0495632_0002134_1227_2228 | 329 |
| 591 | 3300046519 | Ga0495632_0023938 | Ga0495632_0023938_1267_2268 | 329 |
| 592 | 3300046519 | Ga0495632_0026672 | Ga0495632_0026672_762_1763 | 329 |
| 593 | 3300046520 | Ga0495637_0001228 | Ga0495637_0001228_1002_2003 | 329 |
| 594 | 3300046520 | Ga0495637_0002624 | Ga0495637_0002624_968_1969 | 329 |
| 595 | 3300046520 | Ga0495637_0018200 | Ga0495637_0018200_1284_2285 | 329 |
| 596 | 3300046520 | Ga0495637_0020652 | Ga0495637_0020652_1023_2024 | 329 |
| 597 | 3300046520 | Ga0495637_0030564 | Ga0495637_0030564_1192_2193 | 329 |
| 598 | 3300046522 | Ga0495643_0002889 | Ga0495643_0002889_11021_12022 | 329 |
| 599 | 3300046522 | Ga0495643_0015439 | Ga0495643_0015439_2561_3562 | 329 |
| 600 | 3300046522 | Ga0495643_0054021 | Ga0495643_0054021_163_1164 | 329 |
| 601 | 3300046522 | Ga0495643_0142874 | Ga0495643_0142874_51_1052 | 329 |
| 602 | 3300046523 | Ga0495644_0009973 | Ga0495644_0009973_1692_2693 | 329 |
| 603 | 3300046524 | Ga0495648_0003727 | Ga0495648_0003727_968_1969 | 329 |
| 604 | 3300046524 | Ga0495648_0036849 | Ga0495648_0036849_952_1953 | 329 |
| 605 | 3300046530 | Ga0495654_0029533 | Ga0495654_0029533_775_1776 | 329 |
| 606 | 3300046530 | Ga0495654_0080968 | Ga0495654_0080968_224_1225 | 329 |
| 607 | 3300046530 | Ga0495654_0113704 | Ga0495654_0113704_16_1017 | 329 |
| 608 | 3300046538 | Ga0495609_0001501 | Ga0495609_0001501_1006_2007 | 329 |
| 609 | 3300046538 | Ga0495609_0006210 | Ga0495609_0006210_4140_5141 | 329 |
| 610 | 3300046538 | Ga0495609_0035895 | Ga0495609_0035895_850_1851 | 329 |
| 611 | 3300046538 | Ga0495609_0054774 | Ga0495609_0054774_729_1730 | 329 |
| 612 | 3300046542 | Ga0495597_0002134 | Ga0495597_0002134_997_1998 | 329 |
| 613 | 3300046542 | Ga0495597_0041715 | Ga0495597_0041715_93_1094 | 329 |
| 614 | 3300046557 | Ga0495622_0000943 | Ga0495622_0000943_997_1998 | 329 |
| 615 | 3300046558 | Ga0495633_0001860 | Ga0495633_0001860_945_1946 | 329 |
| 616 | 3300046616 | Ga0495668_0099130 | Ga0495668_0099130_556_1557 | 329 |
| 617 | 3300046616 | Ga0495668_0105475 | Ga0495668_0105475_327_1328 | 329 |
| 618 | 3300046648 | Ga0495611_0000947 | Ga0495611_0000947_13545_14546 | 329 |
| 619 | 3300046648 | Ga0495611_0070170 | Ga0495611_0070170_442_1443 | 329 |
| 620 | 3300046660 | Ga0495625_0008604 | Ga0495625_0008604_6719_7720 | 329 |
| 621 | 3300046660 | Ga0495625_0040102 | Ga0495625_0040102_1450_2451 | 329 |
| 622 | 3300046665 | Ga0495661_0024019 | Ga0495661_0024019_2765_3766 | 329 |
| 623 | 3300046665 | Ga0495661_0033093 | Ga0495661_0033093_763_1764 | 329 |
| 624 | 3300046665 | Ga0495661_0149940 | Ga0495661_0149940_215_1216 | 329 |
| 625 | 3300046691 | Ga0495670_0000749 | Ga0495670_0000749_13550_14551 | 329 |
| 626 | 3300046692 | Ga0495671_0001561 | Ga0495671_0001561_994_1995 | 329 |
| 627 | 3300046692 | Ga0495671_0003309 | Ga0495671_0003309_7926_8927 | 329 |
| 628 | 3300046692 | Ga0495671_0018995 | Ga0495671_0018995_1692_2693 | 329 |
| 629 | 3300046692 | Ga0495671_0041231 | Ga0495671_0041231_371_1372 | 329 |
| 630 | 3300046694 | Ga0495649_0004493 | Ga0495649_0004493_7324_8325 | 329 |
| 631 | 3300046694 | Ga0495649_0004696 | Ga0495649_0004696_6865_7866 | 329 |
| 632 | 3300046694 | Ga0495649_0005087 | Ga0495649_0005087_6427_7428 | 329 |
| 633 | 3300046694 | Ga0495649_0024089 | Ga0495649_0024089_967_1968 | 329 |
| 634 | 3300046694 | Ga0495649_0027572 | Ga0495649_0027572_1157_2158 | 329 |
| 635 | 3300046794 | Ga0495589_0001172 | Ga0495589_0001172_13392_14393 | 329 |
| 636 | 3300046794 | Ga0495589_0103497 | Ga0495589_0103497_196_1197 | 329 |
| 637 | 3300046810 | Ga0495660_0003310 | Ga0495660_0003310_995_1996 | 329 |
| 638 | 3300046810 | Ga0495660_0009662 | Ga0495660_0009662_1004_2005 | 329 |
| 639 | 3300046810 | Ga0495660_0022774 | Ga0495660_0022774_1793_2794 | 329 |
| 640 | 3300046810 | Ga0495660_0041853 | Ga0495660_0041853_968_1969 | 329 |
| 641 | 3300046810 | Ga0495660_0054612 | Ga0495660_0054612_645_1646 | 329 |
| 642 | 3300047320 | Ga0495672_0017256 | Ga0495672_0017256_3020_4021 | 329 |
| 643 | 3300047321 | Ga0495676_0004312 | Ga0495676_0004312_976_1977 | 329 |
| 644 | 3300047323 | Ga0495683_0004032 | Ga0495683_0004032_185_1186 | 329 |
| 645 | 3300047323 | Ga0495683_0026945 | Ga0495683_0026945_1161_2162 | 329 |
| 646 | 3300047446 | Ga0495679_005122 | Ga0495679_005122_3937_4938 | 329 |
| 647 | 3300047446 | Ga0495679_005781 | Ga0495679_005781_3453_4454 | 329 |
| 648 | 3300047446 | Ga0495679_023623 | Ga0495679_023623_1000_2001 | 329 |
| 649 | 3300047469 | Ga0495673_0019032 | Ga0495673_0019032_1445_2446 | 329 |
| 650 | 3300047469 | Ga0495673_0019549 | Ga0495673_0019549_1441_2442 | 329 |
| 651 | 3300047469 | Ga0495673_0029104 | Ga0495673_0029104_328_1329 | 329 |
| 652 | 3300047469 | Ga0495673_0033964 | Ga0495673_0033964_370_1371 | 329 |
| 653 | 3300047470 | Ga0495681_0001494 | Ga0495681_0001494_1019_2020 | 329 |
| 654 | 3300047470 | Ga0495681_0004321 | Ga0495681_0004321_984_1985 | 329 |
| 655 | 3300047472 | Ga0495686_0006040 | Ga0495686_0006040_7436_8437 | 329 |
| 656 | 3300047472 | Ga0495686_0013322 | Ga0495686_0013322_945_1946 | 329 |
| 657 | 3300048091 | Ga0495626_0009047 | Ga0495626_0009047_661_1662 | 329 |
| 658 | 3300048091 | Ga0495626_0040977 | Ga0495626_0040977_991_1992 | 329 |
| 659 | 3300048091 | Ga0495626_0093723 | Ga0495626_0093723_27_1028 | 329 |
| 660 | 3300048919 | Ga0496116_0001579 | Ga0496116_0001579_1344_2345 | 329 |
| 661 | 3300049459 | Ga0495678_001889 | Ga0495678_001889_1004_2005 | 329 |
| 662 | 3300049459 | Ga0495678_003308 | Ga0495678_003308_1035_2036 | 329 |
| 663 | 3300049459 | Ga0495678_035796 | Ga0495678_035796_38_1039 | 329 |
| 664 | 3300049459 | Ga0495678_074284 | Ga0495678_074284_172_1173 | 329 |
| 665 | 3300049460 | Ga0495682_0001401 | Ga0495682_0001401_11142_12143 | 329 |
| 666 | 3300049460 | Ga0495682_0026699 | Ga0495682_0026699_289_1290 | 329 |
| 667 | 3300053111 | Ga0500572_001539 | Ga0500572_001539_4178_5179 | 329 |
| 668 | iso_pu_bacteria | 2842805378 | 2842807754 | 329 |
| 669 | 2162886007 | SwRhRL2b_contig_3565411 | SwRhRL2b_0314.00007940 | 330 |
| 670 | 3300003792 | Ga0055540_1000330 | Ga0055540_100033023 | 330 |
| 671 | 3300005288 | Ga0065714_10000038 | Ga0065714_100000381 | 330 |
| 672 | 3300005288 | Ga0065714_10003060 | Ga0065714_1000306012 | 330 |
| 673 | 3300005288 | Ga0065714_10003242 | Ga0065714_100032423 | 330 |
| 674 | 3300005288 | Ga0065714_10009002 | Ga0065714_100090022 | 330 |
| 675 | 3300005288 | Ga0065714_10009362 | Ga0065714_100093622 | 330 |
| 676 | 3300005288 | Ga0065714_10066240 | Ga0065714_100662404 | 330 |
| 677 | 3300005293 | Ga0065715_10135535 | Ga0065715_101355352 | 330 |
| 678 | 3300006048 | Ga0075363_100069823 | Ga0075363_1000698231 | 330 |
| 679 | 3300006051 | Ga0075364_10048649 | Ga0075364_100486492 | 330 |
| 680 | 3300006051 | Ga0075364_10226851 | Ga0075364_102268511 | 330 |
| 681 | 3300006051 | Ga0075364_10252974 | Ga0075364_102529741 | 330 |
| 682 | 3300006058 | Ga0075432_10006002 | Ga0075432_100060022 | 330 |
| 683 | 3300006058 | Ga0075432_10009531 | Ga0075432_100095313 | 330 |
| 684 | 3300006058 | Ga0075432_10041556 | Ga0075432_100415561 | 330 |
| 685 | 3300006058 | Ga0075432_10048138 | Ga0075432_100481381 | 330 |
| 686 | 3300006177 | Ga0075362_10036157 | Ga0075362_100361572 | 330 |
| 687 | 3300006914 | Ga0075436_100142219 | Ga0075436_1001422191 | 330 |
| 688 | 3300006914 | Ga0075436_100154198 | Ga0075436_1001541981 | 330 |
| 689 | 3300006946 | Ga0079104_1000630 | Ga0079104_100063025 | 330 |
| 690 | 3300009011 | Ga0105251_10003205 | Ga0105251_100032054 | 330 |
| 691 | 3300009011 | Ga0105251_10028517 | Ga0105251_100285173 | 330 |
| 692 | 3300009036 | Ga0105244_10002463 | Ga0105244_100024638 | 330 |
| 693 | 3300009036 | Ga0105244_10024554 | Ga0105244_100245542 | 330 |
| 694 | 3300009036 | Ga0105244_10055491 | Ga0105244_100554912 | 330 |
| 695 | 3300009092 | Ga0105250_10054437 | Ga0105250_100544372 | 330 |
| 696 | 3300009092 | Ga0105250_10057456 | Ga0105250_100574561 | 330 |
| 697 | 3300009148 | Ga0105243_10001260 | Ga0105243_1000126010 | 330 |
| 698 | 3300011119 | Ga0105246_10007251 | Ga0105246_100072517 | 330 |
| 699 | 3300013100 | Ga0157373_10009756 | Ga0157373_100097564 | 330 |
| 700 | 3300013104 | Ga0157370_10009735 | Ga0157370_100097354 | 330 |
| 701 | 3300013105 | Ga0157369_10260983 | Ga0157369_102609832 | 330 |
| 702 | 3300013306 | Ga0163162_10006109 | Ga0163162_1000610912 | 330 |
| 703 | 3300014497 | Ga0182008_10008338 | Ga0182008_100083385 | 330 |
| 704 | 3300014497 | Ga0182008_10033038 | Ga0182008_100330382 | 330 |
| 705 | 3300015261 | Ga0182006_1047730 | Ga0182006_10477302 | 330 |
| 706 | 3300015262 | Ga0182007_10002159 | Ga0182007_100021592 | 330 |
| 707 | 3300017792 | Ga0163161_10015992 | Ga0163161_100159923 | 330 |
| 708 | 3300017792 | Ga0163161_10129873 | Ga0163161_101298732 | 330 |
| 709 | 3300017792 | Ga0163161_10336882 | Ga0163161_103368821 | 330 |
| 710 | 3300025292 | Ga0209676_1001824 | Ga0209676_10018242 | 330 |
| 711 | 3300025292 | Ga0209676_1019562 | Ga0209676_10195621 | 330 |
| 712 | 3300025298 | Ga0209050_1000080 | Ga0209050_100008012 | 330 |
| 713 | 3300025298 | Ga0209050_1001281 | Ga0209050_10012815 | 330 |
| 714 | 3300025303 | Ga0209051_1000283 | Ga0209051_100028313 | 330 |
| 715 | 3300025303 | Ga0209051_1009473 | Ga0209051_10094734 | 330 |
| 716 | 3300025711 | Ga0207696_1011320 | Ga0207696_10113202 | 330 |
| 717 | 3300025728 | Ga0207655_1000606 | Ga0207655_100060618 | 330 |
| 718 | 3300025728 | Ga0207655_1022240 | Ga0207655_10222403 | 330 |
| 719 | 3300025735 | Ga0207713_1001277 | Ga0207713_100127712 | 330 |
| 720 | 3300025735 | Ga0207713_1002361 | Ga0207713_10023614 | 330 |
| 721 | 3300025735 | Ga0207713_1015282 | Ga0207713_10152821 | 330 |
| 722 | 3300025935 | Ga0207709_10000030 | Ga0207709_1000003036 | 330 |
| 723 | 3300025935 | Ga0207709_10162495 | Ga0207709_101624951 | 330 |
| 724 | 3300027111 | Ga0209281_1000070 | Ga0209281_10000708 | 330 |
| 725 | 3300027907 | Ga0207428_10004708 | Ga0207428_100047089 | 330 |
| 726 | 3300027907 | Ga0207428_10035747 | Ga0207428_100357472 | 330 |
| 727 | 3300027907 | Ga0207428_10257673 | Ga0207428_102576732 | 330 |
| 728 | 3300030733 | Ga0314311_1241414 | Ga0314311_12414145 | 330 |
| 729 | 3300031548 | Ga0307408_100003846 | Ga0307408_1000038463 | 330 |
| 730 | 3300031548 | Ga0307408_100012131 | Ga0307408_1000121312 | 330 |
| 731 | 3300031548 | Ga0307408_100027993 | Ga0307408_1000279932 | 330 |
| 732 | 3300031731 | Ga0307405_10001496 | Ga0307405_100014968 | 330 |
| 733 | 3300031731 | Ga0307405_10004726 | Ga0307405_100047265 | 330 |
| 734 | 3300031824 | Ga0307413_10022062 | Ga0307413_100220623 | 330 |
| 735 | 3300031903 | Ga0307407_10045261 | Ga0307407_100452612 | 330 |
| 736 | 3300031911 | Ga0307412_10001694 | Ga0307412_100016943 | 330 |
| 737 | 3300031911 | Ga0307412_10002511 | Ga0307412_100025117 | 330 |
| 738 | 3300031995 | Ga0307409_100029505 | Ga0307409_1000295054 | 330 |
| 739 | 3300032002 | Ga0307416_100067168 | Ga0307416_1000671681 | 330 |
| 740 | 3300032002 | Ga0307416_100441505 | Ga0307416_1004415051 | 330 |
| 741 | 3300032004 | Ga0307414_10040299 | Ga0307414_100402993 | 330 |
| 742 | 3300032004 | Ga0307414_10233692 | Ga0307414_102336922 | 330 |
| 743 | 3300038705 | Ga0237819_01552 | Ga0237819_01552_2747_3742 | 330 |
| 744 | 3300041405 | Ga0439438_000664 | Ga0439438_000664_3311_4306 | 330 |
| 745 | 3300041405 | Ga0439438_002279 | Ga0439438_002279_1088_2080 | 330 |
| 746 | 3300041405 | Ga0439438_003649 | Ga0439438_003649_1848_2840 | 330 |
| 747 | 3300041405 | Ga0439438_018796 | Ga0439438_018796_99_1160 | 330 |
| 748 | 3300041405 | Ga0439438_037973 | Ga0439438_037973_44_1036 | 330 |
| 749 | 3300041411 | Ga0439466_0012614 | Ga0439466_0012614_1314_2411 | 330 |
| 750 | 3300041411 | Ga0439466_0041948 | Ga0439466_0041948_372_1367 | 330 |
| 751 | 3300041997 | Ga0439431_0001234 | Ga0439431_0001234_3558_4550 | 330 |
| 752 | 3300042004 | Ga0439445_0003764 | Ga0439445_0003764_1346_2338 | 330 |
| 753 | 3300042004 | Ga0439445_0043772 | Ga0439445_0043772_180_1172 | 330 |
| 754 | 3300042006 | Ga0439432_001714 | Ga0439432_001714_6075_7067 | 330 |
| 755 | 3300042006 | Ga0439432_003883 | Ga0439432_003883_4269_5261 | 330 |
| 756 | 3300042009 | Ga0439451_004296 | Ga0439451_004296_308_1303 | 330 |
| 757 | 3300042009 | Ga0439451_005616 | Ga0439451_005616_342_1334 | 330 |
| 758 | 3300042010 | Ga0439452_003167 | Ga0439452_003167_2665_3657 | 330 |
| 759 | 3300042010 | Ga0439452_007740 | Ga0439452_007740_1998_2990 | 330 |
| 760 | 3300042010 | Ga0439452_015367 | Ga0439452_015367_119_1111 | 330 |
| 761 | 3300042016 | Ga0439463_009044 | Ga0439463_009044_427_1422 | 330 |
| 762 | 3300042016 | Ga0439463_010036 | Ga0439463_010036_734_1729 | 330 |
| 763 | 3300042115 | Ga0450911_000430 | Ga0450911_000430_9881_10873 | 330 |
| 764 | 3300042129 | Ga0450891_001060 | Ga0450891_001060_1032_2027 | 330 |
| 765 | 3300042137 | Ga0450902_000913 | Ga0450902_000913_2411_3403 | 330 |
| 766 | 3300042138 | Ga0450903_002728 | Ga0450903_002728_575_1567 | 330 |
| 767 | 3300042138 | Ga0450903_004965 | Ga0450903_004965_1011_2003 | 330 |
| 768 | 3300042146 | Ga0450907_000072 | Ga0450907_000072_23814_24806 | 330 |
| 769 | 3300042147 | Ga0450910_000316 | Ga0450910_000316_3613_4605 | 330 |
| 770 | 3300042147 | Ga0450910_001276 | Ga0450910_001276_801_1793 | 330 |
| 771 | 3300042156 | Ga0439446_0009363 | Ga0439446_0009363_680_1672 | 330 |
| 772 | 3300042185 | Ga0450909_001026 | Ga0450909_001026_1105_2100 | 330 |
| 773 | 3300042435 | Ga0439434_0000723 | Ga0439434_0000723_7437_8429 | 330 |
| 774 | 3300042461 | Ga0439460_0001093 | Ga0439460_0001093_4643_5635 | 330 |
| 775 | 3300042993 | Ga0439440_0006812 | Ga0439440_0006812_86_1081 | 330 |
| 776 | 3300046452 | Ga0495617_009730 | Ga0495617_009730_1351_2343 | 330 |
| 777 | 3300046452 | Ga0495617_024173 | Ga0495617_024173_26_1021 | 330 |
| 778 | 3300046452 | Ga0495617_057811 | Ga0495617_057811_160_1152 | 330 |
| 779 | 3300046453 | Ga0495627_008351 | Ga0495627_008351_1162_2154 | 330 |
| 780 | 3300046453 | Ga0495627_009226 | Ga0495627_009226_1246_2244 | 330 |
| 781 | 3300046455 | Ga0495603_0013335 | Ga0495603_0013335_403_1395 | 330 |
| 782 | 3300046455 | Ga0495603_0022915 | Ga0495603_0022915_2558_3550 | 330 |
| 783 | 3300046457 | Ga0495590_0021048 | Ga0495590_0021048_1025_2020 | 330 |
| 784 | 3300046457 | Ga0495590_0026389 | Ga0495590_0026389_559_1551 | 330 |
| 785 | 3300046457 | Ga0495590_0054438 | Ga0495590_0054438_177_1169 | 330 |
| 786 | 3300046457 | Ga0495590_0097828 | Ga0495590_0097828_27_1019 | 330 |
| 787 | 3300046458 | Ga0495591_001340 | Ga0495591_001340_1006_2028 | 330 |
| 788 | 3300046458 | Ga0495591_006673 | Ga0495591_006673_3012_4073 | 330 |
| 789 | 3300046458 | Ga0495591_013215 | Ga0495591_013215_1752_2747 | 330 |
| 790 | 3300046458 | Ga0495591_017249 | Ga0495591_017249_48_1040 | 330 |
| 791 | 3300046458 | Ga0495591_047303 | Ga0495591_047303_112_1104 | 330 |
| 792 | 3300046460 | Ga0495638_0001683 | Ga0495638_0001683_16819_17811 | 330 |
| 793 | 3300046460 | Ga0495638_0002334 | Ga0495638_0002334_13236_14228 | 330 |
| 794 | 3300046460 | Ga0495638_0009774 | Ga0495638_0009774_1061_2053 | 330 |
| 795 | 3300046460 | Ga0495638_0017812 | Ga0495638_0017812_1490_2488 | 330 |
| 796 | 3300046460 | Ga0495638_0050564 | Ga0495638_0050564_358_1350 | 330 |
| 797 | 3300046460 | Ga0495638_0055560 | Ga0495638_0055560_1296_2288 | 330 |
| 798 | 3300046460 | Ga0495638_0065783 | Ga0495638_0065783_1060_2055 | 330 |
| 799 | 3300046460 | Ga0495638_0069317 | Ga0495638_0069317_260_1252 | 330 |
| 800 | 3300046471 | Ga0495650_0020286 | Ga0495650_0020286_226_1218 | 330 |
| 801 | 3300046471 | Ga0495650_0024315 | Ga0495650_0024315_825_1820 | 330 |
| 802 | 3300046471 | Ga0495650_0025467 | Ga0495650_0025467_1036_2097 | 330 |
| 803 | 3300046471 | Ga0495650_0032894 | Ga0495650_0032894_400_1392 | 330 |
| 804 | 3300046471 | Ga0495650_0061943 | Ga0495650_0061943_48_1109 | 330 |
| 805 | 3300046474 | Ga0495605_0006707 | Ga0495605_0006707_2970_3962 | 330 |
| 806 | 3300046474 | Ga0495605_0008040 | Ga0495605_0008040_3734_4795 | 330 |
| 807 | 3300046474 | Ga0495605_0045247 | Ga0495605_0045247_1006_2067 | 330 |
| 808 | 3300046475 | Ga0495639_0026401 | Ga0495639_0026401_639_1631 | 330 |
| 809 | 3300046491 | Ga0495584_0001022 | Ga0495584_0001022_6533_7594 | 330 |
| 810 | 3300046491 | Ga0495584_0002615 | Ga0495584_0002615_7336_8328 | 330 |
| 811 | 3300046491 | Ga0495584_0002731 | Ga0495584_0002731_2183_3175 | 330 |
| 812 | 3300046491 | Ga0495584_0007358 | Ga0495584_0007358_1105_2097 | 330 |
| 813 | 3300046491 | Ga0495584_0008672 | Ga0495584_0008672_1196_2188 | 330 |
| 814 | 3300046491 | Ga0495584_0016660 | Ga0495584_0016660_2536_3597 | 330 |
| 815 | 3300046491 | Ga0495584_0025409 | Ga0495584_0025409_1834_2826 | 330 |
| 816 | 3300046492 | Ga0495585_0002284 | Ga0495585_0002284_3420_4481 | 330 |
| 817 | 3300046492 | Ga0495585_0004056 | Ga0495585_0004056_1743_2735 | 330 |
| 818 | 3300046492 | Ga0495585_0018341 | Ga0495585_0018341_2265_3257 | 330 |
| 819 | 3300046492 | Ga0495585_0018563 | Ga0495585_0018563_1215_2207 | 330 |
| 820 | 3300046492 | Ga0495585_0021363 | Ga0495585_0021363_1632_2624 | 330 |
| 821 | 3300046492 | Ga0495585_0029670 | Ga0495585_0029670_2064_3059 | 330 |
| 822 | 3300046492 | Ga0495585_0029898 | Ga0495585_0029898_1061_2056 | 330 |
| 823 | 3300046499 | Ga0495594_0014825 | Ga0495594_0014825_1132_2124 | 330 |
| 824 | 3300046500 | Ga0495596_0000258 | Ga0495596_0000258_26237_27229 | 330 |
| 825 | 3300046501 | Ga0495607_0010191 | Ga0495607_0010191_1052_2044 | 330 |
| 826 | 3300046501 | Ga0495607_0011992 | Ga0495607_0011992_1980_2972 | 330 |
| 827 | 3300046501 | Ga0495607_0019454 | Ga0495607_0019454_2192_3253 | 330 |
| 828 | 3300046501 | Ga0495607_0028980 | Ga0495607_0028980_1264_2256 | 330 |
| 829 | 3300046501 | Ga0495607_0030074 | Ga0495607_0030074_1286_2281 | 330 |
| 830 | 3300046501 | Ga0495607_0072180 | Ga0495607_0072180_47_1039 | 330 |
| 831 | 3300046506 | Ga0495583_0003679 | Ga0495583_0003679_4984_5976 | 330 |
| 832 | 3300046506 | Ga0495583_0004019 | Ga0495583_0004019_910_1971 | 330 |
| 833 | 3300046506 | Ga0495583_0020631 | Ga0495583_0020631_99_1160 | 330 |
| 834 | 3300046507 | Ga0495606_0003121 | Ga0495606_0003121_14940_15932 | 330 |
| 835 | 3300046507 | Ga0495606_0016163 | Ga0495606_0016163_2277_3269 | 330 |
| 836 | 3300046507 | Ga0495606_0029257 | Ga0495606_0029257_1818_2810 | 330 |
| 837 | 3300046507 | Ga0495606_0037025 | Ga0495606_0037025_1432_2427 | 330 |
| 838 | 3300046507 | Ga0495606_0086836 | Ga0495606_0086836_25_1017 | 330 |
| 839 | 3300046512 | Ga0495610_0005434 | Ga0495610_0005434_7069_8061 | 330 |
| 840 | 3300046512 | Ga0495610_0008280 | Ga0495610_0008280_1776_2837 | 330 |
| 841 | 3300046512 | Ga0495610_0016961 | Ga0495610_0016961_1591_2652 | 330 |
| 842 | 3300046512 | Ga0495610_0036876 | Ga0495610_0036876_1442_2434 | 330 |
| 843 | 3300046512 | Ga0495610_0050948 | Ga0495610_0050948_729_1724 | 330 |
| 844 | 3300046512 | Ga0495610_0087962 | Ga0495610_0087962_402_1394 | 330 |
| 845 | 3300046513 | Ga0495616_0029294 | Ga0495616_0029294_1126_2118 | 330 |
| 846 | 3300046515 | Ga0495620_0003116 | Ga0495620_0003116_974_1966 | 330 |
| 847 | 3300046515 | Ga0495620_0003383 | Ga0495620_0003383_2451_3512 | 330 |
| 848 | 3300046515 | Ga0495620_0008667 | Ga0495620_0008667_559_1554 | 330 |
| 849 | 3300046515 | Ga0495620_0018238 | Ga0495620_0018238_1057_2049 | 330 |
| 850 | 3300046516 | Ga0495628_0084739 | Ga0495628_0084739_499_1560 | 330 |
| 851 | 3300046517 | Ga0495630_0053569 | Ga0495630_0053569_645_1649 | 330 |
| 852 | 3300046518 | Ga0495631_0000301 | Ga0495631_0000301_23699_24694 | 330 |
| 853 | 3300046519 | Ga0495632_0002319 | Ga0495632_0002319_10313_11305 | 330 |
| 854 | 3300046519 | Ga0495632_0005110 | Ga0495632_0005110_6704_7696 | 330 |
| 855 | 3300046519 | Ga0495632_0010772 | Ga0495632_0010772_812_1804 | 330 |
| 856 | 3300046519 | Ga0495632_0019715 | Ga0495632_0019715_92_1153 | 330 |
| 857 | 3300046519 | Ga0495632_0019792 | Ga0495632_0019792_1302_2294 | 330 |
| 858 | 3300046519 | Ga0495632_0025849 | Ga0495632_0025849_1286_2347 | 330 |
| 859 | 3300046519 | Ga0495632_0080337 | Ga0495632_0080337_462_1454 | 330 |
| 860 | 3300046520 | Ga0495637_0001157 | Ga0495637_0001157_10043_11035 | 330 |
| 861 | 3300046520 | Ga0495637_0002437 | Ga0495637_0002437_2958_4019 | 330 |
| 862 | 3300046520 | Ga0495637_0005249 | Ga0495637_0005249_4334_5326 | 330 |
| 863 | 3300046520 | Ga0495637_0013453 | Ga0495637_0013453_269_1261 | 330 |
| 864 | 3300046520 | Ga0495637_0033802 | Ga0495637_0033802_716_1777 | 330 |
| 865 | 3300046522 | Ga0495643_0003119 | Ga0495643_0003119_5522_6526 | 330 |
| 866 | 3300046522 | Ga0495643_0009387 | Ga0495643_0009387_5020_6012 | 330 |
| 867 | 3300046522 | Ga0495643_0034632 | Ga0495643_0034632_1108_2100 | 330 |
| 868 | 3300046522 | Ga0495643_0072054 | Ga0495643_0072054_57_1049 | 330 |
| 869 | 3300046522 | Ga0495643_0089248 | Ga0495643_0089248_334_1326 | 330 |
| 870 | 3300046522 | Ga0495643_0116627 | Ga0495643_0116627_245_1237 | 330 |
| 871 | 3300046523 | Ga0495644_0000435 | Ga0495644_0000435_14611_15603 | 330 |
| 872 | 3300046523 | Ga0495644_0005727 | Ga0495644_0005727_1020_2012 | 330 |
| 873 | 3300046523 | Ga0495644_0042287 | Ga0495644_0042287_513_1505 | 330 |
| 874 | 3300046523 | Ga0495644_0044230 | Ga0495644_0044230_140_1132 | 330 |
| 875 | 3300046524 | Ga0495648_0001399 | Ga0495648_0001399_20534_21526 | 330 |
| 876 | 3300046524 | Ga0495648_0002835 | Ga0495648_0002835_13585_14607 | 330 |
| 877 | 3300046524 | Ga0495648_0004621 | Ga0495648_0004621_9855_10850 | 330 |
| 878 | 3300046524 | Ga0495648_0017334 | Ga0495648_0017334_1846_2838 | 330 |
| 879 | 3300046524 | Ga0495648_0033183 | Ga0495648_0033183_928_1920 | 330 |
| 880 | 3300046524 | Ga0495648_0053886 | Ga0495648_0053886_656_1648 | 330 |
| 881 | 3300046524 | Ga0495648_0054461 | Ga0495648_0054461_39_1031 | 330 |
| 882 | 3300046524 | Ga0495648_0067575 | Ga0495648_0067575_1031_2023 | 330 |
| 883 | 3300046526 | Ga0495666_0001767 | Ga0495666_0001767_2697_3701 | 330 |
| 884 | 3300046526 | Ga0495666_0072526 | Ga0495666_0072526_183_1175 | 330 |
| 885 | 3300046528 | Ga0495642_0001272 | Ga0495642_0001272_6861_7853 | 330 |
| 886 | 3300046529 | Ga0495652_0197024 | Ga0495652_0197024_376_1437 | 330 |
| 887 | 3300046530 | Ga0495654_0002021 | Ga0495654_0002021_11124_12185 | 330 |
| 888 | 3300046530 | Ga0495654_0002230 | Ga0495654_0002230_2575_3636 | 330 |
| 889 | 3300046530 | Ga0495654_0002688 | Ga0495654_0002688_1200_2192 | 330 |
| 890 | 3300046530 | Ga0495654_0007101 | Ga0495654_0007101_1872_2933 | 330 |
| 891 | 3300046530 | Ga0495654_0015080 | Ga0495654_0015080_2177_3172 | 330 |
| 892 | 3300046530 | Ga0495654_0017495 | Ga0495654_0017495_2547_3539 | 330 |
| 893 | 3300046530 | Ga0495654_0024005 | Ga0495654_0024005_1257_2249 | 330 |
| 894 | 3300046530 | Ga0495654_0025738 | Ga0495654_0025738_1824_2819 | 330 |
| 895 | 3300046530 | Ga0495654_0128220 | Ga0495654_0128220_93_1085 | 330 |
| 896 | 3300046538 | Ga0495609_0005704 | Ga0495609_0005704_2150_3142 | 330 |
| 897 | 3300046538 | Ga0495609_0013823 | Ga0495609_0013823_949_1944 | 330 |
| 898 | 3300046538 | Ga0495609_0028030 | Ga0495609_0028030_304_1296 | 330 |
| 899 | 3300046538 | Ga0495609_0090349 | Ga0495609_0090349_156_1148 | 330 |
| 900 | 3300046542 | Ga0495597_0003971 | Ga0495597_0003971_1473_2465 | 330 |
| 901 | 3300046542 | Ga0495597_0007943 | Ga0495597_0007943_173_1165 | 330 |
| 902 | 3300046542 | Ga0495597_0015657 | Ga0495597_0015657_1217_2209 | 330 |
| 903 | 3300046542 | Ga0495597_0024255 | Ga0495597_0024255_438_1430 | 330 |
| 904 | 3300046542 | Ga0495597_0029202 | Ga0495597_0029202_64_1125 | 330 |
| 905 | 3300046557 | Ga0495622_0001599 | Ga0495622_0001599_1698_2690 | 330 |
| 906 | 3300046557 | Ga0495622_0014791 | Ga0495622_0014791_1599_2660 | 330 |
| 907 | 3300046557 | Ga0495622_0024495 | Ga0495622_0024495_483_1478 | 330 |
| 908 | 3300046558 | Ga0495633_0003687 | Ga0495633_0003687_995_1990 | 330 |
| 909 | 3300046558 | Ga0495633_0011800 | Ga0495633_0011800_898_1890 | 330 |
| 910 | 3300046615 | Ga0495656_0032376 | Ga0495656_0032376_895_1887 | 330 |
| 911 | 3300046616 | Ga0495668_0001154 | Ga0495668_0001154_23328_24320 | 330 |
| 912 | 3300046642 | Ga0495634_0001466 | Ga0495634_0001466_9493_10554 | 330 |
| 913 | 3300046648 | Ga0495611_0107485 | Ga0495611_0107485_196_1188 | 330 |
| 914 | 3300046660 | Ga0495625_0015872 | Ga0495625_0015872_2276_3268 | 330 |
| 915 | 3300046660 | Ga0495625_0021504 | Ga0495625_0021504_1060_2052 | 330 |
| 916 | 3300046660 | Ga0495625_0022530 | Ga0495625_0022530_1010_2002 | 330 |
| 917 | 3300046660 | Ga0495625_0033920 | Ga0495625_0033920_2157_3152 | 330 |
| 918 | 3300046660 | Ga0495625_0049075 | Ga0495625_0049075_610_1608 | 330 |
| 919 | 3300046660 | Ga0495625_0102823 | Ga0495625_0102823_922_1914 | 330 |
| 920 | 3300046663 | Ga0495635_0002238 | Ga0495635_0002238_6904_7965 | 330 |
| 921 | 3300046664 | Ga0495659_0016120 | Ga0495659_0016120_1397_2389 | 330 |
| 922 | 3300046665 | Ga0495661_0007218 | Ga0495661_0007218_1408_2400 | 330 |
| 923 | 3300046665 | Ga0495661_0022886 | Ga0495661_0022886_1823_2815 | 330 |
| 924 | 3300046665 | Ga0495661_0030712 | Ga0495661_0030712_2182_3177 | 330 |
| 925 | 3300046665 | Ga0495661_0055110 | Ga0495661_0055110_1179_2171 | 330 |
| 926 | 3300046665 | Ga0495661_0082495 | Ga0495661_0082495_334_1326 | 330 |
| 927 | 3300046674 | Ga0495588_0003323 | Ga0495588_0003323_1069_2061 | 330 |
| 928 | 3300046674 | Ga0495588_0019297 | Ga0495588_0019297_880_1941 | 330 |
| 929 | 3300046679 | Ga0495623_0004189 | Ga0495623_0004189_2660_3664 | 330 |
| 930 | 3300046679 | Ga0495623_0004713 | Ga0495623_0004713_6962_8023 | 330 |
| 931 | 3300046684 | Ga0495669_0010530 | Ga0495669_0010530_2006_2998 | 330 |
| 932 | 3300046684 | Ga0495669_0145122 | Ga0495669_0145122_45_1037 | 330 |
| 933 | 3300046689 | Ga0495613_0071124 | Ga0495613_0071124_1265_2260 | 330 |
| 934 | 3300046689 | Ga0495613_0083022 | Ga0495613_0083022_1126_2187 | 330 |
| 935 | 3300046691 | Ga0495670_0002629 | Ga0495670_0002629_6453_7445 | 330 |
| 936 | 3300046691 | Ga0495670_0004839 | Ga0495670_0004839_4835_5827 | 330 |
| 937 | 3300046691 | Ga0495670_0016890 | Ga0495670_0016890_1288_2280 | 330 |
| 938 | 3300046691 | Ga0495670_0021416 | Ga0495670_0021416_961_1953 | 330 |
| 939 | 3300046691 | Ga0495670_0022514 | Ga0495670_0022514_1060_2121 | 330 |
| 940 | 3300046691 | Ga0495670_0025347 | Ga0495670_0025347_1874_2869 | 330 |
| 941 | 3300046692 | Ga0495671_0003889 | Ga0495671_0003889_1452_2444 | 330 |
| 942 | 3300046692 | Ga0495671_0004103 | Ga0495671_0004103_2535_3539 | 330 |
| 943 | 3300046692 | Ga0495671_0005223 | Ga0495671_0005223_3790_4782 | 330 |
| 944 | 3300046692 | Ga0495671_0017297 | Ga0495671_0017297_2145_3140 | 330 |
| 945 | 3300046692 | Ga0495671_0023241 | Ga0495671_0023241_1121_2113 | 330 |
| 946 | 3300046692 | Ga0495671_0028553 | Ga0495671_0028553_939_1931 | 330 |
| 947 | 3300046692 | Ga0495671_0029486 | Ga0495671_0029486_1371_2432 | 330 |
| 948 | 3300046692 | Ga0495671_0037621 | Ga0495671_0037621_1040_2101 | 330 |
| 949 | 3300046694 | Ga0495649_0000531 | Ga0495649_0000531_3372_4385 | 330 |
| 950 | 3300046694 | Ga0495649_0003556 | Ga0495649_0003556_1338_2330 | 330 |
| 951 | 3300046694 | Ga0495649_0044468 | Ga0495649_0044468_233_1228 | 330 |
| 952 | 3300046794 | Ga0495589_0002934 | Ga0495589_0002934_6759_7751 | 330 |
| 953 | 3300046794 | Ga0495589_0004279 | Ga0495589_0004279_5426_6418 | 330 |
| 954 | 3300046794 | Ga0495589_0007874 | Ga0495589_0007874_3622_4614 | 330 |
| 955 | 3300046810 | Ga0495660_0007016 | Ga0495660_0007016_2515_3507 | 330 |
| 956 | 3300046810 | Ga0495660_0008194 | Ga0495660_0008194_1451_2443 | 330 |
| 957 | 3300046810 | Ga0495660_0024188 | Ga0495660_0024188_311_1303 | 330 |
| 958 | 3300046810 | Ga0495660_0044810 | Ga0495660_0044810_175_1167 | 330 |
| 959 | 3300046810 | Ga0495660_0050853 | Ga0495660_0050853_21_1013 | 330 |
| 960 | 3300046810 | Ga0495660_0116684 | Ga0495660_0116684_346_1338 | 330 |
| 961 | 3300047317 | Ga0495604_0102845 | Ga0495604_0102845_380_1441 | 330 |
| 962 | 3300047319 | Ga0495674_0035068 | Ga0495674_0035068_2533_3594 | 330 |
| 963 | 3300047320 | Ga0495672_0002485 | Ga0495672_0002485_2665_3657 | 330 |
| 964 | 3300047320 | Ga0495672_0005106 | Ga0495672_0005106_8250_9242 | 330 |
| 965 | 3300047320 | Ga0495672_0007026 | Ga0495672_0007026_106_1098 | 330 |
| 966 | 3300047322 | Ga0495680_0008523 | Ga0495680_0008523_7236_8297 | 330 |
| 967 | 3300047322 | Ga0495680_0075232 | Ga0495680_0075232_1448_2440 | 330 |
| 968 | 3300047322 | Ga0495680_0101711 | Ga0495680_0101711_802_1806 | 330 |
| 969 | 3300047322 | Ga0495680_0110751 | Ga0495680_0110751_919_1911 | 330 |
| 970 | 3300047323 | Ga0495683_0000404 | Ga0495683_0000404_9971_10966 | 330 |
| 971 | 3300047323 | Ga0495683_0002209 | Ga0495683_0002209_9206_10198 | 330 |
| 972 | 3300047323 | Ga0495683_0003381 | Ga0495683_0003381_1626_2618 | 330 |
| 973 | 3300047323 | Ga0495683_0004998 | Ga0495683_0004998_1201_2193 | 330 |
| 974 | 3300047323 | Ga0495683_0013677 | Ga0495683_0013677_976_1968 | 330 |
| 975 | 3300047323 | Ga0495683_0027770 | Ga0495683_0027770_1624_2616 | 330 |
| 976 | 3300047323 | Ga0495683_0050597 | Ga0495683_0050597_855_1847 | 330 |
| 977 | 3300047443 | Ga0495687_004248 | Ga0495687_004248_6158_7150 | 330 |
| 978 | 3300047445 | Ga0495677_0006133 | Ga0495677_0006133_2625_3617 | 330 |
| 979 | 3300047446 | Ga0495679_001913 | Ga0495679_001913_317_1309 | 330 |
| 980 | 3300047446 | Ga0495679_009858 | Ga0495679_009858_979_2040 | 330 |
| 981 | 3300047446 | Ga0495679_044514 | Ga0495679_044514_296_1288 | 330 |
| 982 | 3300047447 | Ga0495685_014424 | Ga0495685_014424_1500_2492 | 330 |
| 983 | 3300047469 | Ga0495673_0000630 | Ga0495673_0000630_10019_11014 | 330 |
| 984 | 3300047469 | Ga0495673_0002541 | Ga0495673_0002541_9630_10622 | 330 |
| 985 | 3300047469 | Ga0495673_0002605 | Ga0495673_0002605_1864_2856 | 330 |
| 986 | 3300047469 | Ga0495673_0003118 | Ga0495673_0003118_1228_2289 | 330 |
| 987 | 3300047469 | Ga0495673_0004279 | Ga0495673_0004279_103_1095 | 330 |
| 988 | 3300047469 | Ga0495673_0009955 | Ga0495673_0009955_2006_2998 | 330 |
| 989 | 3300047469 | Ga0495673_0018677 | Ga0495673_0018677_1337_2329 | 330 |
| 990 | 3300047469 | Ga0495673_0036871 | Ga0495673_0036871_912_1904 | 330 |
| 991 | 3300047469 | Ga0495673_0037835 | Ga0495673_0037835_1095_2156 | 330 |
| 992 | 3300047470 | Ga0495681_0001632 | Ga0495681_0001632_1035_2027 | 330 |
| 993 | 3300047470 | Ga0495681_0003540 | Ga0495681_0003540_2000_2992 | 330 |
| 994 | 3300047470 | Ga0495681_0008566 | Ga0495681_0008566_3009_4001 | 330 |
| 995 | 3300047470 | Ga0495681_0009988 | Ga0495681_0009988_4120_5112 | 330 |
| 996 | 3300047470 | Ga0495681_0013630 | Ga0495681_0013630_1175_2179 | 330 |
| 997 | 3300047470 | Ga0495681_0028928 | Ga0495681_0028928_1443_2504 | 330 |
| 998 | 3300047470 | Ga0495681_0036765 | Ga0495681_0036765_560_1552 | 330 |
| 999 | 3300047470 | Ga0495681_0038780 | Ga0495681_0038780_1259_2254 | 330 |
| 1000 | 3300047470 | Ga0495681_0112740 | Ga0495681_0112740_77_1069 | 330 |
| 1001 | 3300047472 | Ga0495686_0010976 | Ga0495686_0010976_1352_2413 | 330 |
| 1002 | 3300047472 | Ga0495686_0011965 | Ga0495686_0011965_606_1787 | 330 |
| 1003 | 3300047472 | Ga0495686_0027359 | Ga0495686_0027359_1402_2394 | 330 |
| 1004 | 3300047673 | Ga0495593_0026921 | Ga0495593_0026921_1994_2986 | 330 |
| 1005 | 3300047673 | Ga0495593_0036628 | Ga0495593_0036628_217_1221 | 330 |
| 1006 | 3300048089 | Ga0495614_0142311 | Ga0495614_0142311_11_1003 | 330 |
| 1007 | 3300048091 | Ga0495626_0000898 | Ga0495626_0000898_1427_2419 | 330 |
| 1008 | 3300048091 | Ga0495626_0001022 | Ga0495626_0001022_888_1880 | 330 |
| 1009 | 3300048091 | Ga0495626_0001131 | Ga0495626_0001131_17896_18957 | 330 |
| 1010 | 3300048091 | Ga0495626_0004441 | Ga0495626_0004441_2578_3639 | 330 |
| 1011 | 3300048091 | Ga0495626_0008164 | Ga0495626_0008164_2150_3142 | 330 |
| 1012 | 3300048905 | Ga0496102_0001175 | Ga0496102_0001175_12363_13424 | 330 |
| 1013 | 3300048906 | Ga0496103_0003037 | Ga0496103_0003037_2392_3453 | 330 |
| 1014 | 3300048908 | Ga0496105_0091246 | Ga0496105_0091246_357_1352 | 330 |
| 1015 | 3300048913 | Ga0496110_0058691 | Ga0496110_0058691_2086_3078 | 330 |
| 1016 | 3300048913 | Ga0496110_0128829 | Ga0496110_0128829_136_1128 | 330 |
| 1017 | 3300048913 | Ga0496110_0311611 | Ga0496110_0311611_231_1223 | 330 |
| 1018 | 3300048916 | Ga0496113_0096944 | Ga0496113_0096944_26_1018 | 330 |
| 1019 | 3300048919 | Ga0496116_0057764 | Ga0496116_0057764_1384_2445 | 330 |
| 1020 | 3300048920 | Ga0496117_0058271 | Ga0496117_0058271_1564_2556 | 330 |
| 1021 | 3300048920 | Ga0496117_0078529 | Ga0496117_0078529_98_1159 | 330 |
| 1022 | 3300048920 | Ga0496117_0107255 | Ga0496117_0107255_419_1414 | 330 |
| 1023 | 3300048921 | Ga0496118_0010626 | Ga0496118_0010626_7009_8070 | 330 |
| 1024 | 3300048924 | Ga0496121_0079537 | Ga0496121_0079537_1385_2380 | 330 |
| 1025 | 3300048927 | Ga0496124_0000942 | Ga0496124_0000942_26869_27861 | 330 |
| 1026 | 3300048927 | Ga0496124_0039719 | Ga0496124_0039719_501_1493 | 330 |
| 1027 | 3300048927 | Ga0496124_0206520 | Ga0496124_0206520_370_1362 | 330 |
| 1028 | 3300048928 | Ga0496125_0044073 | Ga0496125_0044073_1907_2902 | 330 |
| 1029 | 3300049459 | Ga0495678_011718 | Ga0495678_011718_1375_2367 | 330 |
| 1030 | 3300049459 | Ga0495678_012614 | Ga0495678_012614_1073_2065 | 330 |
| 1031 | 3300049459 | Ga0495678_015502 | Ga0495678_015502_419_1480 | 330 |
| 1032 | 3300049459 | Ga0495678_020149 | Ga0495678_020149_778_1770 | 330 |
| 1033 | 3300049459 | Ga0495678_020596 | Ga0495678_020596_1390_2382 | 330 |
| 1034 | 3300049460 | Ga0495682_0001116 | Ga0495682_0001116_8747_9739 | 330 |
| 1035 | 3300049460 | Ga0495682_0002657 | Ga0495682_0002657_6121_7113 | 330 |
| 1036 | 3300049460 | Ga0495682_0061707 | Ga0495682_0061707_166_1230 | 330 |
| 1037 | 3300049662 | Ga0501222_001192 | Ga0501222_001192_2453_3448 | 330 |
| 1038 | 3300049766 | Ga0501269_001103 | Ga0501269_001103_2552_3553 | 330 |
| 1039 | 3300049766 | Ga0501269_005778 | Ga0501269_005778_413_1453 | 330 |
| 1040 | 3300049853 | Ga0501226_000307 | Ga0501226_000307_6214_7209 | 330 |
| 1041 | 3300050489 | nmdc:mga03683_58397_c1 | nmdc:mga03683_58397_c1_528_1520 | 330 |
| 1042 | 3300050491 | nmdc:mga00v17_56393_c1 | nmdc:mga00v17_56393_c1_1138_2199 | 330 |
| 1043 | 3300050514 | nmdc:mga08x19_81902_c1 | nmdc:mga08x19_81902_c1_148_1140 | 330 |
| 1044 | iso_pu_bacteria | 2738543020 | 2739286128 | 330 |
| 1045 | iso_pu_bacteria | 2738543021 | 2739291441 | 330 |
| 1046 | 2124908027 | MRS2a_Contig_518 | MRS2a_00398930 | 331 |
| 1047 | 3300003781 | Ga0055536_1000343 | Ga0055536_100034310 | 331 |
| 1048 | 3300003791 | Ga0055530_10000488 | Ga0055530_1000048817 | 331 |
| 1049 | 3300003792 | Ga0055540_1001256 | Ga0055540_10012567 | 331 |
| 1050 | 3300005288 | Ga0065714_10001531 | Ga0065714_100015315 | 331 |
| 1051 | 3300006058 | Ga0075432_10029812 | Ga0075432_100298122 | 331 |
| 1052 | 3300009036 | Ga0105244_10004721 | Ga0105244_100047217 | 331 |
| 1053 | 3300013104 | Ga0157370_10066492 | Ga0157370_100664922 | 331 |
| 1054 | 3300015261 | Ga0182006_1001440 | Ga0182006_100144010 | 331 |
| 1055 | 3300015262 | Ga0182007_10000322 | Ga0182007_1000032221 | 331 |
| 1056 | 3300015265 | Ga0182005_1000792 | Ga0182005_10007923 | 331 |
| 1057 | 3300025292 | Ga0209676_1000337 | Ga0209676_100033769 | 331 |
| 1058 | 3300025298 | Ga0209050_1000106 | Ga0209050_100010617 | 331 |
| 1059 | 3300025303 | Ga0209051_1000260 | Ga0209051_100026068 | 331 |
| 1060 | 3300025728 | Ga0207655_1002582 | Ga0207655_100258212 | 331 |
| 1061 | 3300041411 | Ga0439466_0000291 | Ga0439466_0000291_4003_5010 | 331 |
| 1062 | 3300041411 | Ga0439466_0005494 | Ga0439466_0005494_1269_2276 | 331 |
| 1063 | 3300041411 | Ga0439466_0017160 | Ga0439466_0017160_938_1933 | 331 |
| 1064 | 3300041411 | Ga0439466_0025698 | Ga0439466_0025698_81_1076 | 331 |
| 1065 | 3300041413 | Ga0439465_0008239 | Ga0439465_0008239_1004_1999 | 331 |
| 1066 | 3300042006 | Ga0439432_000876 | Ga0439432_000876_7890_8885 | 331 |
| 1067 | 3300042006 | Ga0439432_012408 | Ga0439432_012408_1169_2164 | 331 |
| 1068 | 3300042006 | Ga0439432_034886 | Ga0439432_034886_561_1568 | 331 |
| 1069 | 3300042009 | Ga0439451_000177 | Ga0439451_000177_1085_2080 | 331 |
| 1070 | 3300042009 | Ga0439451_001319 | Ga0439451_001319_2230_3237 | 331 |
| 1071 | 3300042009 | Ga0439451_001576 | Ga0439451_001576_1610_2605 | 331 |
| 1072 | 3300042010 | Ga0439452_002607 | Ga0439452_002607_822_1886 | 331 |
| 1073 | 3300042010 | Ga0439452_007701 | Ga0439452_007701_1568_2563 | 331 |
| 1074 | 3300042013 | Ga0439456_003530 | Ga0439456_003530_2056_3051 | 331 |
| 1075 | 3300042121 | Ga0450919_000434 | Ga0450919_000434_134_1129 | 331 |
| 1076 | 3300042127 | Ga0450890_003305 | Ga0450890_003305_1100_2095 | 331 |
| 1077 | 3300042130 | Ga0450892_001574 | Ga0450892_001574_107_1102 | 331 |
| 1078 | 3300042145 | Ga0450906_000483 | Ga0450906_000483_437_1432 | 331 |
| 1079 | 3300042146 | Ga0450907_004466 | Ga0450907_004466_269_1264 | 331 |
| 1080 | 3300042156 | Ga0439446_0000897 | Ga0439446_0000897_4661_5656 | 331 |
| 1081 | 3300042461 | Ga0439460_0001063 | Ga0439460_0001063_1919_2914 | 331 |
| 1082 | 3300042532 | Ga0450893_0006817 | Ga0450893_0006817_719_1714 | 331 |
| 1083 | 3300046452 | Ga0495617_000462 | Ga0495617_000462_990_1985 | 331 |
| 1084 | 3300046457 | Ga0495590_0000867 | Ga0495590_0000867_994_1989 | 331 |
| 1085 | 3300046459 | Ga0495629_0006436 | Ga0495629_0006436_6238_7233 | 331 |
| 1086 | 3300046460 | Ga0495638_0008406 | Ga0495638_0008406_2312_3307 | 331 |
| 1087 | 3300046463 | Ga0495653_0011948 | Ga0495653_0011948_3565_4560 | 331 |
| 1088 | 3300046471 | Ga0495650_0004627 | Ga0495650_0004627_8278_9273 | 331 |
| 1089 | 3300046474 | Ga0495605_0000066 | Ga0495605_0000066_116173_117171 | 331 |
| 1090 | 3300046474 | Ga0495605_0018150 | Ga0495605_0018150_1783_2778 | 331 |
| 1091 | 3300046474 | Ga0495605_0041010 | Ga0495605_0041010_1203_2198 | 331 |
| 1092 | 3300046475 | Ga0495639_0000248 | Ga0495639_0000248_1030_2025 | 331 |
| 1093 | 3300046475 | Ga0495639_0002510 | Ga0495639_0002510_6103_7098 | 331 |
| 1094 | 3300046491 | Ga0495584_0000444 | Ga0495584_0000444_14762_15757 | 331 |
| 1095 | 3300046492 | Ga0495585_0116148 | Ga0495585_0116148_332_1327 | 331 |
| 1096 | 3300046499 | Ga0495594_0013133 | Ga0495594_0013133_2257_3252 | 331 |
| 1097 | 3300046499 | Ga0495594_0022581 | Ga0495594_0022581_1479_2474 | 331 |
| 1098 | 3300046501 | Ga0495607_0002606 | Ga0495607_0002606_2629_3624 | 331 |
| 1099 | 3300046506 | Ga0495583_0005532 | Ga0495583_0005532_6529_7524 | 331 |
| 1100 | 3300046515 | Ga0495620_0005409 | Ga0495620_0005409_4958_5965 | 331 |
| 1101 | 3300046517 | Ga0495630_0066109 | Ga0495630_0066109_362_1357 | 331 |
| 1102 | 3300046518 | Ga0495631_0020987 | Ga0495631_0020987_78_1073 | 331 |
| 1103 | 3300046519 | Ga0495632_0002576 | Ga0495632_0002576_1030_2025 | 331 |
| 1104 | 3300046520 | Ga0495637_0000992 | Ga0495637_0000992_1089_2084 | 331 |
| 1105 | 3300046520 | Ga0495637_0037830 | Ga0495637_0037830_334_1341 | 331 |
| 1106 | 3300046520 | Ga0495637_0082043 | Ga0495637_0082043_205_1200 | 331 |
| 1107 | 3300046524 | Ga0495648_0063355 | Ga0495648_0063355_880_1944 | 331 |
| 1108 | 3300046526 | Ga0495666_0007644 | Ga0495666_0007644_3574_4569 | 331 |
| 1109 | 3300046526 | Ga0495666_0030167 | Ga0495666_0030167_265_1260 | 331 |
| 1110 | 3300046528 | Ga0495642_0001027 | Ga0495642_0001027_1002_1997 | 331 |
| 1111 | 3300046535 | Ga0495586_0018212 | Ga0495586_0018212_1758_2753 | 331 |
| 1112 | 3300046536 | Ga0495587_0004236 | Ga0495587_0004236_3600_4595 | 331 |
| 1113 | 3300046538 | Ga0495609_0000125 | Ga0495609_0000125_67465_68463 | 331 |
| 1114 | 3300046538 | Ga0495609_0001565 | Ga0495609_0001565_4769_5764 | 331 |
| 1115 | 3300046542 | Ga0495597_0003287 | Ga0495597_0003287_1183_2247 | 331 |
| 1116 | 3300046543 | Ga0495645_0058681 | Ga0495645_0058681_437_1432 | 331 |
| 1117 | 3300046557 | Ga0495622_0000572 | Ga0495622_0000572_20048_21043 | 331 |
| 1118 | 3300046557 | Ga0495622_0013240 | Ga0495622_0013240_2106_3113 | 331 |
| 1119 | 3300046557 | Ga0495622_0097163 | Ga0495622_0097163_148_1143 | 331 |
| 1120 | 3300046558 | Ga0495633_0031028 | Ga0495633_0031028_67_1062 | 331 |
| 1121 | 3300046648 | Ga0495611_0001585 | Ga0495611_0001585_801_1796 | 331 |
| 1122 | 3300046660 | Ga0495625_0042587 | Ga0495625_0042587_42_1037 | 331 |
| 1123 | 3300046663 | Ga0495635_0004282 | Ga0495635_0004282_5314_6309 | 331 |
| 1124 | 3300046664 | Ga0495659_0000153 | Ga0495659_0000153_8446_9441 | 331 |
| 1125 | 3300046664 | Ga0495659_0001521 | Ga0495659_0001521_933_1928 | 331 |
| 1126 | 3300046664 | Ga0495659_0033436 | Ga0495659_0033436_99_1094 | 331 |
| 1127 | 3300046665 | Ga0495661_0020482 | Ga0495661_0020482_706_1701 | 331 |
| 1128 | 3300046689 | Ga0495613_0012696 | Ga0495613_0012696_1379_2374 | 331 |
| 1129 | 3300046691 | Ga0495670_0001825 | Ga0495670_0001825_8401_9396 | 331 |
| 1130 | 3300046691 | Ga0495670_0037300 | Ga0495670_0037300_33_1028 | 331 |
| 1131 | 3300046692 | Ga0495671_0000336 | Ga0495671_0000336_16488_17483 | 331 |
| 1132 | 3300046694 | Ga0495649_0001947 | Ga0495649_0001947_8962_9957 | 331 |
| 1133 | 3300046694 | Ga0495649_0004717 | Ga0495649_0004717_1019_2014 | 331 |
| 1134 | 3300046794 | Ga0495589_0001641 | Ga0495589_0001641_925_1989 | 331 |
| 1135 | 3300046794 | Ga0495589_0002488 | Ga0495589_0002488_1014_2009 | 331 |
| 1136 | 3300046809 | Ga0495600_0003159 | Ga0495600_0003159_3753_4748 | 331 |
| 1137 | 3300046810 | Ga0495660_0089736 | Ga0495660_0089736_362_1369 | 331 |
| 1138 | 3300047315 | Ga0495581_0004486 | Ga0495581_0004486_983_1978 | 331 |
| 1139 | 3300047315 | Ga0495581_0051731 | Ga0495581_0051731_1081_2076 | 331 |
| 1140 | 3300047317 | Ga0495604_0008037 | Ga0495604_0008037_3294_4289 | 331 |
| 1141 | 3300047318 | Ga0495636_0011816 | Ga0495636_0011816_1750_2745 | 331 |
| 1142 | 3300047320 | Ga0495672_0001518 | Ga0495672_0001518_11889_12884 | 331 |
| 1143 | 3300047320 | Ga0495672_0002877 | Ga0495672_0002877_3360_4355 | 331 |
| 1144 | 3300047320 | Ga0495672_0004292 | Ga0495672_0004292_3969_4970 | 331 |
| 1145 | 3300047322 | Ga0495680_0007966 | Ga0495680_0007966_3247_4242 | 331 |
| 1146 | 3300047323 | Ga0495683_0019241 | Ga0495683_0019241_1685_2680 | 331 |
| 1147 | 3300047323 | Ga0495683_0042183 | Ga0495683_0042183_11_1006 | 331 |
| 1148 | 3300047443 | Ga0495687_002981 | Ga0495687_002981_997_1992 | 331 |
| 1149 | 3300047443 | Ga0495687_015391 | Ga0495687_015391_1020_2015 | 331 |
| 1150 | 3300047447 | Ga0495685_014319 | Ga0495685_014319_733_1728 | 331 |
| 1151 | 3300047469 | Ga0495673_0000543 | Ga0495673_0000543_5208_6215 | 331 |
| 1152 | 3300047469 | Ga0495673_0002490 | Ga0495673_0002490_1005_2000 | 331 |
| 1153 | 3300047469 | Ga0495673_0008994 | Ga0495673_0008994_2857_3855 | 331 |
| 1154 | 3300047469 | Ga0495673_0051799 | Ga0495673_0051799_662_1732 | 331 |
| 1155 | 3300047470 | Ga0495681_0002028 | Ga0495681_0002028_12057_13055 | 331 |
| 1156 | 3300047673 | Ga0495593_0029981 | Ga0495593_0029981_1059_2054 | 331 |
| 1157 | 3300048091 | Ga0495626_0002134 | Ga0495626_0002134_1008_2003 | 331 |
| 1158 | 3300048091 | Ga0495626_0002366 | Ga0495626_0002366_1404_2399 | 331 |
| 1159 | 3300048091 | Ga0495626_0018798 | Ga0495626_0018798_2426_3421 | 331 |
| 1160 | 3300048905 | Ga0496102_0191211 | Ga0496102_0191211_918_1913 | 331 |
| 1161 | 3300048907 | Ga0496104_0343803 | Ga0496104_0343803_167_1231 | 331 |
| 1162 | 3300048919 | Ga0496116_0002272 | Ga0496116_0002272_1117_2112 | 331 |
| 1163 | 3300048920 | Ga0496117_0034133 | Ga0496117_0034133_959_1954 | 331 |
| 1164 | 3300048924 | Ga0496121_0103392 | Ga0496121_0103392_1021_2016 | 331 |
| 1165 | 3300048925 | Ga0496122_0007825 | Ga0496122_0007825_1009_2004 | 331 |
| 1166 | 3300049459 | Ga0495678_002089 | Ga0495678_002089_638_1708 | 331 |
| 1167 | 3300049459 | Ga0495678_002203 | Ga0495678_002203_10897_11892 | 331 |
| 1168 | 3300049460 | Ga0495682_0090746 | Ga0495682_0090746_76_1071 | 331 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oio-assembly1.cif.gz_A | crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum | 0.9504 | 207 | 307 |
| 3w6v-assembly1.cif.gz_A | crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna | 0.9186 | 207 | 306 |
| 3mn2-assembly2.cif.gz_B | the crystal structure of a probable arac family transcriptional regulator from rhodopseudomonas palustris cga009 | 0.9169 | 207 | 307 |
| 3mkl-assembly1.cif.gz_A | crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 | 0.9005 | 207 | 307 |
| 6swi-assembly1.cif.gz_A | the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus | 0.897 | 202 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lsgA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9986 | 262 | 305 | 1.10.10.60 |
| af_P32677_219_275_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9927 | 257 | 309 | 1.10.10.60 |
| 3lsgB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9668 | 262 | 305 | 1.10.10.60 |
| 5suwA03 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9595 | 250 | 309 | 1.10.10.60 |
| 3lsgC02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9569 | 262 | 305 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q1SIF5-F1-model_v4 | AraC family transcriptional regulator | 0.9657 | 207 | 309 |
GO:0003700
GO:0043565 |
| AF-A0A1G4VZP0-F1-model_v4 | AraC-type DNA-binding protein | 0.9618 | 207 | 306 |
GO:0003700
GO:0043565 |
| AF-A0A1V2S9E3-F1-model_v4 | deleted | 0.9602 | 207 | 306 |
|
| AF-A0A2E8CW25-F1-model_v4 | HTH araC/xylS-type domain-containing protein | 0.9595 | 206 | 304 |
GO:0003700
GO:0043565 |
| AF-A0A536L2X9-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9586 | 206 | 306 |
GO:0003700
GO:0043565 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar