F490926
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1155 | 415 | 1139 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300046454|Ga0495592_0021167|Ga0495592_0021167_1444_2214 |
| Length | 256 |
| Sequence | MKLNAQDLKEIITLTLEHYNQRAEEFWTGTRDHDVSQNIAAMLQYIEGESRFTILDFGCGPGRDLKVVAGLGHTAVGLEGAAHFADMARAYCGCEVWQQDFLKLDLPNNYFDGVFANAALFHVPSQELPRVLLELHASLKPGGVLFSSNPHGHNEEGWNGGRYVVYYDLNAWRRYVSAAGFVELSHYYRPAGLPRERQPSLASVWRRQGSCAAWPLPDALSDRCRSNWSAVLTARQLRFAPPRNQLRSTRQRTQLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 2 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 3 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 4 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 5 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 6 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 7 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 8 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 9 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 10 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 11 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 12 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 13 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 14 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 133 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 206 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 214 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 215 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 224 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 243 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 244 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 245 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 246 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 248 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 249 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 250 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 251 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 252 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 253 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 254 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 255 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 256 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 257 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 258 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 259 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 260 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 261 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 262 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 263 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 264 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 265 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 266 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 267 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 268 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 269 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 270 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 271 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 371 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 378 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 379 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 380 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 381 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 382 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 383 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 384 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 385 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 386 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 399 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 414 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 415 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.53 |
| Metatranscriptomes | 0.09 |
| Isolates | 1.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.26 |
| Nodule | 0.43 |
| Rhizoplane | 3.03 |
| Rhizosphere | 94.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10084390 | 3300005295 | Bacteria | 7262 |
| 2 | Ga0065707_10176604 | 3300005295 | Bacteria | 1446 |
| 3 | Ga0065707_10231719 | 3300005295 | Bacteria | 1186 |
| 4 | Ga0070676_10026495 | 3300005328 | Bacteria | 3282 |
| 5 | Ga0070676_10285226 | 3300005328 | Bacteria | 1114 |
| 6 | Ga0070676_10343574 | 3300005328 | Bacteria | 1024 |
| 7 | Ga0070690_100004121 | 3300005330 | Bacteria | 8050 |
| 8 | Ga0070690_100019324 | 3300005330 | Bacteria | 4132 |
| 9 | Ga0070690_100079142 | 3300005330 | Bacteria | 2149 |
| 10 | Ga0070677_10014886 | 3300005333 | Bacteria | 2747 |
| 11 | Ga0068869_100005998 | 3300005334 | Bacteria | 7684 |
| 12 | Ga0068869_100007257 | 3300005334 | Bacteria | 7063 |
| 13 | Ga0068869_100663369 | 3300005334 | Bacteria | 886 |
| 14 | Ga0070666_10078571 | 3300005335 | Bacteria | 2253 |
| 15 | Ga0070666_10132525 | 3300005335 | Bacteria | 1732 |
| 16 | Ga0070680_100003142 | 3300005336 | Bacteria | 12268 |
| 17 | Ga0070682_100030658 | 3300005337 | Bacteria | 3249 |
| 18 | Ga0070682_100440790 | 3300005337 | Bacteria | 995 |
| 19 | Ga0068868_100010422 | 3300005338 | Bacteria | 6729 |
| 20 | Ga0068868_100011124 | 3300005338 | Bacteria | 6548 |
| 21 | Ga0068868_100011828 | 3300005338 | Bacteria | 6363 |
| 22 | Ga0070689_100010204 | 3300005340 | Bacteria | 6689 |
| 23 | Ga0070689_100082145 | 3300005340 | Bacteria | 2530 |
| 24 | Ga0070689_100336428 | 3300005340 | Bacteria | 1264 |
| 25 | Ga0070691_10003222 | 3300005341 | Bacteria | 7311 |
| 26 | Ga0070687_100002697 | 3300005343 | Bacteria | 6713 |
| 27 | Ga0070687_100055389 | 3300005343 | Bacteria | 2071 |
| 28 | Ga0070687_100568821 | 3300005343 | Bacteria | 774 |
| 29 | Ga0070661_100211228 | 3300005344 | Bacteria | 1486 |
| 30 | Ga0070692_10064768 | 3300005345 | Bacteria | 1933 |
| 31 | Ga0070668_100197166 | 3300005347 | Bacteria | 1652 |
| 32 | Ga0070668_100451793 | 3300005347 | Bacteria | 1105 |
| 33 | Ga0070669_100046321 | 3300005353 | Bacteria | 3171 |
| 34 | Ga0070669_100102206 | 3300005353 | Bacteria | 2164 |
| 35 | Ga0070669_100153401 | 3300005353 | Bacteria | 1784 |
| 36 | Ga0070675_100013190 | 3300005354 | Bacteria | 6493 |
| 37 | Ga0070675_100043373 | 3300005354 | Bacteria | 3675 |
| 38 | Ga0070675_100115194 | 3300005354 | Bacteria | 2278 |
| 39 | Ga0070671_100031841 | 3300005355 | Bacteria | 4359 |
| 40 | Ga0070671_100048815 | 3300005355 | Bacteria | 3521 |
| 41 | Ga0070671_100087118 | 3300005355 | Bacteria | 2613 |
| 42 | Ga0070671_100100707 | 3300005355 | Unclassified | 2424 |
| 43 | Ga0070671_100141714 | 3300005355 | Bacteria | 2028 |
| 44 | Ga0070671_100820947 | 3300005355 | Bacteria | 810 |
| 45 | Ga0070674_100006022 | 3300005356 | Bacteria | 7047 |
| 46 | Ga0070674_100486227 | 3300005356 | Bacteria | 1025 |
| 47 | Ga0070673_100043939 | 3300005364 | Bacteria | 3457 |
| 48 | Ga0070673_100062776 | 3300005364 | Bacteria | 2953 |
| 49 | Ga0070673_100079768 | 3300005364 | Bacteria | 2651 |
| 50 | Ga0070673_100357816 | 3300005364 | Bacteria | 1297 |
| 51 | Ga0070673_100516696 | 3300005364 | Bacteria | 1082 |
| 52 | Ga0070688_100094651 | 3300005365 | Bacteria | 1959 |
| 53 | Ga0070688_100336608 | 3300005365 | Bacteria | 1101 |
| 54 | Ga0070659_100104224 | 3300005366 | Bacteria | 2285 |
| 55 | Ga0070667_100001093 | 3300005367 | Bacteria | 24858 |
| 56 | Ga0070667_100007283 | 3300005367 | Bacteria | 9198 |
| 57 | Ga0070703_10006823 | 3300005406 | Bacteria | 3204 |
| 58 | Ga0070703_10132783 | 3300005406 | Bacteria | 916 |
| 59 | Ga0070714_100023933 | 3300005435 | Bacteria | 5023 |
| 60 | Ga0070714_100704411 | 3300005435 | Bacteria | 974 |
| 61 | Ga0070713_100337791 | 3300005436 | Bacteria | 1395 |
| 62 | Ga0070713_100416573 | 3300005436 | Bacteria | 1257 |
| 63 | Ga0070713_101032103 | 3300005436 | Bacteria | 794 |
| 64 | Ga0070710_10163574 | 3300005437 | Unclassified | 1382 |
| 65 | Ga0070701_10024863 | 3300005438 | Bacteria | 2901 |
| 66 | Ga0070701_10494549 | 3300005438 | Bacteria | 793 |
| 67 | Ga0070711_100128317 | 3300005439 | Bacteria | 1885 |
| 68 | Ga0070711_100163288 | 3300005439 | Bacteria | 1690 |
| 69 | Ga0070711_100275581 | 3300005439 | Bacteria | 1329 |
| 70 | Ga0070711_100337560 | 3300005439 | Bacteria | 1208 |
| 71 | Ga0070711_100421991 | 3300005439 | Bacteria | 1087 |
| 72 | Ga0070711_100594474 | 3300005439 | Bacteria | 922 |
| 73 | Ga0070705_100002548 | 3300005440 | Bacteria | 9159 |
| 74 | Ga0070705_100019590 | 3300005440 | Bacteria | 3563 |
| 75 | Ga0070705_100022328 | 3300005440 | Bacteria | 3381 |
| 76 | Ga0070705_100073413 | 3300005440 | Bacteria | 2076 |
| 77 | Ga0070705_100132290 | 3300005440 | Bacteria | 1629 |
| 78 | Ga0070705_100879489 | 3300005440 | Bacteria | 719 |
| 79 | Ga0070700_100009639 | 3300005441 | Bacteria | 5307 |
| 80 | Ga0070700_100024557 | 3300005441 | Bacteria | 3540 |
| 81 | Ga0070694_100013810 | 3300005444 | Bacteria | 5049 |
| 82 | Ga0070694_100280065 | 3300005444 | Bacteria | 1271 |
| 83 | Ga0070708_100395528 | 3300005445 | Bacteria | 1303 |
| 84 | Ga0070708_100537325 | 3300005445 | Unclassified | 1103 |
| 85 | Ga0070678_100236989 | 3300005456 | Bacteria | 1524 |
| 86 | Ga0070662_100009224 | 3300005457 | Bacteria | 6442 |
| 87 | Ga0070681_10402764 | 3300005458 | Bacteria | 1280 |
| 88 | Ga0068867_100006836 | 3300005459 | Bacteria | 8065 |
| 89 | Ga0068867_100010444 | 3300005459 | Bacteria | 6554 |
| 90 | Ga0068867_100057704 | 3300005459 | Bacteria | 2875 |
| 91 | Ga0068867_100063442 | 3300005459 | Bacteria | 2746 |
| 92 | Ga0068867_100409671 | 3300005459 | Bacteria | 1145 |
| 93 | Ga0070685_10036395 | 3300005466 | Bacteria | 2782 |
| 94 | Ga0070685_10236773 | 3300005466 | Bacteria | 1203 |
| 95 | Ga0070706_100027600 | 3300005467 | Bacteria | 5224 |
| 96 | Ga0070706_100234877 | 3300005467 | Bacteria | 1712 |
| 97 | Ga0070707_100020730 | 3300005468 | Bacteria | 6204 |
| 98 | Ga0070707_100037786 | 3300005468 | Bacteria | 4610 |
| 99 | Ga0070707_100308809 | 3300005468 | Bacteria | 1537 |
| 100 | Ga0070707_100585566 | 3300005468 | Bacteria | 1078 |
| 101 | Ga0070698_100039164 | 3300005471 | Bacteria | 4880 |
| 102 | Ga0070698_100215957 | 3300005471 | Bacteria | 1852 |
| 103 | Ga0070698_100366152 | 3300005471 | Bacteria | 1373 |
| 104 | Ga0070699_100053171 | 3300005518 | Bacteria | 3505 |
| 105 | Ga0070699_100455608 | 3300005518 | Bacteria | 1160 |
| 106 | Ga0070699_100463321 | 3300005518 | Bacteria | 1150 |
| 107 | Ga0070679_100001875 | 3300005530 | Bacteria | 18913 |
| 108 | Ga0070679_100008233 | 3300005530 | Bacteria | 9804 |
| 109 | Ga0070679_100277724 | 3300005530 | Bacteria | 1628 |
| 110 | Ga0070697_100117457 | 3300005536 | Bacteria | 2222 |
| 111 | Ga0070697_100542453 | 3300005536 | Bacteria | 1019 |
| 112 | Ga0070672_100001272 | 3300005543 | Bacteria | 15493 |
| 113 | Ga0070672_100018421 | 3300005543 | Bacteria | 5049 |
| 114 | Ga0070672_100021698 | 3300005543 | Bacteria | 4703 |
| 115 | Ga0070672_100022966 | 3300005543 | Bacteria | 4591 |
| 116 | Ga0070672_100652490 | 3300005543 | Bacteria | 919 |
| 117 | Ga0070686_100006730 | 3300005544 | Bacteria | 6397 |
| 118 | Ga0070686_100013198 | 3300005544 | Bacteria | 4722 |
| 119 | Ga0070695_100004287 | 3300005545 | Bacteria | 8345 |
| 120 | Ga0070695_100005497 | 3300005545 | Bacteria | 7465 |
| 121 | Ga0070695_100109814 | 3300005545 | Bacteria | 1870 |
| 122 | Ga0070696_100001122 | 3300005546 | Bacteria | 17336 |
| 123 | Ga0070696_100189621 | 3300005546 | Bacteria | 1530 |
| 124 | Ga0070696_100408956 | 3300005546 | Bacteria | 1063 |
| 125 | Ga0070693_100006305 | 3300005547 | Bacteria | 5749 |
| 126 | Ga0070693_100573191 | 3300005547 | Bacteria | 811 |
| 127 | Ga0070665_100025093 | 3300005548 | Bacteria | 6008 |
| 128 | Ga0070665_100033616 | 3300005548 | Bacteria | 5160 |
| 129 | Ga0070665_100188230 | 3300005548 | Bacteria | 2065 |
| 130 | Ga0070665_100902825 | 3300005548 | Bacteria | 896 |
| 131 | Ga0070704_100000083 | 3300005549 | Bacteria | 32513 |
| 132 | Ga0070704_100016975 | 3300005549 | Bacteria | 4616 |
| 133 | Ga0070704_100184039 | 3300005549 | Bacteria | 1673 |
| 134 | Ga0070704_100443478 | 3300005549 | Bacteria | 1116 |
| 135 | Ga0068855_100025317 | 3300005563 | Bacteria | 7101 |
| 136 | Ga0068855_100039862 | 3300005563 | Bacteria | 5576 |
| 137 | Ga0068855_100547284 | 3300005563 | Bacteria | 1253 |
| 138 | Ga0068857_100048049 | 3300005577 | Bacteria | 3789 |
| 139 | Ga0068854_100050532 | 3300005578 | Bacteria | 2975 |
| 140 | Ga0068854_100069210 | 3300005578 | Bacteria | 2576 |
| 141 | Ga0068856_100533276 | 3300005614 | Bacteria | 1195 |
| 142 | Ga0070702_100007025 | 3300005615 | Bacteria | 5368 |
| 143 | Ga0070702_100033364 | 3300005615 | Bacteria | 2830 |
| 144 | Ga0070702_100812849 | 3300005615 | Bacteria | 724 |
| 145 | Ga0068852_100266552 | 3300005616 | Bacteria | 1647 |
| 146 | Ga0068852_100499417 | 3300005616 | Bacteria | 1211 |
| 147 | Ga0068852_100791229 | 3300005616 | Bacteria | 962 |
| 148 | Ga0068859_100006490 | 3300005617 | Bacteria | 11874 |
| 149 | Ga0068859_100030341 | 3300005617 | Bacteria | 5425 |
| 150 | Ga0068859_100052283 | 3300005617 | Bacteria | 4107 |
| 151 | Ga0068864_100002280 | 3300005618 | Bacteria | 15868 |
| 152 | Ga0068864_100049722 | 3300005618 | Bacteria | 3608 |
| 153 | Ga0068864_100849106 | 3300005618 | Bacteria | 900 |
| 154 | Ga0068866_10002197 | 3300005718 | Bacteria | 8126 |
| 155 | Ga0068866_10036933 | 3300005718 | Bacteria | 2396 |
| 156 | Ga0068861_100001241 | 3300005719 | Bacteria | 15888 |
| 157 | Ga0068861_100014217 | 3300005719 | Bacteria | 5583 |
| 158 | Ga0068870_10001840 | 3300005840 | Bacteria | 8720 |
| 159 | Ga0068870_10016150 | 3300005840 | Bacteria | 3561 |
| 160 | Ga0068863_100002300 | 3300005841 | Bacteria | 18999 |
| 161 | Ga0068863_100013022 | 3300005841 | Bacteria | 8019 |
| 162 | Ga0068863_100046547 | 3300005841 | Bacteria | 4117 |
| 163 | Ga0068863_100080907 | 3300005841 | Bacteria | 3077 |
| 164 | Ga0068863_100081515 | 3300005841 | Bacteria | 3065 |
| 165 | Ga0068863_100232165 | 3300005841 | Bacteria | 1780 |
| 166 | Ga0068858_100010433 | 3300005842 | Bacteria | 8801 |
| 167 | Ga0068858_100030844 | 3300005842 | Bacteria | 4979 |
| 168 | Ga0068858_100034170 | 3300005842 | Bacteria | 4716 |
| 169 | Ga0068858_100063190 | 3300005842 | Bacteria | 3426 |
| 170 | Ga0068858_100065254 | 3300005842 | Bacteria | 3368 |
| 171 | Ga0068858_100171424 | 3300005842 | Bacteria | 2046 |
| 172 | Ga0068860_100014740 | 3300005843 | Bacteria | 7644 |
| 173 | Ga0068860_100018123 | 3300005843 | Bacteria | 6855 |
| 174 | Ga0068860_100024570 | 3300005843 | Bacteria | 5820 |
| 175 | Ga0068860_100065276 | 3300005843 | Bacteria | 3457 |
| 176 | Ga0068860_100253259 | 3300005843 | Bacteria | 1715 |
| 177 | Ga0068860_100833222 | 3300005843 | Bacteria | 937 |
| 178 | Ga0068862_100010079 | 3300005844 | Bacteria | 7801 |
| 179 | Ga0068862_100047828 | 3300005844 | Bacteria | 3651 |
| 180 | Ga0068862_100224879 | 3300005844 | Bacteria | 1700 |
| 181 | Ga0068862_100676069 | 3300005844 | Bacteria | 998 |
| 182 | Ga0068862_100933668 | 3300005844 | Bacteria | 855 |
| 183 | Ga0081455_10005916 | 3300005937 | Bacteria | 13274 |
| 184 | Ga0081455_10019458 | 3300005937 | Bacteria | 6423 |
| 185 | Ga0081455_10031813 | 3300005937 | Bacteria | 4766 |
| 186 | Ga0081455_10047557 | 3300005937 | Bacteria | 3715 |
| 187 | Ga0081540_1023860 | 3300005983 | Bacteria | 3564 |
| 188 | Ga0070717_10090720 | 3300006028 | Bacteria | 2579 |
| 189 | Ga0070717_10798187 | 3300006028 | Unclassified | 859 |
| 190 | Ga0070717_11119322 | 3300006028 | Bacteria | 717 |
| 191 | Ga0075365_10417902 | 3300006038 | Bacteria | 947 |
| 192 | Ga0075432_10010171 | 3300006058 | Bacteria | 3192 |
| 193 | Ga0070715_10196004 | 3300006163 | Bacteria | 1023 |
| 194 | Ga0070716_100013835 | 3300006173 | Bacteria | 4121 |
| 195 | Ga0070716_100119258 | 3300006173 | Bacteria | 1649 |
| 196 | Ga0070716_100165299 | 3300006173 | Bacteria | 1438 |
| 197 | Ga0070716_100240273 | 3300006173 | Bacteria | 1228 |
| 198 | Ga0070712_100000823 | 3300006175 | Bacteria | 18428 |
| 199 | Ga0070712_100045961 | 3300006175 | Bacteria | 3017 |
| 200 | Ga0070712_100183202 | 3300006175 | Bacteria | 1633 |
| 201 | Ga0097621_100003387 | 3300006237 | Bacteria | 10975 |
| 202 | Ga0097621_100017059 | 3300006237 | Bacteria | 5507 |
| 203 | Ga0097621_100024206 | 3300006237 | Bacteria | 4738 |
| 204 | Ga0097621_100179521 | 3300006237 | Bacteria | 1829 |
| 205 | Ga0097621_100519200 | 3300006237 | Bacteria | 1081 |
| 206 | Ga0068871_100003490 | 3300006358 | Bacteria | 10808 |
| 207 | Ga0068871_100008380 | 3300006358 | Bacteria | 7434 |
| 208 | Ga0068871_100078323 | 3300006358 | Bacteria | 2733 |
| 209 | Ga0068871_100108484 | 3300006358 | Bacteria | 2333 |
| 210 | Ga0075428_100010065 | 3300006844 | Bacteria | 10507 |
| 211 | Ga0075428_100188006 | 3300006844 | Bacteria | 2234 |
| 212 | Ga0075428_100221354 | 3300006844 | Bacteria | 2043 |
| 213 | Ga0075430_100318562 | 3300006846 | Bacteria | 1285 |
| 214 | Ga0075431_100007683 | 3300006847 | Bacteria | 10739 |
| 215 | Ga0075431_100056564 | 3300006847 | Bacteria | 4045 |
| 216 | Ga0075431_100389701 | 3300006847 | Unclassified | 1396 |
| 217 | Ga0075433_10088674 | 3300006852 | Bacteria | 2734 |
| 218 | Ga0075433_10108199 | 3300006852 | Bacteria | 2466 |
| 219 | Ga0075434_100021290 | 3300006871 | Bacteria | 6303 |
| 220 | Ga0075434_100073551 | 3300006871 | Bacteria | 3410 |
| 221 | Ga0075434_100092651 | 3300006871 | Bacteria | 3024 |
| 222 | Ga0075434_100098906 | 3300006871 | Bacteria | 2922 |
| 223 | Ga0075434_100103030 | 3300006871 | Bacteria | 2862 |
| 224 | Ga0075429_100002284 | 3300006880 | Bacteria | 16086 |
| 225 | Ga0075429_100033610 | 3300006880 | Bacteria | 4457 |
| 226 | Ga0075429_100064749 | 3300006880 | Bacteria | 3183 |
| 227 | Ga0068865_100006542 | 3300006881 | Bacteria | 7119 |
| 228 | Ga0068865_100210426 | 3300006881 | Bacteria | 1515 |
| 229 | Ga0075436_100004626 | 3300006914 | Bacteria | 9430 |
| 230 | Ga0075436_100008330 | 3300006914 | Bacteria | 7090 |
| 231 | Ga0075436_100187069 | 3300006914 | Bacteria | 1465 |
| 232 | Ga0075436_100196331 | 3300006914 | Bacteria | 1429 |
| 233 | Ga0075436_100204011 | 3300006914 | Bacteria | 1401 |
| 234 | Ga0075436_100403027 | 3300006914 | Bacteria | 991 |
| 235 | Ga0097620_100006489 | 3300006931 | Bacteria | 11874 |
| 236 | Ga0097620_100030340 | 3300006931 | Bacteria | 5425 |
| 237 | Ga0097620_100052284 | 3300006931 | Bacteria | 4107 |
| 238 | Ga0075435_100019017 | 3300007076 | Bacteria | 5235 |
| 239 | Ga0075435_100143852 | 3300007076 | Bacteria | 2002 |
| 240 | Ga0075435_100269005 | 3300007076 | Bacteria | 1453 |
| 241 | Ga0075435_100757569 | 3300007076 | Bacteria | 845 |
| 242 | Ga0099794_10010908 | 3300007265 | Bacteria | 3874 |
| 243 | Ga0099794_10012586 | 3300007265 | Bacteria | 3656 |
| 244 | Ga0099794_10013510 | 3300007265 | Bacteria | 3555 |
| 245 | Ga0099794_10174618 | 3300007265 | Unclassified | 1096 |
| 246 | Ga0105251_10001212 | 3300009011 | Bacteria | 22289 |
| 247 | Ga0105251_10090960 | 3300009011 | Bacteria | 1402 |
| 248 | Ga0105250_10031050 | 3300009092 | Bacteria | 2145 |
| 249 | Ga0105240_10128238 | 3300009093 | Bacteria | 3046 |
| 250 | Ga0111539_10057327 | 3300009094 | Bacteria | 4626 |
| 251 | Ga0111539_10088096 | 3300009094 | Bacteria | 3647 |
| 252 | Ga0111539_10135862 | 3300009094 | Bacteria | 2880 |
| 253 | Ga0111539_10366814 | 3300009094 | Bacteria | 1676 |
| 254 | Ga0111539_11131637 | 3300009094 | Bacteria | 910 |
| 255 | Ga0111539_11155015 | 3300009094 | Bacteria | 900 |
| 256 | Ga0105245_10002508 | 3300009098 | Bacteria | 16549 |
| 257 | Ga0105245_10007367 | 3300009098 | Bacteria | 9633 |
| 258 | Ga0105245_10011365 | 3300009098 | Bacteria | 7753 |
| 259 | Ga0105247_10054226 | 3300009101 | Bacteria | 2474 |
| 260 | Ga0105247_10831621 | 3300009101 | Bacteria | 707 |
| 261 | Ga0114129_10057223 | 3300009147 | Bacteria | 5458 |
| 262 | Ga0114129_10141179 | 3300009147 | Bacteria | 3302 |
| 263 | Ga0105243_10000828 | 3300009148 | Bacteria | 29395 |
| 264 | Ga0105243_10033209 | 3300009148 | Bacteria | 3990 |
| 265 | Ga0105243_10201542 | 3300009148 | Bacteria | 1745 |
| 266 | Ga0105241_10005717 | 3300009174 | Bacteria | 9177 |
| 267 | Ga0105241_10374284 | 3300009174 | Bacteria | 1243 |
| 268 | Ga0105242_10012860 | 3300009176 | Bacteria | 6449 |
| 269 | Ga0105242_10013252 | 3300009176 | Bacteria | 6365 |
| 270 | Ga0105242_10014872 | 3300009176 | Bacteria | 6028 |
| 271 | Ga0105242_10514668 | 3300009176 | Bacteria | 1141 |
| 272 | Ga0105248_10001643 | 3300009177 | Bacteria | 24867 |
| 273 | Ga0105248_10021343 | 3300009177 | Bacteria | 7176 |
| 274 | Ga0105248_10055005 | 3300009177 | Bacteria | 4463 |
| 275 | Ga0105248_10062724 | 3300009177 | Bacteria | 4173 |
| 276 | Ga0105248_10070296 | 3300009177 | Bacteria | 3931 |
| 277 | Ga0105248_10386929 | 3300009177 | Bacteria | 1575 |
| 278 | Ga0105248_10551725 | 3300009177 | Bacteria | 1300 |
| 279 | Ga0105249_10000305 | 3300009553 | Bacteria | 49977 |
| 280 | Ga0105249_10005189 | 3300009553 | Bacteria | 11242 |
| 281 | Ga0105249_10014543 | 3300009553 | Bacteria | 6958 |
| 282 | Ga0105249_10608032 | 3300009553 | Bacteria | 1148 |
| 283 | Ga0099796_10006396 | 3300010159 | Bacteria | 3012 |
| 284 | Ga0105239_10050189 | 3300010375 | Bacteria | 4577 |
| 285 | Ga0105239_10167562 | 3300010375 | Bacteria | 2456 |
| 286 | Ga0105239_11031009 | 3300010375 | Bacteria | 946 |
| 287 | Ga0157371_10000641 | 3300013102 | Bacteria | 41468 |
| 288 | Ga0157370_10065396 | 3300013104 | Bacteria | 3440 |
| 289 | Ga0157370_10345975 | 3300013104 | Bacteria | 1370 |
| 290 | Ga0157369_10746905 | 3300013105 | Bacteria | 1007 |
| 291 | Ga0157369_10842984 | 3300013105 | Bacteria | 941 |
| 292 | Ga0157374_10049694 | 3300013296 | Bacteria | 3896 |
| 293 | Ga0157374_10061531 | 3300013296 | Bacteria | 3516 |
| 294 | Ga0157374_10965470 | 3300013296 | Bacteria | 871 |
| 295 | Ga0157378_10000905 | 3300013297 | Bacteria | 27336 |
| 296 | Ga0157378_10017494 | 3300013297 | Bacteria | 6292 |
| 297 | Ga0157378_10046058 | 3300013297 | Bacteria | 3878 |
| 298 | Ga0157378_10366414 | 3300013297 | Bacteria | 1411 |
| 299 | Ga0157378_10403580 | 3300013297 | Bacteria | 1347 |
| 300 | Ga0163162_10021024 | 3300013306 | Bacteria | 6419 |
| 301 | Ga0163162_10063090 | 3300013306 | Bacteria | 3747 |
| 302 | Ga0163162_10088023 | 3300013306 | Bacteria | 3185 |
| 303 | Ga0163162_10195538 | 3300013306 | Bacteria | 2151 |
| 304 | Ga0163162_10207566 | 3300013306 | Bacteria | 2088 |
| 305 | Ga0157372_10031503 | 3300013307 | Bacteria | 5806 |
| 306 | Ga0157372_10337749 | 3300013307 | Bacteria | 1755 |
| 307 | Ga0157372_10443499 | 3300013307 | Bacteria | 1513 |
| 308 | Ga0157375_10036284 | 3300013308 | Bacteria | 4715 |
| 309 | Ga0157375_10059181 | 3300013308 | Bacteria | 3794 |
| 310 | Ga0157375_10191935 | 3300013308 | Bacteria | 2197 |
| 311 | Ga0157375_10215999 | 3300013308 | Bacteria | 2076 |
| 312 | Ga0163163_10009741 | 3300014325 | Bacteria | 8604 |
| 313 | Ga0163163_10124024 | 3300014325 | Bacteria | 2619 |
| 314 | Ga0157380_10023521 | 3300014326 | Bacteria | 4648 |
| 315 | Ga0157380_10056047 | 3300014326 | Bacteria | 3133 |
| 316 | Ga0182008_10002767 | 3300014497 | Bacteria | 10872 |
| 317 | Ga0182008_10035174 | 3300014497 | Bacteria | 2510 |
| 318 | Ga0157377_10084780 | 3300014745 | Bacteria | 1859 |
| 319 | Ga0157379_10001014 | 3300014968 | Bacteria | 22781 |
| 320 | Ga0157379_10001029 | 3300014968 | Bacteria | 22645 |
| 321 | Ga0157379_10021816 | 3300014968 | Bacteria | 5674 |
| 322 | Ga0157379_10059384 | 3300014968 | Unclassified | 3419 |
| 323 | Ga0157379_10103200 | 3300014968 | Bacteria | 2559 |
| 324 | Ga0157376_10002734 | 3300014969 | Bacteria | 12030 |
| 325 | Ga0157376_10016490 | 3300014969 | Bacteria | 5611 |
| 326 | Ga0157376_10024125 | 3300014969 | Bacteria | 4771 |
| 327 | Ga0157376_10067310 | 3300014969 | Bacteria | 3029 |
| 328 | Ga0182005_1009775 | 3300015265 | Bacteria | 2777 |
| 329 | Ga0163161_10010873 | 3300017792 | Bacteria | 6308 |
| 330 | Ga0163161_10018858 | 3300017792 | Bacteria | 4836 |
| 331 | Ga0228598_1022512 | 3300024227 | Bacteria | 1239 |
| 332 | Ga0207666_1008649 | 3300025271 | Bacteria | 1363 |
| 333 | Ga0207713_1004860 | 3300025735 | Bacteria | 8615 |
| 334 | Ga0207713_1015261 | 3300025735 | Bacteria | 3952 |
| 335 | Ga0207713_1079390 | 3300025735 | Bacteria | 1185 |
| 336 | Ga0207653_10003361 | 3300025885 | Bacteria | 5049 |
| 337 | Ga0207653_10102183 | 3300025885 | Bacteria | 1015 |
| 338 | Ga0207682_10001025 | 3300025893 | Bacteria | 12932 |
| 339 | Ga0207692_10228036 | 3300025898 | Bacteria | 1107 |
| 340 | Ga0207642_10001262 | 3300025899 | Bacteria | 7842 |
| 341 | Ga0207642_10029525 | 3300025899 | Bacteria | 2272 |
| 342 | Ga0207688_10003169 | 3300025901 | Bacteria | 8972 |
| 343 | Ga0207680_10027293 | 3300025903 | Bacteria | 3177 |
| 344 | Ga0207680_10049824 | 3300025903 | Bacteria | 2495 |
| 345 | Ga0207647_10115004 | 3300025904 | Bacteria | 1589 |
| 346 | Ga0207699_10219647 | 3300025906 | Bacteria | 1297 |
| 347 | Ga0207645_10003583 | 3300025907 | Bacteria | 11745 |
| 348 | Ga0207645_10157508 | 3300025907 | Bacteria | 1484 |
| 349 | Ga0207643_10002409 | 3300025908 | Bacteria | 10119 |
| 350 | Ga0207643_10088070 | 3300025908 | Bacteria | 1806 |
| 351 | Ga0207684_10162658 | 3300025910 | Bacteria | 1922 |
| 352 | Ga0207684_10302588 | 3300025910 | Bacteria | 1379 |
| 353 | Ga0207654_10023421 | 3300025911 | Bacteria | 3308 |
| 354 | Ga0207707_10170080 | 3300025912 | Bacteria | 1905 |
| 355 | Ga0207707_10318632 | 3300025912 | Bacteria | 1343 |
| 356 | Ga0207695_10023324 | 3300025913 | Bacteria | 6995 |
| 357 | Ga0207695_10074716 | 3300025913 | Bacteria | 3450 |
| 358 | Ga0207693_10035007 | 3300025915 | Bacteria | 3961 |
| 359 | Ga0207693_10048168 | 3300025915 | Bacteria | 3347 |
| 360 | Ga0207693_10054236 | 3300025915 | Bacteria | 3145 |
| 361 | Ga0207693_10105568 | 3300025915 | Bacteria | 2209 |
| 362 | Ga0207693_10229959 | 3300025915 | Bacteria | 1456 |
| 363 | Ga0207663_10019562 | 3300025916 | Bacteria | 3818 |
| 364 | Ga0207663_10106226 | 3300025916 | Bacteria | 1897 |
| 365 | Ga0207663_10168759 | 3300025916 | Bacteria | 1552 |
| 366 | Ga0207663_10229335 | 3300025916 | Bacteria | 1356 |
| 367 | Ga0207663_10246675 | 3300025916 | Bacteria | 1312 |
| 368 | Ga0207663_10308260 | 3300025916 | Bacteria | 1185 |
| 369 | Ga0207663_10367264 | 3300025916 | Bacteria | 1093 |
| 370 | Ga0207660_10009077 | 3300025917 | Bacteria | 6440 |
| 371 | Ga0207660_10283502 | 3300025917 | Bacteria | 1315 |
| 372 | Ga0207660_10634090 | 3300025917 | Bacteria | 871 |
| 373 | Ga0207662_10000200 | 3300025918 | Bacteria | 27999 |
| 374 | Ga0207662_10004161 | 3300025918 | Bacteria | 7573 |
| 375 | Ga0207652_10024823 | 3300025921 | Bacteria | 4975 |
| 376 | Ga0207652_10202325 | 3300025921 | Bacteria | 1787 |
| 377 | Ga0207646_10029939 | 3300025922 | Bacteria | 4942 |
| 378 | Ga0207646_10257118 | 3300025922 | Bacteria | 1578 |
| 379 | Ga0207681_10006962 | 3300025923 | Bacteria | 6938 |
| 380 | Ga0207681_10040738 | 3300025923 | Bacteria | 3092 |
| 381 | Ga0207650_10018357 | 3300025925 | Bacteria | 4908 |
| 382 | Ga0207650_10037477 | 3300025925 | Bacteria | 3533 |
| 383 | Ga0207650_10111526 | 3300025925 | Bacteria | 2118 |
| 384 | Ga0207650_10714599 | 3300025925 | Bacteria | 847 |
| 385 | Ga0207659_10035166 | 3300025926 | Bacteria | 3461 |
| 386 | Ga0207659_10043726 | 3300025926 | Bacteria | 3148 |
| 387 | Ga0207659_10045844 | 3300025926 | Bacteria | 3085 |
| 388 | Ga0207659_10720493 | 3300025926 | Bacteria | 855 |
| 389 | Ga0207687_10003767 | 3300025927 | Bacteria | 10190 |
| 390 | Ga0207687_10146702 | 3300025927 | Bacteria | 1796 |
| 391 | Ga0207700_10124675 | 3300025928 | Bacteria | 2093 |
| 392 | Ga0207700_10217207 | 3300025928 | Bacteria | 1619 |
| 393 | Ga0207700_10410848 | 3300025928 | Bacteria | 1187 |
| 394 | Ga0207664_10029849 | 3300025929 | Bacteria | 4158 |
| 395 | Ga0207664_10160946 | 3300025929 | Bacteria | 1914 |
| 396 | Ga0207644_10018513 | 3300025931 | Bacteria | 4712 |
| 397 | Ga0207644_10033489 | 3300025931 | Bacteria | 3591 |
| 398 | Ga0207644_10047864 | 3300025931 | Bacteria | 3054 |
| 399 | Ga0207644_10105804 | 3300025931 | Bacteria | 2120 |
| 400 | Ga0207644_10119497 | 3300025931 | Bacteria | 2004 |
| 401 | Ga0207644_10194269 | 3300025931 | Bacteria | 1597 |
| 402 | Ga0207644_10782176 | 3300025931 | Bacteria | 798 |
| 403 | Ga0207690_10097638 | 3300025932 | Bacteria | 2091 |
| 404 | Ga0207706_10016249 | 3300025933 | Bacteria | 6723 |
| 405 | Ga0207706_10027272 | 3300025933 | Bacteria | 5109 |
| 406 | Ga0207706_10055745 | 3300025933 | Bacteria | 3484 |
| 407 | Ga0207686_10006909 | 3300025934 | Bacteria | 6109 |
| 408 | Ga0207686_10055859 | 3300025934 | Bacteria | 2479 |
| 409 | Ga0207709_10004256 | 3300025935 | Bacteria | 8294 |
| 410 | Ga0207709_10179171 | 3300025935 | Bacteria | 1495 |
| 411 | Ga0207670_10014122 | 3300025936 | Bacteria | 4730 |
| 412 | Ga0207670_10024309 | 3300025936 | Bacteria | 3785 |
| 413 | Ga0207670_10063324 | 3300025936 | Bacteria | 2530 |
| 414 | Ga0207670_10159435 | 3300025936 | Bacteria | 1683 |
| 415 | Ga0207704_10010803 | 3300025938 | Bacteria | 4469 |
| 416 | Ga0207704_10073124 | 3300025938 | Bacteria | 2182 |
| 417 | Ga0207704_10151871 | 3300025938 | Bacteria | 1635 |
| 418 | Ga0207665_10063492 | 3300025939 | Bacteria | 2508 |
| 419 | Ga0207691_10001198 | 3300025940 | Bacteria | 25807 |
| 420 | Ga0207691_10315320 | 3300025940 | Bacteria | 1341 |
| 421 | Ga0207711_10004318 | 3300025941 | Bacteria | 12144 |
| 422 | Ga0207711_10027441 | 3300025941 | Bacteria | 4782 |
| 423 | Ga0207711_10298119 | 3300025941 | Bacteria | 1486 |
| 424 | Ga0207711_10532147 | 3300025941 | Bacteria | 1096 |
| 425 | Ga0207689_10000229 | 3300025942 | Bacteria | 49945 |
| 426 | Ga0207689_10000949 | 3300025942 | Bacteria | 27884 |
| 427 | Ga0207689_10023429 | 3300025942 | Bacteria | 5182 |
| 428 | Ga0207661_11226392 | 3300025944 | Bacteria | 690 |
| 429 | Ga0207667_10024078 | 3300025949 | Bacteria | 6694 |
| 430 | Ga0207667_10088567 | 3300025949 | Bacteria | 3201 |
| 431 | Ga0207667_10127864 | 3300025949 | Bacteria | 2617 |
| 432 | Ga0207651_10047665 | 3300025960 | Bacteria | 2891 |
| 433 | Ga0207651_10221879 | 3300025960 | Bacteria | 1528 |
| 434 | Ga0207651_10376413 | 3300025960 | Bacteria | 1202 |
| 435 | Ga0207712_10085661 | 3300025961 | Bacteria | 2307 |
| 436 | Ga0207712_10463353 | 3300025961 | Bacteria | 1077 |
| 437 | Ga0207668_10067082 | 3300025972 | Bacteria | 2546 |
| 438 | Ga0207640_10005122 | 3300025981 | Bacteria | 7128 |
| 439 | Ga0207658_10006854 | 3300025986 | Bacteria | 7758 |
| 440 | Ga0207658_10059301 | 3300025986 | Bacteria | 2851 |
| 441 | Ga0207658_10113071 | 3300025986 | Bacteria | 2150 |
| 442 | Ga0207677_10048141 | 3300026023 | Bacteria | 2868 |
| 443 | Ga0207677_10223930 | 3300026023 | Bacteria | 1510 |
| 444 | Ga0207677_10925031 | 3300026023 | Bacteria | 787 |
| 445 | Ga0207703_10006954 | 3300026035 | Bacteria | 9004 |
| 446 | Ga0207703_10009417 | 3300026035 | Bacteria | 7673 |
| 447 | Ga0207703_10049612 | 3300026035 | Bacteria | 3393 |
| 448 | Ga0207703_10088267 | 3300026035 | Bacteria | 2602 |
| 449 | Ga0207703_10142333 | 3300026035 | Bacteria | 2083 |
| 450 | Ga0207703_10169868 | 3300026035 | Bacteria | 1917 |
| 451 | Ga0207639_10044041 | 3300026041 | Bacteria | 3355 |
| 452 | Ga0207708_10005632 | 3300026075 | Bacteria | 9246 |
| 453 | Ga0207708_10006559 | 3300026075 | Bacteria | 8610 |
| 454 | Ga0207702_10163592 | 3300026078 | Bacteria | 2034 |
| 455 | Ga0207702_11093543 | 3300026078 | Bacteria | 791 |
| 456 | Ga0207641_10022316 | 3300026088 | Bacteria | 5210 |
| 457 | Ga0207641_10027073 | 3300026088 | Bacteria | 4734 |
| 458 | Ga0207641_10044739 | 3300026088 | Bacteria | 3723 |
| 459 | Ga0207641_10305379 | 3300026088 | Bacteria | 1504 |
| 460 | Ga0207641_10673318 | 3300026088 | Bacteria | 1017 |
| 461 | Ga0207648_10000124 | 3300026089 | Bacteria | 75549 |
| 462 | Ga0207648_10004634 | 3300026089 | Bacteria | 14078 |
| 463 | Ga0207648_10017246 | 3300026089 | Bacteria | 6579 |
| 464 | Ga0207676_10016274 | 3300026095 | Bacteria | 5384 |
| 465 | Ga0207676_10046220 | 3300026095 | Bacteria | 3367 |
| 466 | Ga0207676_10055704 | 3300026095 | Bacteria | 3106 |
| 467 | Ga0207676_10105108 | 3300026095 | Bacteria | 2350 |
| 468 | Ga0207674_10027319 | 3300026116 | Bacteria | 6039 |
| 469 | Ga0207675_100001175 | 3300026118 | Bacteria | 26068 |
| 470 | Ga0207675_100001933 | 3300026118 | Bacteria | 20680 |
| 471 | Ga0207675_100006074 | 3300026118 | Bacteria | 11494 |
| 472 | Ga0207675_100117555 | 3300026118 | Bacteria | 2514 |
| 473 | Ga0207675_100845108 | 3300026118 | Bacteria | 930 |
| 474 | Ga0207683_10009783 | 3300026121 | Bacteria | 8173 |
| 475 | Ga0207683_10265192 | 3300026121 | Bacteria | 1568 |
| 476 | Ga0207698_10096938 | 3300026142 | Bacteria | 2432 |
| 477 | Ga0207428_10006751 | 3300027907 | Bacteria | 10529 |
| 478 | Ga0207428_10025467 | 3300027907 | Bacteria | 4952 |
| 479 | Ga0207428_10076391 | 3300027907 | Bacteria | 2623 |
| 480 | Ga0207428_10216895 | 3300027907 | Bacteria | 1436 |
| 481 | Ga0268266_10045567 | 3300028379 | Bacteria | 3752 |
| 482 | Ga0268266_10056127 | 3300028379 | Bacteria | 3388 |
| 483 | Ga0268265_10016085 | 3300028380 | Bacteria | 5133 |
| 484 | Ga0268265_10033425 | 3300028380 | Bacteria | 3739 |
| 485 | Ga0268265_10163484 | 3300028380 | Bacteria | 1894 |
| 486 | Ga0268264_10001839 | 3300028381 | Bacteria | 19337 |
| 487 | Ga0268264_10048729 | 3300028381 | Bacteria | 3524 |
| 488 | Ga0268264_10169576 | 3300028381 | Bacteria | 1973 |
| 489 | Ga0268264_10555657 | 3300028381 | Bacteria | 1126 |
| 490 | Ga0265334_10003454 | 3300028573 | Bacteria | 7185 |
| 491 | Ga0265318_10001215 | 3300028577 | Bacteria | 15658 |
| 492 | Ga0265318_10069229 | 3300028577 | Bacteria | 1308 |
| 493 | Ga0265338_10005969 | 3300028800 | Bacteria | 15663 |
| 494 | Ga0265760_10102095 | 3300031090 | Bacteria | 907 |
| 495 | Ga0265330_10003654 | 3300031235 | Bacteria | 7996 |
| 496 | Ga0265330_10008812 | 3300031235 | Bacteria | 4830 |
| 497 | Ga0265332_10001462 | 3300031238 | Bacteria | 13214 |
| 498 | Ga0265332_10005649 | 3300031238 | Bacteria | 5749 |
| 499 | Ga0265328_10009401 | 3300031239 | Bacteria | 3985 |
| 500 | Ga0265328_10026383 | 3300031239 | Bacteria | 2183 |
| 501 | Ga0265320_10002610 | 3300031240 | Bacteria | 12509 |
| 502 | Ga0265325_10005974 | 3300031241 | Bacteria | 7453 |
| 503 | Ga0265329_10001757 | 3300031242 | Bacteria | 10315 |
| 504 | Ga0265340_10044661 | 3300031247 | Bacteria | 2168 |
| 505 | Ga0265339_10013975 | 3300031249 | Bacteria | 4855 |
| 506 | Ga0265331_10005568 | 3300031250 | Bacteria | 7584 |
| 507 | Ga0265331_10110186 | 3300031250 | Bacteria | 1263 |
| 508 | Ga0265331_10127499 | 3300031250 | Bacteria | 1162 |
| 509 | Ga0265316_10009140 | 3300031344 | Bacteria | 9129 |
| 510 | Ga0265313_10006665 | 3300031595 | Bacteria | 8097 |
| 511 | Ga0265314_10001270 | 3300031711 | Bacteria | 28727 |
| 512 | Ga0265314_10006556 | 3300031711 | Bacteria | 10266 |
| 513 | Ga0265342_10002161 | 3300031712 | Bacteria | 17328 |
| 514 | Ga0265342_10007741 | 3300031712 | Bacteria | 7822 |
| 515 | Ga0373930_0006814 | 3300034816 | Bacteria | 1946 |
| 516 | Ga0373938_0005618 | 3300034957 | Bacteria | 2139 |
| 517 | Ga0373926_0003758 | 3300035083 | Bacteria | 4944 |
| 518 | Ga0373928_0002384 | 3300035084 | Bacteria | 3651 |
| 519 | Ga0373934_0261101 | 3300035086 | Bacteria | 717 |
| 520 | Ga0373940_0007019 | 3300035088 | Bacteria | 2527 |
| 521 | Ga0373944_0002007 | 3300035089 | Bacteria | 5160 |
| 522 | Ga0373952_0006586 | 3300035092 | Bacteria | 2151 |
| 523 | Ga0373923_0068609 | 3300035111 | Bacteria | 1518 |
| 524 | Ga0373923_0074384 | 3300035111 | Bacteria | 1464 |
| 525 | Ga0373923_0107122 | 3300035111 | Bacteria | 1238 |
| 526 | Ga0373923_0119232 | 3300035111 | Bacteria | 1178 |
| 527 | Ga0373932_0007442 | 3300035112 | Bacteria | 2606 |
| 528 | Ga0373936_0098859 | 3300035113 | Bacteria | 1230 |
| 529 | Ga0373936_0201605 | 3300035113 | Unclassified | 878 |
| 530 | Ga0373936_0209570 | 3300035113 | Bacteria | 862 |
| 531 | Ga0373939_0023283 | 3300035114 | Bacteria | 1714 |
| 532 | Ga0373941_0021046 | 3300035115 | Bacteria | 1835 |
| 533 | Ga0373945_0001120 | 3300035116 | Bacteria | 8101 |
| 534 | Ga0373945_0017789 | 3300035116 | Bacteria | 2411 |
| 535 | Ga0373945_0135547 | 3300035116 | Bacteria | 989 |
| 536 | Ga0373953_0001462 | 3300035117 | Bacteria | 6857 |
| 537 | Ga0373953_0003158 | 3300035117 | Bacteria | 5092 |
| 538 | Ga0373953_0148278 | 3300035117 | Bacteria | 1005 |
| 539 | Ga0373954_0002182 | 3300035118 | Bacteria | 8137 |
| 540 | Ga0373954_0066235 | 3300035118 | Bacteria | 1710 |
| 541 | Ga0373954_0167945 | 3300035118 | Bacteria | 1074 |
| 542 | Ga0373954_0218060 | 3300035118 | Bacteria | 938 |
| 543 | Ga0373943_0002502 | 3300035170 | Bacteria | 8355 |
| 544 | Ga0373943_0049420 | 3300035170 | Bacteria | 2064 |
| 545 | Ga0373943_0082986 | 3300035170 | Bacteria | 1646 |
| 546 | Ga0373946_0002385 | 3300035171 | Bacteria | 6645 |
| 547 | Ga0373946_0013338 | 3300035171 | Bacteria | 3089 |
| 548 | Ga0373946_0015152 | 3300035171 | Bacteria | 2919 |
| 549 | Ga0373946_0072308 | 3300035171 | Bacteria | 1493 |
| 550 | Ga0373946_0096540 | 3300035171 | Bacteria | 1318 |
| 551 | Ga0373955_0000200 | 3300035172 | Bacteria | 24884 |
| 552 | Ga0373955_0016724 | 3300035172 | Bacteria | 3615 |
| 553 | Ga0373955_0197934 | 3300035172 | Bacteria | 1196 |
| 554 | Ga0373955_0271399 | 3300035172 | Bacteria | 1019 |
| 555 | Ga0373942_0006173 | 3300035207 | Bacteria | 2766 |
| 556 | Ga0373961_0004757 | 3300035241 | Bacteria | 3266 |
| 557 | Ga0373962_0168887 | 3300035242 | Bacteria | 725 |
| 558 | Ga0373924_0001651 | 3300035410 | Bacteria | 7328 |
| 559 | Ga0373924_0010215 | 3300035410 | Bacteria | 3455 |
| 560 | Ga0373931_0018730 | 3300035691 | Bacteria | 3445 |
| 561 | Ga0373935_0003610 | 3300035692 | Bacteria | 9018 |
| 562 | Ga0373935_0117719 | 3300035692 | Bacteria | 1771 |
| 563 | Ga0373927_0000227 | 3300035695 | Bacteria | 44543 |
| 564 | Ga0373927_0009494 | 3300035695 | Bacteria | 6524 |
| 565 | Ga0373927_0100066 | 3300035695 | Bacteria | 1885 |
| 566 | Ga0373927_0139214 | 3300035695 | Bacteria | 1587 |
| 567 | Ga0373927_0509636 | 3300035695 | Bacteria | 795 |
| 568 | Ga0373933_0001234 | 3300035724 | Bacteria | 15117 |
| 569 | Ga0373933_0080406 | 3300035724 | Bacteria | 1998 |
| 570 | Ga0373933_0090603 | 3300035724 | Bacteria | 1886 |
| 571 | Ga0373933_0138046 | 3300035724 | Bacteria | 1537 |
| 572 | Ga0373933_0162421 | 3300035724 | Bacteria | 1419 |
| 573 | Ga0373933_0210956 | 3300035724 | Bacteria | 1244 |
| 574 | Ga0373933_0518679 | 3300035724 | Bacteria | 781 |
| 575 | Ga0373947_0003871 | 3300035725 | Bacteria | 8810 |
| 576 | Ga0373947_0014412 | 3300035725 | Bacteria | 4534 |
| 577 | Ga0373947_0112291 | 3300035725 | Bacteria | 1723 |
| 578 | Ga0373947_0355669 | 3300035725 | Bacteria | 983 |
| 579 | Ga0373947_0367094 | 3300035725 | Bacteria | 967 |
| 580 | Ga0373947_0381647 | 3300035725 | Bacteria | 949 |
| 581 | Ga0373937_0000313 | 3300036401 | Bacteria | 45893 |
| 582 | Ga0373937_0001469 | 3300036401 | Bacteria | 19735 |
| 583 | Ga0373937_0035405 | 3300036401 | Bacteria | 4544 |
| 584 | Ga0373937_0063706 | 3300036401 | Bacteria | 3391 |
| 585 | Ga0373937_0137131 | 3300036401 | Bacteria | 2288 |
| 586 | Ga0373937_0159420 | 3300036401 | Bacteria | 2115 |
| 587 | Ga0373937_0419564 | 3300036401 | Bacteria | 1270 |
| 588 | Ga0373925_0000025 | 3300037068 | Bacteria | 154937 |
| 589 | Ga0373925_0889035 | 3300037068 | Bacteria | 734 |
| 590 | Ga0439438_001492 | 3300041405 | Bacteria | 10313 |
| 591 | Ga0439438_003823 | 3300041405 | Bacteria | 5939 |
| 592 | Ga0439438_023847 | 3300041405 | Bacteria | 1682 |
| 593 | Ga0439447_000105 | 3300041407 | Bacteria | 28433 |
| 594 | Ga0439466_0003637 | 3300041411 | Bacteria | 5950 |
| 595 | Ga0439466_0010505 | 3300041411 | Bacteria | 3441 |
| 596 | Ga0439466_0025830 | 3300041411 | Bacteria | 2047 |
| 597 | Ga0439466_0094400 | 3300041411 | Bacteria | 936 |
| 598 | Ga0439465_0020468 | 3300041413 | Bacteria | 2073 |
| 599 | Ga0439465_0096296 | 3300041413 | Bacteria | 1017 |
| 600 | Ga0451789_1257416 | 3300041443 | Bacteria | 721 |
| 601 | Ga0451839_0934718 | 3300041496 | Bacteria | 919 |
| 602 | Ga0439443_000312 | 3300042003 | Bacteria | 4022 |
| 603 | Ga0439432_001244 | 3300042006 | Bacteria | 9628 |
| 604 | Ga0439432_007162 | 3300042006 | Bacteria | 3963 |
| 605 | Ga0439432_053152 | 3300042006 | Bacteria | 1260 |
| 606 | Ga0439449_0002973 | 3300042007 | Bacteria | 6605 |
| 607 | Ga0439451_003335 | 3300042009 | Bacteria | 3252 |
| 608 | Ga0439451_005149 | 3300042009 | Bacteria | 2657 |
| 609 | Ga0439451_037070 | 3300042009 | Bacteria | 979 |
| 610 | Ga0439451_051901 | 3300042009 | Bacteria | 821 |
| 611 | Ga0439452_003422 | 3300042010 | Bacteria | 5558 |
| 612 | Ga0439452_018537 | 3300042010 | Bacteria | 1852 |
| 613 | Ga0439452_028224 | 3300042010 | Bacteria | 1402 |
| 614 | Ga0439456_002134 | 3300042013 | Bacteria | 3988 |
| 615 | Ga0439456_007138 | 3300042013 | Bacteria | 2289 |
| 616 | Ga0439456_014413 | 3300042013 | Bacteria | 1649 |
| 617 | Ga0439456_025865 | 3300042013 | Bacteria | 1247 |
| 618 | Ga0439456_040289 | 3300042013 | Bacteria | 1011 |
| 619 | Ga0439463_006472 | 3300042016 | Bacteria | 2903 |
| 620 | Ga0439463_009292 | 3300042016 | Bacteria | 2418 |
| 621 | Ga0450911_001949 | 3300042115 | Bacteria | 4317 |
| 622 | Ga0450911_002634 | 3300042115 | Bacteria | 3443 |
| 623 | Ga0450911_005287 | 3300042115 | Bacteria | 2021 |
| 624 | Ga0450919_000983 | 3300042121 | Bacteria | 3693 |
| 625 | Ga0450922_004291 | 3300042124 | Bacteria | 1310 |
| 626 | Ga0450890_000101 | 3300042127 | Bacteria | 14188 |
| 627 | Ga0450902_001611 | 3300042137 | Bacteria | 3106 |
| 628 | Ga0450902_013595 | 3300042137 | Bacteria | 1311 |
| 629 | Ga0450902_016670 | 3300042137 | Bacteria | 1198 |
| 630 | Ga0450903_010294 | 3300042138 | Bacteria | 1515 |
| 631 | Ga0450906_010651 | 3300042145 | Bacteria | 1734 |
| 632 | Ga0450906_019807 | 3300042145 | Bacteria | 1205 |
| 633 | Ga0450906_037528 | 3300042145 | Bacteria | 855 |
| 634 | Ga0450910_003043 | 3300042147 | Bacteria | 2211 |
| 635 | Ga0439446_0006756 | 3300042156 | Bacteria | 3003 |
| 636 | Ga0450908_000382 | 3300042184 | Bacteria | 8558 |
| 637 | Ga0439444_0005182 | 3300042437 | Bacteria | 1925 |
| 638 | Ga0439460_0001065 | 3300042461 | Bacteria | 6390 |
| 639 | Ga0439460_0007239 | 3300042461 | Bacteria | 2768 |
| 640 | Ga0439460_0013335 | 3300042461 | Bacteria | 2148 |
| 641 | Ga0450893_0030497 | 3300042532 | Bacteria | 960 |
| 642 | Ga0451577_0056502 | 3300042876 | Bacteria | 3501 |
| 643 | Ga0439440_0003240 | 3300042993 | Bacteria | 3124 |
| 644 | Ga0453683_0000623 | 3300044673 | Bacteria | 38586 |
| 645 | Ga0453684_0060792 | 3300044712 | Bacteria | 4855 |
| 646 | Ga0451576_0003712 | 3300045051 | Bacteria | 20647 |
| 647 | Ga0451576_0069172 | 3300045051 | Bacteria | 3673 |
| 648 | Ga0451576_0217814 | 3300045051 | Bacteria | 1993 |
| 649 | Ga0466967_0846148 | 3300045976 | Bacteria | 909 |
| 650 | Ga0495617_024211 | 3300046452 | Bacteria | 2048 |
| 651 | Ga0495617_037444 | 3300046452 | Bacteria | 1624 |
| 652 | Ga0495617_041106 | 3300046452 | Bacteria | 1546 |
| 653 | Ga0495617_094802 | 3300046452 | Bacteria | 972 |
| 654 | Ga0495627_017242 | 3300046453 | Bacteria | 2458 |
| 655 | Ga0495592_0002157 | 3300046454 | Bacteria | 13860 |
| 656 | Ga0495592_0021167 | 3300046454 | Bacteria | 4946 |
| 657 | Ga0495592_0053446 | 3300046454 | Bacteria | 2996 |
| 658 | Ga0495592_0151922 | 3300046454 | Bacteria | 1601 |
| 659 | Ga0495603_0019806 | 3300046455 | Bacteria | 4073 |
| 660 | Ga0495603_0024281 | 3300046455 | Bacteria | 3666 |
| 661 | Ga0495603_0087914 | 3300046455 | Bacteria | 1818 |
| 662 | Ga0495603_0117631 | 3300046455 | Bacteria | 1549 |
| 663 | Ga0495590_0002436 | 3300046457 | Bacteria | 7712 |
| 664 | Ga0495590_0011474 | 3300046457 | Bacteria | 3313 |
| 665 | Ga0495590_0013209 | 3300046457 | Bacteria | 3042 |
| 666 | Ga0495590_0106352 | 3300046457 | Bacteria | 999 |
| 667 | Ga0495591_000194 | 3300046458 | Bacteria | 61820 |
| 668 | Ga0495591_023695 | 3300046458 | Bacteria | 1961 |
| 669 | Ga0495591_044038 | 3300046458 | Bacteria | 1252 |
| 670 | Ga0495591_056327 | 3300046458 | Bacteria | 1057 |
| 671 | Ga0495629_0002377 | 3300046459 | Bacteria | 14477 |
| 672 | Ga0495629_0013043 | 3300046459 | Bacteria | 6005 |
| 673 | Ga0495629_0027771 | 3300046459 | Bacteria | 4019 |
| 674 | Ga0495629_0101079 | 3300046459 | Bacteria | 2012 |
| 675 | Ga0495629_0141495 | 3300046459 | Bacteria | 1674 |
| 676 | Ga0495629_0156653 | 3300046459 | Bacteria | 1582 |
| 677 | Ga0495629_0409188 | 3300046459 | Bacteria | 921 |
| 678 | Ga0495629_0429025 | 3300046459 | Bacteria | 896 |
| 679 | Ga0495638_0006291 | 3300046460 | Bacteria | 8658 |
| 680 | Ga0495638_0010334 | 3300046460 | Bacteria | 6490 |
| 681 | Ga0495638_0027024 | 3300046460 | Bacteria | 3716 |
| 682 | Ga0495638_0034295 | 3300046460 | Bacteria | 3240 |
| 683 | Ga0495638_0150042 | 3300046460 | Bacteria | 1352 |
| 684 | Ga0495641_0325591 | 3300046461 | Bacteria | 694 |
| 685 | Ga0495651_0000283 | 3300046462 | Bacteria | 39478 |
| 686 | Ga0495651_0008148 | 3300046462 | Bacteria | 8036 |
| 687 | Ga0495651_0032787 | 3300046462 | Bacteria | 4051 |
| 688 | Ga0495651_0126226 | 3300046462 | Bacteria | 1873 |
| 689 | Ga0495651_0168906 | 3300046462 | Bacteria | 1560 |
| 690 | Ga0495653_0000041 | 3300046463 | Bacteria | 118366 |
| 691 | Ga0495653_0074943 | 3300046463 | Bacteria | 2520 |
| 692 | Ga0495653_0128500 | 3300046463 | Bacteria | 1797 |
| 693 | Ga0495653_0218296 | 3300046463 | Bacteria | 1283 |
| 694 | Ga0495650_0002333 | 3300046471 | Bacteria | 15693 |
| 695 | Ga0495650_0034994 | 3300046471 | Bacteria | 2215 |
| 696 | Ga0495650_0068542 | 3300046471 | Bacteria | 1399 |
| 697 | Ga0495580_0000157 | 3300046472 | Bacteria | 49611 |
| 698 | Ga0495580_0123458 | 3300046472 | Bacteria | 1797 |
| 699 | Ga0495580_0225746 | 3300046472 | Bacteria | 1286 |
| 700 | Ga0495582_0049527 | 3300046473 | Bacteria | 2313 |
| 701 | Ga0495605_0014878 | 3300046474 | Bacteria | 4245 |
| 702 | Ga0495605_0044806 | 3300046474 | Bacteria | 2184 |
| 703 | Ga0495605_0101852 | 3300046474 | Bacteria | 1319 |
| 704 | Ga0495605_0142283 | 3300046474 | Bacteria | 1075 |
| 705 | Ga0495605_0145495 | 3300046474 | Bacteria | 1060 |
| 706 | Ga0495639_0020279 | 3300046475 | Bacteria | 2904 |
| 707 | Ga0495639_0030576 | 3300046475 | Bacteria | 2393 |
| 708 | Ga0495639_0107428 | 3300046475 | Bacteria | 1322 |
| 709 | Ga0495639_0130128 | 3300046475 | Bacteria | 1204 |
| 710 | Ga0495662_0001774 | 3300046476 | Bacteria | 10792 |
| 711 | Ga0495662_0055819 | 3300046476 | Bacteria | 1908 |
| 712 | Ga0495662_0288985 | 3300046476 | Bacteria | 807 |
| 713 | Ga0495662_0365773 | 3300046476 | Bacteria | 709 |
| 714 | Ga0495664_0000005 | 3300046477 | Bacteria | 439635 |
| 715 | Ga0495664_0091467 | 3300046477 | Bacteria | 1829 |
| 716 | Ga0495664_0115215 | 3300046477 | Bacteria | 1624 |
| 717 | Ga0495664_0221177 | 3300046477 | Bacteria | 1146 |
| 718 | Ga0495584_0000774 | 3300046491 | Bacteria | 21121 |
| 719 | Ga0495584_0001348 | 3300046491 | Bacteria | 14843 |
| 720 | Ga0495584_0002868 | 3300046491 | Bacteria | 9629 |
| 721 | Ga0495584_0005465 | 3300046491 | Bacteria | 6732 |
| 722 | Ga0495584_0005468 | 3300046491 | Bacteria | 6730 |
| 723 | Ga0495584_0018316 | 3300046491 | Bacteria | 3559 |
| 724 | Ga0495584_0038977 | 3300046491 | Bacteria | 2401 |
| 725 | Ga0495584_0077882 | 3300046491 | Bacteria | 1668 |
| 726 | Ga0495584_0251872 | 3300046491 | Bacteria | 898 |
| 727 | Ga0495585_0027067 | 3300046492 | Bacteria | 3273 |
| 728 | Ga0495585_0142003 | 3300046492 | Bacteria | 1257 |
| 729 | Ga0495585_0333727 | 3300046492 | Bacteria | 739 |
| 730 | Ga0495594_0020262 | 3300046499 | Bacteria | 3541 |
| 731 | Ga0495594_0111673 | 3300046499 | Bacteria | 1541 |
| 732 | Ga0495594_0170158 | 3300046499 | Bacteria | 1239 |
| 733 | Ga0495594_0241056 | 3300046499 | Bacteria | 1030 |
| 734 | Ga0495594_0385401 | 3300046499 | Bacteria | 798 |
| 735 | Ga0495596_0000142 | 3300046500 | Bacteria | 49330 |
| 736 | Ga0495607_0006507 | 3300046501 | Bacteria | 8213 |
| 737 | Ga0495607_0015350 | 3300046501 | Bacteria | 4967 |
| 738 | Ga0495607_0019055 | 3300046501 | Bacteria | 4362 |
| 739 | Ga0495607_0026409 | 3300046501 | Bacteria | 3603 |
| 740 | Ga0495607_0117204 | 3300046501 | Bacteria | 1403 |
| 741 | Ga0495583_0097235 | 3300046506 | Bacteria | 1260 |
| 742 | Ga0495606_0006616 | 3300046507 | Bacteria | 10638 |
| 743 | Ga0495606_0006667 | 3300046507 | Bacteria | 10587 |
| 744 | Ga0495608_0000003 | 3300046511 | Bacteria | 369831 |
| 745 | Ga0495608_0057618 | 3300046511 | Bacteria | 2563 |
| 746 | Ga0495608_0099718 | 3300046511 | Bacteria | 1873 |
| 747 | Ga0495610_0004766 | 3300046512 | Bacteria | 9894 |
| 748 | Ga0495610_0017853 | 3300046512 | Bacteria | 4029 |
| 749 | Ga0495610_0087130 | 3300046512 | Bacteria | 1421 |
| 750 | Ga0495616_0002369 | 3300046513 | Bacteria | 12559 |
| 751 | Ga0495616_0020167 | 3300046513 | Bacteria | 3631 |
| 752 | Ga0495616_0020924 | 3300046513 | Bacteria | 3552 |
| 753 | Ga0495616_0047365 | 3300046513 | Bacteria | 2165 |
| 754 | Ga0495616_0053390 | 3300046513 | Bacteria | 2008 |
| 755 | Ga0495618_0000010 | 3300046514 | Bacteria | 189314 |
| 756 | Ga0495618_0006339 | 3300046514 | Bacteria | 7181 |
| 757 | Ga0495618_0010308 | 3300046514 | Bacteria | 5654 |
| 758 | Ga0495618_0056927 | 3300046514 | Bacteria | 2475 |
| 759 | Ga0495618_0237978 | 3300046514 | Bacteria | 1145 |
| 760 | Ga0495620_0002433 | 3300046515 | Bacteria | 10787 |
| 761 | Ga0495620_0019251 | 3300046515 | Bacteria | 3362 |
| 762 | Ga0495620_0138614 | 3300046515 | Bacteria | 952 |
| 763 | Ga0495628_0000019 | 3300046516 | Bacteria | 154435 |
| 764 | Ga0495628_0040050 | 3300046516 | Bacteria | 3746 |
| 765 | Ga0495628_0069866 | 3300046516 | Bacteria | 2739 |
| 766 | Ga0495628_0102898 | 3300046516 | Bacteria | 2203 |
| 767 | Ga0495628_0165765 | 3300046516 | Bacteria | 1677 |
| 768 | Ga0495628_0511648 | 3300046516 | Bacteria | 866 |
| 769 | Ga0495628_0653350 | 3300046516 | Bacteria | 746 |
| 770 | Ga0495630_0005281 | 3300046517 | Bacteria | 9113 |
| 771 | Ga0495630_0020050 | 3300046517 | Bacteria | 4924 |
| 772 | Ga0495630_0029170 | 3300046517 | Bacteria | 4100 |
| 773 | Ga0495630_0057699 | 3300046517 | Bacteria | 2910 |
| 774 | Ga0495630_0199360 | 3300046517 | Bacteria | 1527 |
| 775 | Ga0495630_0208058 | 3300046517 | Bacteria | 1493 |
| 776 | Ga0495630_0505032 | 3300046517 | Bacteria | 927 |
| 777 | Ga0495630_0573283 | 3300046517 | Unclassified | 865 |
| 778 | Ga0495631_0009830 | 3300046518 | Bacteria | 4761 |
| 779 | Ga0495631_0103630 | 3300046518 | Bacteria | 1224 |
| 780 | Ga0495631_0185240 | 3300046518 | Bacteria | 891 |
| 781 | Ga0495632_0002703 | 3300046519 | Bacteria | 13242 |
| 782 | Ga0495632_0003386 | 3300046519 | Bacteria | 11357 |
| 783 | Ga0495632_0019352 | 3300046519 | Bacteria | 3711 |
| 784 | Ga0495632_0057752 | 3300046519 | Bacteria | 1893 |
| 785 | Ga0495637_0001168 | 3300046520 | Bacteria | 16076 |
| 786 | Ga0495637_0003054 | 3300046520 | Bacteria | 8949 |
| 787 | Ga0495637_0033297 | 3300046520 | Bacteria | 2264 |
| 788 | Ga0495637_0064527 | 3300046520 | Bacteria | 1493 |
| 789 | Ga0495637_0176363 | 3300046520 | Bacteria | 794 |
| 790 | Ga0495643_0013290 | 3300046522 | Bacteria | 4932 |
| 791 | Ga0495643_0031487 | 3300046522 | Bacteria | 2951 |
| 792 | Ga0495644_0000468 | 3300046523 | Bacteria | 17485 |
| 793 | Ga0495644_0001015 | 3300046523 | Bacteria | 11697 |
| 794 | Ga0495644_0007759 | 3300046523 | Bacteria | 4137 |
| 795 | Ga0495644_0070222 | 3300046523 | Bacteria | 1316 |
| 796 | Ga0495648_0011641 | 3300046524 | Bacteria | 6608 |
| 797 | Ga0495648_0070469 | 3300046524 | Bacteria | 2031 |
| 798 | Ga0495663_0053033 | 3300046525 | Bacteria | 1260 |
| 799 | Ga0495666_0020964 | 3300046526 | Bacteria | 3236 |
| 800 | Ga0495666_0113673 | 3300046526 | Bacteria | 1271 |
| 801 | Ga0495666_0181017 | 3300046526 | Bacteria | 973 |
| 802 | Ga0495652_0000028 | 3300046529 | Bacteria | 157336 |
| 803 | Ga0495652_0031385 | 3300046529 | Bacteria | 4654 |
| 804 | Ga0495652_0049801 | 3300046529 | Bacteria | 3584 |
| 805 | Ga0495652_0084982 | 3300046529 | Bacteria | 2601 |
| 806 | Ga0495652_0105628 | 3300046529 | Bacteria | 2275 |
| 807 | Ga0495652_0518154 | 3300046529 | Bacteria | 824 |
| 808 | Ga0495654_0003084 | 3300046530 | Bacteria | 10364 |
| 809 | Ga0495654_0007825 | 3300046530 | Bacteria | 5941 |
| 810 | Ga0495654_0008235 | 3300046530 | Bacteria | 5769 |
| 811 | Ga0495654_0056035 | 3300046530 | Bacteria | 1906 |
| 812 | Ga0495654_0101683 | 3300046530 | Bacteria | 1322 |
| 813 | Ga0495654_0128245 | 3300046530 | Bacteria | 1141 |
| 814 | Ga0495654_0177557 | 3300046530 | Bacteria | 924 |
| 815 | Ga0495665_0048785 | 3300046531 | Bacteria | 2245 |
| 816 | Ga0495665_0196999 | 3300046531 | Bacteria | 1045 |
| 817 | Ga0495640_0000014 | 3300046533 | Bacteria | 161741 |
| 818 | Ga0495640_0000946 | 3300046533 | Bacteria | 22440 |
| 819 | Ga0495640_0018796 | 3300046533 | Bacteria | 5114 |
| 820 | Ga0495640_0025477 | 3300046533 | Bacteria | 4290 |
| 821 | Ga0495640_0229015 | 3300046533 | Bacteria | 1169 |
| 822 | Ga0495640_0332048 | 3300046533 | Unclassified | 940 |
| 823 | Ga0495640_0461363 | 3300046533 | Bacteria | 775 |
| 824 | Ga0495586_0064174 | 3300046535 | Bacteria | 2001 |
| 825 | Ga0495586_0186182 | 3300046535 | Bacteria | 1175 |
| 826 | Ga0495586_0222364 | 3300046535 | Bacteria | 1073 |
| 827 | Ga0495587_0000026 | 3300046536 | Bacteria | 147819 |
| 828 | Ga0495587_0003753 | 3300046536 | Bacteria | 10074 |
| 829 | Ga0495587_0005223 | 3300046536 | Bacteria | 8487 |
| 830 | Ga0495587_0008708 | 3300046536 | Bacteria | 6514 |
| 831 | Ga0495598_0018645 | 3300046537 | Bacteria | 1807 |
| 832 | Ga0495598_0028076 | 3300046537 | Bacteria | 1558 |
| 833 | Ga0495598_0167395 | 3300046537 | Bacteria | 777 |
| 834 | Ga0495609_0009563 | 3300046538 | Bacteria | 4687 |
| 835 | Ga0495609_0050094 | 3300046538 | Bacteria | 1862 |
| 836 | Ga0495621_0004372 | 3300046539 | Bacteria | 3971 |
| 837 | Ga0495597_0005357 | 3300046542 | Bacteria | 6801 |
| 838 | Ga0495597_0011083 | 3300046542 | Bacteria | 4378 |
| 839 | Ga0495597_0026484 | 3300046542 | Bacteria | 2663 |
| 840 | Ga0495597_0036119 | 3300046542 | Bacteria | 2227 |
| 841 | Ga0495597_0040991 | 3300046542 | Bacteria | 2069 |
| 842 | Ga0495597_0041134 | 3300046542 | Bacteria | 2065 |
| 843 | Ga0495597_0102509 | 3300046542 | Bacteria | 1205 |
| 844 | Ga0495645_0000005 | 3300046543 | Bacteria | 443917 |
| 845 | Ga0495645_0174782 | 3300046543 | Bacteria | 1476 |
| 846 | Ga0495645_0184950 | 3300046543 | Bacteria | 1424 |
| 847 | Ga0495633_0014133 | 3300046558 | Bacteria | 4184 |
| 848 | Ga0495667_0000003 | 3300046559 | Bacteria | 295404 |
| 849 | Ga0495667_0037027 | 3300046559 | Bacteria | 3253 |
| 850 | Ga0495667_0042670 | 3300046559 | Bacteria | 3008 |
| 851 | Ga0495656_0008898 | 3300046615 | Bacteria | 3601 |
| 852 | Ga0495656_0208682 | 3300046615 | Bacteria | 972 |
| 853 | Ga0495668_0001389 | 3300046616 | Bacteria | 23561 |
| 854 | Ga0495634_0000017 | 3300046642 | Bacteria | 122411 |
| 855 | Ga0495634_0001609 | 3300046642 | Bacteria | 19728 |
| 856 | Ga0495634_0009717 | 3300046642 | Bacteria | 7080 |
| 857 | Ga0495634_0010017 | 3300046642 | Bacteria | 6957 |
| 858 | Ga0495634_0037009 | 3300046642 | Bacteria | 3336 |
| 859 | Ga0495634_0049595 | 3300046642 | Bacteria | 2822 |
| 860 | Ga0495634_0065130 | 3300046642 | Bacteria | 2415 |
| 861 | Ga0495634_0149390 | 3300046642 | Bacteria | 1478 |
| 862 | Ga0495611_0011154 | 3300046648 | Bacteria | 3808 |
| 863 | Ga0495611_0029179 | 3300046648 | Bacteria | 2418 |
| 864 | Ga0495611_0166359 | 3300046648 | Bacteria | 1031 |
| 865 | Ga0495625_0012035 | 3300046660 | Bacteria | 7022 |
| 866 | Ga0495625_0018672 | 3300046660 | Bacteria | 5404 |
| 867 | Ga0495625_0043899 | 3300046660 | Bacteria | 3239 |
| 868 | Ga0495625_0427325 | 3300046660 | Bacteria | 822 |
| 869 | Ga0495635_0000024 | 3300046663 | Bacteria | 148235 |
| 870 | Ga0495635_0002778 | 3300046663 | Bacteria | 12001 |
| 871 | Ga0495635_0010685 | 3300046663 | Bacteria | 6427 |
| 872 | Ga0495635_0026038 | 3300046663 | Bacteria | 4073 |
| 873 | Ga0495635_0112379 | 3300046663 | Unclassified | 1860 |
| 874 | Ga0495659_0004708 | 3300046664 | Bacteria | 4293 |
| 875 | Ga0495659_0064274 | 3300046664 | Bacteria | 1362 |
| 876 | Ga0495661_0010360 | 3300046665 | Bacteria | 6362 |
| 877 | Ga0495661_0028142 | 3300046665 | Bacteria | 3601 |
| 878 | Ga0495661_0058863 | 3300046665 | Bacteria | 2288 |
| 879 | Ga0495661_0082540 | 3300046665 | Bacteria | 1849 |
| 880 | Ga0495661_0104991 | 3300046665 | Bacteria | 1583 |
| 881 | Ga0495588_0048283 | 3300046674 | Bacteria | 2186 |
| 882 | Ga0495588_0162337 | 3300046674 | Bacteria | 1181 |
| 883 | Ga0495588_0332304 | 3300046674 | Bacteria | 799 |
| 884 | Ga0495657_0000034 | 3300046675 | Bacteria | 122360 |
| 885 | Ga0495657_0079863 | 3300046675 | Bacteria | 2118 |
| 886 | Ga0495599_0000017 | 3300046678 | Bacteria | 162507 |
| 887 | Ga0495599_0155072 | 3300046678 | Bacteria | 1417 |
| 888 | Ga0495623_0000028 | 3300046679 | Bacteria | 87634 |
| 889 | Ga0495623_0012865 | 3300046679 | Bacteria | 5421 |
| 890 | Ga0495623_0153544 | 3300046679 | Bacteria | 1359 |
| 891 | Ga0495646_0000015 | 3300046680 | Bacteria | 141718 |
| 892 | Ga0495646_0012842 | 3300046680 | Bacteria | 5325 |
| 893 | Ga0495646_0019757 | 3300046680 | Bacteria | 4259 |
| 894 | Ga0495646_0035958 | 3300046680 | Bacteria | 3070 |
| 895 | Ga0495646_0068799 | 3300046680 | Bacteria | 2089 |
| 896 | Ga0495647_0164642 | 3300046681 | Bacteria | 957 |
| 897 | Ga0495658_0030577 | 3300046683 | Bacteria | 2925 |
| 898 | Ga0495658_0096942 | 3300046683 | Bacteria | 1755 |
| 899 | Ga0495658_0272888 | 3300046683 | Bacteria | 1066 |
| 900 | Ga0495658_0363378 | 3300046683 | Bacteria | 920 |
| 901 | Ga0495613_0042752 | 3300046689 | Bacteria | 3352 |
| 902 | Ga0495613_0050088 | 3300046689 | Bacteria | 3081 |
| 903 | Ga0495613_0072681 | 3300046689 | Bacteria | 2507 |
| 904 | Ga0495613_0089910 | 3300046689 | Bacteria | 2224 |
| 905 | Ga0495624_0003729 | 3300046690 | Bacteria | 11266 |
| 906 | Ga0495624_0081364 | 3300046690 | Bacteria | 2006 |
| 907 | Ga0495624_0344437 | 3300046690 | Bacteria | 896 |
| 908 | Ga0495670_0001106 | 3300046691 | Bacteria | 13088 |
| 909 | Ga0495670_0001964 | 3300046691 | Bacteria | 10104 |
| 910 | Ga0495670_0012957 | 3300046691 | Bacteria | 4099 |
| 911 | Ga0495670_0109139 | 3300046691 | Bacteria | 1431 |
| 912 | Ga0495670_0128649 | 3300046691 | Bacteria | 1319 |
| 913 | Ga0495670_0148850 | 3300046691 | Bacteria | 1227 |
| 914 | Ga0495670_0327684 | 3300046691 | Bacteria | 823 |
| 915 | Ga0495671_0000472 | 3300046692 | Bacteria | 31501 |
| 916 | Ga0495671_0001142 | 3300046692 | Bacteria | 18232 |
| 917 | Ga0495671_0010887 | 3300046692 | Bacteria | 5026 |
| 918 | Ga0495671_0010924 | 3300046692 | Bacteria | 5016 |
| 919 | Ga0495671_0014858 | 3300046692 | Bacteria | 4183 |
| 920 | Ga0495671_0017779 | 3300046692 | Bacteria | 3781 |
| 921 | Ga0495671_0040182 | 3300046692 | Bacteria | 2359 |
| 922 | Ga0495671_0051855 | 3300046692 | Bacteria | 2040 |
| 923 | Ga0495671_0066408 | 3300046692 | Bacteria | 1775 |
| 924 | Ga0495649_0003407 | 3300046694 | Bacteria | 10746 |
| 925 | Ga0495649_0004589 | 3300046694 | Bacteria | 8990 |
| 926 | Ga0495649_0010429 | 3300046694 | Bacteria | 5478 |
| 927 | Ga0495649_0043315 | 3300046694 | Bacteria | 2457 |
| 928 | Ga0495649_0163273 | 3300046694 | Bacteria | 1167 |
| 929 | Ga0495589_0011660 | 3300046794 | Bacteria | 4563 |
| 930 | Ga0495589_0021606 | 3300046794 | Bacteria | 3288 |
| 931 | Ga0495600_0000058 | 3300046809 | Bacteria | 65689 |
| 932 | Ga0495600_0101636 | 3300046809 | Bacteria | 1874 |
| 933 | Ga0495600_0104177 | 3300046809 | Bacteria | 1848 |
| 934 | Ga0495660_0035332 | 3300046810 | Bacteria | 2793 |
| 935 | Ga0495660_0043942 | 3300046810 | Bacteria | 2460 |
| 936 | Ga0495660_0053198 | 3300046810 | Bacteria | 2198 |
| 937 | Ga0495660_0061073 | 3300046810 | Bacteria | 2023 |
| 938 | Ga0495660_0133395 | 3300046810 | Bacteria | 1243 |
| 939 | Ga0495581_0483247 | 3300047315 | Bacteria | 720 |
| 940 | Ga0495604_0000021 | 3300047317 | Bacteria | 169432 |
| 941 | Ga0495604_0002971 | 3300047317 | Bacteria | 13575 |
| 942 | Ga0495604_0005948 | 3300047317 | Bacteria | 9680 |
| 943 | Ga0495604_0022424 | 3300047317 | Bacteria | 5041 |
| 944 | Ga0495604_0130956 | 3300047317 | Bacteria | 1803 |
| 945 | Ga0495604_0188783 | 3300047317 | Bacteria | 1437 |
| 946 | Ga0495636_0107089 | 3300047318 | Bacteria | 1227 |
| 947 | Ga0495636_0146976 | 3300047318 | Bacteria | 1055 |
| 948 | Ga0495674_0000005 | 3300047319 | Bacteria | 375129 |
| 949 | Ga0495674_0011146 | 3300047319 | Bacteria | 8489 |
| 950 | Ga0495674_0014128 | 3300047319 | Bacteria | 7480 |
| 951 | Ga0495674_0017300 | 3300047319 | Bacteria | 6707 |
| 952 | Ga0495674_0040116 | 3300047319 | Bacteria | 4190 |
| 953 | Ga0495674_0082226 | 3300047319 | Bacteria | 2761 |
| 954 | Ga0495674_0120020 | 3300047319 | Bacteria | 2222 |
| 955 | Ga0495674_0143092 | 3300047319 | Bacteria | 2009 |
| 956 | Ga0495674_0276992 | 3300047319 | Bacteria | 1375 |
| 957 | Ga0495674_0408415 | 3300047319 | Bacteria | 1095 |
| 958 | Ga0495672_0004200 | 3300047320 | Bacteria | 11930 |
| 959 | Ga0495672_0006384 | 3300047320 | Bacteria | 9153 |
| 960 | Ga0495672_0037638 | 3300047320 | Bacteria | 2958 |
| 961 | Ga0495672_0050553 | 3300047320 | Bacteria | 2452 |
| 962 | Ga0495676_0026342 | 3300047321 | Bacteria | 5007 |
| 963 | Ga0495676_0028518 | 3300047321 | Bacteria | 4765 |
| 964 | Ga0495676_0059791 | 3300047321 | Bacteria | 2990 |
| 965 | Ga0495676_0134937 | 3300047321 | Bacteria | 1776 |
| 966 | Ga0495676_0136672 | 3300047321 | Bacteria | 1762 |
| 967 | Ga0495676_0388599 | 3300047321 | Bacteria | 927 |
| 968 | Ga0495680_0000222 | 3300047322 | Bacteria | 61837 |
| 969 | Ga0495680_0005923 | 3300047322 | Bacteria | 11425 |
| 970 | Ga0495680_0007247 | 3300047322 | Bacteria | 10214 |
| 971 | Ga0495680_0015308 | 3300047322 | Bacteria | 6618 |
| 972 | Ga0495680_0055885 | 3300047322 | Bacteria | 3059 |
| 973 | Ga0495680_0328873 | 3300047322 | Bacteria | 1068 |
| 974 | Ga0495680_0351773 | 3300047322 | Bacteria | 1025 |
| 975 | Ga0495683_0000329 | 3300047323 | Bacteria | 39891 |
| 976 | Ga0495683_0007352 | 3300047323 | Bacteria | 5966 |
| 977 | Ga0495683_0019704 | 3300047323 | Bacteria | 3481 |
| 978 | Ga0495683_0028815 | 3300047323 | Bacteria | 2838 |
| 979 | Ga0495683_0097355 | 3300047323 | Bacteria | 1418 |
| 980 | Ga0495675_0000173 | 3300047444 | Bacteria | 46825 |
| 981 | Ga0495675_0018919 | 3300047444 | Bacteria | 4376 |
| 982 | Ga0495677_0205660 | 3300047445 | Bacteria | 766 |
| 983 | Ga0495679_013688 | 3300047446 | Bacteria | 3033 |
| 984 | Ga0495673_0000684 | 3300047469 | Bacteria | 33224 |
| 985 | Ga0495673_0003103 | 3300047469 | Bacteria | 11141 |
| 986 | Ga0495673_0008822 | 3300047469 | Bacteria | 5625 |
| 987 | Ga0495673_0015134 | 3300047469 | Bacteria | 3985 |
| 988 | Ga0495673_0016750 | 3300047469 | Bacteria | 3738 |
| 989 | Ga0495673_0036206 | 3300047469 | Bacteria | 2266 |
| 990 | Ga0495681_0000571 | 3300047470 | Bacteria | 28196 |
| 991 | Ga0495681_0001390 | 3300047470 | Bacteria | 18260 |
| 992 | Ga0495681_0009001 | 3300047470 | Bacteria | 6196 |
| 993 | Ga0495681_0014693 | 3300047470 | Bacteria | 4473 |
| 994 | Ga0495681_0017362 | 3300047470 | Bacteria | 3997 |
| 995 | Ga0495681_0022862 | 3300047470 | Bacteria | 3335 |
| 996 | Ga0495681_0216198 | 3300047470 | Bacteria | 771 |
| 997 | Ga0495684_0000001 | 3300047471 | Bacteria | 369809 |
| 998 | Ga0495684_0000945 | 3300047471 | Bacteria | 23655 |
| 999 | Ga0495684_0011640 | 3300047471 | Bacteria | 6790 |
| 1000 | Ga0495684_0118445 | 3300047471 | Bacteria | 1996 |
| 1001 | Ga0495684_0138874 | 3300047471 | Bacteria | 1822 |
| 1002 | Ga0495684_0166899 | 3300047471 | Bacteria | 1639 |
| 1003 | Ga0495684_0363468 | 3300047471 | Bacteria | 1024 |
| 1004 | Ga0495684_0485360 | 3300047471 | Bacteria | 852 |
| 1005 | Ga0495684_0500057 | 3300047471 | Bacteria | 836 |
| 1006 | Ga0495686_0379704 | 3300047472 | Bacteria | 762 |
| 1007 | Ga0495593_0059774 | 3300047673 | Bacteria | 1996 |
| 1008 | Ga0495593_0108816 | 3300047673 | Bacteria | 1416 |
| 1009 | Ga0495602_0000003 | 3300048088 | Bacteria | 357240 |
| 1010 | Ga0495602_0065515 | 3300048088 | Bacteria | 3135 |
| 1011 | Ga0495614_0081055 | 3300048089 | Bacteria | 1406 |
| 1012 | Ga0495626_0000439 | 3300048091 | Bacteria | 42547 |
| 1013 | Ga0495626_0000510 | 3300048091 | Bacteria | 38895 |
| 1014 | Ga0495626_0002843 | 3300048091 | Bacteria | 11571 |
| 1015 | Ga0495626_0007916 | 3300048091 | Bacteria | 5883 |
| 1016 | Ga0495626_0117367 | 3300048091 | Bacteria | 1147 |
| 1017 | Ga0495626_0209339 | 3300048091 | Bacteria | 796 |
| 1018 | Ga0496101_0079623 | 3300048904 | Bacteria | 2419 |
| 1019 | Ga0496101_0209857 | 3300048904 | Bacteria | 1508 |
| 1020 | Ga0496101_0436442 | 3300048904 | Bacteria | 1033 |
| 1021 | Ga0496102_0000837 | 3300048905 | Bacteria | 29565 |
| 1022 | Ga0496102_0062418 | 3300048905 | Bacteria | 3412 |
| 1023 | Ga0496102_0177184 | 3300048905 | Bacteria | 2008 |
| 1024 | Ga0496102_0352677 | 3300048905 | Bacteria | 1385 |
| 1025 | Ga0496102_0562277 | 3300048905 | Bacteria | 1063 |
| 1026 | Ga0496103_0004343 | 3300048906 | Bacteria | 8608 |
| 1027 | Ga0496103_0547401 | 3300048906 | Bacteria | 739 |
| 1028 | Ga0496104_0001024 | 3300048907 | Bacteria | 23928 |
| 1029 | Ga0496104_0005082 | 3300048907 | Bacteria | 11482 |
| 1030 | Ga0496104_0007414 | 3300048907 | Bacteria | 9694 |
| 1031 | Ga0496104_0118065 | 3300048907 | Bacteria | 2546 |
| 1032 | Ga0496104_0141620 | 3300048907 | Bacteria | 2310 |
| 1033 | Ga0496105_0034245 | 3300048908 | Bacteria | 4176 |
| 1034 | Ga0496106_0170332 | 3300048909 | Bacteria | 1725 |
| 1035 | Ga0496106_0765336 | 3300048909 | Bacteria | 767 |
| 1036 | Ga0496108_0004479 | 3300048911 | Bacteria | 11245 |
| 1037 | Ga0496108_0151530 | 3300048911 | Bacteria | 2001 |
| 1038 | Ga0496108_0436198 | 3300048911 | Bacteria | 1144 |
| 1039 | Ga0496109_0021985 | 3300048912 | Bacteria | 5646 |
| 1040 | Ga0496109_0259724 | 3300048912 | Bacteria | 1636 |
| 1041 | Ga0496110_0002432 | 3300048913 | Bacteria | 13954 |
| 1042 | Ga0496110_0007846 | 3300048913 | Bacteria | 8550 |
| 1043 | Ga0496111_0032677 | 3300048914 | Bacteria | 3710 |
| 1044 | Ga0496111_0045810 | 3300048914 | Bacteria | 3147 |
| 1045 | Ga0496111_0692311 | 3300048914 | Bacteria | 742 |
| 1046 | Ga0496113_0105770 | 3300048916 | Bacteria | 2185 |
| 1047 | Ga0496113_0241677 | 3300048916 | Bacteria | 1441 |
| 1048 | Ga0496113_0502051 | 3300048916 | Bacteria | 974 |
| 1049 | Ga0496114_0772617 | 3300048917 | Bacteria | 839 |
| 1050 | Ga0496115_0071689 | 3300048918 | Bacteria | 2810 |
| 1051 | Ga0496115_0154878 | 3300048918 | Bacteria | 1893 |
| 1052 | Ga0496116_0028779 | 3300048919 | Bacteria | 4018 |
| 1053 | Ga0496117_0006279 | 3300048920 | Bacteria | 12101 |
| 1054 | Ga0496117_0151120 | 3300048920 | Bacteria | 1374 |
| 1055 | Ga0496118_0008651 | 3300048921 | Bacteria | 10470 |
| 1056 | Ga0496118_0051925 | 3300048921 | Bacteria | 3132 |
| 1057 | Ga0496121_0054623 | 3300048924 | Bacteria | 3335 |
| 1058 | Ga0496121_0077684 | 3300048924 | Bacteria | 2642 |
| 1059 | Ga0496124_0004885 | 3300048927 | Bacteria | 15421 |
| 1060 | Ga0496124_0009323 | 3300048927 | Bacteria | 10114 |
| 1061 | Ga0496124_0078936 | 3300048927 | Bacteria | 2711 |
| 1062 | Ga0496124_0329738 | 3300048927 | Bacteria | 1089 |
| 1063 | Ga0496126_0069460 | 3300048929 | Bacteria | 3142 |
| 1064 | Ga0495678_002210 | 3300049459 | Bacteria | 13643 |
| 1065 | Ga0495678_007559 | 3300049459 | Bacteria | 5612 |
| 1066 | Ga0495678_038216 | 3300049459 | Bacteria | 1944 |
| 1067 | Ga0495678_165543 | 3300049459 | Bacteria | 703 |
| 1068 | Ga0495682_0026861 | 3300049460 | Bacteria | 2136 |
| 1069 | Ga0501034_0801201 | 3300049571 | Bacteria | 835 |
| 1070 | Ga0501037_0117428 | 3300049573 | Bacteria | 1914 |
| 1071 | Ga0501040_0198045 | 3300049576 | Bacteria | 1426 |
| 1072 | Ga0501041_0185203 | 3300049577 | Bacteria | 1304 |
| 1073 | Ga0501067_0444367 | 3300049583 | Bacteria | 724 |
| 1074 | Ga0501071_0182209 | 3300049587 | Bacteria | 1574 |
| 1075 | Ga0501075_0077762 | 3300049591 | Bacteria | 2511 |
| 1076 | Ga0501075_0088162 | 3300049591 | Bacteria | 2352 |
| 1077 | Ga0501081_0219251 | 3300049743 | Bacteria | 1383 |
| 1078 | nmdc:mga03683_360479_c1 | 3300050489 | Bacteria | 689 |
| 1079 | nmdc:mga06z11_464399_c1 | 3300050494 | Bacteria | 765 |
| 1080 | nmdc:mga05p37_394764_c1 | 3300050507 | Bacteria | 1617 |
| 1081 | nmdc:mga05p37_49656_c1 | 3300050507 | Bacteria | 5161 |
| 1082 | nmdc:mga09592_264265_c1 | 3300050508 | Bacteria | 1493 |
| 1083 | nmdc:mga09592_40616_c1 | 3300050508 | Bacteria | 3909 |
| 1084 | nmdc:mga09592_478835_c1 | 3300050508 | Bacteria | 1073 |
| 1085 | nmdc:mga0qj67_31004_c1 | 3300050509 | Bacteria | 4164 |
| 1086 | nmdc:mga0qj67_487028_c1 | 3300050509 | Bacteria | 992 |
| 1087 | nmdc:mga0qj67_59978_c1 | 3300050509 | Bacteria | 3018 |
| 1088 | nmdc:mga08y16_1422931_c1 | 3300050511 | Bacteria | 656 |
| 1089 | nmdc:mga08y16_406940_c1 | 3300050511 | Bacteria | 1392 |
| 1090 | nmdc:mga08y16_41205_c1 | 3300050511 | Bacteria | 4839 |
| 1091 | nmdc:mga08y16_604941_c1 | 3300050511 | Bacteria | 1105 |
| 1092 | nmdc:mga08y16_98542_c1 | 3300050511 | Bacteria | 3044 |
| 1093 | nmdc:mga0n895_1203541_c1 | 3300050512 | Bacteria | 731 |
| 1094 | nmdc:mga0n895_17270_c1 | 3300050512 | Bacteria | 6649 |
| 1095 | nmdc:mga0n895_209223_c1 | 3300050512 | Bacteria | 1981 |
| 1096 | nmdc:mga0n895_25840_c1 | 3300050512 | Bacteria | 5554 |
| 1097 | nmdc:mga0n895_48212_c1 | 3300050512 | Bacteria | 4169 |
| 1098 | nmdc:mga0n895_756553_c1 | 3300050512 | Bacteria | 964 |
| 1099 | nmdc:mga0n895_93679_c1 | 3300050512 | Bacteria | 3007 |
| 1100 | nmdc:mga0rr50_105236_c1 | 3300050513 | Bacteria | 2225 |
| 1101 | nmdc:mga0rr50_261522_c1 | 3300050513 | Bacteria | 1440 |
| 1102 | nmdc:mga0rr50_405564_c1 | 3300050513 | Bacteria | 1152 |
| 1103 | nmdc:mga0rr50_56035_c1 | 3300050513 | Bacteria | 2944 |
| 1104 | nmdc:mga0rr50_716109_c1 | 3300050513 | Bacteria | 854 |
| 1105 | nmdc:mga08x19_161298_c1 | 3300050514 | Bacteria | 1523 |
| 1106 | nmdc:mga08x19_345160_c1 | 3300050514 | Bacteria | 1039 |
| 1107 | nmdc:mga08x19_35_c1 | 3300050514 | Bacteria | 185171 |
| 1108 | nmdc:mga0a205_19958_c1 | 3300050515 | Bacteria | 6324 |
| 1109 | nmdc:mga0a205_37485_c1 | 3300050515 | Bacteria | 4662 |
| 1110 | nmdc:mga0a205_497_c1 | 3300050515 | Bacteria | 30781 |
| 1111 | nmdc:mga0a205_844721_c1 | 3300050515 | Bacteria | 763 |
| 1112 | Ga0495601_0000005 | 3300053077 | Bacteria | 387079 |
| 1113 | Ga0495601_0000980 | 3300053077 | Bacteria | 15588 |
| 1114 | Ga0495601_0004375 | 3300053077 | Bacteria | 8161 |
| 1115 | Ga0495601_0005989 | 3300053077 | Bacteria | 7094 |
| 1116 | Ga0495601_0032295 | 3300053077 | Bacteria | 3258 |
| 1117 | Ga0495601_0084223 | 3300053077 | Bacteria | 2042 |
| 1118 | Ga0495601_0155333 | 3300053077 | Bacteria | 1494 |
| 1119 | Ga0495601_0442565 | 3300053077 | Bacteria | 841 |
| 1120 | Ga0495612_0000001 | 3300053078 | Bacteria | 418244 |
| 1121 | Ga0495612_0005906 | 3300053078 | Bacteria | 5047 |
| 1122 | Ga0495612_0014025 | 3300053078 | Bacteria | 3227 |
| 1123 | Ga0495612_0042793 | 3300053078 | Bacteria | 1849 |
| 1124 | Ga0495655_0178544 | 3300053083 | Bacteria | 683 |
| 1125 | Ga0495595_0000033 | 3300053084 | Bacteria | 86879 |
| 1126 | Ga0495595_0001344 | 3300053084 | Bacteria | 9553 |
| 1127 | Ga0495595_0001798 | 3300053084 | Bacteria | 8362 |
| 1128 | Ga0495595_0017852 | 3300053084 | Bacteria | 3056 |
| 1129 | Ga0495595_0308317 | 3300053084 | Bacteria | 797 |
| 1130 | Ga0495619_0000007 | 3300053085 | Bacteria | 369936 |
| 1131 | Ga0495619_0001550 | 3300053085 | Bacteria | 15134 |
| 1132 | Ga0495619_0003438 | 3300053085 | Bacteria | 10218 |
| 1133 | Ga0495619_0006725 | 3300053085 | Bacteria | 7274 |
| 1134 | Ga0495619_0008428 | 3300053085 | Bacteria | 6516 |
| 1135 | Ga0495619_0083323 | 3300053085 | Bacteria | 2157 |
| 1136 | Ga0495619_0111200 | 3300053085 | Bacteria | 1872 |
| 1137 | Ga0495619_0153905 | 3300053085 | Bacteria | 1586 |
| 1138 | Ga0495619_0281309 | 3300053085 | Bacteria | 1153 |
| 1139 | Ga0590075_016342 | 3300059424 | Bacteria | 1825 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035410 | Ga0373924_0010215 | Ga0373924_0010215_2695_3336 | 201 |
| 2 | 3300028573 | Ga0265334_10003454 | Ga0265334_100034542 | 203 |
| 3 | 3300028577 | Ga0265318_10001215 | Ga0265318_100012155 | 203 |
| 4 | 3300028800 | Ga0265338_10005969 | Ga0265338_1000596914 | 203 |
| 5 | 3300031235 | Ga0265330_10003654 | Ga0265330_100036542 | 203 |
| 6 | 3300031238 | Ga0265332_10001462 | Ga0265332_100014624 | 203 |
| 7 | 3300031239 | Ga0265328_10026383 | Ga0265328_100263832 | 203 |
| 8 | 3300031240 | Ga0265320_10002610 | Ga0265320_100026104 | 203 |
| 9 | 3300031241 | Ga0265325_10005974 | Ga0265325_100059744 | 203 |
| 10 | 3300031242 | Ga0265329_10001757 | Ga0265329_100017571 | 203 |
| 11 | 3300031249 | Ga0265339_10013975 | Ga0265339_100139754 | 203 |
| 12 | 3300031250 | Ga0265331_10005568 | Ga0265331_1000556812 | 203 |
| 13 | 3300031344 | Ga0265316_10009140 | Ga0265316_100091404 | 203 |
| 14 | 3300031595 | Ga0265313_10006665 | Ga0265313_100066657 | 203 |
| 15 | 3300031711 | Ga0265314_10006556 | Ga0265314_100065566 | 203 |
| 16 | 3300031712 | Ga0265342_10002161 | Ga0265342_1000216116 | 203 |
| 17 | 3300005439 | Ga0070711_100337560 | Ga0070711_1003375602 | 205 |
| 18 | 3300005543 | Ga0070672_100021698 | Ga0070672_1000216982 | 205 |
| 19 | 3300005842 | Ga0068858_100171424 | Ga0068858_1001714243 | 205 |
| 20 | 3300005843 | Ga0068860_100253259 | Ga0068860_1002532592 | 205 |
| 21 | 3300005844 | Ga0068862_100676069 | Ga0068862_1006760692 | 205 |
| 22 | 3300009177 | Ga0105248_10001643 | Ga0105248_1000164319 | 205 |
| 23 | 3300013297 | Ga0157378_10366414 | Ga0157378_103664142 | 205 |
| 24 | 3300013306 | Ga0163162_10207566 | Ga0163162_102075662 | 205 |
| 25 | 3300013308 | Ga0157375_10059181 | Ga0157375_100591814 | 205 |
| 26 | 3300025931 | Ga0207644_10018513 | Ga0207644_100185133 | 205 |
| 27 | 3300025941 | Ga0207711_10027441 | Ga0207711_100274412 | 205 |
| 28 | 3300026035 | Ga0207703_10142333 | Ga0207703_101423333 | 205 |
| 29 | 3300035725 | Ga0373947_0381647 | Ga0373947_0381647_203_829 | 205 |
| 30 | 3300045976 | Ga0466967_0846148 | Ga0466967_0846148_127_744 | 205 |
| 31 | 3300048905 | Ga0496102_0352677 | Ga0496102_0352677_360_983 | 205 |
| 32 | 3300048911 | Ga0496108_0151530 | Ga0496108_0151530_1082_1705 | 205 |
| 33 | iso_pu_bacteria | 2511231004 | 2511256380 | 205 |
| 34 | iso_pu_bacteria | 2511231012 | 2511300737 | 205 |
| 35 | iso_pu_bacteria | 2511231015 | 2511321024 | 205 |
| 36 | iso_pu_bacteria | 2511231016 | 2511326295 | 205 |
| 37 | iso_pu_bacteria | 2511231018 | 2511340115 | 205 |
| 38 | iso_pu_bacteria | 2643221565 | 2643840744 | 205 |
| 39 | iso_pu_bacteria | 2773857670 | 2774119766 | 205 |
| 40 | iso_pu_bacteria | 2784132072 | 2784315020 | 205 |
| 41 | iso_pu_bacteria | 2808606377 | 2808931164 | 205 |
| 42 | iso_pu_bacteria | 2808606381 | 2808953346 | 205 |
| 43 | iso_pu_bacteria | 2857537821 | 2857539358 | 205 |
| 44 | iso_pu_bacteria | 2919456309 | 2919459759 | 205 |
| 45 | iso_pu_bacteria | 2931396565 | 2931398619 | 205 |
| 46 | iso_pu_bacteria | 8056125926 | 8056126261 | 205 |
| 47 | iso_pu_bacteria | 8056155041 | 8056158301 | 205 |
| 48 | 3300005295 | Ga0065707_10231719 | Ga0065707_102317191 | 206 |
| 49 | 3300005328 | Ga0070676_10343574 | Ga0070676_103435742 | 206 |
| 50 | 3300005330 | Ga0070690_100004121 | Ga0070690_1000041217 | 206 |
| 51 | 3300005334 | Ga0068869_100007257 | Ga0068869_1000072575 | 206 |
| 52 | 3300005336 | Ga0070680_100003142 | Ga0070680_1000031424 | 206 |
| 53 | 3300005337 | Ga0070682_100030658 | Ga0070682_1000306582 | 206 |
| 54 | 3300005338 | Ga0068868_100011124 | Ga0068868_1000111246 | 206 |
| 55 | 3300005340 | Ga0070689_100336428 | Ga0070689_1003364281 | 206 |
| 56 | 3300005341 | Ga0070691_10003222 | Ga0070691_100032223 | 206 |
| 57 | 3300005343 | Ga0070687_100002697 | Ga0070687_1000026972 | 206 |
| 58 | 3300005345 | Ga0070692_10064768 | Ga0070692_100647682 | 206 |
| 59 | 3300005353 | Ga0070669_100102206 | Ga0070669_1001022062 | 206 |
| 60 | 3300005355 | Ga0070671_100087118 | Ga0070671_1000871181 | 206 |
| 61 | 3300005364 | Ga0070673_100516696 | Ga0070673_1005166962 | 206 |
| 62 | 3300005365 | Ga0070688_100336608 | Ga0070688_1003366082 | 206 |
| 63 | 3300005406 | Ga0070703_10006823 | Ga0070703_100068234 | 206 |
| 64 | 3300005440 | Ga0070705_100002548 | Ga0070705_1000025485 | 206 |
| 65 | 3300005441 | Ga0070700_100009639 | Ga0070700_1000096393 | 206 |
| 66 | 3300005444 | Ga0070694_100013810 | Ga0070694_1000138102 | 206 |
| 67 | 3300005445 | Ga0070708_100395528 | Ga0070708_1003955282 | 206 |
| 68 | 3300005458 | Ga0070681_10402764 | Ga0070681_104027642 | 206 |
| 69 | 3300005459 | Ga0068867_100006836 | Ga0068867_1000068367 | 206 |
| 70 | 3300005468 | Ga0070707_100585566 | Ga0070707_1005855662 | 206 |
| 71 | 3300005530 | Ga0070679_100001875 | Ga0070679_1000018758 | 206 |
| 72 | 3300005544 | Ga0070686_100006730 | Ga0070686_1000067307 | 206 |
| 73 | 3300005545 | Ga0070695_100004287 | Ga0070695_1000042877 | 206 |
| 74 | 3300005546 | Ga0070696_100001122 | Ga0070696_1000011228 | 206 |
| 75 | 3300005547 | Ga0070693_100006305 | Ga0070693_1000063052 | 206 |
| 76 | 3300005549 | Ga0070704_100000083 | Ga0070704_10000008322 | 206 |
| 77 | 3300005563 | Ga0068855_100025317 | Ga0068855_1000253172 | 206 |
| 78 | 3300005578 | Ga0068854_100050532 | Ga0068854_1000505322 | 206 |
| 79 | 3300005615 | Ga0070702_100007025 | Ga0070702_1000070252 | 206 |
| 80 | 3300005616 | Ga0068852_100499417 | Ga0068852_1004994172 | 206 |
| 81 | 3300005718 | Ga0068866_10002197 | Ga0068866_100021977 | 206 |
| 82 | 3300005719 | Ga0068861_100014217 | Ga0068861_1000142177 | 206 |
| 83 | 3300005842 | Ga0068858_100030844 | Ga0068858_1000308442 | 206 |
| 84 | 3300005842 | Ga0068858_100063190 | Ga0068858_1000631903 | 206 |
| 85 | 3300005843 | Ga0068860_100018123 | Ga0068860_1000181234 | 206 |
| 86 | 3300006028 | Ga0070717_10798187 | Ga0070717_107981872 | 206 |
| 87 | 3300006163 | Ga0070715_10196004 | Ga0070715_101960042 | 206 |
| 88 | 3300006237 | Ga0097621_100017059 | Ga0097621_1000170595 | 206 |
| 89 | 3300006358 | Ga0068871_100003490 | Ga0068871_10000349013 | 206 |
| 90 | 3300006358 | Ga0068871_100078323 | Ga0068871_1000783231 | 206 |
| 91 | 3300006844 | Ga0075428_100010065 | Ga0075428_1000100652 | 206 |
| 92 | 3300006852 | Ga0075433_10108199 | Ga0075433_101081992 | 206 |
| 93 | 3300006871 | Ga0075434_100098906 | Ga0075434_1000989065 | 206 |
| 94 | 3300006880 | Ga0075429_100002284 | Ga0075429_10000228416 | 206 |
| 95 | 3300006914 | Ga0075436_100008330 | Ga0075436_1000083305 | 206 |
| 96 | 3300006914 | Ga0075436_100204011 | Ga0075436_1002040112 | 206 |
| 97 | 3300007076 | Ga0075435_100019017 | Ga0075435_1000190176 | 206 |
| 98 | 3300009092 | Ga0105250_10031050 | Ga0105250_100310503 | 206 |
| 99 | 3300009094 | Ga0111539_10135862 | Ga0111539_101358622 | 206 |
| 100 | 3300009098 | Ga0105245_10002508 | Ga0105245_1000250811 | 206 |
| 101 | 3300009147 | Ga0114129_10057223 | Ga0114129_100572231 | 206 |
| 102 | 3300009148 | Ga0105243_10000828 | Ga0105243_100008285 | 206 |
| 103 | 3300009174 | Ga0105241_10005717 | Ga0105241_100057177 | 206 |
| 104 | 3300009174 | Ga0105241_10374284 | Ga0105241_103742842 | 206 |
| 105 | 3300009176 | Ga0105242_10012860 | Ga0105242_100128602 | 206 |
| 106 | 3300009553 | Ga0105249_10005189 | Ga0105249_100051897 | 206 |
| 107 | 3300010375 | Ga0105239_10050189 | Ga0105239_100501892 | 206 |
| 108 | 3300013297 | Ga0157378_10000905 | Ga0157378_100009054 | 206 |
| 109 | 3300013307 | Ga0157372_10337749 | Ga0157372_103377491 | 206 |
| 110 | 3300014745 | Ga0157377_10084780 | Ga0157377_100847802 | 206 |
| 111 | 3300014968 | Ga0157379_10103200 | Ga0157379_101032002 | 206 |
| 112 | 3300014969 | Ga0157376_10016490 | Ga0157376_100164902 | 206 |
| 113 | 3300014969 | Ga0157376_10067310 | Ga0157376_100673105 | 206 |
| 114 | 3300025885 | Ga0207653_10003361 | Ga0207653_100033613 | 206 |
| 115 | 3300025899 | Ga0207642_10001262 | Ga0207642_100012625 | 206 |
| 116 | 3300025904 | Ga0207647_10115004 | Ga0207647_101150042 | 206 |
| 117 | 3300025907 | Ga0207645_10157508 | Ga0207645_101575081 | 206 |
| 118 | 3300025911 | Ga0207654_10023421 | Ga0207654_100234212 | 206 |
| 119 | 3300025912 | Ga0207707_10318632 | Ga0207707_103186322 | 206 |
| 120 | 3300025917 | Ga0207660_10009077 | Ga0207660_100090772 | 206 |
| 121 | 3300025918 | Ga0207662_10000200 | Ga0207662_100002007 | 206 |
| 122 | 3300025921 | Ga0207652_10202325 | Ga0207652_102023251 | 206 |
| 123 | 3300025926 | Ga0207659_10720493 | Ga0207659_107204931 | 206 |
| 124 | 3300025927 | Ga0207687_10003767 | Ga0207687_1000376710 | 206 |
| 125 | 3300025931 | Ga0207644_10033489 | Ga0207644_100334893 | 206 |
| 126 | 3300025934 | Ga0207686_10006909 | Ga0207686_100069092 | 206 |
| 127 | 3300025935 | Ga0207709_10004256 | Ga0207709_100042567 | 206 |
| 128 | 3300025936 | Ga0207670_10014122 | Ga0207670_100141224 | 206 |
| 129 | 3300025936 | Ga0207670_10159435 | Ga0207670_101594354 | 206 |
| 130 | 3300025938 | Ga0207704_10010803 | Ga0207704_100108032 | 206 |
| 131 | 3300025941 | Ga0207711_10298119 | Ga0207711_102981192 | 206 |
| 132 | 3300025942 | Ga0207689_10000229 | Ga0207689_1000022928 | 206 |
| 133 | 3300025949 | Ga0207667_10088567 | Ga0207667_100885672 | 206 |
| 134 | 3300025961 | Ga0207712_10463353 | Ga0207712_104633532 | 206 |
| 135 | 3300025981 | Ga0207640_10005122 | Ga0207640_100051225 | 206 |
| 136 | 3300026035 | Ga0207703_10049612 | Ga0207703_100496123 | 206 |
| 137 | 3300026035 | Ga0207703_10088267 | Ga0207703_100882672 | 206 |
| 138 | 3300026041 | Ga0207639_10044041 | Ga0207639_100440412 | 206 |
| 139 | 3300026075 | Ga0207708_10005632 | Ga0207708_100056323 | 206 |
| 140 | 3300026078 | Ga0207702_11093543 | Ga0207702_110935431 | 206 |
| 141 | 3300026088 | Ga0207641_10673318 | Ga0207641_106733181 | 206 |
| 142 | 3300026089 | Ga0207648_10000124 | Ga0207648_1000012417 | 206 |
| 143 | 3300026118 | Ga0207675_100001175 | Ga0207675_10000117524 | 206 |
| 144 | 3300026142 | Ga0207698_10096938 | Ga0207698_100969383 | 206 |
| 145 | 3300027907 | Ga0207428_10076391 | Ga0207428_100763914 | 206 |
| 146 | 3300028380 | Ga0268265_10016085 | Ga0268265_100160852 | 206 |
| 147 | 3300028381 | Ga0268264_10001839 | Ga0268264_1000183915 | 206 |
| 148 | 3300034816 | Ga0373930_0006814 | Ga0373930_0006814_560_1180 | 206 |
| 149 | 3300034957 | Ga0373938_0005618 | Ga0373938_0005618_20_640 | 206 |
| 150 | 3300035084 | Ga0373928_0002384 | Ga0373928_0002384_439_1059 | 206 |
| 151 | 3300035086 | Ga0373934_0261101 | Ga0373934_0261101_29_685 | 206 |
| 152 | 3300035088 | Ga0373940_0007019 | Ga0373940_0007019_1676_2296 | 206 |
| 153 | 3300035092 | Ga0373952_0006586 | Ga0373952_0006586_747_1367 | 206 |
| 154 | 3300035111 | Ga0373923_0107122 | Ga0373923_0107122_122_820 | 206 |
| 155 | 3300035112 | Ga0373932_0007442 | Ga0373932_0007442_983_1603 | 206 |
| 156 | 3300035114 | Ga0373939_0023283 | Ga0373939_0023283_764_1384 | 206 |
| 157 | 3300035115 | Ga0373941_0021046 | Ga0373941_0021046_19_639 | 206 |
| 158 | 3300035207 | Ga0373942_0006173 | Ga0373942_0006173_201_821 | 206 |
| 159 | 3300035241 | Ga0373961_0004757 | Ga0373961_0004757_1509_2129 | 206 |
| 160 | 3300035691 | Ga0373931_0018730 | Ga0373931_0018730_1847_2467 | 206 |
| 161 | 3300042003 | Ga0439443_000312 | Ga0439443_000312_958_1587 | 206 |
| 162 | 3300042437 | Ga0439444_0005182 | Ga0439444_0005182_583_1212 | 206 |
| 163 | 3300042461 | Ga0439460_0013335 | Ga0439460_0013335_1125_1754 | 206 |
| 164 | 3300042532 | Ga0450893_0030497 | Ga0450893_0030497_198_827 | 206 |
| 165 | 3300045051 | Ga0451576_0217814 | Ga0451576_0217814_931_1551 | 206 |
| 166 | 3300049576 | Ga0501040_0198045 | Ga0501040_0198045_274_903 | 206 |
| 167 | 3300049591 | Ga0501075_0088162 | Ga0501075_0088162_52_672 | 206 |
| 168 | 3300050508 | nmdc:mga09592_264265_c1 | nmdc:mga09592_264265_c1_606_1226 | 206 |
| 169 | 3300050511 | nmdc:mga08y16_406940_c1 | nmdc:mga08y16_406940_c1_585_1205 | 206 |
| 170 | 3300050511 | nmdc:mga08y16_604941_c1 | nmdc:mga08y16_604941_c1_322_942 | 206 |
| 171 | 3300050512 | nmdc:mga0n895_25840_c1 | nmdc:mga0n895_25840_c1_3463_4083 | 206 |
| 172 | 3300050513 | nmdc:mga0rr50_105236_c1 | nmdc:mga0rr50_105236_c1_181_801 | 206 |
| 173 | 3300050513 | nmdc:mga0rr50_405564_c1 | nmdc:mga0rr50_405564_c1_241_870 | 206 |
| 174 | 3300050515 | nmdc:mga0a205_19958_c1 | nmdc:mga0a205_19958_c1_687_1307 | 206 |
| 175 | 3300053085 | Ga0495619_0281309 | Ga0495619_0281309_114_812 | 206 |
| 176 | 3300005330 | Ga0070690_100079142 | Ga0070690_1000791422 | 207 |
| 177 | 3300005335 | Ga0070666_10132525 | Ga0070666_101325252 | 207 |
| 178 | 3300005338 | Ga0068868_100011828 | Ga0068868_1000118285 | 207 |
| 179 | 3300005343 | Ga0070687_100568821 | Ga0070687_1005688211 | 207 |
| 180 | 3300005355 | Ga0070671_100141714 | Ga0070671_1001417142 | 207 |
| 181 | 3300005364 | Ga0070673_100079768 | Ga0070673_1000797682 | 207 |
| 182 | 3300005367 | Ga0070667_100001093 | Ga0070667_10000109318 | 207 |
| 183 | 3300005435 | Ga0070714_100704411 | Ga0070714_1007044111 | 207 |
| 184 | 3300005436 | Ga0070713_100416573 | Ga0070713_1004165731 | 207 |
| 185 | 3300005439 | Ga0070711_100128317 | Ga0070711_1001283171 | 207 |
| 186 | 3300005439 | Ga0070711_100421991 | Ga0070711_1004219911 | 207 |
| 187 | 3300005439 | Ga0070711_100594474 | Ga0070711_1005944742 | 207 |
| 188 | 3300005440 | Ga0070705_100132290 | Ga0070705_1001322903 | 207 |
| 189 | 3300005543 | Ga0070672_100652490 | Ga0070672_1006524902 | 207 |
| 190 | 3300005547 | Ga0070693_100573191 | Ga0070693_1005731911 | 207 |
| 191 | 3300005548 | Ga0070665_100033616 | Ga0070665_1000336163 | 207 |
| 192 | 3300005615 | Ga0070702_100812849 | Ga0070702_1008128491 | 207 |
| 193 | 3300005616 | Ga0068852_100791229 | Ga0068852_1007912291 | 207 |
| 194 | 3300005617 | Ga0068859_100052283 | Ga0068859_1000522832 | 207 |
| 195 | 3300005618 | Ga0068864_100049722 | Ga0068864_1000497223 | 207 |
| 196 | 3300005841 | Ga0068863_100013022 | Ga0068863_1000130223 | 207 |
| 197 | 3300005842 | Ga0068858_100034170 | Ga0068858_1000341701 | 207 |
| 198 | 3300005843 | Ga0068860_100014740 | Ga0068860_1000147402 | 207 |
| 199 | 3300005937 | Ga0081455_10031813 | Ga0081455_100318139 | 207 |
| 200 | 3300006028 | Ga0070717_10090720 | Ga0070717_100907202 | 207 |
| 201 | 3300006028 | Ga0070717_11119322 | Ga0070717_111193221 | 207 |
| 202 | 3300006038 | Ga0075365_10417902 | Ga0075365_104179021 | 207 |
| 203 | 3300006173 | Ga0070716_100013835 | Ga0070716_1000138354 | 207 |
| 204 | 3300006175 | Ga0070712_100000823 | Ga0070712_10000082318 | 207 |
| 205 | 3300006175 | Ga0070712_100045961 | Ga0070712_1000459614 | 207 |
| 206 | 3300006175 | Ga0070712_100183202 | Ga0070712_1001832023 | 207 |
| 207 | 3300006237 | Ga0097621_100003387 | Ga0097621_1000033879 | 207 |
| 208 | 3300006358 | Ga0068871_100008380 | Ga0068871_1000083804 | 207 |
| 209 | 3300006844 | Ga0075428_100188006 | Ga0075428_1001880062 | 207 |
| 210 | 3300006844 | Ga0075428_100221354 | Ga0075428_1002213542 | 207 |
| 211 | 3300006846 | Ga0075430_100318562 | Ga0075430_1003185622 | 207 |
| 212 | 3300006847 | Ga0075431_100007683 | Ga0075431_1000076835 | 207 |
| 213 | 3300006871 | Ga0075434_100103030 | Ga0075434_1001030303 | 207 |
| 214 | 3300006880 | Ga0075429_100064749 | Ga0075429_1000647491 | 207 |
| 215 | 3300006931 | Ga0097620_100052284 | Ga0097620_1000522842 | 207 |
| 216 | 3300007076 | Ga0075435_100143852 | Ga0075435_1001438523 | 207 |
| 217 | 3300007076 | Ga0075435_100757569 | Ga0075435_1007575692 | 207 |
| 218 | 3300007265 | Ga0099794_10013510 | Ga0099794_100135101 | 207 |
| 219 | 3300009094 | Ga0111539_11131637 | Ga0111539_111316371 | 207 |
| 220 | 3300009098 | Ga0105245_10007367 | Ga0105245_100073672 | 207 |
| 221 | 3300009101 | Ga0105247_10831621 | Ga0105247_108316211 | 207 |
| 222 | 3300009147 | Ga0114129_10141179 | Ga0114129_101411793 | 207 |
| 223 | 3300009176 | Ga0105242_10013252 | Ga0105242_100132522 | 207 |
| 224 | 3300009177 | Ga0105248_10062724 | Ga0105248_100627243 | 207 |
| 225 | 3300009553 | Ga0105249_10000305 | Ga0105249_100003055 | 207 |
| 226 | 3300010159 | Ga0099796_10006396 | Ga0099796_100063962 | 207 |
| 227 | 3300010375 | Ga0105239_10167562 | Ga0105239_101675623 | 207 |
| 228 | 3300013296 | Ga0157374_10061531 | Ga0157374_100615313 | 207 |
| 229 | 3300013297 | Ga0157378_10017494 | Ga0157378_100174942 | 207 |
| 230 | 3300014325 | Ga0163163_10009741 | Ga0163163_100097418 | 207 |
| 231 | 3300014968 | Ga0157379_10001014 | Ga0157379_100010149 | 207 |
| 232 | 3300014969 | Ga0157376_10002734 | Ga0157376_100027348 | 207 |
| 233 | 3300024227 | Ga0228598_1022512 | Ga0228598_10225121 | 207 |
| 234 | 3300025898 | Ga0207692_10228036 | Ga0207692_102280361 | 207 |
| 235 | 3300025906 | Ga0207699_10219647 | Ga0207699_102196472 | 207 |
| 236 | 3300025913 | Ga0207695_10023324 | Ga0207695_100233247 | 207 |
| 237 | 3300025915 | Ga0207693_10035007 | Ga0207693_100350074 | 207 |
| 238 | 3300025915 | Ga0207693_10048168 | Ga0207693_100481684 | 207 |
| 239 | 3300025915 | Ga0207693_10105568 | Ga0207693_101055682 | 207 |
| 240 | 3300025915 | Ga0207693_10229959 | Ga0207693_102299591 | 207 |
| 241 | 3300025916 | Ga0207663_10019562 | Ga0207663_100195623 | 207 |
| 242 | 3300025916 | Ga0207663_10106226 | Ga0207663_101062263 | 207 |
| 243 | 3300025916 | Ga0207663_10168759 | Ga0207663_101687591 | 207 |
| 244 | 3300025916 | Ga0207663_10229335 | Ga0207663_102293352 | 207 |
| 245 | 3300025916 | Ga0207663_10308260 | Ga0207663_103082602 | 207 |
| 246 | 3300025917 | Ga0207660_10634090 | Ga0207660_106340902 | 207 |
| 247 | 3300025928 | Ga0207700_10217207 | Ga0207700_102172072 | 207 |
| 248 | 3300025928 | Ga0207700_10410848 | Ga0207700_104108482 | 207 |
| 249 | 3300025929 | Ga0207664_10160946 | Ga0207664_101609462 | 207 |
| 250 | 3300025939 | Ga0207665_10063492 | Ga0207665_100634922 | 207 |
| 251 | 3300025941 | Ga0207711_10004318 | Ga0207711_100043186 | 207 |
| 252 | 3300025986 | Ga0207658_10006854 | Ga0207658_100068544 | 207 |
| 253 | 3300026023 | Ga0207677_10048141 | Ga0207677_100481412 | 207 |
| 254 | 3300026035 | Ga0207703_10006954 | Ga0207703_100069544 | 207 |
| 255 | 3300026088 | Ga0207641_10044739 | Ga0207641_100447394 | 207 |
| 256 | 3300026095 | Ga0207676_10055704 | Ga0207676_100557042 | 207 |
| 257 | 3300028379 | Ga0268266_10045567 | Ga0268266_100455672 | 207 |
| 258 | 3300028381 | Ga0268264_10048729 | Ga0268264_100487292 | 207 |
| 259 | 3300031250 | Ga0265331_10110186 | Ga0265331_101101862 | 207 |
| 260 | 3300035083 | Ga0373926_0003758 | Ga0373926_0003758_3398_4021 | 207 |
| 261 | 3300035089 | Ga0373944_0002007 | Ga0373944_0002007_2281_2904 | 207 |
| 262 | 3300035111 | Ga0373923_0068609 | Ga0373923_0068609_49_687 | 207 |
| 263 | 3300035111 | Ga0373923_0119232 | Ga0373923_0119232_210_833 | 207 |
| 264 | 3300035113 | Ga0373936_0098859 | Ga0373936_0098859_110_733 | 207 |
| 265 | 3300035113 | Ga0373936_0201605 | Ga0373936_0201605_57_680 | 207 |
| 266 | 3300035116 | Ga0373945_0001120 | Ga0373945_0001120_7427_8065 | 207 |
| 267 | 3300035116 | Ga0373945_0017789 | Ga0373945_0017789_1112_1735 | 207 |
| 268 | 3300035117 | Ga0373953_0001462 | Ga0373953_0001462_2081_2719 | 207 |
| 269 | 3300035118 | Ga0373954_0002182 | Ga0373954_0002182_4061_4699 | 207 |
| 270 | 3300035118 | Ga0373954_0066235 | Ga0373954_0066235_339_962 | 207 |
| 271 | 3300035170 | Ga0373943_0002502 | Ga0373943_0002502_1589_2212 | 207 |
| 272 | 3300035171 | Ga0373946_0002385 | Ga0373946_0002385_3496_4119 | 207 |
| 273 | 3300035171 | Ga0373946_0013338 | Ga0373946_0013338_2399_3037 | 207 |
| 274 | 3300035171 | Ga0373946_0015152 | Ga0373946_0015152_460_1083 | 207 |
| 275 | 3300035171 | Ga0373946_0072308 | Ga0373946_0072308_221_844 | 207 |
| 276 | 3300035172 | Ga0373955_0000200 | Ga0373955_0000200_9236_9874 | 207 |
| 277 | 3300035172 | Ga0373955_0016724 | Ga0373955_0016724_2015_2638 | 207 |
| 278 | 3300035172 | Ga0373955_0197934 | Ga0373955_0197934_332_955 | 207 |
| 279 | 3300035410 | Ga0373924_0001651 | Ga0373924_0001651_6639_7277 | 207 |
| 280 | 3300035692 | Ga0373935_0003610 | Ga0373935_0003610_3109_3747 | 207 |
| 281 | 3300035695 | Ga0373927_0000227 | Ga0373927_0000227_4302_4925 | 207 |
| 282 | 3300035695 | Ga0373927_0009494 | Ga0373927_0009494_2865_3503 | 207 |
| 283 | 3300035695 | Ga0373927_0100066 | Ga0373927_0100066_256_879 | 207 |
| 284 | 3300035695 | Ga0373927_0509636 | Ga0373927_0509636_105_737 | 207 |
| 285 | 3300035724 | Ga0373933_0001234 | Ga0373933_0001234_5816_6454 | 207 |
| 286 | 3300035724 | Ga0373933_0080406 | Ga0373933_0080406_1139_1762 | 207 |
| 287 | 3300035724 | Ga0373933_0138046 | Ga0373933_0138046_637_1260 | 207 |
| 288 | 3300035725 | Ga0373947_0003871 | Ga0373947_0003871_6469_7107 | 207 |
| 289 | 3300035725 | Ga0373947_0014412 | Ga0373947_0014412_795_1418 | 207 |
| 290 | 3300035725 | Ga0373947_0355669 | Ga0373947_0355669_260_883 | 207 |
| 291 | 3300035725 | Ga0373947_0367094 | Ga0373947_0367094_263_886 | 207 |
| 292 | 3300036401 | Ga0373937_0000313 | Ga0373937_0000313_36434_37072 | 207 |
| 293 | 3300036401 | Ga0373937_0035405 | Ga0373937_0035405_1199_1822 | 207 |
| 294 | 3300036401 | Ga0373937_0419564 | Ga0373937_0419564_340_963 | 207 |
| 295 | 3300037068 | Ga0373925_0000025 | Ga0373925_0000025_53469_54107 | 207 |
| 296 | 3300041443 | Ga0451789_1257416 | Ga0451789_1257416_17_661 | 207 |
| 297 | 3300046454 | Ga0495592_0002157 | Ga0495592_0002157_10668_11306 | 207 |
| 298 | 3300046454 | Ga0495592_0053446 | Ga0495592_0053446_518_1141 | 207 |
| 299 | 3300046454 | Ga0495592_0151922 | Ga0495592_0151922_413_1036 | 207 |
| 300 | 3300046455 | Ga0495603_0087914 | Ga0495603_0087914_994_1617 | 207 |
| 301 | 3300046455 | Ga0495603_0117631 | Ga0495603_0117631_909_1532 | 207 |
| 302 | 3300046459 | Ga0495629_0002377 | Ga0495629_0002377_4291_4929 | 207 |
| 303 | 3300046459 | Ga0495629_0013043 | Ga0495629_0013043_5063_5686 | 207 |
| 304 | 3300046459 | Ga0495629_0027771 | Ga0495629_0027771_226_849 | 207 |
| 305 | 3300046459 | Ga0495629_0101079 | Ga0495629_0101079_977_1600 | 207 |
| 306 | 3300046459 | Ga0495629_0429025 | Ga0495629_0429025_257_880 | 207 |
| 307 | 3300046462 | Ga0495651_0000283 | Ga0495651_0000283_22997_23635 | 207 |
| 308 | 3300046462 | Ga0495651_0008148 | Ga0495651_0008148_6411_7034 | 207 |
| 309 | 3300046462 | Ga0495651_0032787 | Ga0495651_0032787_272_895 | 207 |
| 310 | 3300046462 | Ga0495651_0126226 | Ga0495651_0126226_566_1189 | 207 |
| 311 | 3300046463 | Ga0495653_0000041 | Ga0495653_0000041_36348_36986 | 207 |
| 312 | 3300046463 | Ga0495653_0074943 | Ga0495653_0074943_1195_1818 | 207 |
| 313 | 3300046463 | Ga0495653_0128500 | Ga0495653_0128500_971_1594 | 207 |
| 314 | 3300046463 | Ga0495653_0218296 | Ga0495653_0218296_215_838 | 207 |
| 315 | 3300046472 | Ga0495580_0225746 | Ga0495580_0225746_401_1024 | 207 |
| 316 | 3300046475 | Ga0495639_0030576 | Ga0495639_0030576_1331_1954 | 207 |
| 317 | 3300046475 | Ga0495639_0107428 | Ga0495639_0107428_596_1219 | 207 |
| 318 | 3300046475 | Ga0495639_0130128 | Ga0495639_0130128_409_1032 | 207 |
| 319 | 3300046476 | Ga0495662_0001774 | Ga0495662_0001774_128_766 | 207 |
| 320 | 3300046476 | Ga0495662_0055819 | Ga0495662_0055819_237_860 | 207 |
| 321 | 3300046477 | Ga0495664_0000005 | Ga0495664_0000005_170573_171211 | 207 |
| 322 | 3300046477 | Ga0495664_0115215 | Ga0495664_0115215_559_1182 | 207 |
| 323 | 3300046477 | Ga0495664_0221177 | Ga0495664_0221177_240_863 | 207 |
| 324 | 3300046491 | Ga0495584_0251872 | Ga0495584_0251872_173_796 | 207 |
| 325 | 3300046499 | Ga0495594_0111673 | Ga0495594_0111673_262_885 | 207 |
| 326 | 3300046499 | Ga0495594_0170158 | Ga0495594_0170158_208_831 | 207 |
| 327 | 3300046499 | Ga0495594_0385401 | Ga0495594_0385401_118_741 | 207 |
| 328 | 3300046511 | Ga0495608_0000003 | Ga0495608_0000003_268367_269005 | 207 |
| 329 | 3300046511 | Ga0495608_0099718 | Ga0495608_0099718_946_1569 | 207 |
| 330 | 3300046514 | Ga0495618_0000010 | Ga0495618_0000010_46521_47159 | 207 |
| 331 | 3300046514 | Ga0495618_0006339 | Ga0495618_0006339_5307_5930 | 207 |
| 332 | 3300046514 | Ga0495618_0010308 | Ga0495618_0010308_1335_1958 | 207 |
| 333 | 3300046514 | Ga0495618_0056927 | Ga0495618_0056927_1385_2008 | 207 |
| 334 | 3300046516 | Ga0495628_0000019 | Ga0495628_0000019_100831_101469 | 207 |
| 335 | 3300046516 | Ga0495628_0040050 | Ga0495628_0040050_286_909 | 207 |
| 336 | 3300046516 | Ga0495628_0069866 | Ga0495628_0069866_848_1471 | 207 |
| 337 | 3300046516 | Ga0495628_0102898 | Ga0495628_0102898_1106_1816 | 207 |
| 338 | 3300046516 | Ga0495628_0165765 | Ga0495628_0165765_125_748 | 207 |
| 339 | 3300046517 | Ga0495630_0005281 | Ga0495630_0005281_1523_2161 | 207 |
| 340 | 3300046517 | Ga0495630_0029170 | Ga0495630_0029170_1567_2190 | 207 |
| 341 | 3300046517 | Ga0495630_0057699 | Ga0495630_0057699_1255_1878 | 207 |
| 342 | 3300046517 | Ga0495630_0208058 | Ga0495630_0208058_312_935 | 207 |
| 343 | 3300046517 | Ga0495630_0505032 | Ga0495630_0505032_44_667 | 207 |
| 344 | 3300046517 | Ga0495630_0573283 | Ga0495630_0573283_10_633 | 207 |
| 345 | 3300046523 | Ga0495644_0070222 | Ga0495644_0070222_254_877 | 207 |
| 346 | 3300046526 | Ga0495666_0113673 | Ga0495666_0113673_347_970 | 207 |
| 347 | 3300046526 | Ga0495666_0181017 | Ga0495666_0181017_209_832 | 207 |
| 348 | 3300046529 | Ga0495652_0000028 | Ga0495652_0000028_100831_101469 | 207 |
| 349 | 3300046529 | Ga0495652_0049801 | Ga0495652_0049801_1321_1944 | 207 |
| 350 | 3300046529 | Ga0495652_0084982 | Ga0495652_0084982_1630_2253 | 207 |
| 351 | 3300046529 | Ga0495652_0105628 | Ga0495652_0105628_1031_1654 | 207 |
| 352 | 3300046529 | Ga0495652_0518154 | Ga0495652_0518154_20_643 | 207 |
| 353 | 3300046531 | Ga0495665_0048785 | Ga0495665_0048785_26_664 | 207 |
| 354 | 3300046533 | Ga0495640_0000014 | Ga0495640_0000014_60273_60911 | 207 |
| 355 | 3300046533 | Ga0495640_0000946 | Ga0495640_0000946_12162_12785 | 207 |
| 356 | 3300046533 | Ga0495640_0018796 | Ga0495640_0018796_226_849 | 207 |
| 357 | 3300046533 | Ga0495640_0332048 | Ga0495640_0332048_115_738 | 207 |
| 358 | 3300046535 | Ga0495586_0064174 | Ga0495586_0064174_403_1026 | 207 |
| 359 | 3300046535 | Ga0495586_0186182 | Ga0495586_0186182_391_1014 | 207 |
| 360 | 3300046535 | Ga0495586_0222364 | Ga0495586_0222364_220_843 | 207 |
| 361 | 3300046536 | Ga0495587_0000026 | Ga0495587_0000026_46351_46989 | 207 |
| 362 | 3300046536 | Ga0495587_0003753 | Ga0495587_0003753_3998_4621 | 207 |
| 363 | 3300046536 | Ga0495587_0008708 | Ga0495587_0008708_309_932 | 207 |
| 364 | 3300046543 | Ga0495645_0000005 | Ga0495645_0000005_170544_171182 | 207 |
| 365 | 3300046543 | Ga0495645_0174782 | Ga0495645_0174782_276_899 | 207 |
| 366 | 3300046559 | Ga0495667_0000003 | Ga0495667_0000003_193451_194089 | 207 |
| 367 | 3300046559 | Ga0495667_0037027 | Ga0495667_0037027_623_1246 | 207 |
| 368 | 3300046559 | Ga0495667_0042670 | Ga0495667_0042670_1431_2054 | 207 |
| 369 | 3300046642 | Ga0495634_0000017 | Ga0495634_0000017_23063_23701 | 207 |
| 370 | 3300046642 | Ga0495634_0009717 | Ga0495634_0009717_90_713 | 207 |
| 371 | 3300046642 | Ga0495634_0010017 | Ga0495634_0010017_1187_1810 | 207 |
| 372 | 3300046642 | Ga0495634_0049595 | Ga0495634_0049595_554_1177 | 207 |
| 373 | 3300046642 | Ga0495634_0149390 | Ga0495634_0149390_416_1039 | 207 |
| 374 | 3300046648 | Ga0495611_0166359 | Ga0495611_0166359_221_844 | 207 |
| 375 | 3300046663 | Ga0495635_0000024 | Ga0495635_0000024_46745_47383 | 207 |
| 376 | 3300046663 | Ga0495635_0010685 | Ga0495635_0010685_4927_5550 | 207 |
| 377 | 3300046663 | Ga0495635_0026038 | Ga0495635_0026038_3006_3629 | 207 |
| 378 | 3300046674 | Ga0495588_0332304 | Ga0495588_0332304_40_663 | 207 |
| 379 | 3300046675 | Ga0495657_0000034 | Ga0495657_0000034_81585_82223 | 207 |
| 380 | 3300046675 | Ga0495657_0079863 | Ga0495657_0079863_868_1491 | 207 |
| 381 | 3300046678 | Ga0495599_0000017 | Ga0495599_0000017_101150_101788 | 207 |
| 382 | 3300046679 | Ga0495623_0000028 | Ga0495623_0000028_71519_72157 | 207 |
| 383 | 3300046679 | Ga0495623_0153544 | Ga0495623_0153544_125_748 | 207 |
| 384 | 3300046680 | Ga0495646_0000015 | Ga0495646_0000015_40252_40890 | 207 |
| 385 | 3300046680 | Ga0495646_0012842 | Ga0495646_0012842_3521_4144 | 207 |
| 386 | 3300046680 | Ga0495646_0035958 | Ga0495646_0035958_608_1231 | 207 |
| 387 | 3300046680 | Ga0495646_0068799 | Ga0495646_0068799_619_1242 | 207 |
| 388 | 3300046681 | Ga0495647_0164642 | Ga0495647_0164642_40_678 | 207 |
| 389 | 3300046683 | Ga0495658_0363378 | Ga0495658_0363378_76_699 | 207 |
| 390 | 3300046689 | Ga0495613_0050088 | Ga0495613_0050088_64_702 | 207 |
| 391 | 3300046689 | Ga0495613_0089910 | Ga0495613_0089910_1046_1669 | 207 |
| 392 | 3300046690 | Ga0495624_0003729 | Ga0495624_0003729_7317_7940 | 207 |
| 393 | 3300046690 | Ga0495624_0344437 | Ga0495624_0344437_145_783 | 207 |
| 394 | 3300046691 | Ga0495670_0148850 | Ga0495670_0148850_22_645 | 207 |
| 395 | 3300046809 | Ga0495600_0000058 | Ga0495600_0000058_53205_53843 | 207 |
| 396 | 3300046809 | Ga0495600_0101636 | Ga0495600_0101636_1009_1632 | 207 |
| 397 | 3300046809 | Ga0495600_0104177 | Ga0495600_0104177_1064_1687 | 207 |
| 398 | 3300047315 | Ga0495581_0483247 | Ga0495581_0483247_14_637 | 207 |
| 399 | 3300047317 | Ga0495604_0000021 | Ga0495604_0000021_100828_101466 | 207 |
| 400 | 3300047317 | Ga0495604_0002971 | Ga0495604_0002971_9793_10416 | 207 |
| 401 | 3300047317 | Ga0495604_0022424 | Ga0495604_0022424_976_1599 | 207 |
| 402 | 3300047317 | Ga0495604_0130956 | Ga0495604_0130956_737_1360 | 207 |
| 403 | 3300047319 | Ga0495674_0000005 | Ga0495674_0000005_273661_274299 | 207 |
| 404 | 3300047319 | Ga0495674_0011146 | Ga0495674_0011146_6710_7333 | 207 |
| 405 | 3300047319 | Ga0495674_0017300 | Ga0495674_0017300_4211_4834 | 207 |
| 406 | 3300047319 | Ga0495674_0040116 | Ga0495674_0040116_1840_2463 | 207 |
| 407 | 3300047319 | Ga0495674_0143092 | Ga0495674_0143092_1123_1746 | 207 |
| 408 | 3300047319 | Ga0495674_0408415 | Ga0495674_0408415_416_1039 | 207 |
| 409 | 3300047321 | Ga0495676_0059791 | Ga0495676_0059791_435_1058 | 207 |
| 410 | 3300047321 | Ga0495676_0134937 | Ga0495676_0134937_897_1520 | 207 |
| 411 | 3300047321 | Ga0495676_0136672 | Ga0495676_0136672_135_773 | 207 |
| 412 | 3300047321 | Ga0495676_0388599 | Ga0495676_0388599_154_777 | 207 |
| 413 | 3300047322 | Ga0495680_0000222 | Ga0495680_0000222_36251_36889 | 207 |
| 414 | 3300047322 | Ga0495680_0005923 | Ga0495680_0005923_8812_9435 | 207 |
| 415 | 3300047322 | Ga0495680_0015308 | Ga0495680_0015308_5093_5716 | 207 |
| 416 | 3300047322 | Ga0495680_0055885 | Ga0495680_0055885_942_1565 | 207 |
| 417 | 3300047444 | Ga0495675_0000173 | Ga0495675_0000173_12376_13014 | 207 |
| 418 | 3300047444 | Ga0495675_0018919 | Ga0495675_0018919_922_1545 | 207 |
| 419 | 3300047470 | Ga0495681_0216198 | Ga0495681_0216198_20_643 | 207 |
| 420 | 3300047471 | Ga0495684_0000001 | Ga0495684_0000001_100807_101445 | 207 |
| 421 | 3300047471 | Ga0495684_0000945 | Ga0495684_0000945_5525_6148 | 207 |
| 422 | 3300047471 | Ga0495684_0011640 | Ga0495684_0011640_1180_1803 | 207 |
| 423 | 3300047471 | Ga0495684_0166899 | Ga0495684_0166899_711_1334 | 207 |
| 424 | 3300047471 | Ga0495684_0363468 | Ga0495684_0363468_105_728 | 207 |
| 425 | 3300047471 | Ga0495684_0500057 | Ga0495684_0500057_48_671 | 207 |
| 426 | 3300047673 | Ga0495593_0108816 | Ga0495593_0108816_260_883 | 207 |
| 427 | 3300048088 | Ga0495602_0000003 | Ga0495602_0000003_255772_256410 | 207 |
| 428 | 3300048088 | Ga0495602_0065515 | Ga0495602_0065515_1665_2288 | 207 |
| 429 | 3300048089 | Ga0495614_0081055 | Ga0495614_0081055_521_1144 | 207 |
| 430 | 3300048904 | Ga0496101_0209857 | Ga0496101_0209857_822_1454 | 207 |
| 431 | 3300048904 | Ga0496101_0436442 | Ga0496101_0436442_348_971 | 207 |
| 432 | 3300048905 | Ga0496102_0177184 | Ga0496102_0177184_418_1065 | 207 |
| 433 | 3300048907 | Ga0496104_0001024 | Ga0496104_0001024_13182_13829 | 207 |
| 434 | 3300048907 | Ga0496104_0007414 | Ga0496104_0007414_8527_9159 | 207 |
| 435 | 3300048907 | Ga0496104_0118065 | Ga0496104_0118065_720_1463 | 207 |
| 436 | 3300048907 | Ga0496104_0141620 | Ga0496104_0141620_328_996 | 207 |
| 437 | 3300048908 | Ga0496105_0034245 | Ga0496105_0034245_300_932 | 207 |
| 438 | 3300048909 | Ga0496106_0170332 | Ga0496106_0170332_114_737 | 207 |
| 439 | 3300048911 | Ga0496108_0004479 | Ga0496108_0004479_5959_6627 | 207 |
| 440 | 3300048912 | Ga0496109_0021985 | Ga0496109_0021985_480_1112 | 207 |
| 441 | 3300048912 | Ga0496109_0259724 | Ga0496109_0259724_577_1224 | 207 |
| 442 | 3300048913 | Ga0496110_0002432 | Ga0496110_0002432_11707_12375 | 207 |
| 443 | 3300048913 | Ga0496110_0007846 | Ga0496110_0007846_5616_6248 | 207 |
| 444 | 3300048914 | Ga0496111_0032677 | Ga0496111_0032677_1816_2484 | 207 |
| 445 | 3300048914 | Ga0496111_0045810 | Ga0496111_0045810_2313_2945 | 207 |
| 446 | 3300048916 | Ga0496113_0105770 | Ga0496113_0105770_1026_1694 | 207 |
| 447 | 3300048916 | Ga0496113_0241677 | Ga0496113_0241677_384_1016 | 207 |
| 448 | 3300049577 | Ga0501041_0185203 | Ga0501041_0185203_385_1008 | 207 |
| 449 | 3300049583 | Ga0501067_0444367 | Ga0501067_0444367_54_677 | 207 |
| 450 | 3300049591 | Ga0501075_0077762 | Ga0501075_0077762_1573_2196 | 207 |
| 451 | 3300049743 | Ga0501081_0219251 | Ga0501081_0219251_275_898 | 207 |
| 452 | 3300050507 | nmdc:mga05p37_394764_c1 | nmdc:mga05p37_394764_c1_781_1404 | 207 |
| 453 | 3300050508 | nmdc:mga09592_478835_c1 | nmdc:mga09592_478835_c1_248_949 | 207 |
| 454 | 3300050509 | nmdc:mga0qj67_487028_c1 | nmdc:mga0qj67_487028_c1_83_706 | 207 |
| 455 | 3300050509 | nmdc:mga0qj67_59978_c1 | nmdc:mga0qj67_59978_c1_625_1248 | 207 |
| 456 | 3300050512 | nmdc:mga0n895_93679_c1 | nmdc:mga0n895_93679_c1_1715_2338 | 207 |
| 457 | 3300050513 | nmdc:mga0rr50_716109_c1 | nmdc:mga0rr50_716109_c1_81_704 | 207 |
| 458 | 3300053077 | Ga0495601_0000005 | Ga0495601_0000005_98711_99349 | 207 |
| 459 | 3300053077 | Ga0495601_0000980 | Ga0495601_0000980_5315_5938 | 207 |
| 460 | 3300053077 | Ga0495601_0004375 | Ga0495601_0004375_7333_7956 | 207 |
| 461 | 3300053077 | Ga0495601_0005989 | Ga0495601_0005989_3733_4356 | 207 |
| 462 | 3300053077 | Ga0495601_0032295 | Ga0495601_0032295_1941_2564 | 207 |
| 463 | 3300053077 | Ga0495601_0442565 | Ga0495601_0442565_107_730 | 207 |
| 464 | 3300053078 | Ga0495612_0000001 | Ga0495612_0000001_316776_317414 | 207 |
| 465 | 3300053078 | Ga0495612_0005906 | Ga0495612_0005906_1366_1989 | 207 |
| 466 | 3300053078 | Ga0495612_0014025 | Ga0495612_0014025_2116_2739 | 207 |
| 467 | 3300053078 | Ga0495612_0042793 | Ga0495612_0042793_1087_1710 | 207 |
| 468 | 3300053084 | Ga0495595_0000033 | Ga0495595_0000033_53608_54246 | 207 |
| 469 | 3300053084 | Ga0495595_0001344 | Ga0495595_0001344_8413_9036 | 207 |
| 470 | 3300053084 | Ga0495595_0001798 | Ga0495595_0001798_2617_3240 | 207 |
| 471 | 3300053084 | Ga0495595_0017852 | Ga0495595_0017852_1077_1700 | 207 |
| 472 | 3300053084 | Ga0495595_0308317 | Ga0495595_0308317_160_783 | 207 |
| 473 | 3300053085 | Ga0495619_0000007 | Ga0495619_0000007_100831_101469 | 207 |
| 474 | 3300053085 | Ga0495619_0001550 | Ga0495619_0001550_2108_2731 | 207 |
| 475 | 3300053085 | Ga0495619_0003438 | Ga0495619_0003438_3157_3780 | 207 |
| 476 | 3300053085 | Ga0495619_0006725 | Ga0495619_0006725_5712_6335 | 207 |
| 477 | 3300053085 | Ga0495619_0008428 | Ga0495619_0008428_4615_5238 | 207 |
| 478 | 3300053085 | Ga0495619_0083323 | Ga0495619_0083323_1484_2146 | 207 |
| 479 | 3300005328 | Ga0070676_10285226 | Ga0070676_102852262 | 208 |
| 480 | 3300005334 | Ga0068869_100005998 | Ga0068869_1000059985 | 208 |
| 481 | 3300005335 | Ga0070666_10078571 | Ga0070666_100785712 | 208 |
| 482 | 3300005337 | Ga0070682_100440790 | Ga0070682_1004407902 | 208 |
| 483 | 3300005340 | Ga0070689_100010204 | Ga0070689_1000102042 | 208 |
| 484 | 3300005347 | Ga0070668_100451793 | Ga0070668_1004517931 | 208 |
| 485 | 3300005353 | Ga0070669_100153401 | Ga0070669_1001534012 | 208 |
| 486 | 3300005354 | Ga0070675_100043373 | Ga0070675_1000433734 | 208 |
| 487 | 3300005355 | Ga0070671_100100707 | Ga0070671_1001007072 | 208 |
| 488 | 3300005356 | Ga0070674_100486227 | Ga0070674_1004862271 | 208 |
| 489 | 3300005364 | Ga0070673_100062776 | Ga0070673_1000627762 | 208 |
| 490 | 3300005367 | Ga0070667_100007283 | Ga0070667_1000072832 | 208 |
| 491 | 3300005435 | Ga0070714_100023933 | Ga0070714_1000239332 | 208 |
| 492 | 3300005440 | Ga0070705_100879489 | Ga0070705_1008794891 | 208 |
| 493 | 3300005459 | Ga0068867_100010444 | Ga0068867_1000104444 | 208 |
| 494 | 3300005459 | Ga0068867_100409671 | Ga0068867_1004096712 | 208 |
| 495 | 3300005466 | Ga0070685_10236773 | Ga0070685_102367732 | 208 |
| 496 | 3300005467 | Ga0070706_100234877 | Ga0070706_1002348772 | 208 |
| 497 | 3300005468 | Ga0070707_100020730 | Ga0070707_1000207306 | 208 |
| 498 | 3300005518 | Ga0070699_100455608 | Ga0070699_1004556082 | 208 |
| 499 | 3300005536 | Ga0070697_100117457 | Ga0070697_1001174571 | 208 |
| 500 | 3300005543 | Ga0070672_100022966 | Ga0070672_1000229664 | 208 |
| 501 | 3300005546 | Ga0070696_100189621 | Ga0070696_1001896213 | 208 |
| 502 | 3300005548 | Ga0070665_100902825 | Ga0070665_1009028252 | 208 |
| 503 | 3300005549 | Ga0070704_100016975 | Ga0070704_1000169754 | 208 |
| 504 | 3300005549 | Ga0070704_100443478 | Ga0070704_1004434782 | 208 |
| 505 | 3300005563 | Ga0068855_100039862 | Ga0068855_1000398625 | 208 |
| 506 | 3300005563 | Ga0068855_100547284 | Ga0068855_1005472841 | 208 |
| 507 | 3300005577 | Ga0068857_100048049 | Ga0068857_1000480492 | 208 |
| 508 | 3300005617 | Ga0068859_100006490 | Ga0068859_1000064904 | 208 |
| 509 | 3300005618 | Ga0068864_100002280 | Ga0068864_1000022804 | 208 |
| 510 | 3300005719 | Ga0068861_100001241 | Ga0068861_1000012417 | 208 |
| 511 | 3300005840 | Ga0068870_10001840 | Ga0068870_100018402 | 208 |
| 512 | 3300005840 | Ga0068870_10016150 | Ga0068870_100161504 | 208 |
| 513 | 3300005841 | Ga0068863_100002300 | Ga0068863_1000023005 | 208 |
| 514 | 3300005841 | Ga0068863_100046547 | Ga0068863_1000465472 | 208 |
| 515 | 3300005842 | Ga0068858_100010433 | Ga0068858_1000104332 | 208 |
| 516 | 3300005843 | Ga0068860_100024570 | Ga0068860_1000245702 | 208 |
| 517 | 3300005844 | Ga0068862_100010079 | Ga0068862_1000100793 | 208 |
| 518 | 3300006237 | Ga0097621_100519200 | Ga0097621_1005192001 | 208 |
| 519 | 3300006852 | Ga0075433_10088674 | Ga0075433_100886744 | 208 |
| 520 | 3300006871 | Ga0075434_100021290 | Ga0075434_1000212902 | 208 |
| 521 | 3300006871 | Ga0075434_100092651 | Ga0075434_1000926513 | 208 |
| 522 | 3300006931 | Ga0097620_100006489 | Ga0097620_1000064894 | 208 |
| 523 | 3300009094 | Ga0111539_10088096 | Ga0111539_100880963 | 208 |
| 524 | 3300009094 | Ga0111539_11155015 | Ga0111539_111550152 | 208 |
| 525 | 3300009148 | Ga0105243_10201542 | Ga0105243_102015422 | 208 |
| 526 | 3300009177 | Ga0105248_10021343 | Ga0105248_100213433 | 208 |
| 527 | 3300009177 | Ga0105248_10551725 | Ga0105248_105517251 | 208 |
| 528 | 3300013102 | Ga0157371_10000641 | Ga0157371_1000064123 | 208 |
| 529 | 3300013104 | Ga0157370_10345975 | Ga0157370_103459752 | 208 |
| 530 | 3300013297 | Ga0157378_10403580 | Ga0157378_104035801 | 208 |
| 531 | 3300013306 | Ga0163162_10088023 | Ga0163162_100880232 | 208 |
| 532 | 3300013308 | Ga0157375_10191935 | Ga0157375_101919353 | 208 |
| 533 | 3300014326 | Ga0157380_10023521 | Ga0157380_100235212 | 208 |
| 534 | 3300014968 | Ga0157379_10001029 | Ga0157379_1000102917 | 208 |
| 535 | 3300014968 | Ga0157379_10059384 | Ga0157379_100593848 | 208 |
| 536 | 3300017792 | Ga0163161_10010873 | Ga0163161_100108732 | 208 |
| 537 | 3300025885 | Ga0207653_10102183 | Ga0207653_101021832 | 208 |
| 538 | 3300025899 | Ga0207642_10029525 | Ga0207642_100295252 | 208 |
| 539 | 3300025903 | Ga0207680_10027293 | Ga0207680_100272933 | 208 |
| 540 | 3300025910 | Ga0207684_10302588 | Ga0207684_103025882 | 208 |
| 541 | 3300025912 | Ga0207707_10170080 | Ga0207707_101700801 | 208 |
| 542 | 3300025925 | Ga0207650_10037477 | Ga0207650_100374773 | 208 |
| 543 | 3300025926 | Ga0207659_10045844 | Ga0207659_100458443 | 208 |
| 544 | 3300025929 | Ga0207664_10029849 | Ga0207664_100298492 | 208 |
| 545 | 3300025931 | Ga0207644_10194269 | Ga0207644_101942693 | 208 |
| 546 | 3300025933 | Ga0207706_10055745 | Ga0207706_100557452 | 208 |
| 547 | 3300025936 | Ga0207670_10063324 | Ga0207670_100633242 | 208 |
| 548 | 3300025940 | Ga0207691_10315320 | Ga0207691_103153202 | 208 |
| 549 | 3300025942 | Ga0207689_10000949 | Ga0207689_1000094920 | 208 |
| 550 | 3300025949 | Ga0207667_10024078 | Ga0207667_100240782 | 208 |
| 551 | 3300025949 | Ga0207667_10127864 | Ga0207667_101278642 | 208 |
| 552 | 3300025960 | Ga0207651_10047665 | Ga0207651_100476652 | 208 |
| 553 | 3300025986 | Ga0207658_10059301 | Ga0207658_100593013 | 208 |
| 554 | 3300026035 | Ga0207703_10009417 | Ga0207703_100094175 | 208 |
| 555 | 3300026078 | Ga0207702_10163592 | Ga0207702_101635922 | 208 |
| 556 | 3300026088 | Ga0207641_10027073 | Ga0207641_100270732 | 208 |
| 557 | 3300026089 | Ga0207648_10004634 | Ga0207648_100046348 | 208 |
| 558 | 3300026089 | Ga0207648_10017246 | Ga0207648_100172463 | 208 |
| 559 | 3300026095 | Ga0207676_10016274 | Ga0207676_100162745 | 208 |
| 560 | 3300026116 | Ga0207674_10027319 | Ga0207674_100273195 | 208 |
| 561 | 3300026118 | Ga0207675_100001933 | Ga0207675_1000019339 | 208 |
| 562 | 3300026118 | Ga0207675_100117555 | Ga0207675_1001175551 | 208 |
| 563 | 3300027907 | Ga0207428_10216895 | Ga0207428_102168952 | 208 |
| 564 | 3300028380 | Ga0268265_10033425 | Ga0268265_100334252 | 208 |
| 565 | 3300031247 | Ga0265340_10044661 | Ga0265340_100446612 | 208 |
| 566 | 3300031250 | Ga0265331_10127499 | Ga0265331_101274991 | 208 |
| 567 | 3300035117 | Ga0373953_0003158 | Ga0373953_0003158_3907_4554 | 208 |
| 568 | 3300035118 | Ga0373954_0167945 | Ga0373954_0167945_236_883 | 208 |
| 569 | 3300035170 | Ga0373943_0049420 | Ga0373943_0049420_1313_1939 | 208 |
| 570 | 3300035172 | Ga0373955_0271399 | Ga0373955_0271399_91_738 | 208 |
| 571 | 3300035724 | Ga0373933_0210956 | Ga0373933_0210956_263_910 | 208 |
| 572 | 3300036401 | Ga0373937_0001469 | Ga0373937_0001469_1293_1940 | 208 |
| 573 | 3300037068 | Ga0373925_0889035 | Ga0373925_0889035_67_702 | 208 |
| 574 | 3300041411 | Ga0439466_0025830 | Ga0439466_0025830_47_742 | 208 |
| 575 | 3300042006 | Ga0439432_053152 | Ga0439432_053152_524_1219 | 208 |
| 576 | 3300042007 | Ga0439449_0002973 | Ga0439449_0002973_83_709 | 208 |
| 577 | 3300042009 | Ga0439451_005149 | Ga0439451_005149_645_1340 | 208 |
| 578 | 3300042010 | Ga0439452_003422 | Ga0439452_003422_399_1025 | 208 |
| 579 | 3300042010 | Ga0439452_028224 | Ga0439452_028224_260_955 | 208 |
| 580 | 3300042013 | Ga0439456_040289 | Ga0439456_040289_285_980 | 208 |
| 581 | 3300042016 | Ga0439463_009292 | Ga0439463_009292_126_752 | 208 |
| 582 | 3300042115 | Ga0450911_005287 | Ga0450911_005287_935_1561 | 208 |
| 583 | 3300042127 | Ga0450890_000101 | Ga0450890_000101_10136_10762 | 208 |
| 584 | 3300046457 | Ga0495590_0002436 | Ga0495590_0002436_449_1075 | 208 |
| 585 | 3300046474 | Ga0495605_0014878 | Ga0495605_0014878_800_1426 | 208 |
| 586 | 3300046474 | Ga0495605_0044806 | Ga0495605_0044806_246_872 | 208 |
| 587 | 3300046476 | Ga0495662_0365773 | Ga0495662_0365773_25_672 | 208 |
| 588 | 3300046491 | Ga0495584_0005465 | Ga0495584_0005465_3601_4227 | 208 |
| 589 | 3300046501 | Ga0495607_0006507 | Ga0495607_0006507_4142_4798 | 208 |
| 590 | 3300046512 | Ga0495610_0017853 | Ga0495610_0017853_384_1010 | 208 |
| 591 | 3300046513 | Ga0495616_0002369 | Ga0495616_0002369_6625_7251 | 208 |
| 592 | 3300046516 | Ga0495628_0653350 | Ga0495628_0653350_96_722 | 208 |
| 593 | 3300046530 | Ga0495654_0003084 | Ga0495654_0003084_9538_10164 | 208 |
| 594 | 3300046530 | Ga0495654_0128245 | Ga0495654_0128245_344_970 | 208 |
| 595 | 3300046536 | Ga0495587_0005223 | Ga0495587_0005223_3868_4494 | 208 |
| 596 | 3300046538 | Ga0495609_0009563 | Ga0495609_0009563_604_1230 | 208 |
| 597 | 3300046542 | Ga0495597_0011083 | Ga0495597_0011083_3377_4003 | 208 |
| 598 | 3300046615 | Ga0495656_0208682 | Ga0495656_0208682_302_928 | 208 |
| 599 | 3300046663 | Ga0495635_0002778 | Ga0495635_0002778_8625_9251 | 208 |
| 600 | 3300046664 | Ga0495659_0064274 | Ga0495659_0064274_604_1260 | 208 |
| 601 | 3300046665 | Ga0495661_0104991 | Ga0495661_0104991_31_687 | 208 |
| 602 | 3300046679 | Ga0495623_0012865 | Ga0495623_0012865_2042_2668 | 208 |
| 603 | 3300046689 | Ga0495613_0042752 | Ga0495613_0042752_652_1278 | 208 |
| 604 | 3300046691 | Ga0495670_0001106 | Ga0495670_0001106_2926_3582 | 208 |
| 605 | 3300046692 | Ga0495671_0066408 | Ga0495671_0066408_77_703 | 208 |
| 606 | 3300046694 | Ga0495649_0003407 | Ga0495649_0003407_268_894 | 208 |
| 607 | 3300046794 | Ga0495589_0011660 | Ga0495589_0011660_2122_2748 | 208 |
| 608 | 3300047317 | Ga0495604_0005948 | Ga0495604_0005948_1487_2113 | 208 |
| 609 | 3300047317 | Ga0495604_0188783 | Ga0495604_0188783_111_737 | 208 |
| 610 | 3300047318 | Ga0495636_0146976 | Ga0495636_0146976_324_950 | 208 |
| 611 | 3300047319 | Ga0495674_0082226 | Ga0495674_0082226_58_684 | 208 |
| 612 | 3300047322 | Ga0495680_0007247 | Ga0495680_0007247_7401_8027 | 208 |
| 613 | 3300047322 | Ga0495680_0351773 | Ga0495680_0351773_76_702 | 208 |
| 614 | 3300047323 | Ga0495683_0097355 | Ga0495683_0097355_532_1158 | 208 |
| 615 | 3300047445 | Ga0495677_0205660 | Ga0495677_0205660_58_684 | 208 |
| 616 | 3300047469 | Ga0495673_0016750 | Ga0495673_0016750_3011_3637 | 208 |
| 617 | 3300047673 | Ga0495593_0059774 | Ga0495593_0059774_1038_1664 | 208 |
| 618 | 3300048091 | Ga0495626_0002843 | Ga0495626_0002843_8833_9459 | 208 |
| 619 | 3300048905 | Ga0496102_0062418 | Ga0496102_0062418_759_1466 | 208 |
| 620 | 3300048909 | Ga0496106_0765336 | Ga0496106_0765336_94_720 | 208 |
| 621 | 3300048927 | Ga0496124_0009323 | Ga0496124_0009323_2743_3381 | 208 |
| 622 | 3300048929 | Ga0496126_0069460 | Ga0496126_0069460_2273_2899 | 208 |
| 623 | 3300049460 | Ga0495682_0026861 | Ga0495682_0026861_902_1528 | 208 |
| 624 | 3300050489 | nmdc:mga03683_360479_c1 | nmdc:mga03683_360479_c1_46_672 | 208 |
| 625 | 3300050494 | nmdc:mga06z11_464399_c1 | nmdc:mga06z11_464399_c1_90_716 | 208 |
| 626 | 3300050511 | nmdc:mga08y16_98542_c1 | nmdc:mga08y16_98542_c1_172_810 | 208 |
| 627 | 3300050512 | nmdc:mga0n895_1203541_c1 | nmdc:mga0n895_1203541_c1_13_639 | 208 |
| 628 | 3300050512 | nmdc:mga0n895_17270_c1 | nmdc:mga0n895_17270_c1_5432_6058 | 208 |
| 629 | 3300050512 | nmdc:mga0n895_756553_c1 | nmdc:mga0n895_756553_c1_81_716 | 208 |
| 630 | 3300050513 | nmdc:mga0rr50_261522_c1 | nmdc:mga0rr50_261522_c1_204_830 | 208 |
| 631 | 3300050515 | nmdc:mga0a205_497_c1 | nmdc:mga0a205_497_c1_8224_8850 | 208 |
| 632 | 3300005295 | Ga0065707_10176604 | Ga0065707_101766041 | 209 |
| 633 | 3300005436 | Ga0070713_100337791 | Ga0070713_1003377912 | 209 |
| 634 | 3300005436 | Ga0070713_101032103 | Ga0070713_1010321031 | 209 |
| 635 | 3300005437 | Ga0070710_10163574 | Ga0070710_101635741 | 209 |
| 636 | 3300005439 | Ga0070711_100163288 | Ga0070711_1001632883 | 209 |
| 637 | 3300005439 | Ga0070711_100275581 | Ga0070711_1002755812 | 209 |
| 638 | 3300005440 | Ga0070705_100019590 | Ga0070705_1000195904 | 209 |
| 639 | 3300005445 | Ga0070708_100537325 | Ga0070708_1005373252 | 209 |
| 640 | 3300005459 | Ga0068867_100063442 | Ga0068867_1000634423 | 209 |
| 641 | 3300005530 | Ga0070679_100008233 | Ga0070679_1000082334 | 209 |
| 642 | 3300005530 | Ga0070679_100277724 | Ga0070679_1002777242 | 209 |
| 643 | 3300005545 | Ga0070695_100005497 | Ga0070695_1000054972 | 209 |
| 644 | 3300005549 | Ga0070704_100184039 | Ga0070704_1001840392 | 209 |
| 645 | 3300005614 | Ga0068856_100533276 | Ga0068856_1005332762 | 209 |
| 646 | 3300005618 | Ga0068864_100849106 | Ga0068864_1008491062 | 209 |
| 647 | 3300005841 | Ga0068863_100080907 | Ga0068863_1000809072 | 209 |
| 648 | 3300005844 | Ga0068862_100933668 | Ga0068862_1009336682 | 209 |
| 649 | 3300005937 | Ga0081455_10019458 | Ga0081455_100194587 | 209 |
| 650 | 3300006058 | Ga0075432_10010171 | Ga0075432_100101712 | 209 |
| 651 | 3300006173 | Ga0070716_100119258 | Ga0070716_1001192581 | 209 |
| 652 | 3300006173 | Ga0070716_100165299 | Ga0070716_1001652992 | 209 |
| 653 | 3300006237 | Ga0097621_100179521 | Ga0097621_1001795213 | 209 |
| 654 | 3300006358 | Ga0068871_100108484 | Ga0068871_1001084844 | 209 |
| 655 | 3300006847 | Ga0075431_100056564 | Ga0075431_1000565644 | 209 |
| 656 | 3300006847 | Ga0075431_100389701 | Ga0075431_1003897012 | 209 |
| 657 | 3300006871 | Ga0075434_100073551 | Ga0075434_1000735514 | 209 |
| 658 | 3300006880 | Ga0075429_100033610 | Ga0075429_1000336104 | 209 |
| 659 | 3300006914 | Ga0075436_100004626 | Ga0075436_1000046265 | 209 |
| 660 | 3300006914 | Ga0075436_100196331 | Ga0075436_1001963312 | 209 |
| 661 | 3300006914 | Ga0075436_100403027 | Ga0075436_1004030272 | 209 |
| 662 | 3300007076 | Ga0075435_100269005 | Ga0075435_1002690052 | 209 |
| 663 | 3300007265 | Ga0099794_10010908 | Ga0099794_100109084 | 209 |
| 664 | 3300007265 | Ga0099794_10012586 | Ga0099794_100125866 | 209 |
| 665 | 3300007265 | Ga0099794_10174618 | Ga0099794_101746181 | 209 |
| 666 | 3300009011 | Ga0105251_10001212 | Ga0105251_1000121210 | 209 |
| 667 | 3300009011 | Ga0105251_10090960 | Ga0105251_100909601 | 209 |
| 668 | 3300009093 | Ga0105240_10128238 | Ga0105240_101282382 | 209 |
| 669 | 3300009094 | Ga0111539_10057327 | Ga0111539_100573275 | 209 |
| 670 | 3300009177 | Ga0105248_10386929 | Ga0105248_103869292 | 209 |
| 671 | 3300010375 | Ga0105239_11031009 | Ga0105239_110310091 | 209 |
| 672 | 3300013104 | Ga0157370_10065396 | Ga0157370_100653963 | 209 |
| 673 | 3300013105 | Ga0157369_10746905 | Ga0157369_107469051 | 209 |
| 674 | 3300013105 | Ga0157369_10842984 | Ga0157369_108429842 | 209 |
| 675 | 3300013296 | Ga0157374_10965470 | Ga0157374_109654701 | 209 |
| 676 | 3300013307 | Ga0157372_10031503 | Ga0157372_100315032 | 209 |
| 677 | 3300013307 | Ga0157372_10443499 | Ga0157372_104434992 | 209 |
| 678 | 3300013308 | Ga0157375_10215999 | Ga0157375_102159993 | 209 |
| 679 | 3300014497 | Ga0182008_10002767 | Ga0182008_100027677 | 209 |
| 680 | 3300014497 | Ga0182008_10035174 | Ga0182008_100351743 | 209 |
| 681 | 3300014969 | Ga0157376_10024125 | Ga0157376_100241252 | 209 |
| 682 | 3300015265 | Ga0182005_1009775 | Ga0182005_10097752 | 209 |
| 683 | 3300025735 | Ga0207713_1004860 | Ga0207713_10048605 | 209 |
| 684 | 3300025735 | Ga0207713_1015261 | Ga0207713_10152615 | 209 |
| 685 | 3300025735 | Ga0207713_1079390 | Ga0207713_10793902 | 209 |
| 686 | 3300025913 | Ga0207695_10074716 | Ga0207695_100747163 | 209 |
| 687 | 3300025915 | Ga0207693_10054236 | Ga0207693_100542362 | 209 |
| 688 | 3300025916 | Ga0207663_10246675 | Ga0207663_102466751 | 209 |
| 689 | 3300025917 | Ga0207660_10283502 | Ga0207660_102835021 | 209 |
| 690 | 3300025921 | Ga0207652_10024823 | Ga0207652_100248231 | 209 |
| 691 | 3300025928 | Ga0207700_10124675 | Ga0207700_101246752 | 209 |
| 692 | 3300025931 | Ga0207644_10782176 | Ga0207644_107821761 | 209 |
| 693 | 3300025941 | Ga0207711_10532147 | Ga0207711_105321472 | 209 |
| 694 | 3300025944 | Ga0207661_11226392 | Ga0207661_112263921 | 209 |
| 695 | 3300026023 | Ga0207677_10925031 | Ga0207677_109250311 | 209 |
| 696 | 3300026088 | Ga0207641_10022316 | Ga0207641_100223166 | 209 |
| 697 | 3300026088 | Ga0207641_10305379 | Ga0207641_103053792 | 209 |
| 698 | 3300026095 | Ga0207676_10105108 | Ga0207676_101051082 | 209 |
| 699 | 3300026118 | Ga0207675_100845108 | Ga0207675_1008451082 | 209 |
| 700 | 3300027907 | Ga0207428_10006751 | Ga0207428_100067518 | 209 |
| 701 | 3300027907 | Ga0207428_10025467 | Ga0207428_100254674 | 209 |
| 702 | 3300028577 | Ga0265318_10069229 | Ga0265318_100692292 | 209 |
| 703 | 3300031235 | Ga0265330_10008812 | Ga0265330_100088123 | 209 |
| 704 | 3300031238 | Ga0265332_10005649 | Ga0265332_100056496 | 209 |
| 705 | 3300031239 | Ga0265328_10009401 | Ga0265328_100094014 | 209 |
| 706 | 3300031711 | Ga0265314_10001270 | Ga0265314_1000127027 | 209 |
| 707 | 3300031712 | Ga0265342_10007741 | Ga0265342_100077418 | 209 |
| 708 | 3300035111 | Ga0373923_0074384 | Ga0373923_0074384_119_757 | 209 |
| 709 | 3300035113 | Ga0373936_0209570 | Ga0373936_0209570_174_812 | 209 |
| 710 | 3300035116 | Ga0373945_0135547 | Ga0373945_0135547_40_678 | 209 |
| 711 | 3300035170 | Ga0373943_0082986 | Ga0373943_0082986_337_975 | 209 |
| 712 | 3300035171 | Ga0373946_0096540 | Ga0373946_0096540_262_900 | 209 |
| 713 | 3300035242 | Ga0373962_0168887 | Ga0373962_0168887_53_694 | 209 |
| 714 | 3300035692 | Ga0373935_0117719 | Ga0373935_0117719_413_1057 | 209 |
| 715 | 3300035725 | Ga0373947_0112291 | Ga0373947_0112291_439_1077 | 209 |
| 716 | 3300036401 | Ga0373937_0159420 | Ga0373937_0159420_151_798 | 209 |
| 717 | 3300041405 | Ga0439438_001492 | Ga0439438_001492_8738_9367 | 209 |
| 718 | 3300041405 | Ga0439438_003823 | Ga0439438_003823_2257_2886 | 209 |
| 719 | 3300041405 | Ga0439438_023847 | Ga0439438_023847_818_1447 | 209 |
| 720 | 3300041407 | Ga0439447_000105 | Ga0439447_000105_9243_9872 | 209 |
| 721 | 3300041411 | Ga0439466_0003637 | Ga0439466_0003637_1661_2290 | 209 |
| 722 | 3300041411 | Ga0439466_0010505 | Ga0439466_0010505_2508_3137 | 209 |
| 723 | 3300041411 | Ga0439466_0094400 | Ga0439466_0094400_290_919 | 209 |
| 724 | 3300041413 | Ga0439465_0020468 | Ga0439465_0020468_1265_1894 | 209 |
| 725 | 3300041413 | Ga0439465_0096296 | Ga0439465_0096296_86_715 | 209 |
| 726 | 3300042006 | Ga0439432_001244 | Ga0439432_001244_8099_8728 | 209 |
| 727 | 3300042006 | Ga0439432_007162 | Ga0439432_007162_3125_3754 | 209 |
| 728 | 3300042009 | Ga0439451_003335 | Ga0439451_003335_380_1009 | 209 |
| 729 | 3300042009 | Ga0439451_037070 | Ga0439451_037070_323_952 | 209 |
| 730 | 3300042009 | Ga0439451_051901 | Ga0439451_051901_55_684 | 209 |
| 731 | 3300042010 | Ga0439452_018537 | Ga0439452_018537_924_1553 | 209 |
| 732 | 3300042013 | Ga0439456_002134 | Ga0439456_002134_405_1034 | 209 |
| 733 | 3300042013 | Ga0439456_007138 | Ga0439456_007138_1633_2262 | 209 |
| 734 | 3300042013 | Ga0439456_014413 | Ga0439456_014413_89_718 | 209 |
| 735 | 3300042013 | Ga0439456_025865 | Ga0439456_025865_508_1137 | 209 |
| 736 | 3300042016 | Ga0439463_006472 | Ga0439463_006472_1863_2492 | 209 |
| 737 | 3300042115 | Ga0450911_001949 | Ga0450911_001949_1908_2537 | 209 |
| 738 | 3300042115 | Ga0450911_002634 | Ga0450911_002634_531_1160 | 209 |
| 739 | 3300042121 | Ga0450919_000983 | Ga0450919_000983_2601_3230 | 209 |
| 740 | 3300042124 | Ga0450922_004291 | Ga0450922_004291_598_1227 | 209 |
| 741 | 3300042137 | Ga0450902_001611 | Ga0450902_001611_584_1213 | 209 |
| 742 | 3300042137 | Ga0450902_013595 | Ga0450902_013595_205_834 | 209 |
| 743 | 3300042137 | Ga0450902_016670 | Ga0450902_016670_329_958 | 209 |
| 744 | 3300042138 | Ga0450903_010294 | Ga0450903_010294_179_808 | 209 |
| 745 | 3300042145 | Ga0450906_010651 | Ga0450906_010651_1079_1708 | 209 |
| 746 | 3300042145 | Ga0450906_019807 | Ga0450906_019807_79_708 | 209 |
| 747 | 3300042145 | Ga0450906_037528 | Ga0450906_037528_28_657 | 209 |
| 748 | 3300042147 | Ga0450910_003043 | Ga0450910_003043_307_936 | 209 |
| 749 | 3300042156 | Ga0439446_0006756 | Ga0439446_0006756_238_867 | 209 |
| 750 | 3300042184 | Ga0450908_000382 | Ga0450908_000382_7612_8241 | 209 |
| 751 | 3300042461 | Ga0439460_0001065 | Ga0439460_0001065_3901_4530 | 209 |
| 752 | 3300042461 | Ga0439460_0007239 | Ga0439460_0007239_1292_1921 | 209 |
| 753 | 3300042876 | Ga0451577_0056502 | Ga0451577_0056502_176_805 | 209 |
| 754 | 3300042993 | Ga0439440_0003240 | Ga0439440_0003240_1738_2367 | 209 |
| 755 | 3300045051 | Ga0451576_0003712 | Ga0451576_0003712_10296_10925 | 209 |
| 756 | 3300045051 | Ga0451576_0069172 | Ga0451576_0069172_1472_2101 | 209 |
| 757 | 3300046452 | Ga0495617_024211 | Ga0495617_024211_416_1045 | 209 |
| 758 | 3300046452 | Ga0495617_037444 | Ga0495617_037444_213_842 | 209 |
| 759 | 3300046452 | Ga0495617_041106 | Ga0495617_041106_882_1520 | 209 |
| 760 | 3300046453 | Ga0495627_017242 | Ga0495627_017242_1738_2367 | 209 |
| 761 | 3300046455 | Ga0495603_0019806 | Ga0495603_0019806_3091_3729 | 209 |
| 762 | 3300046455 | Ga0495603_0024281 | Ga0495603_0024281_82_711 | 209 |
| 763 | 3300046457 | Ga0495590_0011474 | Ga0495590_0011474_2462_3091 | 209 |
| 764 | 3300046457 | Ga0495590_0013209 | Ga0495590_0013209_1576_2205 | 209 |
| 765 | 3300046457 | Ga0495590_0106352 | Ga0495590_0106352_289_918 | 209 |
| 766 | 3300046458 | Ga0495591_000194 | Ga0495591_000194_26604_27233 | 209 |
| 767 | 3300046458 | Ga0495591_023695 | Ga0495591_023695_467_1096 | 209 |
| 768 | 3300046458 | Ga0495591_044038 | Ga0495591_044038_593_1222 | 209 |
| 769 | 3300046458 | Ga0495591_056327 | Ga0495591_056327_71_709 | 209 |
| 770 | 3300046459 | Ga0495629_0141495 | Ga0495629_0141495_211_858 | 209 |
| 771 | 3300046459 | Ga0495629_0156653 | Ga0495629_0156653_403_1041 | 209 |
| 772 | 3300046459 | Ga0495629_0409188 | Ga0495629_0409188_215_844 | 209 |
| 773 | 3300046460 | Ga0495638_0006291 | Ga0495638_0006291_2620_3249 | 209 |
| 774 | 3300046460 | Ga0495638_0010334 | Ga0495638_0010334_2590_3219 | 209 |
| 775 | 3300046460 | Ga0495638_0027024 | Ga0495638_0027024_2753_3382 | 209 |
| 776 | 3300046460 | Ga0495638_0034295 | Ga0495638_0034295_875_1504 | 209 |
| 777 | 3300046460 | Ga0495638_0150042 | Ga0495638_0150042_57_686 | 209 |
| 778 | 3300046461 | Ga0495641_0325591 | Ga0495641_0325591_12_650 | 209 |
| 779 | 3300046462 | Ga0495651_0168906 | Ga0495651_0168906_700_1338 | 209 |
| 780 | 3300046471 | Ga0495650_0002333 | Ga0495650_0002333_3743_4372 | 209 |
| 781 | 3300046471 | Ga0495650_0068542 | Ga0495650_0068542_308_937 | 209 |
| 782 | 3300046472 | Ga0495580_0000157 | Ga0495580_0000157_32542_33174 | 209 |
| 783 | 3300046473 | Ga0495582_0049527 | Ga0495582_0049527_223_861 | 209 |
| 784 | 3300046474 | Ga0495605_0101852 | Ga0495605_0101852_448_1083 | 209 |
| 785 | 3300046474 | Ga0495605_0142283 | Ga0495605_0142283_416_1045 | 209 |
| 786 | 3300046475 | Ga0495639_0020279 | Ga0495639_0020279_545_1183 | 209 |
| 787 | 3300046476 | Ga0495662_0288985 | Ga0495662_0288985_60_689 | 209 |
| 788 | 3300046477 | Ga0495664_0091467 | Ga0495664_0091467_544_1182 | 209 |
| 789 | 3300046491 | Ga0495584_0000774 | Ga0495584_0000774_7274_7903 | 209 |
| 790 | 3300046491 | Ga0495584_0001348 | Ga0495584_0001348_14049_14678 | 209 |
| 791 | 3300046491 | Ga0495584_0002868 | Ga0495584_0002868_8507_9136 | 209 |
| 792 | 3300046491 | Ga0495584_0005468 | Ga0495584_0005468_4369_4998 | 209 |
| 793 | 3300046491 | Ga0495584_0018316 | Ga0495584_0018316_2403_3041 | 209 |
| 794 | 3300046491 | Ga0495584_0038977 | Ga0495584_0038977_1428_2057 | 209 |
| 795 | 3300046491 | Ga0495584_0077882 | Ga0495584_0077882_1016_1645 | 209 |
| 796 | 3300046492 | Ga0495585_0027067 | Ga0495585_0027067_450_1088 | 209 |
| 797 | 3300046492 | Ga0495585_0142003 | Ga0495585_0142003_377_1006 | 209 |
| 798 | 3300046492 | Ga0495585_0333727 | Ga0495585_0333727_35_664 | 209 |
| 799 | 3300046499 | Ga0495594_0020262 | Ga0495594_0020262_2875_3504 | 209 |
| 800 | 3300046499 | Ga0495594_0241056 | Ga0495594_0241056_246_884 | 209 |
| 801 | 3300046500 | Ga0495596_0000142 | Ga0495596_0000142_14877_15506 | 209 |
| 802 | 3300046501 | Ga0495607_0015350 | Ga0495607_0015350_3226_3864 | 209 |
| 803 | 3300046501 | Ga0495607_0019055 | Ga0495607_0019055_2313_2942 | 209 |
| 804 | 3300046501 | Ga0495607_0026409 | Ga0495607_0026409_801_1430 | 209 |
| 805 | 3300046501 | Ga0495607_0117204 | Ga0495607_0117204_370_999 | 209 |
| 806 | 3300046506 | Ga0495583_0097235 | Ga0495583_0097235_152_781 | 209 |
| 807 | 3300046507 | Ga0495606_0006616 | Ga0495606_0006616_6604_7233 | 209 |
| 808 | 3300046512 | Ga0495610_0087130 | Ga0495610_0087130_53_682 | 209 |
| 809 | 3300046513 | Ga0495616_0020167 | Ga0495616_0020167_1026_1655 | 209 |
| 810 | 3300046513 | Ga0495616_0020924 | Ga0495616_0020924_727_1356 | 209 |
| 811 | 3300046513 | Ga0495616_0047365 | Ga0495616_0047365_1419_2048 | 209 |
| 812 | 3300046513 | Ga0495616_0053390 | Ga0495616_0053390_74_703 | 209 |
| 813 | 3300046514 | Ga0495618_0237978 | Ga0495618_0237978_124_762 | 209 |
| 814 | 3300046515 | Ga0495620_0019251 | Ga0495620_0019251_725_1354 | 209 |
| 815 | 3300046515 | Ga0495620_0138614 | Ga0495620_0138614_139_768 | 209 |
| 816 | 3300046516 | Ga0495628_0511648 | Ga0495628_0511648_116_754 | 209 |
| 817 | 3300046517 | Ga0495630_0020050 | Ga0495630_0020050_1937_2566 | 209 |
| 818 | 3300046517 | Ga0495630_0199360 | Ga0495630_0199360_312_950 | 209 |
| 819 | 3300046518 | Ga0495631_0009830 | Ga0495631_0009830_448_1077 | 209 |
| 820 | 3300046518 | Ga0495631_0103630 | Ga0495631_0103630_256_894 | 209 |
| 821 | 3300046519 | Ga0495632_0002703 | Ga0495632_0002703_801_1430 | 209 |
| 822 | 3300046519 | Ga0495632_0019352 | Ga0495632_0019352_887_1516 | 209 |
| 823 | 3300046519 | Ga0495632_0057752 | Ga0495632_0057752_380_1009 | 209 |
| 824 | 3300046520 | Ga0495637_0001168 | Ga0495637_0001168_12717_13346 | 209 |
| 825 | 3300046520 | Ga0495637_0003054 | Ga0495637_0003054_7966_8595 | 209 |
| 826 | 3300046520 | Ga0495637_0064527 | Ga0495637_0064527_169_807 | 209 |
| 827 | 3300046520 | Ga0495637_0176363 | Ga0495637_0176363_94_723 | 209 |
| 828 | 3300046522 | Ga0495643_0013290 | Ga0495643_0013290_3976_4605 | 209 |
| 829 | 3300046522 | Ga0495643_0031487 | Ga0495643_0031487_961_1590 | 209 |
| 830 | 3300046523 | Ga0495644_0000468 | Ga0495644_0000468_8318_8947 | 209 |
| 831 | 3300046523 | Ga0495644_0001015 | Ga0495644_0001015_3923_4552 | 209 |
| 832 | 3300046523 | Ga0495644_0007759 | Ga0495644_0007759_3058_3696 | 209 |
| 833 | 3300046524 | Ga0495648_0070469 | Ga0495648_0070469_1168_1797 | 209 |
| 834 | 3300046525 | Ga0495663_0053033 | Ga0495663_0053033_43_681 | 209 |
| 835 | 3300046526 | Ga0495666_0020964 | Ga0495666_0020964_1730_2368 | 209 |
| 836 | 3300046530 | Ga0495654_0007825 | Ga0495654_0007825_3933_4562 | 209 |
| 837 | 3300046530 | Ga0495654_0008235 | Ga0495654_0008235_3404_4033 | 209 |
| 838 | 3300046530 | Ga0495654_0056035 | Ga0495654_0056035_327_956 | 209 |
| 839 | 3300046530 | Ga0495654_0101683 | Ga0495654_0101683_567_1196 | 209 |
| 840 | 3300046530 | Ga0495654_0177557 | Ga0495654_0177557_67_696 | 209 |
| 841 | 3300046533 | Ga0495640_0229015 | Ga0495640_0229015_397_1035 | 209 |
| 842 | 3300046533 | Ga0495640_0461363 | Ga0495640_0461363_81_710 | 209 |
| 843 | 3300046537 | Ga0495598_0018645 | Ga0495598_0018645_880_1527 | 209 |
| 844 | 3300046537 | Ga0495598_0028076 | Ga0495598_0028076_192_830 | 209 |
| 845 | 3300046538 | Ga0495609_0050094 | Ga0495609_0050094_1096_1734 | 209 |
| 846 | 3300046539 | Ga0495621_0004372 | Ga0495621_0004372_3283_3921 | 209 |
| 847 | 3300046542 | Ga0495597_0005357 | Ga0495597_0005357_5356_5985 | 209 |
| 848 | 3300046542 | Ga0495597_0026484 | Ga0495597_0026484_113_742 | 209 |
| 849 | 3300046542 | Ga0495597_0036119 | Ga0495597_0036119_785_1414 | 209 |
| 850 | 3300046542 | Ga0495597_0040991 | Ga0495597_0040991_429_1058 | 209 |
| 851 | 3300046542 | Ga0495597_0041134 | Ga0495597_0041134_75_704 | 209 |
| 852 | 3300046542 | Ga0495597_0102509 | Ga0495597_0102509_508_1137 | 209 |
| 853 | 3300046558 | Ga0495633_0014133 | Ga0495633_0014133_2912_3550 | 209 |
| 854 | 3300046615 | Ga0495656_0008898 | Ga0495656_0008898_1651_2289 | 209 |
| 855 | 3300046616 | Ga0495668_0001389 | Ga0495668_0001389_12508_13137 | 209 |
| 856 | 3300046642 | Ga0495634_0001609 | Ga0495634_0001609_13717_14346 | 209 |
| 857 | 3300046642 | Ga0495634_0037009 | Ga0495634_0037009_221_865 | 209 |
| 858 | 3300046642 | Ga0495634_0065130 | Ga0495634_0065130_671_1309 | 209 |
| 859 | 3300046648 | Ga0495611_0011154 | Ga0495611_0011154_1520_2158 | 209 |
| 860 | 3300046648 | Ga0495611_0029179 | Ga0495611_0029179_95_724 | 209 |
| 861 | 3300046660 | Ga0495625_0012035 | Ga0495625_0012035_2832_3461 | 209 |
| 862 | 3300046660 | Ga0495625_0043899 | Ga0495625_0043899_2475_3173 | 209 |
| 863 | 3300046660 | Ga0495625_0427325 | Ga0495625_0427325_80_709 | 209 |
| 864 | 3300046664 | Ga0495659_0004708 | Ga0495659_0004708_2182_2820 | 209 |
| 865 | 3300046665 | Ga0495661_0028142 | Ga0495661_0028142_176_805 | 209 |
| 866 | 3300046665 | Ga0495661_0058863 | Ga0495661_0058863_354_983 | 209 |
| 867 | 3300046665 | Ga0495661_0082540 | Ga0495661_0082540_298_927 | 209 |
| 868 | 3300046674 | Ga0495588_0048283 | Ga0495588_0048283_102_740 | 209 |
| 869 | 3300046674 | Ga0495588_0162337 | Ga0495588_0162337_514_1143 | 209 |
| 870 | 3300046680 | Ga0495646_0019757 | Ga0495646_0019757_2250_2879 | 209 |
| 871 | 3300046683 | Ga0495658_0030577 | Ga0495658_0030577_101_739 | 209 |
| 872 | 3300046689 | Ga0495613_0072681 | Ga0495613_0072681_1504_2142 | 209 |
| 873 | 3300046690 | Ga0495624_0081364 | Ga0495624_0081364_1315_1953 | 209 |
| 874 | 3300046691 | Ga0495670_0001964 | Ga0495670_0001964_2800_3429 | 209 |
| 875 | 3300046691 | Ga0495670_0012957 | Ga0495670_0012957_3246_3884 | 209 |
| 876 | 3300046691 | Ga0495670_0109139 | Ga0495670_0109139_457_1089 | 209 |
| 877 | 3300046691 | Ga0495670_0327684 | Ga0495670_0327684_88_717 | 209 |
| 878 | 3300046692 | Ga0495671_0000472 | Ga0495671_0000472_11789_12418 | 209 |
| 879 | 3300046692 | Ga0495671_0001142 | Ga0495671_0001142_9826_10455 | 209 |
| 880 | 3300046692 | Ga0495671_0010887 | Ga0495671_0010887_3037_3666 | 209 |
| 881 | 3300046692 | Ga0495671_0010924 | Ga0495671_0010924_743_1372 | 209 |
| 882 | 3300046692 | Ga0495671_0014858 | Ga0495671_0014858_2669_3298 | 209 |
| 883 | 3300046692 | Ga0495671_0017779 | Ga0495671_0017779_2484_3113 | 209 |
| 884 | 3300046692 | Ga0495671_0040182 | Ga0495671_0040182_1334_1963 | 209 |
| 885 | 3300046692 | Ga0495671_0051855 | Ga0495671_0051855_903_1541 | 209 |
| 886 | 3300046694 | Ga0495649_0004589 | Ga0495649_0004589_8255_8884 | 209 |
| 887 | 3300046694 | Ga0495649_0010429 | Ga0495649_0010429_801_1430 | 209 |
| 888 | 3300046694 | Ga0495649_0163273 | Ga0495649_0163273_405_1034 | 209 |
| 889 | 3300046794 | Ga0495589_0021606 | Ga0495589_0021606_426_1055 | 209 |
| 890 | 3300046810 | Ga0495660_0035332 | Ga0495660_0035332_83_712 | 209 |
| 891 | 3300046810 | Ga0495660_0043942 | Ga0495660_0043942_180_809 | 209 |
| 892 | 3300046810 | Ga0495660_0053198 | Ga0495660_0053198_442_1071 | 209 |
| 893 | 3300046810 | Ga0495660_0061073 | Ga0495660_0061073_1227_1856 | 209 |
| 894 | 3300046810 | Ga0495660_0133395 | Ga0495660_0133395_517_1146 | 209 |
| 895 | 3300047318 | Ga0495636_0107089 | Ga0495636_0107089_572_1210 | 209 |
| 896 | 3300047319 | Ga0495674_0120020 | Ga0495674_0120020_129_773 | 209 |
| 897 | 3300047319 | Ga0495674_0276992 | Ga0495674_0276992_410_1048 | 209 |
| 898 | 3300047320 | Ga0495672_0004200 | Ga0495672_0004200_2851_3480 | 209 |
| 899 | 3300047320 | Ga0495672_0006384 | Ga0495672_0006384_3018_3647 | 209 |
| 900 | 3300047320 | Ga0495672_0037638 | Ga0495672_0037638_1967_2596 | 209 |
| 901 | 3300047320 | Ga0495672_0050553 | Ga0495672_0050553_1067_1696 | 209 |
| 902 | 3300047321 | Ga0495676_0026342 | Ga0495676_0026342_1582_2220 | 209 |
| 903 | 3300047322 | Ga0495680_0328873 | Ga0495680_0328873_387_1025 | 209 |
| 904 | 3300047323 | Ga0495683_0000329 | Ga0495683_0000329_34981_35610 | 209 |
| 905 | 3300047323 | Ga0495683_0007352 | Ga0495683_0007352_4903_5532 | 209 |
| 906 | 3300047323 | Ga0495683_0019704 | Ga0495683_0019704_69_698 | 209 |
| 907 | 3300047323 | Ga0495683_0028815 | Ga0495683_0028815_811_1440 | 209 |
| 908 | 3300047469 | Ga0495673_0000684 | Ga0495673_0000684_24700_25329 | 209 |
| 909 | 3300047469 | Ga0495673_0003103 | Ga0495673_0003103_2238_2867 | 209 |
| 910 | 3300047469 | Ga0495673_0015134 | Ga0495673_0015134_3072_3701 | 209 |
| 911 | 3300047469 | Ga0495673_0036206 | Ga0495673_0036206_220_849 | 209 |
| 912 | 3300047470 | Ga0495681_0000571 | Ga0495681_0000571_18845_19474 | 209 |
| 913 | 3300047470 | Ga0495681_0001390 | Ga0495681_0001390_13150_13779 | 209 |
| 914 | 3300047470 | Ga0495681_0009001 | Ga0495681_0009001_5359_5988 | 209 |
| 915 | 3300047470 | Ga0495681_0014693 | Ga0495681_0014693_3441_4070 | 209 |
| 916 | 3300047470 | Ga0495681_0022862 | Ga0495681_0022862_348_977 | 209 |
| 917 | 3300047471 | Ga0495684_0118445 | Ga0495684_0118445_889_1533 | 209 |
| 918 | 3300047471 | Ga0495684_0485360 | Ga0495684_0485360_38_667 | 209 |
| 919 | 3300047472 | Ga0495686_0379704 | Ga0495686_0379704_69_698 | 209 |
| 920 | 3300048091 | Ga0495626_0000439 | Ga0495626_0000439_14352_14981 | 209 |
| 921 | 3300048091 | Ga0495626_0007916 | Ga0495626_0007916_246_875 | 209 |
| 922 | 3300048091 | Ga0495626_0117367 | Ga0495626_0117367_338_967 | 209 |
| 923 | 3300048091 | Ga0495626_0209339 | Ga0495626_0209339_98_727 | 209 |
| 924 | 3300048905 | Ga0496102_0000837 | Ga0496102_0000837_13923_14552 | 209 |
| 925 | 3300048905 | Ga0496102_0562277 | Ga0496102_0562277_146_775 | 209 |
| 926 | 3300048906 | Ga0496103_0004343 | Ga0496103_0004343_1157_1786 | 209 |
| 927 | 3300048918 | Ga0496115_0071689 | Ga0496115_0071689_58_687 | 209 |
| 928 | 3300048919 | Ga0496116_0028779 | Ga0496116_0028779_523_1152 | 209 |
| 929 | 3300048920 | Ga0496117_0006279 | Ga0496117_0006279_4286_4915 | 209 |
| 930 | 3300048920 | Ga0496117_0151120 | Ga0496117_0151120_198_827 | 209 |
| 931 | 3300048921 | Ga0496118_0008651 | Ga0496118_0008651_7075_7704 | 209 |
| 932 | 3300048921 | Ga0496118_0051925 | Ga0496118_0051925_2462_3091 | 209 |
| 933 | 3300048924 | Ga0496121_0054623 | Ga0496121_0054623_1691_2320 | 209 |
| 934 | 3300048924 | Ga0496121_0077684 | Ga0496121_0077684_834_1463 | 209 |
| 935 | 3300048927 | Ga0496124_0004885 | Ga0496124_0004885_8763_9392 | 209 |
| 936 | 3300048927 | Ga0496124_0078936 | Ga0496124_0078936_219_848 | 209 |
| 937 | 3300048927 | Ga0496124_0329738 | Ga0496124_0329738_448_1077 | 209 |
| 938 | 3300049459 | Ga0495678_002210 | Ga0495678_002210_6819_7448 | 209 |
| 939 | 3300049459 | Ga0495678_007559 | Ga0495678_007559_2782_3411 | 209 |
| 940 | 3300049459 | Ga0495678_038216 | Ga0495678_038216_146_775 | 209 |
| 941 | 3300049459 | Ga0495678_165543 | Ga0495678_165543_35_664 | 209 |
| 942 | 3300050507 | nmdc:mga05p37_49656_c1 | nmdc:mga05p37_49656_c1_742_1380 | 209 |
| 943 | 3300050508 | nmdc:mga09592_40616_c1 | nmdc:mga09592_40616_c1_865_1503 | 209 |
| 944 | 3300050509 | nmdc:mga0qj67_31004_c1 | nmdc:mga0qj67_31004_c1_882_1520 | 209 |
| 945 | 3300050511 | nmdc:mga08y16_1422931_c1 | nmdc:mga08y16_1422931_c1_12_641 | 209 |
| 946 | 3300050511 | nmdc:mga08y16_41205_c1 | nmdc:mga08y16_41205_c1_2670_3308 | 209 |
| 947 | 3300050512 | nmdc:mga0n895_48212_c1 | nmdc:mga0n895_48212_c1_3464_4102 | 209 |
| 948 | 3300050513 | nmdc:mga0rr50_56035_c1 | nmdc:mga0rr50_56035_c1_2262_2900 | 209 |
| 949 | 3300050514 | nmdc:mga08x19_161298_c1 | nmdc:mga08x19_161298_c1_257_895 | 209 |
| 950 | 3300050514 | nmdc:mga08x19_345160_c1 | nmdc:mga08x19_345160_c1_158_820 | 209 |
| 951 | 3300050514 | nmdc:mga08x19_35_c1 | nmdc:mga08x19_35_c1_110364_111023 | 209 |
| 952 | 3300050515 | nmdc:mga0a205_37485_c1 | nmdc:mga0a205_37485_c1_1352_1990 | 209 |
| 953 | 3300053077 | Ga0495601_0084223 | Ga0495601_0084223_683_1321 | 209 |
| 954 | 3300053077 | Ga0495601_0155333 | Ga0495601_0155333_230_874 | 209 |
| 955 | 3300053085 | Ga0495619_0111200 | Ga0495619_0111200_507_1145 | 209 |
| 956 | 3300059424 | Ga0590075_016342 | Ga0590075_016342_565_1197 | 209 |
| 957 | iso_pu_bacteria | 2643221569 | 2643862977 | 209 |
| 958 | 3300005295 | Ga0065707_10084390 | Ga0065707_100843904 | 210 |
| 959 | 3300005328 | Ga0070676_10026495 | Ga0070676_100264953 | 210 |
| 960 | 3300005330 | Ga0070690_100019324 | Ga0070690_1000193242 | 210 |
| 961 | 3300005333 | Ga0070677_10014886 | Ga0070677_100148862 | 210 |
| 962 | 3300005334 | Ga0068869_100663369 | Ga0068869_1006633691 | 210 |
| 963 | 3300005338 | Ga0068868_100010422 | Ga0068868_1000104224 | 210 |
| 964 | 3300005340 | Ga0070689_100082145 | Ga0070689_1000821454 | 210 |
| 965 | 3300005343 | Ga0070687_100055389 | Ga0070687_1000553894 | 210 |
| 966 | 3300005344 | Ga0070661_100211228 | Ga0070661_1002112281 | 210 |
| 967 | 3300005347 | Ga0070668_100197166 | Ga0070668_1001971664 | 210 |
| 968 | 3300005353 | Ga0070669_100046321 | Ga0070669_1000463211 | 210 |
| 969 | 3300005354 | Ga0070675_100013190 | Ga0070675_1000131904 | 210 |
| 970 | 3300005354 | Ga0070675_100115194 | Ga0070675_1001151943 | 210 |
| 971 | 3300005355 | Ga0070671_100031841 | Ga0070671_1000318417 | 210 |
| 972 | 3300005355 | Ga0070671_100048815 | Ga0070671_1000488152 | 210 |
| 973 | 3300005355 | Ga0070671_100820947 | Ga0070671_1008209471 | 210 |
| 974 | 3300005356 | Ga0070674_100006022 | Ga0070674_1000060224 | 210 |
| 975 | 3300005364 | Ga0070673_100043939 | Ga0070673_1000439392 | 210 |
| 976 | 3300005364 | Ga0070673_100357816 | Ga0070673_1003578162 | 210 |
| 977 | 3300005365 | Ga0070688_100094651 | Ga0070688_1000946512 | 210 |
| 978 | 3300005366 | Ga0070659_100104224 | Ga0070659_1001042242 | 210 |
| 979 | 3300005406 | Ga0070703_10132783 | Ga0070703_101327831 | 210 |
| 980 | 3300005438 | Ga0070701_10024863 | Ga0070701_100248631 | 210 |
| 981 | 3300005438 | Ga0070701_10494549 | Ga0070701_104945491 | 210 |
| 982 | 3300005440 | Ga0070705_100022328 | Ga0070705_1000223283 | 210 |
| 983 | 3300005440 | Ga0070705_100073413 | Ga0070705_1000734132 | 210 |
| 984 | 3300005441 | Ga0070700_100024557 | Ga0070700_1000245573 | 210 |
| 985 | 3300005444 | Ga0070694_100280065 | Ga0070694_1002800651 | 210 |
| 986 | 3300005456 | Ga0070678_100236989 | Ga0070678_1002369892 | 210 |
| 987 | 3300005457 | Ga0070662_100009224 | Ga0070662_1000092246 | 210 |
| 988 | 3300005459 | Ga0068867_100057704 | Ga0068867_1000577042 | 210 |
| 989 | 3300005466 | Ga0070685_10036395 | Ga0070685_100363953 | 210 |
| 990 | 3300005467 | Ga0070706_100027600 | Ga0070706_1000276002 | 210 |
| 991 | 3300005468 | Ga0070707_100037786 | Ga0070707_1000377864 | 210 |
| 992 | 3300005468 | Ga0070707_100308809 | Ga0070707_1003088091 | 210 |
| 993 | 3300005471 | Ga0070698_100039164 | Ga0070698_1000391647 | 210 |
| 994 | 3300005471 | Ga0070698_100215957 | Ga0070698_1002159572 | 210 |
| 995 | 3300005471 | Ga0070698_100366152 | Ga0070698_1003661521 | 210 |
| 996 | 3300005518 | Ga0070699_100053171 | Ga0070699_1000531713 | 210 |
| 997 | 3300005518 | Ga0070699_100463321 | Ga0070699_1004633212 | 210 |
| 998 | 3300005536 | Ga0070697_100542453 | Ga0070697_1005424531 | 210 |
| 999 | 3300005543 | Ga0070672_100001272 | Ga0070672_1000012722 | 210 |
| 1000 | 3300005543 | Ga0070672_100018421 | Ga0070672_1000184215 | 210 |
| 1001 | 3300005544 | Ga0070686_100013198 | Ga0070686_1000131985 | 210 |
| 1002 | 3300005545 | Ga0070695_100109814 | Ga0070695_1001098142 | 210 |
| 1003 | 3300005546 | Ga0070696_100408956 | Ga0070696_1004089562 | 210 |
| 1004 | 3300005548 | Ga0070665_100025093 | Ga0070665_1000250937 | 210 |
| 1005 | 3300005548 | Ga0070665_100188230 | Ga0070665_1001882304 | 210 |
| 1006 | 3300005578 | Ga0068854_100069210 | Ga0068854_1000692102 | 210 |
| 1007 | 3300005615 | Ga0070702_100033364 | Ga0070702_1000333641 | 210 |
| 1008 | 3300005616 | Ga0068852_100266552 | Ga0068852_1002665522 | 210 |
| 1009 | 3300005617 | Ga0068859_100030341 | Ga0068859_1000303413 | 210 |
| 1010 | 3300005718 | Ga0068866_10036933 | Ga0068866_100369334 | 210 |
| 1011 | 3300005841 | Ga0068863_100081515 | Ga0068863_1000815154 | 210 |
| 1012 | 3300005841 | Ga0068863_100232165 | Ga0068863_1002321651 | 210 |
| 1013 | 3300005842 | Ga0068858_100065254 | Ga0068858_1000652542 | 210 |
| 1014 | 3300005843 | Ga0068860_100065276 | Ga0068860_1000652762 | 210 |
| 1015 | 3300005843 | Ga0068860_100833222 | Ga0068860_1008332221 | 210 |
| 1016 | 3300005844 | Ga0068862_100047828 | Ga0068862_1000478282 | 210 |
| 1017 | 3300005844 | Ga0068862_100224879 | Ga0068862_1002248792 | 210 |
| 1018 | 3300005937 | Ga0081455_10005916 | Ga0081455_100059163 | 210 |
| 1019 | 3300005937 | Ga0081455_10047557 | Ga0081455_100475575 | 210 |
| 1020 | 3300005983 | Ga0081540_1023860 | Ga0081540_10238604 | 210 |
| 1021 | 3300006173 | Ga0070716_100240273 | Ga0070716_1002402732 | 210 |
| 1022 | 3300006237 | Ga0097621_100024206 | Ga0097621_1000242061 | 210 |
| 1023 | 3300006881 | Ga0068865_100006542 | Ga0068865_1000065426 | 210 |
| 1024 | 3300006881 | Ga0068865_100210426 | Ga0068865_1002104262 | 210 |
| 1025 | 3300006914 | Ga0075436_100187069 | Ga0075436_1001870692 | 210 |
| 1026 | 3300006931 | Ga0097620_100030340 | Ga0097620_1000303407 | 210 |
| 1027 | 3300009094 | Ga0111539_10366814 | Ga0111539_103668142 | 210 |
| 1028 | 3300009098 | Ga0105245_10011365 | Ga0105245_100113658 | 210 |
| 1029 | 3300009101 | Ga0105247_10054226 | Ga0105247_100542262 | 210 |
| 1030 | 3300009148 | Ga0105243_10033209 | Ga0105243_100332093 | 210 |
| 1031 | 3300009176 | Ga0105242_10014872 | Ga0105242_100148724 | 210 |
| 1032 | 3300009176 | Ga0105242_10514668 | Ga0105242_105146682 | 210 |
| 1033 | 3300009177 | Ga0105248_10055005 | Ga0105248_100550055 | 210 |
| 1034 | 3300009177 | Ga0105248_10070296 | Ga0105248_100702966 | 210 |
| 1035 | 3300009553 | Ga0105249_10014543 | Ga0105249_100145432 | 210 |
| 1036 | 3300009553 | Ga0105249_10608032 | Ga0105249_106080321 | 210 |
| 1037 | 3300013296 | Ga0157374_10049694 | Ga0157374_100496945 | 210 |
| 1038 | 3300013297 | Ga0157378_10046058 | Ga0157378_100460582 | 210 |
| 1039 | 3300013306 | Ga0163162_10021024 | Ga0163162_100210248 | 210 |
| 1040 | 3300013306 | Ga0163162_10063090 | Ga0163162_100630901 | 210 |
| 1041 | 3300013306 | Ga0163162_10195538 | Ga0163162_101955381 | 210 |
| 1042 | 3300013308 | Ga0157375_10036284 | Ga0157375_100362844 | 210 |
| 1043 | 3300014325 | Ga0163163_10124024 | Ga0163163_101240245 | 210 |
| 1044 | 3300014326 | Ga0157380_10056047 | Ga0157380_100560473 | 210 |
| 1045 | 3300014968 | Ga0157379_10021816 | Ga0157379_100218161 | 210 |
| 1046 | 3300017792 | Ga0163161_10018858 | Ga0163161_100188584 | 210 |
| 1047 | 3300025271 | Ga0207666_1008649 | Ga0207666_10086492 | 210 |
| 1048 | 3300025893 | Ga0207682_10001025 | Ga0207682_100010259 | 210 |
| 1049 | 3300025901 | Ga0207688_10003169 | Ga0207688_100031695 | 210 |
| 1050 | 3300025903 | Ga0207680_10049824 | Ga0207680_100498242 | 210 |
| 1051 | 3300025907 | Ga0207645_10003583 | Ga0207645_100035833 | 210 |
| 1052 | 3300025908 | Ga0207643_10002409 | Ga0207643_100024097 | 210 |
| 1053 | 3300025908 | Ga0207643_10088070 | Ga0207643_100880702 | 210 |
| 1054 | 3300025910 | Ga0207684_10162658 | Ga0207684_101626582 | 210 |
| 1055 | 3300025916 | Ga0207663_10367264 | Ga0207663_103672642 | 210 |
| 1056 | 3300025918 | Ga0207662_10004161 | Ga0207662_100041611 | 210 |
| 1057 | 3300025922 | Ga0207646_10029939 | Ga0207646_100299392 | 210 |
| 1058 | 3300025922 | Ga0207646_10257118 | Ga0207646_102571182 | 210 |
| 1059 | 3300025923 | Ga0207681_10006962 | Ga0207681_100069625 | 210 |
| 1060 | 3300025923 | Ga0207681_10040738 | Ga0207681_100407384 | 210 |
| 1061 | 3300025925 | Ga0207650_10018357 | Ga0207650_100183573 | 210 |
| 1062 | 3300025925 | Ga0207650_10111526 | Ga0207650_101115261 | 210 |
| 1063 | 3300025925 | Ga0207650_10714599 | Ga0207650_107145991 | 210 |
| 1064 | 3300025926 | Ga0207659_10035166 | Ga0207659_100351662 | 210 |
| 1065 | 3300025926 | Ga0207659_10043726 | Ga0207659_100437262 | 210 |
| 1066 | 3300025927 | Ga0207687_10146702 | Ga0207687_101467021 | 210 |
| 1067 | 3300025931 | Ga0207644_10047864 | Ga0207644_100478643 | 210 |
| 1068 | 3300025931 | Ga0207644_10105804 | Ga0207644_101058042 | 210 |
| 1069 | 3300025931 | Ga0207644_10119497 | Ga0207644_101194974 | 210 |
| 1070 | 3300025932 | Ga0207690_10097638 | Ga0207690_100976382 | 210 |
| 1071 | 3300025933 | Ga0207706_10016249 | Ga0207706_100162496 | 210 |
| 1072 | 3300025933 | Ga0207706_10027272 | Ga0207706_100272723 | 210 |
| 1073 | 3300025934 | Ga0207686_10055859 | Ga0207686_100558593 | 210 |
| 1074 | 3300025935 | Ga0207709_10179171 | Ga0207709_101791712 | 210 |
| 1075 | 3300025936 | Ga0207670_10024309 | Ga0207670_100243096 | 210 |
| 1076 | 3300025938 | Ga0207704_10073124 | Ga0207704_100731242 | 210 |
| 1077 | 3300025938 | Ga0207704_10151871 | Ga0207704_101518711 | 210 |
| 1078 | 3300025940 | Ga0207691_10001198 | Ga0207691_1000119810 | 210 |
| 1079 | 3300025942 | Ga0207689_10023429 | Ga0207689_100234295 | 210 |
| 1080 | 3300025960 | Ga0207651_10221879 | Ga0207651_102218793 | 210 |
| 1081 | 3300025960 | Ga0207651_10376413 | Ga0207651_103764132 | 210 |
| 1082 | 3300025961 | Ga0207712_10085661 | Ga0207712_100856611 | 210 |
| 1083 | 3300025972 | Ga0207668_10067082 | Ga0207668_100670821 | 210 |
| 1084 | 3300025986 | Ga0207658_10113071 | Ga0207658_101130711 | 210 |
| 1085 | 3300026023 | Ga0207677_10223930 | Ga0207677_102239301 | 210 |
| 1086 | 3300026035 | Ga0207703_10169868 | Ga0207703_101698684 | 210 |
| 1087 | 3300026075 | Ga0207708_10006559 | Ga0207708_100065594 | 210 |
| 1088 | 3300026095 | Ga0207676_10046220 | Ga0207676_100462203 | 210 |
| 1089 | 3300026118 | Ga0207675_100006074 | Ga0207675_1000060743 | 210 |
| 1090 | 3300026121 | Ga0207683_10009783 | Ga0207683_100097834 | 210 |
| 1091 | 3300026121 | Ga0207683_10265192 | Ga0207683_102651922 | 210 |
| 1092 | 3300028379 | Ga0268266_10056127 | Ga0268266_100561271 | 210 |
| 1093 | 3300028380 | Ga0268265_10163484 | Ga0268265_101634841 | 210 |
| 1094 | 3300028381 | Ga0268264_10169576 | Ga0268264_101695764 | 210 |
| 1095 | 3300028381 | Ga0268264_10555657 | Ga0268264_105556571 | 210 |
| 1096 | 3300031090 | Ga0265760_10102095 | Ga0265760_101020952 | 210 |
| 1097 | 3300035117 | Ga0373953_0148278 | Ga0373953_0148278_60_713 | 210 |
| 1098 | 3300035118 | Ga0373954_0218060 | Ga0373954_0218060_26_658 | 210 |
| 1099 | 3300035695 | Ga0373927_0139214 | Ga0373927_0139214_331_987 | 210 |
| 1100 | 3300035724 | Ga0373933_0090603 | Ga0373933_0090603_1056_1697 | 210 |
| 1101 | 3300035724 | Ga0373933_0162421 | Ga0373933_0162421_286_939 | 210 |
| 1102 | 3300035724 | Ga0373933_0518679 | Ga0373933_0518679_39_671 | 210 |
| 1103 | 3300036401 | Ga0373937_0063706 | Ga0373937_0063706_933_1586 | 210 |
| 1104 | 3300036401 | Ga0373937_0137131 | Ga0373937_0137131_1116_1748 | 210 |
| 1105 | 3300041496 | Ga0451839_0934718 | Ga0451839_0934718_70_717 | 210 |
| 1106 | 3300044673 | Ga0453683_0000623 | Ga0453683_0000623_16682_17314 | 210 |
| 1107 | 3300044712 | Ga0453684_0060792 | Ga0453684_0060792_2465_3097 | 210 |
| 1108 | 3300046452 | Ga0495617_094802 | Ga0495617_094802_278_913 | 210 |
| 1109 | 3300046454 | Ga0495592_0021167 | Ga0495592_0021167_1444_2214 | 210 |
| 1110 | 3300046471 | Ga0495650_0034994 | Ga0495650_0034994_188_823 | 210 |
| 1111 | 3300046472 | Ga0495580_0123458 | Ga0495580_0123458_1106_1738 | 210 |
| 1112 | 3300046474 | Ga0495605_0145495 | Ga0495605_0145495_293_928 | 210 |
| 1113 | 3300046507 | Ga0495606_0006667 | Ga0495606_0006667_8489_9124 | 210 |
| 1114 | 3300046511 | Ga0495608_0057618 | Ga0495608_0057618_460_1230 | 210 |
| 1115 | 3300046512 | Ga0495610_0004766 | Ga0495610_0004766_2166_2801 | 210 |
| 1116 | 3300046515 | Ga0495620_0002433 | Ga0495620_0002433_8922_9557 | 210 |
| 1117 | 3300046518 | Ga0495631_0185240 | Ga0495631_0185240_76_711 | 210 |
| 1118 | 3300046519 | Ga0495632_0003386 | Ga0495632_0003386_10601_11236 | 210 |
| 1119 | 3300046520 | Ga0495637_0033297 | Ga0495637_0033297_1418_2053 | 210 |
| 1120 | 3300046524 | Ga0495648_0011641 | Ga0495648_0011641_4261_4896 | 210 |
| 1121 | 3300046529 | Ga0495652_0031385 | Ga0495652_0031385_1347_1994 | 210 |
| 1122 | 3300046531 | Ga0495665_0196999 | Ga0495665_0196999_14_784 | 210 |
| 1123 | 3300046533 | Ga0495640_0025477 | Ga0495640_0025477_2900_3670 | 210 |
| 1124 | 3300046537 | Ga0495598_0167395 | Ga0495598_0167395_82_723 | 210 |
| 1125 | 3300046543 | Ga0495645_0184950 | Ga0495645_0184950_375_1022 | 210 |
| 1126 | 3300046660 | Ga0495625_0018672 | Ga0495625_0018672_1716_2351 | 210 |
| 1127 | 3300046663 | Ga0495635_0112379 | Ga0495635_0112379_1170_1817 | 210 |
| 1128 | 3300046665 | Ga0495661_0010360 | Ga0495661_0010360_3501_4136 | 210 |
| 1129 | 3300046678 | Ga0495599_0155072 | Ga0495599_0155072_446_1216 | 210 |
| 1130 | 3300046683 | Ga0495658_0096942 | Ga0495658_0096942_968_1621 | 210 |
| 1131 | 3300046683 | Ga0495658_0272888 | Ga0495658_0272888_14_655 | 210 |
| 1132 | 3300046691 | Ga0495670_0128649 | Ga0495670_0128649_644_1279 | 210 |
| 1133 | 3300046694 | Ga0495649_0043315 | Ga0495649_0043315_1419_2054 | 210 |
| 1134 | 3300047319 | Ga0495674_0014128 | Ga0495674_0014128_2041_2811 | 210 |
| 1135 | 3300047321 | Ga0495676_0028518 | Ga0495676_0028518_2408_3178 | 210 |
| 1136 | 3300047446 | Ga0495679_013688 | Ga0495679_013688_944_1579 | 210 |
| 1137 | 3300047469 | Ga0495673_0008822 | Ga0495673_0008822_3275_3910 | 210 |
| 1138 | 3300047470 | Ga0495681_0017362 | Ga0495681_0017362_2841_3476 | 210 |
| 1139 | 3300047471 | Ga0495684_0138874 | Ga0495684_0138874_1068_1715 | 210 |
| 1140 | 3300048091 | Ga0495626_0000510 | Ga0495626_0000510_34921_35556 | 210 |
| 1141 | 3300048904 | Ga0496101_0079623 | Ga0496101_0079623_1031_1669 | 210 |
| 1142 | 3300048906 | Ga0496103_0547401 | Ga0496103_0547401_82_714 | 210 |
| 1143 | 3300048907 | Ga0496104_0005082 | Ga0496104_0005082_6346_6978 | 210 |
| 1144 | 3300048911 | Ga0496108_0436198 | Ga0496108_0436198_343_984 | 210 |
| 1145 | 3300048914 | Ga0496111_0692311 | Ga0496111_0692311_72_704 | 210 |
| 1146 | 3300048916 | Ga0496113_0502051 | Ga0496113_0502051_188_820 | 210 |
| 1147 | 3300048917 | Ga0496114_0772617 | Ga0496114_0772617_103_744 | 210 |
| 1148 | 3300048918 | Ga0496115_0154878 | Ga0496115_0154878_135_767 | 210 |
| 1149 | 3300049571 | Ga0501034_0801201 | Ga0501034_0801201_38_679 | 210 |
| 1150 | 3300049573 | Ga0501037_0117428 | Ga0501037_0117428_1128_1778 | 210 |
| 1151 | 3300049587 | Ga0501071_0182209 | Ga0501071_0182209_585_1217 | 210 |
| 1152 | 3300050512 | nmdc:mga0n895_209223_c1 | nmdc:mga0n895_209223_c1_1173_1844 | 210 |
| 1153 | 3300050515 | nmdc:mga0a205_844721_c1 | nmdc:mga0a205_844721_c1_66_737 | 210 |
| 1154 | 3300053083 | Ga0495655_0178544 | Ga0495655_0178544_24_656 | 210 |
| 1155 | 3300053085 | Ga0495619_0153905 | Ga0495619_0153905_813_1454 | 210 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e23-assembly1.cif.gz_A | crystal structure of the rpa2492 protein in complex with sam from rhodopseudomonas palustris, northeast structural genomics consortium target rpr299 | 0.8545 | 13 | 208 |
| 2ex4-assembly1.cif.gz_B | crystal structure of human methyltransferase ad-003 in complex with s-adenosyl-l-homocysteine | 0.8508 | 6 | 206 |
| 3sm3-assembly1.cif.gz_A-2 | crystal structure of sam-dependent methyltransferases q8puk2_metma from methanosarcina mazei. northeast structural genomics consortium target mar262. | 0.85 | 43 | 210 |
| 6wh8-assembly1.cif.gz_B | the structure of ntmt1 in complex with compound bm-30 | 0.8475 | 6 | 206 |
| 3h2b-assembly1.cif.gz_A | crystal structure of the sam-dependent methyltransferase cg3271 from corynebacterium glutamicum in complex with s-adenosyl-l-homocysteine and pyrophosphate. northeast structural genomics consortium target cgr113a | 0.8456 | 12 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DGB0_458_609_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8882 | 65 | 98 | 3.40.50.1010 |
| af_A0A1D6QMW6_179_313_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8807 | 55 | 145 | 3.40.50.150 |
| af_A0A1D6EFY7_537_616_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8702 | 53 | 100 | 3.40.50.150 |
| af_Q80WQ4_26_187_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8671 | 40 | 147 | 3.40.50.150 |
| af_Q9P3E7_8_144_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8632 | 53 | 160 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I1VMB8-F1-model_v4 | Methyltransferase domain-containing protein | 0.9949 | 1 | 209 |
GO:0008168
GO:0032259 |
| AF-A0A523G3N5-F1-model_v4 | Methyltransferase domain-containing protein | 0.9943 | 3 | 208 |
GO:0000150
GO:0003677 GO:0008168 GO:0032259 |
| AF-A0A2S6R7N8-F1-model_v4 | Methyltransferase domain-containing protein | 0.9938 | 6 | 207 |
GO:0008168
GO:0032259 |
| AF-A0A3M6I8Y5-F1-model_v4 | Ubiquinone/menaquinone biosynthesis methyltransferase ubie | 0.9932 | 44 | 208 |
GO:0008168
GO:0032259 |
| AF-A0A7U7EEM4-F1-model_v4 | deleted | 0.9922 | 6 | 210 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar