F490926

General Info

Members Datasets Scaffolds Average Seq Length
1155 415 1139 211

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0021167|Ga0495592_0021167_1444_2214
Length 256
Sequence MKLNAQDLKEIITLTLEHYNQRAEEFWTGTRDHDVSQNIAAMLQYIEGESRFTILDFGCGPGRDLKVVAGLGHTAVGLEGAAHFADMARAYCGCEVWQQDFLKLDLPNNYFDGVFANAALFHVPSQELPRVLLELHASLKPGGVLFSSNPHGHNEEGWNGGRYVVYYDLNAWRRYVSAAGFVELSHYYRPAGLPRERQPSLASVWRRQGSCAAWPLPDALSDRCRSNWSAVLTARQLRFAPPRNQLRSTRQRTQLL

Samples

Sample ID Description Type Environment
1 2511231004 Pseudomonas sp. GM102 Isolate Nodule
2 2511231012 Pseudomonas sp. GM33 Isolate Nodule
3 2511231015 Pseudomonas sp. GM49 Isolate Nodule
4 2511231016 Pseudomonas sp. GM50 Isolate Nodule
5 2511231018 Pseudomonas sp. GM60 Isolate Nodule
6 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
7 2643221569 Achromobacter sp. Root565 Isolate Unclassified
8 2773857670 Pseudomonas sp. 478 Isolate Unclassified
9 2784132072 Pseudomonas sp. 460 Isolate Unclassified
10 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
11 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
12 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
13 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
14 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
133 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
196 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
200 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
201 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
202 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
205 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
212 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
213 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
214 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
215 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
218 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
219 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
220 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
224 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
225 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
243 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
244 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
245 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
246 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
247 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
248 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
249 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
250 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
251 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
252 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
253 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
254 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
255 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
256 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
257 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
258 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
259 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
260 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
261 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
262 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
263 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
264 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
265 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
266 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
267 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
268 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
269 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
270 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
271 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
275 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
279 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
282 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
283 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
284 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
285 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
286 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
287 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
288 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
289 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
290 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
296 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
297 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
298 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
299 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
300 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
303 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
307 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
308 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
309 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
310 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
311 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
312 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
313 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
314 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
315 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
316 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
317 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
318 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
319 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
320 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
323 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
324 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
329 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
330 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
331 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
334 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
337 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
338 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
339 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
340 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
341 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
342 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
343 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
344 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
345 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
346 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
347 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
348 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
349 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
350 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
351 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
352 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
355 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
356 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
357 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
358 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
359 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
360 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
361 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
362 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
363 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
364 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
365 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
366 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
367 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
368 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
369 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
370 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
371 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
372 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
373 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
374 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
375 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
376 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
377 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
378 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
381 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
382 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
383 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
384 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
385 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
386 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
389 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
390 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
395 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
396 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
397 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
398 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
399 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
400 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
401 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
402 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
403 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
404 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
405 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
406 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
407 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
408 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
409 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
410 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
411 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
412 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
413 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
414 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
415 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0.09
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0.43
Rhizoplane 3.03
Rhizosphere 94.72
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10084390 3300005295 Bacteria 7262
2 Ga0065707_10176604 3300005295 Bacteria 1446
3 Ga0065707_10231719 3300005295 Bacteria 1186
4 Ga0070676_10026495 3300005328 Bacteria 3282
5 Ga0070676_10285226 3300005328 Bacteria 1114
6 Ga0070676_10343574 3300005328 Bacteria 1024
7 Ga0070690_100004121 3300005330 Bacteria 8050
8 Ga0070690_100019324 3300005330 Bacteria 4132
9 Ga0070690_100079142 3300005330 Bacteria 2149
10 Ga0070677_10014886 3300005333 Bacteria 2747
11 Ga0068869_100005998 3300005334 Bacteria 7684
12 Ga0068869_100007257 3300005334 Bacteria 7063
13 Ga0068869_100663369 3300005334 Bacteria 886
14 Ga0070666_10078571 3300005335 Bacteria 2253
15 Ga0070666_10132525 3300005335 Bacteria 1732
16 Ga0070680_100003142 3300005336 Bacteria 12268
17 Ga0070682_100030658 3300005337 Bacteria 3249
18 Ga0070682_100440790 3300005337 Bacteria 995
19 Ga0068868_100010422 3300005338 Bacteria 6729
20 Ga0068868_100011124 3300005338 Bacteria 6548
21 Ga0068868_100011828 3300005338 Bacteria 6363
22 Ga0070689_100010204 3300005340 Bacteria 6689
23 Ga0070689_100082145 3300005340 Bacteria 2530
24 Ga0070689_100336428 3300005340 Bacteria 1264
25 Ga0070691_10003222 3300005341 Bacteria 7311
26 Ga0070687_100002697 3300005343 Bacteria 6713
27 Ga0070687_100055389 3300005343 Bacteria 2071
28 Ga0070687_100568821 3300005343 Bacteria 774
29 Ga0070661_100211228 3300005344 Bacteria 1486
30 Ga0070692_10064768 3300005345 Bacteria 1933
31 Ga0070668_100197166 3300005347 Bacteria 1652
32 Ga0070668_100451793 3300005347 Bacteria 1105
33 Ga0070669_100046321 3300005353 Bacteria 3171
34 Ga0070669_100102206 3300005353 Bacteria 2164
35 Ga0070669_100153401 3300005353 Bacteria 1784
36 Ga0070675_100013190 3300005354 Bacteria 6493
37 Ga0070675_100043373 3300005354 Bacteria 3675
38 Ga0070675_100115194 3300005354 Bacteria 2278
39 Ga0070671_100031841 3300005355 Bacteria 4359
40 Ga0070671_100048815 3300005355 Bacteria 3521
41 Ga0070671_100087118 3300005355 Bacteria 2613
42 Ga0070671_100100707 3300005355 Unclassified 2424
43 Ga0070671_100141714 3300005355 Bacteria 2028
44 Ga0070671_100820947 3300005355 Bacteria 810
45 Ga0070674_100006022 3300005356 Bacteria 7047
46 Ga0070674_100486227 3300005356 Bacteria 1025
47 Ga0070673_100043939 3300005364 Bacteria 3457
48 Ga0070673_100062776 3300005364 Bacteria 2953
49 Ga0070673_100079768 3300005364 Bacteria 2651
50 Ga0070673_100357816 3300005364 Bacteria 1297
51 Ga0070673_100516696 3300005364 Bacteria 1082
52 Ga0070688_100094651 3300005365 Bacteria 1959
53 Ga0070688_100336608 3300005365 Bacteria 1101
54 Ga0070659_100104224 3300005366 Bacteria 2285
55 Ga0070667_100001093 3300005367 Bacteria 24858
56 Ga0070667_100007283 3300005367 Bacteria 9198
57 Ga0070703_10006823 3300005406 Bacteria 3204
58 Ga0070703_10132783 3300005406 Bacteria 916
59 Ga0070714_100023933 3300005435 Bacteria 5023
60 Ga0070714_100704411 3300005435 Bacteria 974
61 Ga0070713_100337791 3300005436 Bacteria 1395
62 Ga0070713_100416573 3300005436 Bacteria 1257
63 Ga0070713_101032103 3300005436 Bacteria 794
64 Ga0070710_10163574 3300005437 Unclassified 1382
65 Ga0070701_10024863 3300005438 Bacteria 2901
66 Ga0070701_10494549 3300005438 Bacteria 793
67 Ga0070711_100128317 3300005439 Bacteria 1885
68 Ga0070711_100163288 3300005439 Bacteria 1690
69 Ga0070711_100275581 3300005439 Bacteria 1329
70 Ga0070711_100337560 3300005439 Bacteria 1208
71 Ga0070711_100421991 3300005439 Bacteria 1087
72 Ga0070711_100594474 3300005439 Bacteria 922
73 Ga0070705_100002548 3300005440 Bacteria 9159
74 Ga0070705_100019590 3300005440 Bacteria 3563
75 Ga0070705_100022328 3300005440 Bacteria 3381
76 Ga0070705_100073413 3300005440 Bacteria 2076
77 Ga0070705_100132290 3300005440 Bacteria 1629
78 Ga0070705_100879489 3300005440 Bacteria 719
79 Ga0070700_100009639 3300005441 Bacteria 5307
80 Ga0070700_100024557 3300005441 Bacteria 3540
81 Ga0070694_100013810 3300005444 Bacteria 5049
82 Ga0070694_100280065 3300005444 Bacteria 1271
83 Ga0070708_100395528 3300005445 Bacteria 1303
84 Ga0070708_100537325 3300005445 Unclassified 1103
85 Ga0070678_100236989 3300005456 Bacteria 1524
86 Ga0070662_100009224 3300005457 Bacteria 6442
87 Ga0070681_10402764 3300005458 Bacteria 1280
88 Ga0068867_100006836 3300005459 Bacteria 8065
89 Ga0068867_100010444 3300005459 Bacteria 6554
90 Ga0068867_100057704 3300005459 Bacteria 2875
91 Ga0068867_100063442 3300005459 Bacteria 2746
92 Ga0068867_100409671 3300005459 Bacteria 1145
93 Ga0070685_10036395 3300005466 Bacteria 2782
94 Ga0070685_10236773 3300005466 Bacteria 1203
95 Ga0070706_100027600 3300005467 Bacteria 5224
96 Ga0070706_100234877 3300005467 Bacteria 1712
97 Ga0070707_100020730 3300005468 Bacteria 6204
98 Ga0070707_100037786 3300005468 Bacteria 4610
99 Ga0070707_100308809 3300005468 Bacteria 1537
100 Ga0070707_100585566 3300005468 Bacteria 1078
101 Ga0070698_100039164 3300005471 Bacteria 4880
102 Ga0070698_100215957 3300005471 Bacteria 1852
103 Ga0070698_100366152 3300005471 Bacteria 1373
104 Ga0070699_100053171 3300005518 Bacteria 3505
105 Ga0070699_100455608 3300005518 Bacteria 1160
106 Ga0070699_100463321 3300005518 Bacteria 1150
107 Ga0070679_100001875 3300005530 Bacteria 18913
108 Ga0070679_100008233 3300005530 Bacteria 9804
109 Ga0070679_100277724 3300005530 Bacteria 1628
110 Ga0070697_100117457 3300005536 Bacteria 2222
111 Ga0070697_100542453 3300005536 Bacteria 1019
112 Ga0070672_100001272 3300005543 Bacteria 15493
113 Ga0070672_100018421 3300005543 Bacteria 5049
114 Ga0070672_100021698 3300005543 Bacteria 4703
115 Ga0070672_100022966 3300005543 Bacteria 4591
116 Ga0070672_100652490 3300005543 Bacteria 919
117 Ga0070686_100006730 3300005544 Bacteria 6397
118 Ga0070686_100013198 3300005544 Bacteria 4722
119 Ga0070695_100004287 3300005545 Bacteria 8345
120 Ga0070695_100005497 3300005545 Bacteria 7465
121 Ga0070695_100109814 3300005545 Bacteria 1870
122 Ga0070696_100001122 3300005546 Bacteria 17336
123 Ga0070696_100189621 3300005546 Bacteria 1530
124 Ga0070696_100408956 3300005546 Bacteria 1063
125 Ga0070693_100006305 3300005547 Bacteria 5749
126 Ga0070693_100573191 3300005547 Bacteria 811
127 Ga0070665_100025093 3300005548 Bacteria 6008
128 Ga0070665_100033616 3300005548 Bacteria 5160
129 Ga0070665_100188230 3300005548 Bacteria 2065
130 Ga0070665_100902825 3300005548 Bacteria 896
131 Ga0070704_100000083 3300005549 Bacteria 32513
132 Ga0070704_100016975 3300005549 Bacteria 4616
133 Ga0070704_100184039 3300005549 Bacteria 1673
134 Ga0070704_100443478 3300005549 Bacteria 1116
135 Ga0068855_100025317 3300005563 Bacteria 7101
136 Ga0068855_100039862 3300005563 Bacteria 5576
137 Ga0068855_100547284 3300005563 Bacteria 1253
138 Ga0068857_100048049 3300005577 Bacteria 3789
139 Ga0068854_100050532 3300005578 Bacteria 2975
140 Ga0068854_100069210 3300005578 Bacteria 2576
141 Ga0068856_100533276 3300005614 Bacteria 1195
142 Ga0070702_100007025 3300005615 Bacteria 5368
143 Ga0070702_100033364 3300005615 Bacteria 2830
144 Ga0070702_100812849 3300005615 Bacteria 724
145 Ga0068852_100266552 3300005616 Bacteria 1647
146 Ga0068852_100499417 3300005616 Bacteria 1211
147 Ga0068852_100791229 3300005616 Bacteria 962
148 Ga0068859_100006490 3300005617 Bacteria 11874
149 Ga0068859_100030341 3300005617 Bacteria 5425
150 Ga0068859_100052283 3300005617 Bacteria 4107
151 Ga0068864_100002280 3300005618 Bacteria 15868
152 Ga0068864_100049722 3300005618 Bacteria 3608
153 Ga0068864_100849106 3300005618 Bacteria 900
154 Ga0068866_10002197 3300005718 Bacteria 8126
155 Ga0068866_10036933 3300005718 Bacteria 2396
156 Ga0068861_100001241 3300005719 Bacteria 15888
157 Ga0068861_100014217 3300005719 Bacteria 5583
158 Ga0068870_10001840 3300005840 Bacteria 8720
159 Ga0068870_10016150 3300005840 Bacteria 3561
160 Ga0068863_100002300 3300005841 Bacteria 18999
161 Ga0068863_100013022 3300005841 Bacteria 8019
162 Ga0068863_100046547 3300005841 Bacteria 4117
163 Ga0068863_100080907 3300005841 Bacteria 3077
164 Ga0068863_100081515 3300005841 Bacteria 3065
165 Ga0068863_100232165 3300005841 Bacteria 1780
166 Ga0068858_100010433 3300005842 Bacteria 8801
167 Ga0068858_100030844 3300005842 Bacteria 4979
168 Ga0068858_100034170 3300005842 Bacteria 4716
169 Ga0068858_100063190 3300005842 Bacteria 3426
170 Ga0068858_100065254 3300005842 Bacteria 3368
171 Ga0068858_100171424 3300005842 Bacteria 2046
172 Ga0068860_100014740 3300005843 Bacteria 7644
173 Ga0068860_100018123 3300005843 Bacteria 6855
174 Ga0068860_100024570 3300005843 Bacteria 5820
175 Ga0068860_100065276 3300005843 Bacteria 3457
176 Ga0068860_100253259 3300005843 Bacteria 1715
177 Ga0068860_100833222 3300005843 Bacteria 937
178 Ga0068862_100010079 3300005844 Bacteria 7801
179 Ga0068862_100047828 3300005844 Bacteria 3651
180 Ga0068862_100224879 3300005844 Bacteria 1700
181 Ga0068862_100676069 3300005844 Bacteria 998
182 Ga0068862_100933668 3300005844 Bacteria 855
183 Ga0081455_10005916 3300005937 Bacteria 13274
184 Ga0081455_10019458 3300005937 Bacteria 6423
185 Ga0081455_10031813 3300005937 Bacteria 4766
186 Ga0081455_10047557 3300005937 Bacteria 3715
187 Ga0081540_1023860 3300005983 Bacteria 3564
188 Ga0070717_10090720 3300006028 Bacteria 2579
189 Ga0070717_10798187 3300006028 Unclassified 859
190 Ga0070717_11119322 3300006028 Bacteria 717
191 Ga0075365_10417902 3300006038 Bacteria 947
192 Ga0075432_10010171 3300006058 Bacteria 3192
193 Ga0070715_10196004 3300006163 Bacteria 1023
194 Ga0070716_100013835 3300006173 Bacteria 4121
195 Ga0070716_100119258 3300006173 Bacteria 1649
196 Ga0070716_100165299 3300006173 Bacteria 1438
197 Ga0070716_100240273 3300006173 Bacteria 1228
198 Ga0070712_100000823 3300006175 Bacteria 18428
199 Ga0070712_100045961 3300006175 Bacteria 3017
200 Ga0070712_100183202 3300006175 Bacteria 1633
201 Ga0097621_100003387 3300006237 Bacteria 10975
202 Ga0097621_100017059 3300006237 Bacteria 5507
203 Ga0097621_100024206 3300006237 Bacteria 4738
204 Ga0097621_100179521 3300006237 Bacteria 1829
205 Ga0097621_100519200 3300006237 Bacteria 1081
206 Ga0068871_100003490 3300006358 Bacteria 10808
207 Ga0068871_100008380 3300006358 Bacteria 7434
208 Ga0068871_100078323 3300006358 Bacteria 2733
209 Ga0068871_100108484 3300006358 Bacteria 2333
210 Ga0075428_100010065 3300006844 Bacteria 10507
211 Ga0075428_100188006 3300006844 Bacteria 2234
212 Ga0075428_100221354 3300006844 Bacteria 2043
213 Ga0075430_100318562 3300006846 Bacteria 1285
214 Ga0075431_100007683 3300006847 Bacteria 10739
215 Ga0075431_100056564 3300006847 Bacteria 4045
216 Ga0075431_100389701 3300006847 Unclassified 1396
217 Ga0075433_10088674 3300006852 Bacteria 2734
218 Ga0075433_10108199 3300006852 Bacteria 2466
219 Ga0075434_100021290 3300006871 Bacteria 6303
220 Ga0075434_100073551 3300006871 Bacteria 3410
221 Ga0075434_100092651 3300006871 Bacteria 3024
222 Ga0075434_100098906 3300006871 Bacteria 2922
223 Ga0075434_100103030 3300006871 Bacteria 2862
224 Ga0075429_100002284 3300006880 Bacteria 16086
225 Ga0075429_100033610 3300006880 Bacteria 4457
226 Ga0075429_100064749 3300006880 Bacteria 3183
227 Ga0068865_100006542 3300006881 Bacteria 7119
228 Ga0068865_100210426 3300006881 Bacteria 1515
229 Ga0075436_100004626 3300006914 Bacteria 9430
230 Ga0075436_100008330 3300006914 Bacteria 7090
231 Ga0075436_100187069 3300006914 Bacteria 1465
232 Ga0075436_100196331 3300006914 Bacteria 1429
233 Ga0075436_100204011 3300006914 Bacteria 1401
234 Ga0075436_100403027 3300006914 Bacteria 991
235 Ga0097620_100006489 3300006931 Bacteria 11874
236 Ga0097620_100030340 3300006931 Bacteria 5425
237 Ga0097620_100052284 3300006931 Bacteria 4107
238 Ga0075435_100019017 3300007076 Bacteria 5235
239 Ga0075435_100143852 3300007076 Bacteria 2002
240 Ga0075435_100269005 3300007076 Bacteria 1453
241 Ga0075435_100757569 3300007076 Bacteria 845
242 Ga0099794_10010908 3300007265 Bacteria 3874
243 Ga0099794_10012586 3300007265 Bacteria 3656
244 Ga0099794_10013510 3300007265 Bacteria 3555
245 Ga0099794_10174618 3300007265 Unclassified 1096
246 Ga0105251_10001212 3300009011 Bacteria 22289
247 Ga0105251_10090960 3300009011 Bacteria 1402
248 Ga0105250_10031050 3300009092 Bacteria 2145
249 Ga0105240_10128238 3300009093 Bacteria 3046
250 Ga0111539_10057327 3300009094 Bacteria 4626
251 Ga0111539_10088096 3300009094 Bacteria 3647
252 Ga0111539_10135862 3300009094 Bacteria 2880
253 Ga0111539_10366814 3300009094 Bacteria 1676
254 Ga0111539_11131637 3300009094 Bacteria 910
255 Ga0111539_11155015 3300009094 Bacteria 900
256 Ga0105245_10002508 3300009098 Bacteria 16549
257 Ga0105245_10007367 3300009098 Bacteria 9633
258 Ga0105245_10011365 3300009098 Bacteria 7753
259 Ga0105247_10054226 3300009101 Bacteria 2474
260 Ga0105247_10831621 3300009101 Bacteria 707
261 Ga0114129_10057223 3300009147 Bacteria 5458
262 Ga0114129_10141179 3300009147 Bacteria 3302
263 Ga0105243_10000828 3300009148 Bacteria 29395
264 Ga0105243_10033209 3300009148 Bacteria 3990
265 Ga0105243_10201542 3300009148 Bacteria 1745
266 Ga0105241_10005717 3300009174 Bacteria 9177
267 Ga0105241_10374284 3300009174 Bacteria 1243
268 Ga0105242_10012860 3300009176 Bacteria 6449
269 Ga0105242_10013252 3300009176 Bacteria 6365
270 Ga0105242_10014872 3300009176 Bacteria 6028
271 Ga0105242_10514668 3300009176 Bacteria 1141
272 Ga0105248_10001643 3300009177 Bacteria 24867
273 Ga0105248_10021343 3300009177 Bacteria 7176
274 Ga0105248_10055005 3300009177 Bacteria 4463
275 Ga0105248_10062724 3300009177 Bacteria 4173
276 Ga0105248_10070296 3300009177 Bacteria 3931
277 Ga0105248_10386929 3300009177 Bacteria 1575
278 Ga0105248_10551725 3300009177 Bacteria 1300
279 Ga0105249_10000305 3300009553 Bacteria 49977
280 Ga0105249_10005189 3300009553 Bacteria 11242
281 Ga0105249_10014543 3300009553 Bacteria 6958
282 Ga0105249_10608032 3300009553 Bacteria 1148
283 Ga0099796_10006396 3300010159 Bacteria 3012
284 Ga0105239_10050189 3300010375 Bacteria 4577
285 Ga0105239_10167562 3300010375 Bacteria 2456
286 Ga0105239_11031009 3300010375 Bacteria 946
287 Ga0157371_10000641 3300013102 Bacteria 41468
288 Ga0157370_10065396 3300013104 Bacteria 3440
289 Ga0157370_10345975 3300013104 Bacteria 1370
290 Ga0157369_10746905 3300013105 Bacteria 1007
291 Ga0157369_10842984 3300013105 Bacteria 941
292 Ga0157374_10049694 3300013296 Bacteria 3896
293 Ga0157374_10061531 3300013296 Bacteria 3516
294 Ga0157374_10965470 3300013296 Bacteria 871
295 Ga0157378_10000905 3300013297 Bacteria 27336
296 Ga0157378_10017494 3300013297 Bacteria 6292
297 Ga0157378_10046058 3300013297 Bacteria 3878
298 Ga0157378_10366414 3300013297 Bacteria 1411
299 Ga0157378_10403580 3300013297 Bacteria 1347
300 Ga0163162_10021024 3300013306 Bacteria 6419
301 Ga0163162_10063090 3300013306 Bacteria 3747
302 Ga0163162_10088023 3300013306 Bacteria 3185
303 Ga0163162_10195538 3300013306 Bacteria 2151
304 Ga0163162_10207566 3300013306 Bacteria 2088
305 Ga0157372_10031503 3300013307 Bacteria 5806
306 Ga0157372_10337749 3300013307 Bacteria 1755
307 Ga0157372_10443499 3300013307 Bacteria 1513
308 Ga0157375_10036284 3300013308 Bacteria 4715
309 Ga0157375_10059181 3300013308 Bacteria 3794
310 Ga0157375_10191935 3300013308 Bacteria 2197
311 Ga0157375_10215999 3300013308 Bacteria 2076
312 Ga0163163_10009741 3300014325 Bacteria 8604
313 Ga0163163_10124024 3300014325 Bacteria 2619
314 Ga0157380_10023521 3300014326 Bacteria 4648
315 Ga0157380_10056047 3300014326 Bacteria 3133
316 Ga0182008_10002767 3300014497 Bacteria 10872
317 Ga0182008_10035174 3300014497 Bacteria 2510
318 Ga0157377_10084780 3300014745 Bacteria 1859
319 Ga0157379_10001014 3300014968 Bacteria 22781
320 Ga0157379_10001029 3300014968 Bacteria 22645
321 Ga0157379_10021816 3300014968 Bacteria 5674
322 Ga0157379_10059384 3300014968 Unclassified 3419
323 Ga0157379_10103200 3300014968 Bacteria 2559
324 Ga0157376_10002734 3300014969 Bacteria 12030
325 Ga0157376_10016490 3300014969 Bacteria 5611
326 Ga0157376_10024125 3300014969 Bacteria 4771
327 Ga0157376_10067310 3300014969 Bacteria 3029
328 Ga0182005_1009775 3300015265 Bacteria 2777
329 Ga0163161_10010873 3300017792 Bacteria 6308
330 Ga0163161_10018858 3300017792 Bacteria 4836
331 Ga0228598_1022512 3300024227 Bacteria 1239
332 Ga0207666_1008649 3300025271 Bacteria 1363
333 Ga0207713_1004860 3300025735 Bacteria 8615
334 Ga0207713_1015261 3300025735 Bacteria 3952
335 Ga0207713_1079390 3300025735 Bacteria 1185
336 Ga0207653_10003361 3300025885 Bacteria 5049
337 Ga0207653_10102183 3300025885 Bacteria 1015
338 Ga0207682_10001025 3300025893 Bacteria 12932
339 Ga0207692_10228036 3300025898 Bacteria 1107
340 Ga0207642_10001262 3300025899 Bacteria 7842
341 Ga0207642_10029525 3300025899 Bacteria 2272
342 Ga0207688_10003169 3300025901 Bacteria 8972
343 Ga0207680_10027293 3300025903 Bacteria 3177
344 Ga0207680_10049824 3300025903 Bacteria 2495
345 Ga0207647_10115004 3300025904 Bacteria 1589
346 Ga0207699_10219647 3300025906 Bacteria 1297
347 Ga0207645_10003583 3300025907 Bacteria 11745
348 Ga0207645_10157508 3300025907 Bacteria 1484
349 Ga0207643_10002409 3300025908 Bacteria 10119
350 Ga0207643_10088070 3300025908 Bacteria 1806
351 Ga0207684_10162658 3300025910 Bacteria 1922
352 Ga0207684_10302588 3300025910 Bacteria 1379
353 Ga0207654_10023421 3300025911 Bacteria 3308
354 Ga0207707_10170080 3300025912 Bacteria 1905
355 Ga0207707_10318632 3300025912 Bacteria 1343
356 Ga0207695_10023324 3300025913 Bacteria 6995
357 Ga0207695_10074716 3300025913 Bacteria 3450
358 Ga0207693_10035007 3300025915 Bacteria 3961
359 Ga0207693_10048168 3300025915 Bacteria 3347
360 Ga0207693_10054236 3300025915 Bacteria 3145
361 Ga0207693_10105568 3300025915 Bacteria 2209
362 Ga0207693_10229959 3300025915 Bacteria 1456
363 Ga0207663_10019562 3300025916 Bacteria 3818
364 Ga0207663_10106226 3300025916 Bacteria 1897
365 Ga0207663_10168759 3300025916 Bacteria 1552
366 Ga0207663_10229335 3300025916 Bacteria 1356
367 Ga0207663_10246675 3300025916 Bacteria 1312
368 Ga0207663_10308260 3300025916 Bacteria 1185
369 Ga0207663_10367264 3300025916 Bacteria 1093
370 Ga0207660_10009077 3300025917 Bacteria 6440
371 Ga0207660_10283502 3300025917 Bacteria 1315
372 Ga0207660_10634090 3300025917 Bacteria 871
373 Ga0207662_10000200 3300025918 Bacteria 27999
374 Ga0207662_10004161 3300025918 Bacteria 7573
375 Ga0207652_10024823 3300025921 Bacteria 4975
376 Ga0207652_10202325 3300025921 Bacteria 1787
377 Ga0207646_10029939 3300025922 Bacteria 4942
378 Ga0207646_10257118 3300025922 Bacteria 1578
379 Ga0207681_10006962 3300025923 Bacteria 6938
380 Ga0207681_10040738 3300025923 Bacteria 3092
381 Ga0207650_10018357 3300025925 Bacteria 4908
382 Ga0207650_10037477 3300025925 Bacteria 3533
383 Ga0207650_10111526 3300025925 Bacteria 2118
384 Ga0207650_10714599 3300025925 Bacteria 847
385 Ga0207659_10035166 3300025926 Bacteria 3461
386 Ga0207659_10043726 3300025926 Bacteria 3148
387 Ga0207659_10045844 3300025926 Bacteria 3085
388 Ga0207659_10720493 3300025926 Bacteria 855
389 Ga0207687_10003767 3300025927 Bacteria 10190
390 Ga0207687_10146702 3300025927 Bacteria 1796
391 Ga0207700_10124675 3300025928 Bacteria 2093
392 Ga0207700_10217207 3300025928 Bacteria 1619
393 Ga0207700_10410848 3300025928 Bacteria 1187
394 Ga0207664_10029849 3300025929 Bacteria 4158
395 Ga0207664_10160946 3300025929 Bacteria 1914
396 Ga0207644_10018513 3300025931 Bacteria 4712
397 Ga0207644_10033489 3300025931 Bacteria 3591
398 Ga0207644_10047864 3300025931 Bacteria 3054
399 Ga0207644_10105804 3300025931 Bacteria 2120
400 Ga0207644_10119497 3300025931 Bacteria 2004
401 Ga0207644_10194269 3300025931 Bacteria 1597
402 Ga0207644_10782176 3300025931 Bacteria 798
403 Ga0207690_10097638 3300025932 Bacteria 2091
404 Ga0207706_10016249 3300025933 Bacteria 6723
405 Ga0207706_10027272 3300025933 Bacteria 5109
406 Ga0207706_10055745 3300025933 Bacteria 3484
407 Ga0207686_10006909 3300025934 Bacteria 6109
408 Ga0207686_10055859 3300025934 Bacteria 2479
409 Ga0207709_10004256 3300025935 Bacteria 8294
410 Ga0207709_10179171 3300025935 Bacteria 1495
411 Ga0207670_10014122 3300025936 Bacteria 4730
412 Ga0207670_10024309 3300025936 Bacteria 3785
413 Ga0207670_10063324 3300025936 Bacteria 2530
414 Ga0207670_10159435 3300025936 Bacteria 1683
415 Ga0207704_10010803 3300025938 Bacteria 4469
416 Ga0207704_10073124 3300025938 Bacteria 2182
417 Ga0207704_10151871 3300025938 Bacteria 1635
418 Ga0207665_10063492 3300025939 Bacteria 2508
419 Ga0207691_10001198 3300025940 Bacteria 25807
420 Ga0207691_10315320 3300025940 Bacteria 1341
421 Ga0207711_10004318 3300025941 Bacteria 12144
422 Ga0207711_10027441 3300025941 Bacteria 4782
423 Ga0207711_10298119 3300025941 Bacteria 1486
424 Ga0207711_10532147 3300025941 Bacteria 1096
425 Ga0207689_10000229 3300025942 Bacteria 49945
426 Ga0207689_10000949 3300025942 Bacteria 27884
427 Ga0207689_10023429 3300025942 Bacteria 5182
428 Ga0207661_11226392 3300025944 Bacteria 690
429 Ga0207667_10024078 3300025949 Bacteria 6694
430 Ga0207667_10088567 3300025949 Bacteria 3201
431 Ga0207667_10127864 3300025949 Bacteria 2617
432 Ga0207651_10047665 3300025960 Bacteria 2891
433 Ga0207651_10221879 3300025960 Bacteria 1528
434 Ga0207651_10376413 3300025960 Bacteria 1202
435 Ga0207712_10085661 3300025961 Bacteria 2307
436 Ga0207712_10463353 3300025961 Bacteria 1077
437 Ga0207668_10067082 3300025972 Bacteria 2546
438 Ga0207640_10005122 3300025981 Bacteria 7128
439 Ga0207658_10006854 3300025986 Bacteria 7758
440 Ga0207658_10059301 3300025986 Bacteria 2851
441 Ga0207658_10113071 3300025986 Bacteria 2150
442 Ga0207677_10048141 3300026023 Bacteria 2868
443 Ga0207677_10223930 3300026023 Bacteria 1510
444 Ga0207677_10925031 3300026023 Bacteria 787
445 Ga0207703_10006954 3300026035 Bacteria 9004
446 Ga0207703_10009417 3300026035 Bacteria 7673
447 Ga0207703_10049612 3300026035 Bacteria 3393
448 Ga0207703_10088267 3300026035 Bacteria 2602
449 Ga0207703_10142333 3300026035 Bacteria 2083
450 Ga0207703_10169868 3300026035 Bacteria 1917
451 Ga0207639_10044041 3300026041 Bacteria 3355
452 Ga0207708_10005632 3300026075 Bacteria 9246
453 Ga0207708_10006559 3300026075 Bacteria 8610
454 Ga0207702_10163592 3300026078 Bacteria 2034
455 Ga0207702_11093543 3300026078 Bacteria 791
456 Ga0207641_10022316 3300026088 Bacteria 5210
457 Ga0207641_10027073 3300026088 Bacteria 4734
458 Ga0207641_10044739 3300026088 Bacteria 3723
459 Ga0207641_10305379 3300026088 Bacteria 1504
460 Ga0207641_10673318 3300026088 Bacteria 1017
461 Ga0207648_10000124 3300026089 Bacteria 75549
462 Ga0207648_10004634 3300026089 Bacteria 14078
463 Ga0207648_10017246 3300026089 Bacteria 6579
464 Ga0207676_10016274 3300026095 Bacteria 5384
465 Ga0207676_10046220 3300026095 Bacteria 3367
466 Ga0207676_10055704 3300026095 Bacteria 3106
467 Ga0207676_10105108 3300026095 Bacteria 2350
468 Ga0207674_10027319 3300026116 Bacteria 6039
469 Ga0207675_100001175 3300026118 Bacteria 26068
470 Ga0207675_100001933 3300026118 Bacteria 20680
471 Ga0207675_100006074 3300026118 Bacteria 11494
472 Ga0207675_100117555 3300026118 Bacteria 2514
473 Ga0207675_100845108 3300026118 Bacteria 930
474 Ga0207683_10009783 3300026121 Bacteria 8173
475 Ga0207683_10265192 3300026121 Bacteria 1568
476 Ga0207698_10096938 3300026142 Bacteria 2432
477 Ga0207428_10006751 3300027907 Bacteria 10529
478 Ga0207428_10025467 3300027907 Bacteria 4952
479 Ga0207428_10076391 3300027907 Bacteria 2623
480 Ga0207428_10216895 3300027907 Bacteria 1436
481 Ga0268266_10045567 3300028379 Bacteria 3752
482 Ga0268266_10056127 3300028379 Bacteria 3388
483 Ga0268265_10016085 3300028380 Bacteria 5133
484 Ga0268265_10033425 3300028380 Bacteria 3739
485 Ga0268265_10163484 3300028380 Bacteria 1894
486 Ga0268264_10001839 3300028381 Bacteria 19337
487 Ga0268264_10048729 3300028381 Bacteria 3524
488 Ga0268264_10169576 3300028381 Bacteria 1973
489 Ga0268264_10555657 3300028381 Bacteria 1126
490 Ga0265334_10003454 3300028573 Bacteria 7185
491 Ga0265318_10001215 3300028577 Bacteria 15658
492 Ga0265318_10069229 3300028577 Bacteria 1308
493 Ga0265338_10005969 3300028800 Bacteria 15663
494 Ga0265760_10102095 3300031090 Bacteria 907
495 Ga0265330_10003654 3300031235 Bacteria 7996
496 Ga0265330_10008812 3300031235 Bacteria 4830
497 Ga0265332_10001462 3300031238 Bacteria 13214
498 Ga0265332_10005649 3300031238 Bacteria 5749
499 Ga0265328_10009401 3300031239 Bacteria 3985
500 Ga0265328_10026383 3300031239 Bacteria 2183
501 Ga0265320_10002610 3300031240 Bacteria 12509
502 Ga0265325_10005974 3300031241 Bacteria 7453
503 Ga0265329_10001757 3300031242 Bacteria 10315
504 Ga0265340_10044661 3300031247 Bacteria 2168
505 Ga0265339_10013975 3300031249 Bacteria 4855
506 Ga0265331_10005568 3300031250 Bacteria 7584
507 Ga0265331_10110186 3300031250 Bacteria 1263
508 Ga0265331_10127499 3300031250 Bacteria 1162
509 Ga0265316_10009140 3300031344 Bacteria 9129
510 Ga0265313_10006665 3300031595 Bacteria 8097
511 Ga0265314_10001270 3300031711 Bacteria 28727
512 Ga0265314_10006556 3300031711 Bacteria 10266
513 Ga0265342_10002161 3300031712 Bacteria 17328
514 Ga0265342_10007741 3300031712 Bacteria 7822
515 Ga0373930_0006814 3300034816 Bacteria 1946
516 Ga0373938_0005618 3300034957 Bacteria 2139
517 Ga0373926_0003758 3300035083 Bacteria 4944
518 Ga0373928_0002384 3300035084 Bacteria 3651
519 Ga0373934_0261101 3300035086 Bacteria 717
520 Ga0373940_0007019 3300035088 Bacteria 2527
521 Ga0373944_0002007 3300035089 Bacteria 5160
522 Ga0373952_0006586 3300035092 Bacteria 2151
523 Ga0373923_0068609 3300035111 Bacteria 1518
524 Ga0373923_0074384 3300035111 Bacteria 1464
525 Ga0373923_0107122 3300035111 Bacteria 1238
526 Ga0373923_0119232 3300035111 Bacteria 1178
527 Ga0373932_0007442 3300035112 Bacteria 2606
528 Ga0373936_0098859 3300035113 Bacteria 1230
529 Ga0373936_0201605 3300035113 Unclassified 878
530 Ga0373936_0209570 3300035113 Bacteria 862
531 Ga0373939_0023283 3300035114 Bacteria 1714
532 Ga0373941_0021046 3300035115 Bacteria 1835
533 Ga0373945_0001120 3300035116 Bacteria 8101
534 Ga0373945_0017789 3300035116 Bacteria 2411
535 Ga0373945_0135547 3300035116 Bacteria 989
536 Ga0373953_0001462 3300035117 Bacteria 6857
537 Ga0373953_0003158 3300035117 Bacteria 5092
538 Ga0373953_0148278 3300035117 Bacteria 1005
539 Ga0373954_0002182 3300035118 Bacteria 8137
540 Ga0373954_0066235 3300035118 Bacteria 1710
541 Ga0373954_0167945 3300035118 Bacteria 1074
542 Ga0373954_0218060 3300035118 Bacteria 938
543 Ga0373943_0002502 3300035170 Bacteria 8355
544 Ga0373943_0049420 3300035170 Bacteria 2064
545 Ga0373943_0082986 3300035170 Bacteria 1646
546 Ga0373946_0002385 3300035171 Bacteria 6645
547 Ga0373946_0013338 3300035171 Bacteria 3089
548 Ga0373946_0015152 3300035171 Bacteria 2919
549 Ga0373946_0072308 3300035171 Bacteria 1493
550 Ga0373946_0096540 3300035171 Bacteria 1318
551 Ga0373955_0000200 3300035172 Bacteria 24884
552 Ga0373955_0016724 3300035172 Bacteria 3615
553 Ga0373955_0197934 3300035172 Bacteria 1196
554 Ga0373955_0271399 3300035172 Bacteria 1019
555 Ga0373942_0006173 3300035207 Bacteria 2766
556 Ga0373961_0004757 3300035241 Bacteria 3266
557 Ga0373962_0168887 3300035242 Bacteria 725
558 Ga0373924_0001651 3300035410 Bacteria 7328
559 Ga0373924_0010215 3300035410 Bacteria 3455
560 Ga0373931_0018730 3300035691 Bacteria 3445
561 Ga0373935_0003610 3300035692 Bacteria 9018
562 Ga0373935_0117719 3300035692 Bacteria 1771
563 Ga0373927_0000227 3300035695 Bacteria 44543
564 Ga0373927_0009494 3300035695 Bacteria 6524
565 Ga0373927_0100066 3300035695 Bacteria 1885
566 Ga0373927_0139214 3300035695 Bacteria 1587
567 Ga0373927_0509636 3300035695 Bacteria 795
568 Ga0373933_0001234 3300035724 Bacteria 15117
569 Ga0373933_0080406 3300035724 Bacteria 1998
570 Ga0373933_0090603 3300035724 Bacteria 1886
571 Ga0373933_0138046 3300035724 Bacteria 1537
572 Ga0373933_0162421 3300035724 Bacteria 1419
573 Ga0373933_0210956 3300035724 Bacteria 1244
574 Ga0373933_0518679 3300035724 Bacteria 781
575 Ga0373947_0003871 3300035725 Bacteria 8810
576 Ga0373947_0014412 3300035725 Bacteria 4534
577 Ga0373947_0112291 3300035725 Bacteria 1723
578 Ga0373947_0355669 3300035725 Bacteria 983
579 Ga0373947_0367094 3300035725 Bacteria 967
580 Ga0373947_0381647 3300035725 Bacteria 949
581 Ga0373937_0000313 3300036401 Bacteria 45893
582 Ga0373937_0001469 3300036401 Bacteria 19735
583 Ga0373937_0035405 3300036401 Bacteria 4544
584 Ga0373937_0063706 3300036401 Bacteria 3391
585 Ga0373937_0137131 3300036401 Bacteria 2288
586 Ga0373937_0159420 3300036401 Bacteria 2115
587 Ga0373937_0419564 3300036401 Bacteria 1270
588 Ga0373925_0000025 3300037068 Bacteria 154937
589 Ga0373925_0889035 3300037068 Bacteria 734
590 Ga0439438_001492 3300041405 Bacteria 10313
591 Ga0439438_003823 3300041405 Bacteria 5939
592 Ga0439438_023847 3300041405 Bacteria 1682
593 Ga0439447_000105 3300041407 Bacteria 28433
594 Ga0439466_0003637 3300041411 Bacteria 5950
595 Ga0439466_0010505 3300041411 Bacteria 3441
596 Ga0439466_0025830 3300041411 Bacteria 2047
597 Ga0439466_0094400 3300041411 Bacteria 936
598 Ga0439465_0020468 3300041413 Bacteria 2073
599 Ga0439465_0096296 3300041413 Bacteria 1017
600 Ga0451789_1257416 3300041443 Bacteria 721
601 Ga0451839_0934718 3300041496 Bacteria 919
602 Ga0439443_000312 3300042003 Bacteria 4022
603 Ga0439432_001244 3300042006 Bacteria 9628
604 Ga0439432_007162 3300042006 Bacteria 3963
605 Ga0439432_053152 3300042006 Bacteria 1260
606 Ga0439449_0002973 3300042007 Bacteria 6605
607 Ga0439451_003335 3300042009 Bacteria 3252
608 Ga0439451_005149 3300042009 Bacteria 2657
609 Ga0439451_037070 3300042009 Bacteria 979
610 Ga0439451_051901 3300042009 Bacteria 821
611 Ga0439452_003422 3300042010 Bacteria 5558
612 Ga0439452_018537 3300042010 Bacteria 1852
613 Ga0439452_028224 3300042010 Bacteria 1402
614 Ga0439456_002134 3300042013 Bacteria 3988
615 Ga0439456_007138 3300042013 Bacteria 2289
616 Ga0439456_014413 3300042013 Bacteria 1649
617 Ga0439456_025865 3300042013 Bacteria 1247
618 Ga0439456_040289 3300042013 Bacteria 1011
619 Ga0439463_006472 3300042016 Bacteria 2903
620 Ga0439463_009292 3300042016 Bacteria 2418
621 Ga0450911_001949 3300042115 Bacteria 4317
622 Ga0450911_002634 3300042115 Bacteria 3443
623 Ga0450911_005287 3300042115 Bacteria 2021
624 Ga0450919_000983 3300042121 Bacteria 3693
625 Ga0450922_004291 3300042124 Bacteria 1310
626 Ga0450890_000101 3300042127 Bacteria 14188
627 Ga0450902_001611 3300042137 Bacteria 3106
628 Ga0450902_013595 3300042137 Bacteria 1311
629 Ga0450902_016670 3300042137 Bacteria 1198
630 Ga0450903_010294 3300042138 Bacteria 1515
631 Ga0450906_010651 3300042145 Bacteria 1734
632 Ga0450906_019807 3300042145 Bacteria 1205
633 Ga0450906_037528 3300042145 Bacteria 855
634 Ga0450910_003043 3300042147 Bacteria 2211
635 Ga0439446_0006756 3300042156 Bacteria 3003
636 Ga0450908_000382 3300042184 Bacteria 8558
637 Ga0439444_0005182 3300042437 Bacteria 1925
638 Ga0439460_0001065 3300042461 Bacteria 6390
639 Ga0439460_0007239 3300042461 Bacteria 2768
640 Ga0439460_0013335 3300042461 Bacteria 2148
641 Ga0450893_0030497 3300042532 Bacteria 960
642 Ga0451577_0056502 3300042876 Bacteria 3501
643 Ga0439440_0003240 3300042993 Bacteria 3124
644 Ga0453683_0000623 3300044673 Bacteria 38586
645 Ga0453684_0060792 3300044712 Bacteria 4855
646 Ga0451576_0003712 3300045051 Bacteria 20647
647 Ga0451576_0069172 3300045051 Bacteria 3673
648 Ga0451576_0217814 3300045051 Bacteria 1993
649 Ga0466967_0846148 3300045976 Bacteria 909
650 Ga0495617_024211 3300046452 Bacteria 2048
651 Ga0495617_037444 3300046452 Bacteria 1624
652 Ga0495617_041106 3300046452 Bacteria 1546
653 Ga0495617_094802 3300046452 Bacteria 972
654 Ga0495627_017242 3300046453 Bacteria 2458
655 Ga0495592_0002157 3300046454 Bacteria 13860
656 Ga0495592_0021167 3300046454 Bacteria 4946
657 Ga0495592_0053446 3300046454 Bacteria 2996
658 Ga0495592_0151922 3300046454 Bacteria 1601
659 Ga0495603_0019806 3300046455 Bacteria 4073
660 Ga0495603_0024281 3300046455 Bacteria 3666
661 Ga0495603_0087914 3300046455 Bacteria 1818
662 Ga0495603_0117631 3300046455 Bacteria 1549
663 Ga0495590_0002436 3300046457 Bacteria 7712
664 Ga0495590_0011474 3300046457 Bacteria 3313
665 Ga0495590_0013209 3300046457 Bacteria 3042
666 Ga0495590_0106352 3300046457 Bacteria 999
667 Ga0495591_000194 3300046458 Bacteria 61820
668 Ga0495591_023695 3300046458 Bacteria 1961
669 Ga0495591_044038 3300046458 Bacteria 1252
670 Ga0495591_056327 3300046458 Bacteria 1057
671 Ga0495629_0002377 3300046459 Bacteria 14477
672 Ga0495629_0013043 3300046459 Bacteria 6005
673 Ga0495629_0027771 3300046459 Bacteria 4019
674 Ga0495629_0101079 3300046459 Bacteria 2012
675 Ga0495629_0141495 3300046459 Bacteria 1674
676 Ga0495629_0156653 3300046459 Bacteria 1582
677 Ga0495629_0409188 3300046459 Bacteria 921
678 Ga0495629_0429025 3300046459 Bacteria 896
679 Ga0495638_0006291 3300046460 Bacteria 8658
680 Ga0495638_0010334 3300046460 Bacteria 6490
681 Ga0495638_0027024 3300046460 Bacteria 3716
682 Ga0495638_0034295 3300046460 Bacteria 3240
683 Ga0495638_0150042 3300046460 Bacteria 1352
684 Ga0495641_0325591 3300046461 Bacteria 694
685 Ga0495651_0000283 3300046462 Bacteria 39478
686 Ga0495651_0008148 3300046462 Bacteria 8036
687 Ga0495651_0032787 3300046462 Bacteria 4051
688 Ga0495651_0126226 3300046462 Bacteria 1873
689 Ga0495651_0168906 3300046462 Bacteria 1560
690 Ga0495653_0000041 3300046463 Bacteria 118366
691 Ga0495653_0074943 3300046463 Bacteria 2520
692 Ga0495653_0128500 3300046463 Bacteria 1797
693 Ga0495653_0218296 3300046463 Bacteria 1283
694 Ga0495650_0002333 3300046471 Bacteria 15693
695 Ga0495650_0034994 3300046471 Bacteria 2215
696 Ga0495650_0068542 3300046471 Bacteria 1399
697 Ga0495580_0000157 3300046472 Bacteria 49611
698 Ga0495580_0123458 3300046472 Bacteria 1797
699 Ga0495580_0225746 3300046472 Bacteria 1286
700 Ga0495582_0049527 3300046473 Bacteria 2313
701 Ga0495605_0014878 3300046474 Bacteria 4245
702 Ga0495605_0044806 3300046474 Bacteria 2184
703 Ga0495605_0101852 3300046474 Bacteria 1319
704 Ga0495605_0142283 3300046474 Bacteria 1075
705 Ga0495605_0145495 3300046474 Bacteria 1060
706 Ga0495639_0020279 3300046475 Bacteria 2904
707 Ga0495639_0030576 3300046475 Bacteria 2393
708 Ga0495639_0107428 3300046475 Bacteria 1322
709 Ga0495639_0130128 3300046475 Bacteria 1204
710 Ga0495662_0001774 3300046476 Bacteria 10792
711 Ga0495662_0055819 3300046476 Bacteria 1908
712 Ga0495662_0288985 3300046476 Bacteria 807
713 Ga0495662_0365773 3300046476 Bacteria 709
714 Ga0495664_0000005 3300046477 Bacteria 439635
715 Ga0495664_0091467 3300046477 Bacteria 1829
716 Ga0495664_0115215 3300046477 Bacteria 1624
717 Ga0495664_0221177 3300046477 Bacteria 1146
718 Ga0495584_0000774 3300046491 Bacteria 21121
719 Ga0495584_0001348 3300046491 Bacteria 14843
720 Ga0495584_0002868 3300046491 Bacteria 9629
721 Ga0495584_0005465 3300046491 Bacteria 6732
722 Ga0495584_0005468 3300046491 Bacteria 6730
723 Ga0495584_0018316 3300046491 Bacteria 3559
724 Ga0495584_0038977 3300046491 Bacteria 2401
725 Ga0495584_0077882 3300046491 Bacteria 1668
726 Ga0495584_0251872 3300046491 Bacteria 898
727 Ga0495585_0027067 3300046492 Bacteria 3273
728 Ga0495585_0142003 3300046492 Bacteria 1257
729 Ga0495585_0333727 3300046492 Bacteria 739
730 Ga0495594_0020262 3300046499 Bacteria 3541
731 Ga0495594_0111673 3300046499 Bacteria 1541
732 Ga0495594_0170158 3300046499 Bacteria 1239
733 Ga0495594_0241056 3300046499 Bacteria 1030
734 Ga0495594_0385401 3300046499 Bacteria 798
735 Ga0495596_0000142 3300046500 Bacteria 49330
736 Ga0495607_0006507 3300046501 Bacteria 8213
737 Ga0495607_0015350 3300046501 Bacteria 4967
738 Ga0495607_0019055 3300046501 Bacteria 4362
739 Ga0495607_0026409 3300046501 Bacteria 3603
740 Ga0495607_0117204 3300046501 Bacteria 1403
741 Ga0495583_0097235 3300046506 Bacteria 1260
742 Ga0495606_0006616 3300046507 Bacteria 10638
743 Ga0495606_0006667 3300046507 Bacteria 10587
744 Ga0495608_0000003 3300046511 Bacteria 369831
745 Ga0495608_0057618 3300046511 Bacteria 2563
746 Ga0495608_0099718 3300046511 Bacteria 1873
747 Ga0495610_0004766 3300046512 Bacteria 9894
748 Ga0495610_0017853 3300046512 Bacteria 4029
749 Ga0495610_0087130 3300046512 Bacteria 1421
750 Ga0495616_0002369 3300046513 Bacteria 12559
751 Ga0495616_0020167 3300046513 Bacteria 3631
752 Ga0495616_0020924 3300046513 Bacteria 3552
753 Ga0495616_0047365 3300046513 Bacteria 2165
754 Ga0495616_0053390 3300046513 Bacteria 2008
755 Ga0495618_0000010 3300046514 Bacteria 189314
756 Ga0495618_0006339 3300046514 Bacteria 7181
757 Ga0495618_0010308 3300046514 Bacteria 5654
758 Ga0495618_0056927 3300046514 Bacteria 2475
759 Ga0495618_0237978 3300046514 Bacteria 1145
760 Ga0495620_0002433 3300046515 Bacteria 10787
761 Ga0495620_0019251 3300046515 Bacteria 3362
762 Ga0495620_0138614 3300046515 Bacteria 952
763 Ga0495628_0000019 3300046516 Bacteria 154435
764 Ga0495628_0040050 3300046516 Bacteria 3746
765 Ga0495628_0069866 3300046516 Bacteria 2739
766 Ga0495628_0102898 3300046516 Bacteria 2203
767 Ga0495628_0165765 3300046516 Bacteria 1677
768 Ga0495628_0511648 3300046516 Bacteria 866
769 Ga0495628_0653350 3300046516 Bacteria 746
770 Ga0495630_0005281 3300046517 Bacteria 9113
771 Ga0495630_0020050 3300046517 Bacteria 4924
772 Ga0495630_0029170 3300046517 Bacteria 4100
773 Ga0495630_0057699 3300046517 Bacteria 2910
774 Ga0495630_0199360 3300046517 Bacteria 1527
775 Ga0495630_0208058 3300046517 Bacteria 1493
776 Ga0495630_0505032 3300046517 Bacteria 927
777 Ga0495630_0573283 3300046517 Unclassified 865
778 Ga0495631_0009830 3300046518 Bacteria 4761
779 Ga0495631_0103630 3300046518 Bacteria 1224
780 Ga0495631_0185240 3300046518 Bacteria 891
781 Ga0495632_0002703 3300046519 Bacteria 13242
782 Ga0495632_0003386 3300046519 Bacteria 11357
783 Ga0495632_0019352 3300046519 Bacteria 3711
784 Ga0495632_0057752 3300046519 Bacteria 1893
785 Ga0495637_0001168 3300046520 Bacteria 16076
786 Ga0495637_0003054 3300046520 Bacteria 8949
787 Ga0495637_0033297 3300046520 Bacteria 2264
788 Ga0495637_0064527 3300046520 Bacteria 1493
789 Ga0495637_0176363 3300046520 Bacteria 794
790 Ga0495643_0013290 3300046522 Bacteria 4932
791 Ga0495643_0031487 3300046522 Bacteria 2951
792 Ga0495644_0000468 3300046523 Bacteria 17485
793 Ga0495644_0001015 3300046523 Bacteria 11697
794 Ga0495644_0007759 3300046523 Bacteria 4137
795 Ga0495644_0070222 3300046523 Bacteria 1316
796 Ga0495648_0011641 3300046524 Bacteria 6608
797 Ga0495648_0070469 3300046524 Bacteria 2031
798 Ga0495663_0053033 3300046525 Bacteria 1260
799 Ga0495666_0020964 3300046526 Bacteria 3236
800 Ga0495666_0113673 3300046526 Bacteria 1271
801 Ga0495666_0181017 3300046526 Bacteria 973
802 Ga0495652_0000028 3300046529 Bacteria 157336
803 Ga0495652_0031385 3300046529 Bacteria 4654
804 Ga0495652_0049801 3300046529 Bacteria 3584
805 Ga0495652_0084982 3300046529 Bacteria 2601
806 Ga0495652_0105628 3300046529 Bacteria 2275
807 Ga0495652_0518154 3300046529 Bacteria 824
808 Ga0495654_0003084 3300046530 Bacteria 10364
809 Ga0495654_0007825 3300046530 Bacteria 5941
810 Ga0495654_0008235 3300046530 Bacteria 5769
811 Ga0495654_0056035 3300046530 Bacteria 1906
812 Ga0495654_0101683 3300046530 Bacteria 1322
813 Ga0495654_0128245 3300046530 Bacteria 1141
814 Ga0495654_0177557 3300046530 Bacteria 924
815 Ga0495665_0048785 3300046531 Bacteria 2245
816 Ga0495665_0196999 3300046531 Bacteria 1045
817 Ga0495640_0000014 3300046533 Bacteria 161741
818 Ga0495640_0000946 3300046533 Bacteria 22440
819 Ga0495640_0018796 3300046533 Bacteria 5114
820 Ga0495640_0025477 3300046533 Bacteria 4290
821 Ga0495640_0229015 3300046533 Bacteria 1169
822 Ga0495640_0332048 3300046533 Unclassified 940
823 Ga0495640_0461363 3300046533 Bacteria 775
824 Ga0495586_0064174 3300046535 Bacteria 2001
825 Ga0495586_0186182 3300046535 Bacteria 1175
826 Ga0495586_0222364 3300046535 Bacteria 1073
827 Ga0495587_0000026 3300046536 Bacteria 147819
828 Ga0495587_0003753 3300046536 Bacteria 10074
829 Ga0495587_0005223 3300046536 Bacteria 8487
830 Ga0495587_0008708 3300046536 Bacteria 6514
831 Ga0495598_0018645 3300046537 Bacteria 1807
832 Ga0495598_0028076 3300046537 Bacteria 1558
833 Ga0495598_0167395 3300046537 Bacteria 777
834 Ga0495609_0009563 3300046538 Bacteria 4687
835 Ga0495609_0050094 3300046538 Bacteria 1862
836 Ga0495621_0004372 3300046539 Bacteria 3971
837 Ga0495597_0005357 3300046542 Bacteria 6801
838 Ga0495597_0011083 3300046542 Bacteria 4378
839 Ga0495597_0026484 3300046542 Bacteria 2663
840 Ga0495597_0036119 3300046542 Bacteria 2227
841 Ga0495597_0040991 3300046542 Bacteria 2069
842 Ga0495597_0041134 3300046542 Bacteria 2065
843 Ga0495597_0102509 3300046542 Bacteria 1205
844 Ga0495645_0000005 3300046543 Bacteria 443917
845 Ga0495645_0174782 3300046543 Bacteria 1476
846 Ga0495645_0184950 3300046543 Bacteria 1424
847 Ga0495633_0014133 3300046558 Bacteria 4184
848 Ga0495667_0000003 3300046559 Bacteria 295404
849 Ga0495667_0037027 3300046559 Bacteria 3253
850 Ga0495667_0042670 3300046559 Bacteria 3008
851 Ga0495656_0008898 3300046615 Bacteria 3601
852 Ga0495656_0208682 3300046615 Bacteria 972
853 Ga0495668_0001389 3300046616 Bacteria 23561
854 Ga0495634_0000017 3300046642 Bacteria 122411
855 Ga0495634_0001609 3300046642 Bacteria 19728
856 Ga0495634_0009717 3300046642 Bacteria 7080
857 Ga0495634_0010017 3300046642 Bacteria 6957
858 Ga0495634_0037009 3300046642 Bacteria 3336
859 Ga0495634_0049595 3300046642 Bacteria 2822
860 Ga0495634_0065130 3300046642 Bacteria 2415
861 Ga0495634_0149390 3300046642 Bacteria 1478
862 Ga0495611_0011154 3300046648 Bacteria 3808
863 Ga0495611_0029179 3300046648 Bacteria 2418
864 Ga0495611_0166359 3300046648 Bacteria 1031
865 Ga0495625_0012035 3300046660 Bacteria 7022
866 Ga0495625_0018672 3300046660 Bacteria 5404
867 Ga0495625_0043899 3300046660 Bacteria 3239
868 Ga0495625_0427325 3300046660 Bacteria 822
869 Ga0495635_0000024 3300046663 Bacteria 148235
870 Ga0495635_0002778 3300046663 Bacteria 12001
871 Ga0495635_0010685 3300046663 Bacteria 6427
872 Ga0495635_0026038 3300046663 Bacteria 4073
873 Ga0495635_0112379 3300046663 Unclassified 1860
874 Ga0495659_0004708 3300046664 Bacteria 4293
875 Ga0495659_0064274 3300046664 Bacteria 1362
876 Ga0495661_0010360 3300046665 Bacteria 6362
877 Ga0495661_0028142 3300046665 Bacteria 3601
878 Ga0495661_0058863 3300046665 Bacteria 2288
879 Ga0495661_0082540 3300046665 Bacteria 1849
880 Ga0495661_0104991 3300046665 Bacteria 1583
881 Ga0495588_0048283 3300046674 Bacteria 2186
882 Ga0495588_0162337 3300046674 Bacteria 1181
883 Ga0495588_0332304 3300046674 Bacteria 799
884 Ga0495657_0000034 3300046675 Bacteria 122360
885 Ga0495657_0079863 3300046675 Bacteria 2118
886 Ga0495599_0000017 3300046678 Bacteria 162507
887 Ga0495599_0155072 3300046678 Bacteria 1417
888 Ga0495623_0000028 3300046679 Bacteria 87634
889 Ga0495623_0012865 3300046679 Bacteria 5421
890 Ga0495623_0153544 3300046679 Bacteria 1359
891 Ga0495646_0000015 3300046680 Bacteria 141718
892 Ga0495646_0012842 3300046680 Bacteria 5325
893 Ga0495646_0019757 3300046680 Bacteria 4259
894 Ga0495646_0035958 3300046680 Bacteria 3070
895 Ga0495646_0068799 3300046680 Bacteria 2089
896 Ga0495647_0164642 3300046681 Bacteria 957
897 Ga0495658_0030577 3300046683 Bacteria 2925
898 Ga0495658_0096942 3300046683 Bacteria 1755
899 Ga0495658_0272888 3300046683 Bacteria 1066
900 Ga0495658_0363378 3300046683 Bacteria 920
901 Ga0495613_0042752 3300046689 Bacteria 3352
902 Ga0495613_0050088 3300046689 Bacteria 3081
903 Ga0495613_0072681 3300046689 Bacteria 2507
904 Ga0495613_0089910 3300046689 Bacteria 2224
905 Ga0495624_0003729 3300046690 Bacteria 11266
906 Ga0495624_0081364 3300046690 Bacteria 2006
907 Ga0495624_0344437 3300046690 Bacteria 896
908 Ga0495670_0001106 3300046691 Bacteria 13088
909 Ga0495670_0001964 3300046691 Bacteria 10104
910 Ga0495670_0012957 3300046691 Bacteria 4099
911 Ga0495670_0109139 3300046691 Bacteria 1431
912 Ga0495670_0128649 3300046691 Bacteria 1319
913 Ga0495670_0148850 3300046691 Bacteria 1227
914 Ga0495670_0327684 3300046691 Bacteria 823
915 Ga0495671_0000472 3300046692 Bacteria 31501
916 Ga0495671_0001142 3300046692 Bacteria 18232
917 Ga0495671_0010887 3300046692 Bacteria 5026
918 Ga0495671_0010924 3300046692 Bacteria 5016
919 Ga0495671_0014858 3300046692 Bacteria 4183
920 Ga0495671_0017779 3300046692 Bacteria 3781
921 Ga0495671_0040182 3300046692 Bacteria 2359
922 Ga0495671_0051855 3300046692 Bacteria 2040
923 Ga0495671_0066408 3300046692 Bacteria 1775
924 Ga0495649_0003407 3300046694 Bacteria 10746
925 Ga0495649_0004589 3300046694 Bacteria 8990
926 Ga0495649_0010429 3300046694 Bacteria 5478
927 Ga0495649_0043315 3300046694 Bacteria 2457
928 Ga0495649_0163273 3300046694 Bacteria 1167
929 Ga0495589_0011660 3300046794 Bacteria 4563
930 Ga0495589_0021606 3300046794 Bacteria 3288
931 Ga0495600_0000058 3300046809 Bacteria 65689
932 Ga0495600_0101636 3300046809 Bacteria 1874
933 Ga0495600_0104177 3300046809 Bacteria 1848
934 Ga0495660_0035332 3300046810 Bacteria 2793
935 Ga0495660_0043942 3300046810 Bacteria 2460
936 Ga0495660_0053198 3300046810 Bacteria 2198
937 Ga0495660_0061073 3300046810 Bacteria 2023
938 Ga0495660_0133395 3300046810 Bacteria 1243
939 Ga0495581_0483247 3300047315 Bacteria 720
940 Ga0495604_0000021 3300047317 Bacteria 169432
941 Ga0495604_0002971 3300047317 Bacteria 13575
942 Ga0495604_0005948 3300047317 Bacteria 9680
943 Ga0495604_0022424 3300047317 Bacteria 5041
944 Ga0495604_0130956 3300047317 Bacteria 1803
945 Ga0495604_0188783 3300047317 Bacteria 1437
946 Ga0495636_0107089 3300047318 Bacteria 1227
947 Ga0495636_0146976 3300047318 Bacteria 1055
948 Ga0495674_0000005 3300047319 Bacteria 375129
949 Ga0495674_0011146 3300047319 Bacteria 8489
950 Ga0495674_0014128 3300047319 Bacteria 7480
951 Ga0495674_0017300 3300047319 Bacteria 6707
952 Ga0495674_0040116 3300047319 Bacteria 4190
953 Ga0495674_0082226 3300047319 Bacteria 2761
954 Ga0495674_0120020 3300047319 Bacteria 2222
955 Ga0495674_0143092 3300047319 Bacteria 2009
956 Ga0495674_0276992 3300047319 Bacteria 1375
957 Ga0495674_0408415 3300047319 Bacteria 1095
958 Ga0495672_0004200 3300047320 Bacteria 11930
959 Ga0495672_0006384 3300047320 Bacteria 9153
960 Ga0495672_0037638 3300047320 Bacteria 2958
961 Ga0495672_0050553 3300047320 Bacteria 2452
962 Ga0495676_0026342 3300047321 Bacteria 5007
963 Ga0495676_0028518 3300047321 Bacteria 4765
964 Ga0495676_0059791 3300047321 Bacteria 2990
965 Ga0495676_0134937 3300047321 Bacteria 1776
966 Ga0495676_0136672 3300047321 Bacteria 1762
967 Ga0495676_0388599 3300047321 Bacteria 927
968 Ga0495680_0000222 3300047322 Bacteria 61837
969 Ga0495680_0005923 3300047322 Bacteria 11425
970 Ga0495680_0007247 3300047322 Bacteria 10214
971 Ga0495680_0015308 3300047322 Bacteria 6618
972 Ga0495680_0055885 3300047322 Bacteria 3059
973 Ga0495680_0328873 3300047322 Bacteria 1068
974 Ga0495680_0351773 3300047322 Bacteria 1025
975 Ga0495683_0000329 3300047323 Bacteria 39891
976 Ga0495683_0007352 3300047323 Bacteria 5966
977 Ga0495683_0019704 3300047323 Bacteria 3481
978 Ga0495683_0028815 3300047323 Bacteria 2838
979 Ga0495683_0097355 3300047323 Bacteria 1418
980 Ga0495675_0000173 3300047444 Bacteria 46825
981 Ga0495675_0018919 3300047444 Bacteria 4376
982 Ga0495677_0205660 3300047445 Bacteria 766
983 Ga0495679_013688 3300047446 Bacteria 3033
984 Ga0495673_0000684 3300047469 Bacteria 33224
985 Ga0495673_0003103 3300047469 Bacteria 11141
986 Ga0495673_0008822 3300047469 Bacteria 5625
987 Ga0495673_0015134 3300047469 Bacteria 3985
988 Ga0495673_0016750 3300047469 Bacteria 3738
989 Ga0495673_0036206 3300047469 Bacteria 2266
990 Ga0495681_0000571 3300047470 Bacteria 28196
991 Ga0495681_0001390 3300047470 Bacteria 18260
992 Ga0495681_0009001 3300047470 Bacteria 6196
993 Ga0495681_0014693 3300047470 Bacteria 4473
994 Ga0495681_0017362 3300047470 Bacteria 3997
995 Ga0495681_0022862 3300047470 Bacteria 3335
996 Ga0495681_0216198 3300047470 Bacteria 771
997 Ga0495684_0000001 3300047471 Bacteria 369809
998 Ga0495684_0000945 3300047471 Bacteria 23655
999 Ga0495684_0011640 3300047471 Bacteria 6790
1000 Ga0495684_0118445 3300047471 Bacteria 1996
1001 Ga0495684_0138874 3300047471 Bacteria 1822
1002 Ga0495684_0166899 3300047471 Bacteria 1639
1003 Ga0495684_0363468 3300047471 Bacteria 1024
1004 Ga0495684_0485360 3300047471 Bacteria 852
1005 Ga0495684_0500057 3300047471 Bacteria 836
1006 Ga0495686_0379704 3300047472 Bacteria 762
1007 Ga0495593_0059774 3300047673 Bacteria 1996
1008 Ga0495593_0108816 3300047673 Bacteria 1416
1009 Ga0495602_0000003 3300048088 Bacteria 357240
1010 Ga0495602_0065515 3300048088 Bacteria 3135
1011 Ga0495614_0081055 3300048089 Bacteria 1406
1012 Ga0495626_0000439 3300048091 Bacteria 42547
1013 Ga0495626_0000510 3300048091 Bacteria 38895
1014 Ga0495626_0002843 3300048091 Bacteria 11571
1015 Ga0495626_0007916 3300048091 Bacteria 5883
1016 Ga0495626_0117367 3300048091 Bacteria 1147
1017 Ga0495626_0209339 3300048091 Bacteria 796
1018 Ga0496101_0079623 3300048904 Bacteria 2419
1019 Ga0496101_0209857 3300048904 Bacteria 1508
1020 Ga0496101_0436442 3300048904 Bacteria 1033
1021 Ga0496102_0000837 3300048905 Bacteria 29565
1022 Ga0496102_0062418 3300048905 Bacteria 3412
1023 Ga0496102_0177184 3300048905 Bacteria 2008
1024 Ga0496102_0352677 3300048905 Bacteria 1385
1025 Ga0496102_0562277 3300048905 Bacteria 1063
1026 Ga0496103_0004343 3300048906 Bacteria 8608
1027 Ga0496103_0547401 3300048906 Bacteria 739
1028 Ga0496104_0001024 3300048907 Bacteria 23928
1029 Ga0496104_0005082 3300048907 Bacteria 11482
1030 Ga0496104_0007414 3300048907 Bacteria 9694
1031 Ga0496104_0118065 3300048907 Bacteria 2546
1032 Ga0496104_0141620 3300048907 Bacteria 2310
1033 Ga0496105_0034245 3300048908 Bacteria 4176
1034 Ga0496106_0170332 3300048909 Bacteria 1725
1035 Ga0496106_0765336 3300048909 Bacteria 767
1036 Ga0496108_0004479 3300048911 Bacteria 11245
1037 Ga0496108_0151530 3300048911 Bacteria 2001
1038 Ga0496108_0436198 3300048911 Bacteria 1144
1039 Ga0496109_0021985 3300048912 Bacteria 5646
1040 Ga0496109_0259724 3300048912 Bacteria 1636
1041 Ga0496110_0002432 3300048913 Bacteria 13954
1042 Ga0496110_0007846 3300048913 Bacteria 8550
1043 Ga0496111_0032677 3300048914 Bacteria 3710
1044 Ga0496111_0045810 3300048914 Bacteria 3147
1045 Ga0496111_0692311 3300048914 Bacteria 742
1046 Ga0496113_0105770 3300048916 Bacteria 2185
1047 Ga0496113_0241677 3300048916 Bacteria 1441
1048 Ga0496113_0502051 3300048916 Bacteria 974
1049 Ga0496114_0772617 3300048917 Bacteria 839
1050 Ga0496115_0071689 3300048918 Bacteria 2810
1051 Ga0496115_0154878 3300048918 Bacteria 1893
1052 Ga0496116_0028779 3300048919 Bacteria 4018
1053 Ga0496117_0006279 3300048920 Bacteria 12101
1054 Ga0496117_0151120 3300048920 Bacteria 1374
1055 Ga0496118_0008651 3300048921 Bacteria 10470
1056 Ga0496118_0051925 3300048921 Bacteria 3132
1057 Ga0496121_0054623 3300048924 Bacteria 3335
1058 Ga0496121_0077684 3300048924 Bacteria 2642
1059 Ga0496124_0004885 3300048927 Bacteria 15421
1060 Ga0496124_0009323 3300048927 Bacteria 10114
1061 Ga0496124_0078936 3300048927 Bacteria 2711
1062 Ga0496124_0329738 3300048927 Bacteria 1089
1063 Ga0496126_0069460 3300048929 Bacteria 3142
1064 Ga0495678_002210 3300049459 Bacteria 13643
1065 Ga0495678_007559 3300049459 Bacteria 5612
1066 Ga0495678_038216 3300049459 Bacteria 1944
1067 Ga0495678_165543 3300049459 Bacteria 703
1068 Ga0495682_0026861 3300049460 Bacteria 2136
1069 Ga0501034_0801201 3300049571 Bacteria 835
1070 Ga0501037_0117428 3300049573 Bacteria 1914
1071 Ga0501040_0198045 3300049576 Bacteria 1426
1072 Ga0501041_0185203 3300049577 Bacteria 1304
1073 Ga0501067_0444367 3300049583 Bacteria 724
1074 Ga0501071_0182209 3300049587 Bacteria 1574
1075 Ga0501075_0077762 3300049591 Bacteria 2511
1076 Ga0501075_0088162 3300049591 Bacteria 2352
1077 Ga0501081_0219251 3300049743 Bacteria 1383
1078 nmdc:mga03683_360479_c1 3300050489 Bacteria 689
1079 nmdc:mga06z11_464399_c1 3300050494 Bacteria 765
1080 nmdc:mga05p37_394764_c1 3300050507 Bacteria 1617
1081 nmdc:mga05p37_49656_c1 3300050507 Bacteria 5161
1082 nmdc:mga09592_264265_c1 3300050508 Bacteria 1493
1083 nmdc:mga09592_40616_c1 3300050508 Bacteria 3909
1084 nmdc:mga09592_478835_c1 3300050508 Bacteria 1073
1085 nmdc:mga0qj67_31004_c1 3300050509 Bacteria 4164
1086 nmdc:mga0qj67_487028_c1 3300050509 Bacteria 992
1087 nmdc:mga0qj67_59978_c1 3300050509 Bacteria 3018
1088 nmdc:mga08y16_1422931_c1 3300050511 Bacteria 656
1089 nmdc:mga08y16_406940_c1 3300050511 Bacteria 1392
1090 nmdc:mga08y16_41205_c1 3300050511 Bacteria 4839
1091 nmdc:mga08y16_604941_c1 3300050511 Bacteria 1105
1092 nmdc:mga08y16_98542_c1 3300050511 Bacteria 3044
1093 nmdc:mga0n895_1203541_c1 3300050512 Bacteria 731
1094 nmdc:mga0n895_17270_c1 3300050512 Bacteria 6649
1095 nmdc:mga0n895_209223_c1 3300050512 Bacteria 1981
1096 nmdc:mga0n895_25840_c1 3300050512 Bacteria 5554
1097 nmdc:mga0n895_48212_c1 3300050512 Bacteria 4169
1098 nmdc:mga0n895_756553_c1 3300050512 Bacteria 964
1099 nmdc:mga0n895_93679_c1 3300050512 Bacteria 3007
1100 nmdc:mga0rr50_105236_c1 3300050513 Bacteria 2225
1101 nmdc:mga0rr50_261522_c1 3300050513 Bacteria 1440
1102 nmdc:mga0rr50_405564_c1 3300050513 Bacteria 1152
1103 nmdc:mga0rr50_56035_c1 3300050513 Bacteria 2944
1104 nmdc:mga0rr50_716109_c1 3300050513 Bacteria 854
1105 nmdc:mga08x19_161298_c1 3300050514 Bacteria 1523
1106 nmdc:mga08x19_345160_c1 3300050514 Bacteria 1039
1107 nmdc:mga08x19_35_c1 3300050514 Bacteria 185171
1108 nmdc:mga0a205_19958_c1 3300050515 Bacteria 6324
1109 nmdc:mga0a205_37485_c1 3300050515 Bacteria 4662
1110 nmdc:mga0a205_497_c1 3300050515 Bacteria 30781
1111 nmdc:mga0a205_844721_c1 3300050515 Bacteria 763
1112 Ga0495601_0000005 3300053077 Bacteria 387079
1113 Ga0495601_0000980 3300053077 Bacteria 15588
1114 Ga0495601_0004375 3300053077 Bacteria 8161
1115 Ga0495601_0005989 3300053077 Bacteria 7094
1116 Ga0495601_0032295 3300053077 Bacteria 3258
1117 Ga0495601_0084223 3300053077 Bacteria 2042
1118 Ga0495601_0155333 3300053077 Bacteria 1494
1119 Ga0495601_0442565 3300053077 Bacteria 841
1120 Ga0495612_0000001 3300053078 Bacteria 418244
1121 Ga0495612_0005906 3300053078 Bacteria 5047
1122 Ga0495612_0014025 3300053078 Bacteria 3227
1123 Ga0495612_0042793 3300053078 Bacteria 1849
1124 Ga0495655_0178544 3300053083 Bacteria 683
1125 Ga0495595_0000033 3300053084 Bacteria 86879
1126 Ga0495595_0001344 3300053084 Bacteria 9553
1127 Ga0495595_0001798 3300053084 Bacteria 8362
1128 Ga0495595_0017852 3300053084 Bacteria 3056
1129 Ga0495595_0308317 3300053084 Bacteria 797
1130 Ga0495619_0000007 3300053085 Bacteria 369936
1131 Ga0495619_0001550 3300053085 Bacteria 15134
1132 Ga0495619_0003438 3300053085 Bacteria 10218
1133 Ga0495619_0006725 3300053085 Bacteria 7274
1134 Ga0495619_0008428 3300053085 Bacteria 6516
1135 Ga0495619_0083323 3300053085 Bacteria 2157
1136 Ga0495619_0111200 3300053085 Bacteria 1872
1137 Ga0495619_0153905 3300053085 Bacteria 1586
1138 Ga0495619_0281309 3300053085 Bacteria 1153
1139 Ga0590075_016342 3300059424 Bacteria 1825

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035410 Ga0373924_0010215 Ga0373924_0010215_2695_3336 201
2 3300028573 Ga0265334_10003454 Ga0265334_100034542 203
3 3300028577 Ga0265318_10001215 Ga0265318_100012155 203
4 3300028800 Ga0265338_10005969 Ga0265338_1000596914 203
5 3300031235 Ga0265330_10003654 Ga0265330_100036542 203
6 3300031238 Ga0265332_10001462 Ga0265332_100014624 203
7 3300031239 Ga0265328_10026383 Ga0265328_100263832 203
8 3300031240 Ga0265320_10002610 Ga0265320_100026104 203
9 3300031241 Ga0265325_10005974 Ga0265325_100059744 203
10 3300031242 Ga0265329_10001757 Ga0265329_100017571 203
11 3300031249 Ga0265339_10013975 Ga0265339_100139754 203
12 3300031250 Ga0265331_10005568 Ga0265331_1000556812 203
13 3300031344 Ga0265316_10009140 Ga0265316_100091404 203
14 3300031595 Ga0265313_10006665 Ga0265313_100066657 203
15 3300031711 Ga0265314_10006556 Ga0265314_100065566 203
16 3300031712 Ga0265342_10002161 Ga0265342_1000216116 203
17 3300005439 Ga0070711_100337560 Ga0070711_1003375602 205
18 3300005543 Ga0070672_100021698 Ga0070672_1000216982 205
19 3300005842 Ga0068858_100171424 Ga0068858_1001714243 205
20 3300005843 Ga0068860_100253259 Ga0068860_1002532592 205
21 3300005844 Ga0068862_100676069 Ga0068862_1006760692 205
22 3300009177 Ga0105248_10001643 Ga0105248_1000164319 205
23 3300013297 Ga0157378_10366414 Ga0157378_103664142 205
24 3300013306 Ga0163162_10207566 Ga0163162_102075662 205
25 3300013308 Ga0157375_10059181 Ga0157375_100591814 205
26 3300025931 Ga0207644_10018513 Ga0207644_100185133 205
27 3300025941 Ga0207711_10027441 Ga0207711_100274412 205
28 3300026035 Ga0207703_10142333 Ga0207703_101423333 205
29 3300035725 Ga0373947_0381647 Ga0373947_0381647_203_829 205
30 3300045976 Ga0466967_0846148 Ga0466967_0846148_127_744 205
31 3300048905 Ga0496102_0352677 Ga0496102_0352677_360_983 205
32 3300048911 Ga0496108_0151530 Ga0496108_0151530_1082_1705 205
33 iso_pu_bacteria 2511231004 2511256380 205
34 iso_pu_bacteria 2511231012 2511300737 205
35 iso_pu_bacteria 2511231015 2511321024 205
36 iso_pu_bacteria 2511231016 2511326295 205
37 iso_pu_bacteria 2511231018 2511340115 205
38 iso_pu_bacteria 2643221565 2643840744 205
39 iso_pu_bacteria 2773857670 2774119766 205
40 iso_pu_bacteria 2784132072 2784315020 205
41 iso_pu_bacteria 2808606377 2808931164 205
42 iso_pu_bacteria 2808606381 2808953346 205
43 iso_pu_bacteria 2857537821 2857539358 205
44 iso_pu_bacteria 2919456309 2919459759 205
45 iso_pu_bacteria 2931396565 2931398619 205
46 iso_pu_bacteria 8056125926 8056126261 205
47 iso_pu_bacteria 8056155041 8056158301 205
48 3300005295 Ga0065707_10231719 Ga0065707_102317191 206
49 3300005328 Ga0070676_10343574 Ga0070676_103435742 206
50 3300005330 Ga0070690_100004121 Ga0070690_1000041217 206
51 3300005334 Ga0068869_100007257 Ga0068869_1000072575 206
52 3300005336 Ga0070680_100003142 Ga0070680_1000031424 206
53 3300005337 Ga0070682_100030658 Ga0070682_1000306582 206
54 3300005338 Ga0068868_100011124 Ga0068868_1000111246 206
55 3300005340 Ga0070689_100336428 Ga0070689_1003364281 206
56 3300005341 Ga0070691_10003222 Ga0070691_100032223 206
57 3300005343 Ga0070687_100002697 Ga0070687_1000026972 206
58 3300005345 Ga0070692_10064768 Ga0070692_100647682 206
59 3300005353 Ga0070669_100102206 Ga0070669_1001022062 206
60 3300005355 Ga0070671_100087118 Ga0070671_1000871181 206
61 3300005364 Ga0070673_100516696 Ga0070673_1005166962 206
62 3300005365 Ga0070688_100336608 Ga0070688_1003366082 206
63 3300005406 Ga0070703_10006823 Ga0070703_100068234 206
64 3300005440 Ga0070705_100002548 Ga0070705_1000025485 206
65 3300005441 Ga0070700_100009639 Ga0070700_1000096393 206
66 3300005444 Ga0070694_100013810 Ga0070694_1000138102 206
67 3300005445 Ga0070708_100395528 Ga0070708_1003955282 206
68 3300005458 Ga0070681_10402764 Ga0070681_104027642 206
69 3300005459 Ga0068867_100006836 Ga0068867_1000068367 206
70 3300005468 Ga0070707_100585566 Ga0070707_1005855662 206
71 3300005530 Ga0070679_100001875 Ga0070679_1000018758 206
72 3300005544 Ga0070686_100006730 Ga0070686_1000067307 206
73 3300005545 Ga0070695_100004287 Ga0070695_1000042877 206
74 3300005546 Ga0070696_100001122 Ga0070696_1000011228 206
75 3300005547 Ga0070693_100006305 Ga0070693_1000063052 206
76 3300005549 Ga0070704_100000083 Ga0070704_10000008322 206
77 3300005563 Ga0068855_100025317 Ga0068855_1000253172 206
78 3300005578 Ga0068854_100050532 Ga0068854_1000505322 206
79 3300005615 Ga0070702_100007025 Ga0070702_1000070252 206
80 3300005616 Ga0068852_100499417 Ga0068852_1004994172 206
81 3300005718 Ga0068866_10002197 Ga0068866_100021977 206
82 3300005719 Ga0068861_100014217 Ga0068861_1000142177 206
83 3300005842 Ga0068858_100030844 Ga0068858_1000308442 206
84 3300005842 Ga0068858_100063190 Ga0068858_1000631903 206
85 3300005843 Ga0068860_100018123 Ga0068860_1000181234 206
86 3300006028 Ga0070717_10798187 Ga0070717_107981872 206
87 3300006163 Ga0070715_10196004 Ga0070715_101960042 206
88 3300006237 Ga0097621_100017059 Ga0097621_1000170595 206
89 3300006358 Ga0068871_100003490 Ga0068871_10000349013 206
90 3300006358 Ga0068871_100078323 Ga0068871_1000783231 206
91 3300006844 Ga0075428_100010065 Ga0075428_1000100652 206
92 3300006852 Ga0075433_10108199 Ga0075433_101081992 206
93 3300006871 Ga0075434_100098906 Ga0075434_1000989065 206
94 3300006880 Ga0075429_100002284 Ga0075429_10000228416 206
95 3300006914 Ga0075436_100008330 Ga0075436_1000083305 206
96 3300006914 Ga0075436_100204011 Ga0075436_1002040112 206
97 3300007076 Ga0075435_100019017 Ga0075435_1000190176 206
98 3300009092 Ga0105250_10031050 Ga0105250_100310503 206
99 3300009094 Ga0111539_10135862 Ga0111539_101358622 206
100 3300009098 Ga0105245_10002508 Ga0105245_1000250811 206
101 3300009147 Ga0114129_10057223 Ga0114129_100572231 206
102 3300009148 Ga0105243_10000828 Ga0105243_100008285 206
103 3300009174 Ga0105241_10005717 Ga0105241_100057177 206
104 3300009174 Ga0105241_10374284 Ga0105241_103742842 206
105 3300009176 Ga0105242_10012860 Ga0105242_100128602 206
106 3300009553 Ga0105249_10005189 Ga0105249_100051897 206
107 3300010375 Ga0105239_10050189 Ga0105239_100501892 206
108 3300013297 Ga0157378_10000905 Ga0157378_100009054 206
109 3300013307 Ga0157372_10337749 Ga0157372_103377491 206
110 3300014745 Ga0157377_10084780 Ga0157377_100847802 206
111 3300014968 Ga0157379_10103200 Ga0157379_101032002 206
112 3300014969 Ga0157376_10016490 Ga0157376_100164902 206
113 3300014969 Ga0157376_10067310 Ga0157376_100673105 206
114 3300025885 Ga0207653_10003361 Ga0207653_100033613 206
115 3300025899 Ga0207642_10001262 Ga0207642_100012625 206
116 3300025904 Ga0207647_10115004 Ga0207647_101150042 206
117 3300025907 Ga0207645_10157508 Ga0207645_101575081 206
118 3300025911 Ga0207654_10023421 Ga0207654_100234212 206
119 3300025912 Ga0207707_10318632 Ga0207707_103186322 206
120 3300025917 Ga0207660_10009077 Ga0207660_100090772 206
121 3300025918 Ga0207662_10000200 Ga0207662_100002007 206
122 3300025921 Ga0207652_10202325 Ga0207652_102023251 206
123 3300025926 Ga0207659_10720493 Ga0207659_107204931 206
124 3300025927 Ga0207687_10003767 Ga0207687_1000376710 206
125 3300025931 Ga0207644_10033489 Ga0207644_100334893 206
126 3300025934 Ga0207686_10006909 Ga0207686_100069092 206
127 3300025935 Ga0207709_10004256 Ga0207709_100042567 206
128 3300025936 Ga0207670_10014122 Ga0207670_100141224 206
129 3300025936 Ga0207670_10159435 Ga0207670_101594354 206
130 3300025938 Ga0207704_10010803 Ga0207704_100108032 206
131 3300025941 Ga0207711_10298119 Ga0207711_102981192 206
132 3300025942 Ga0207689_10000229 Ga0207689_1000022928 206
133 3300025949 Ga0207667_10088567 Ga0207667_100885672 206
134 3300025961 Ga0207712_10463353 Ga0207712_104633532 206
135 3300025981 Ga0207640_10005122 Ga0207640_100051225 206
136 3300026035 Ga0207703_10049612 Ga0207703_100496123 206
137 3300026035 Ga0207703_10088267 Ga0207703_100882672 206
138 3300026041 Ga0207639_10044041 Ga0207639_100440412 206
139 3300026075 Ga0207708_10005632 Ga0207708_100056323 206
140 3300026078 Ga0207702_11093543 Ga0207702_110935431 206
141 3300026088 Ga0207641_10673318 Ga0207641_106733181 206
142 3300026089 Ga0207648_10000124 Ga0207648_1000012417 206
143 3300026118 Ga0207675_100001175 Ga0207675_10000117524 206
144 3300026142 Ga0207698_10096938 Ga0207698_100969383 206
145 3300027907 Ga0207428_10076391 Ga0207428_100763914 206
146 3300028380 Ga0268265_10016085 Ga0268265_100160852 206
147 3300028381 Ga0268264_10001839 Ga0268264_1000183915 206
148 3300034816 Ga0373930_0006814 Ga0373930_0006814_560_1180 206
149 3300034957 Ga0373938_0005618 Ga0373938_0005618_20_640 206
150 3300035084 Ga0373928_0002384 Ga0373928_0002384_439_1059 206
151 3300035086 Ga0373934_0261101 Ga0373934_0261101_29_685 206
152 3300035088 Ga0373940_0007019 Ga0373940_0007019_1676_2296 206
153 3300035092 Ga0373952_0006586 Ga0373952_0006586_747_1367 206
154 3300035111 Ga0373923_0107122 Ga0373923_0107122_122_820 206
155 3300035112 Ga0373932_0007442 Ga0373932_0007442_983_1603 206
156 3300035114 Ga0373939_0023283 Ga0373939_0023283_764_1384 206
157 3300035115 Ga0373941_0021046 Ga0373941_0021046_19_639 206
158 3300035207 Ga0373942_0006173 Ga0373942_0006173_201_821 206
159 3300035241 Ga0373961_0004757 Ga0373961_0004757_1509_2129 206
160 3300035691 Ga0373931_0018730 Ga0373931_0018730_1847_2467 206
161 3300042003 Ga0439443_000312 Ga0439443_000312_958_1587 206
162 3300042437 Ga0439444_0005182 Ga0439444_0005182_583_1212 206
163 3300042461 Ga0439460_0013335 Ga0439460_0013335_1125_1754 206
164 3300042532 Ga0450893_0030497 Ga0450893_0030497_198_827 206
165 3300045051 Ga0451576_0217814 Ga0451576_0217814_931_1551 206
166 3300049576 Ga0501040_0198045 Ga0501040_0198045_274_903 206
167 3300049591 Ga0501075_0088162 Ga0501075_0088162_52_672 206
168 3300050508 nmdc:mga09592_264265_c1 nmdc:mga09592_264265_c1_606_1226 206
169 3300050511 nmdc:mga08y16_406940_c1 nmdc:mga08y16_406940_c1_585_1205 206
170 3300050511 nmdc:mga08y16_604941_c1 nmdc:mga08y16_604941_c1_322_942 206
171 3300050512 nmdc:mga0n895_25840_c1 nmdc:mga0n895_25840_c1_3463_4083 206
172 3300050513 nmdc:mga0rr50_105236_c1 nmdc:mga0rr50_105236_c1_181_801 206
173 3300050513 nmdc:mga0rr50_405564_c1 nmdc:mga0rr50_405564_c1_241_870 206
174 3300050515 nmdc:mga0a205_19958_c1 nmdc:mga0a205_19958_c1_687_1307 206
175 3300053085 Ga0495619_0281309 Ga0495619_0281309_114_812 206
176 3300005330 Ga0070690_100079142 Ga0070690_1000791422 207
177 3300005335 Ga0070666_10132525 Ga0070666_101325252 207
178 3300005338 Ga0068868_100011828 Ga0068868_1000118285 207
179 3300005343 Ga0070687_100568821 Ga0070687_1005688211 207
180 3300005355 Ga0070671_100141714 Ga0070671_1001417142 207
181 3300005364 Ga0070673_100079768 Ga0070673_1000797682 207
182 3300005367 Ga0070667_100001093 Ga0070667_10000109318 207
183 3300005435 Ga0070714_100704411 Ga0070714_1007044111 207
184 3300005436 Ga0070713_100416573 Ga0070713_1004165731 207
185 3300005439 Ga0070711_100128317 Ga0070711_1001283171 207
186 3300005439 Ga0070711_100421991 Ga0070711_1004219911 207
187 3300005439 Ga0070711_100594474 Ga0070711_1005944742 207
188 3300005440 Ga0070705_100132290 Ga0070705_1001322903 207
189 3300005543 Ga0070672_100652490 Ga0070672_1006524902 207
190 3300005547 Ga0070693_100573191 Ga0070693_1005731911 207
191 3300005548 Ga0070665_100033616 Ga0070665_1000336163 207
192 3300005615 Ga0070702_100812849 Ga0070702_1008128491 207
193 3300005616 Ga0068852_100791229 Ga0068852_1007912291 207
194 3300005617 Ga0068859_100052283 Ga0068859_1000522832 207
195 3300005618 Ga0068864_100049722 Ga0068864_1000497223 207
196 3300005841 Ga0068863_100013022 Ga0068863_1000130223 207
197 3300005842 Ga0068858_100034170 Ga0068858_1000341701 207
198 3300005843 Ga0068860_100014740 Ga0068860_1000147402 207
199 3300005937 Ga0081455_10031813 Ga0081455_100318139 207
200 3300006028 Ga0070717_10090720 Ga0070717_100907202 207
201 3300006028 Ga0070717_11119322 Ga0070717_111193221 207
202 3300006038 Ga0075365_10417902 Ga0075365_104179021 207
203 3300006173 Ga0070716_100013835 Ga0070716_1000138354 207
204 3300006175 Ga0070712_100000823 Ga0070712_10000082318 207
205 3300006175 Ga0070712_100045961 Ga0070712_1000459614 207
206 3300006175 Ga0070712_100183202 Ga0070712_1001832023 207
207 3300006237 Ga0097621_100003387 Ga0097621_1000033879 207
208 3300006358 Ga0068871_100008380 Ga0068871_1000083804 207
209 3300006844 Ga0075428_100188006 Ga0075428_1001880062 207
210 3300006844 Ga0075428_100221354 Ga0075428_1002213542 207
211 3300006846 Ga0075430_100318562 Ga0075430_1003185622 207
212 3300006847 Ga0075431_100007683 Ga0075431_1000076835 207
213 3300006871 Ga0075434_100103030 Ga0075434_1001030303 207
214 3300006880 Ga0075429_100064749 Ga0075429_1000647491 207
215 3300006931 Ga0097620_100052284 Ga0097620_1000522842 207
216 3300007076 Ga0075435_100143852 Ga0075435_1001438523 207
217 3300007076 Ga0075435_100757569 Ga0075435_1007575692 207
218 3300007265 Ga0099794_10013510 Ga0099794_100135101 207
219 3300009094 Ga0111539_11131637 Ga0111539_111316371 207
220 3300009098 Ga0105245_10007367 Ga0105245_100073672 207
221 3300009101 Ga0105247_10831621 Ga0105247_108316211 207
222 3300009147 Ga0114129_10141179 Ga0114129_101411793 207
223 3300009176 Ga0105242_10013252 Ga0105242_100132522 207
224 3300009177 Ga0105248_10062724 Ga0105248_100627243 207
225 3300009553 Ga0105249_10000305 Ga0105249_100003055 207
226 3300010159 Ga0099796_10006396 Ga0099796_100063962 207
227 3300010375 Ga0105239_10167562 Ga0105239_101675623 207
228 3300013296 Ga0157374_10061531 Ga0157374_100615313 207
229 3300013297 Ga0157378_10017494 Ga0157378_100174942 207
230 3300014325 Ga0163163_10009741 Ga0163163_100097418 207
231 3300014968 Ga0157379_10001014 Ga0157379_100010149 207
232 3300014969 Ga0157376_10002734 Ga0157376_100027348 207
233 3300024227 Ga0228598_1022512 Ga0228598_10225121 207
234 3300025898 Ga0207692_10228036 Ga0207692_102280361 207
235 3300025906 Ga0207699_10219647 Ga0207699_102196472 207
236 3300025913 Ga0207695_10023324 Ga0207695_100233247 207
237 3300025915 Ga0207693_10035007 Ga0207693_100350074 207
238 3300025915 Ga0207693_10048168 Ga0207693_100481684 207
239 3300025915 Ga0207693_10105568 Ga0207693_101055682 207
240 3300025915 Ga0207693_10229959 Ga0207693_102299591 207
241 3300025916 Ga0207663_10019562 Ga0207663_100195623 207
242 3300025916 Ga0207663_10106226 Ga0207663_101062263 207
243 3300025916 Ga0207663_10168759 Ga0207663_101687591 207
244 3300025916 Ga0207663_10229335 Ga0207663_102293352 207
245 3300025916 Ga0207663_10308260 Ga0207663_103082602 207
246 3300025917 Ga0207660_10634090 Ga0207660_106340902 207
247 3300025928 Ga0207700_10217207 Ga0207700_102172072 207
248 3300025928 Ga0207700_10410848 Ga0207700_104108482 207
249 3300025929 Ga0207664_10160946 Ga0207664_101609462 207
250 3300025939 Ga0207665_10063492 Ga0207665_100634922 207
251 3300025941 Ga0207711_10004318 Ga0207711_100043186 207
252 3300025986 Ga0207658_10006854 Ga0207658_100068544 207
253 3300026023 Ga0207677_10048141 Ga0207677_100481412 207
254 3300026035 Ga0207703_10006954 Ga0207703_100069544 207
255 3300026088 Ga0207641_10044739 Ga0207641_100447394 207
256 3300026095 Ga0207676_10055704 Ga0207676_100557042 207
257 3300028379 Ga0268266_10045567 Ga0268266_100455672 207
258 3300028381 Ga0268264_10048729 Ga0268264_100487292 207
259 3300031250 Ga0265331_10110186 Ga0265331_101101862 207
260 3300035083 Ga0373926_0003758 Ga0373926_0003758_3398_4021 207
261 3300035089 Ga0373944_0002007 Ga0373944_0002007_2281_2904 207
262 3300035111 Ga0373923_0068609 Ga0373923_0068609_49_687 207
263 3300035111 Ga0373923_0119232 Ga0373923_0119232_210_833 207
264 3300035113 Ga0373936_0098859 Ga0373936_0098859_110_733 207
265 3300035113 Ga0373936_0201605 Ga0373936_0201605_57_680 207
266 3300035116 Ga0373945_0001120 Ga0373945_0001120_7427_8065 207
267 3300035116 Ga0373945_0017789 Ga0373945_0017789_1112_1735 207
268 3300035117 Ga0373953_0001462 Ga0373953_0001462_2081_2719 207
269 3300035118 Ga0373954_0002182 Ga0373954_0002182_4061_4699 207
270 3300035118 Ga0373954_0066235 Ga0373954_0066235_339_962 207
271 3300035170 Ga0373943_0002502 Ga0373943_0002502_1589_2212 207
272 3300035171 Ga0373946_0002385 Ga0373946_0002385_3496_4119 207
273 3300035171 Ga0373946_0013338 Ga0373946_0013338_2399_3037 207
274 3300035171 Ga0373946_0015152 Ga0373946_0015152_460_1083 207
275 3300035171 Ga0373946_0072308 Ga0373946_0072308_221_844 207
276 3300035172 Ga0373955_0000200 Ga0373955_0000200_9236_9874 207
277 3300035172 Ga0373955_0016724 Ga0373955_0016724_2015_2638 207
278 3300035172 Ga0373955_0197934 Ga0373955_0197934_332_955 207
279 3300035410 Ga0373924_0001651 Ga0373924_0001651_6639_7277 207
280 3300035692 Ga0373935_0003610 Ga0373935_0003610_3109_3747 207
281 3300035695 Ga0373927_0000227 Ga0373927_0000227_4302_4925 207
282 3300035695 Ga0373927_0009494 Ga0373927_0009494_2865_3503 207
283 3300035695 Ga0373927_0100066 Ga0373927_0100066_256_879 207
284 3300035695 Ga0373927_0509636 Ga0373927_0509636_105_737 207
285 3300035724 Ga0373933_0001234 Ga0373933_0001234_5816_6454 207
286 3300035724 Ga0373933_0080406 Ga0373933_0080406_1139_1762 207
287 3300035724 Ga0373933_0138046 Ga0373933_0138046_637_1260 207
288 3300035725 Ga0373947_0003871 Ga0373947_0003871_6469_7107 207
289 3300035725 Ga0373947_0014412 Ga0373947_0014412_795_1418 207
290 3300035725 Ga0373947_0355669 Ga0373947_0355669_260_883 207
291 3300035725 Ga0373947_0367094 Ga0373947_0367094_263_886 207
292 3300036401 Ga0373937_0000313 Ga0373937_0000313_36434_37072 207
293 3300036401 Ga0373937_0035405 Ga0373937_0035405_1199_1822 207
294 3300036401 Ga0373937_0419564 Ga0373937_0419564_340_963 207
295 3300037068 Ga0373925_0000025 Ga0373925_0000025_53469_54107 207
296 3300041443 Ga0451789_1257416 Ga0451789_1257416_17_661 207
297 3300046454 Ga0495592_0002157 Ga0495592_0002157_10668_11306 207
298 3300046454 Ga0495592_0053446 Ga0495592_0053446_518_1141 207
299 3300046454 Ga0495592_0151922 Ga0495592_0151922_413_1036 207
300 3300046455 Ga0495603_0087914 Ga0495603_0087914_994_1617 207
301 3300046455 Ga0495603_0117631 Ga0495603_0117631_909_1532 207
302 3300046459 Ga0495629_0002377 Ga0495629_0002377_4291_4929 207
303 3300046459 Ga0495629_0013043 Ga0495629_0013043_5063_5686 207
304 3300046459 Ga0495629_0027771 Ga0495629_0027771_226_849 207
305 3300046459 Ga0495629_0101079 Ga0495629_0101079_977_1600 207
306 3300046459 Ga0495629_0429025 Ga0495629_0429025_257_880 207
307 3300046462 Ga0495651_0000283 Ga0495651_0000283_22997_23635 207
308 3300046462 Ga0495651_0008148 Ga0495651_0008148_6411_7034 207
309 3300046462 Ga0495651_0032787 Ga0495651_0032787_272_895 207
310 3300046462 Ga0495651_0126226 Ga0495651_0126226_566_1189 207
311 3300046463 Ga0495653_0000041 Ga0495653_0000041_36348_36986 207
312 3300046463 Ga0495653_0074943 Ga0495653_0074943_1195_1818 207
313 3300046463 Ga0495653_0128500 Ga0495653_0128500_971_1594 207
314 3300046463 Ga0495653_0218296 Ga0495653_0218296_215_838 207
315 3300046472 Ga0495580_0225746 Ga0495580_0225746_401_1024 207
316 3300046475 Ga0495639_0030576 Ga0495639_0030576_1331_1954 207
317 3300046475 Ga0495639_0107428 Ga0495639_0107428_596_1219 207
318 3300046475 Ga0495639_0130128 Ga0495639_0130128_409_1032 207
319 3300046476 Ga0495662_0001774 Ga0495662_0001774_128_766 207
320 3300046476 Ga0495662_0055819 Ga0495662_0055819_237_860 207
321 3300046477 Ga0495664_0000005 Ga0495664_0000005_170573_171211 207
322 3300046477 Ga0495664_0115215 Ga0495664_0115215_559_1182 207
323 3300046477 Ga0495664_0221177 Ga0495664_0221177_240_863 207
324 3300046491 Ga0495584_0251872 Ga0495584_0251872_173_796 207
325 3300046499 Ga0495594_0111673 Ga0495594_0111673_262_885 207
326 3300046499 Ga0495594_0170158 Ga0495594_0170158_208_831 207
327 3300046499 Ga0495594_0385401 Ga0495594_0385401_118_741 207
328 3300046511 Ga0495608_0000003 Ga0495608_0000003_268367_269005 207
329 3300046511 Ga0495608_0099718 Ga0495608_0099718_946_1569 207
330 3300046514 Ga0495618_0000010 Ga0495618_0000010_46521_47159 207
331 3300046514 Ga0495618_0006339 Ga0495618_0006339_5307_5930 207
332 3300046514 Ga0495618_0010308 Ga0495618_0010308_1335_1958 207
333 3300046514 Ga0495618_0056927 Ga0495618_0056927_1385_2008 207
334 3300046516 Ga0495628_0000019 Ga0495628_0000019_100831_101469 207
335 3300046516 Ga0495628_0040050 Ga0495628_0040050_286_909 207
336 3300046516 Ga0495628_0069866 Ga0495628_0069866_848_1471 207
337 3300046516 Ga0495628_0102898 Ga0495628_0102898_1106_1816 207
338 3300046516 Ga0495628_0165765 Ga0495628_0165765_125_748 207
339 3300046517 Ga0495630_0005281 Ga0495630_0005281_1523_2161 207
340 3300046517 Ga0495630_0029170 Ga0495630_0029170_1567_2190 207
341 3300046517 Ga0495630_0057699 Ga0495630_0057699_1255_1878 207
342 3300046517 Ga0495630_0208058 Ga0495630_0208058_312_935 207
343 3300046517 Ga0495630_0505032 Ga0495630_0505032_44_667 207
344 3300046517 Ga0495630_0573283 Ga0495630_0573283_10_633 207
345 3300046523 Ga0495644_0070222 Ga0495644_0070222_254_877 207
346 3300046526 Ga0495666_0113673 Ga0495666_0113673_347_970 207
347 3300046526 Ga0495666_0181017 Ga0495666_0181017_209_832 207
348 3300046529 Ga0495652_0000028 Ga0495652_0000028_100831_101469 207
349 3300046529 Ga0495652_0049801 Ga0495652_0049801_1321_1944 207
350 3300046529 Ga0495652_0084982 Ga0495652_0084982_1630_2253 207
351 3300046529 Ga0495652_0105628 Ga0495652_0105628_1031_1654 207
352 3300046529 Ga0495652_0518154 Ga0495652_0518154_20_643 207
353 3300046531 Ga0495665_0048785 Ga0495665_0048785_26_664 207
354 3300046533 Ga0495640_0000014 Ga0495640_0000014_60273_60911 207
355 3300046533 Ga0495640_0000946 Ga0495640_0000946_12162_12785 207
356 3300046533 Ga0495640_0018796 Ga0495640_0018796_226_849 207
357 3300046533 Ga0495640_0332048 Ga0495640_0332048_115_738 207
358 3300046535 Ga0495586_0064174 Ga0495586_0064174_403_1026 207
359 3300046535 Ga0495586_0186182 Ga0495586_0186182_391_1014 207
360 3300046535 Ga0495586_0222364 Ga0495586_0222364_220_843 207
361 3300046536 Ga0495587_0000026 Ga0495587_0000026_46351_46989 207
362 3300046536 Ga0495587_0003753 Ga0495587_0003753_3998_4621 207
363 3300046536 Ga0495587_0008708 Ga0495587_0008708_309_932 207
364 3300046543 Ga0495645_0000005 Ga0495645_0000005_170544_171182 207
365 3300046543 Ga0495645_0174782 Ga0495645_0174782_276_899 207
366 3300046559 Ga0495667_0000003 Ga0495667_0000003_193451_194089 207
367 3300046559 Ga0495667_0037027 Ga0495667_0037027_623_1246 207
368 3300046559 Ga0495667_0042670 Ga0495667_0042670_1431_2054 207
369 3300046642 Ga0495634_0000017 Ga0495634_0000017_23063_23701 207
370 3300046642 Ga0495634_0009717 Ga0495634_0009717_90_713 207
371 3300046642 Ga0495634_0010017 Ga0495634_0010017_1187_1810 207
372 3300046642 Ga0495634_0049595 Ga0495634_0049595_554_1177 207
373 3300046642 Ga0495634_0149390 Ga0495634_0149390_416_1039 207
374 3300046648 Ga0495611_0166359 Ga0495611_0166359_221_844 207
375 3300046663 Ga0495635_0000024 Ga0495635_0000024_46745_47383 207
376 3300046663 Ga0495635_0010685 Ga0495635_0010685_4927_5550 207
377 3300046663 Ga0495635_0026038 Ga0495635_0026038_3006_3629 207
378 3300046674 Ga0495588_0332304 Ga0495588_0332304_40_663 207
379 3300046675 Ga0495657_0000034 Ga0495657_0000034_81585_82223 207
380 3300046675 Ga0495657_0079863 Ga0495657_0079863_868_1491 207
381 3300046678 Ga0495599_0000017 Ga0495599_0000017_101150_101788 207
382 3300046679 Ga0495623_0000028 Ga0495623_0000028_71519_72157 207
383 3300046679 Ga0495623_0153544 Ga0495623_0153544_125_748 207
384 3300046680 Ga0495646_0000015 Ga0495646_0000015_40252_40890 207
385 3300046680 Ga0495646_0012842 Ga0495646_0012842_3521_4144 207
386 3300046680 Ga0495646_0035958 Ga0495646_0035958_608_1231 207
387 3300046680 Ga0495646_0068799 Ga0495646_0068799_619_1242 207
388 3300046681 Ga0495647_0164642 Ga0495647_0164642_40_678 207
389 3300046683 Ga0495658_0363378 Ga0495658_0363378_76_699 207
390 3300046689 Ga0495613_0050088 Ga0495613_0050088_64_702 207
391 3300046689 Ga0495613_0089910 Ga0495613_0089910_1046_1669 207
392 3300046690 Ga0495624_0003729 Ga0495624_0003729_7317_7940 207
393 3300046690 Ga0495624_0344437 Ga0495624_0344437_145_783 207
394 3300046691 Ga0495670_0148850 Ga0495670_0148850_22_645 207
395 3300046809 Ga0495600_0000058 Ga0495600_0000058_53205_53843 207
396 3300046809 Ga0495600_0101636 Ga0495600_0101636_1009_1632 207
397 3300046809 Ga0495600_0104177 Ga0495600_0104177_1064_1687 207
398 3300047315 Ga0495581_0483247 Ga0495581_0483247_14_637 207
399 3300047317 Ga0495604_0000021 Ga0495604_0000021_100828_101466 207
400 3300047317 Ga0495604_0002971 Ga0495604_0002971_9793_10416 207
401 3300047317 Ga0495604_0022424 Ga0495604_0022424_976_1599 207
402 3300047317 Ga0495604_0130956 Ga0495604_0130956_737_1360 207
403 3300047319 Ga0495674_0000005 Ga0495674_0000005_273661_274299 207
404 3300047319 Ga0495674_0011146 Ga0495674_0011146_6710_7333 207
405 3300047319 Ga0495674_0017300 Ga0495674_0017300_4211_4834 207
406 3300047319 Ga0495674_0040116 Ga0495674_0040116_1840_2463 207
407 3300047319 Ga0495674_0143092 Ga0495674_0143092_1123_1746 207
408 3300047319 Ga0495674_0408415 Ga0495674_0408415_416_1039 207
409 3300047321 Ga0495676_0059791 Ga0495676_0059791_435_1058 207
410 3300047321 Ga0495676_0134937 Ga0495676_0134937_897_1520 207
411 3300047321 Ga0495676_0136672 Ga0495676_0136672_135_773 207
412 3300047321 Ga0495676_0388599 Ga0495676_0388599_154_777 207
413 3300047322 Ga0495680_0000222 Ga0495680_0000222_36251_36889 207
414 3300047322 Ga0495680_0005923 Ga0495680_0005923_8812_9435 207
415 3300047322 Ga0495680_0015308 Ga0495680_0015308_5093_5716 207
416 3300047322 Ga0495680_0055885 Ga0495680_0055885_942_1565 207
417 3300047444 Ga0495675_0000173 Ga0495675_0000173_12376_13014 207
418 3300047444 Ga0495675_0018919 Ga0495675_0018919_922_1545 207
419 3300047470 Ga0495681_0216198 Ga0495681_0216198_20_643 207
420 3300047471 Ga0495684_0000001 Ga0495684_0000001_100807_101445 207
421 3300047471 Ga0495684_0000945 Ga0495684_0000945_5525_6148 207
422 3300047471 Ga0495684_0011640 Ga0495684_0011640_1180_1803 207
423 3300047471 Ga0495684_0166899 Ga0495684_0166899_711_1334 207
424 3300047471 Ga0495684_0363468 Ga0495684_0363468_105_728 207
425 3300047471 Ga0495684_0500057 Ga0495684_0500057_48_671 207
426 3300047673 Ga0495593_0108816 Ga0495593_0108816_260_883 207
427 3300048088 Ga0495602_0000003 Ga0495602_0000003_255772_256410 207
428 3300048088 Ga0495602_0065515 Ga0495602_0065515_1665_2288 207
429 3300048089 Ga0495614_0081055 Ga0495614_0081055_521_1144 207
430 3300048904 Ga0496101_0209857 Ga0496101_0209857_822_1454 207
431 3300048904 Ga0496101_0436442 Ga0496101_0436442_348_971 207
432 3300048905 Ga0496102_0177184 Ga0496102_0177184_418_1065 207
433 3300048907 Ga0496104_0001024 Ga0496104_0001024_13182_13829 207
434 3300048907 Ga0496104_0007414 Ga0496104_0007414_8527_9159 207
435 3300048907 Ga0496104_0118065 Ga0496104_0118065_720_1463 207
436 3300048907 Ga0496104_0141620 Ga0496104_0141620_328_996 207
437 3300048908 Ga0496105_0034245 Ga0496105_0034245_300_932 207
438 3300048909 Ga0496106_0170332 Ga0496106_0170332_114_737 207
439 3300048911 Ga0496108_0004479 Ga0496108_0004479_5959_6627 207
440 3300048912 Ga0496109_0021985 Ga0496109_0021985_480_1112 207
441 3300048912 Ga0496109_0259724 Ga0496109_0259724_577_1224 207
442 3300048913 Ga0496110_0002432 Ga0496110_0002432_11707_12375 207
443 3300048913 Ga0496110_0007846 Ga0496110_0007846_5616_6248 207
444 3300048914 Ga0496111_0032677 Ga0496111_0032677_1816_2484 207
445 3300048914 Ga0496111_0045810 Ga0496111_0045810_2313_2945 207
446 3300048916 Ga0496113_0105770 Ga0496113_0105770_1026_1694 207
447 3300048916 Ga0496113_0241677 Ga0496113_0241677_384_1016 207
448 3300049577 Ga0501041_0185203 Ga0501041_0185203_385_1008 207
449 3300049583 Ga0501067_0444367 Ga0501067_0444367_54_677 207
450 3300049591 Ga0501075_0077762 Ga0501075_0077762_1573_2196 207
451 3300049743 Ga0501081_0219251 Ga0501081_0219251_275_898 207
452 3300050507 nmdc:mga05p37_394764_c1 nmdc:mga05p37_394764_c1_781_1404 207
453 3300050508 nmdc:mga09592_478835_c1 nmdc:mga09592_478835_c1_248_949 207
454 3300050509 nmdc:mga0qj67_487028_c1 nmdc:mga0qj67_487028_c1_83_706 207
455 3300050509 nmdc:mga0qj67_59978_c1 nmdc:mga0qj67_59978_c1_625_1248 207
456 3300050512 nmdc:mga0n895_93679_c1 nmdc:mga0n895_93679_c1_1715_2338 207
457 3300050513 nmdc:mga0rr50_716109_c1 nmdc:mga0rr50_716109_c1_81_704 207
458 3300053077 Ga0495601_0000005 Ga0495601_0000005_98711_99349 207
459 3300053077 Ga0495601_0000980 Ga0495601_0000980_5315_5938 207
460 3300053077 Ga0495601_0004375 Ga0495601_0004375_7333_7956 207
461 3300053077 Ga0495601_0005989 Ga0495601_0005989_3733_4356 207
462 3300053077 Ga0495601_0032295 Ga0495601_0032295_1941_2564 207
463 3300053077 Ga0495601_0442565 Ga0495601_0442565_107_730 207
464 3300053078 Ga0495612_0000001 Ga0495612_0000001_316776_317414 207
465 3300053078 Ga0495612_0005906 Ga0495612_0005906_1366_1989 207
466 3300053078 Ga0495612_0014025 Ga0495612_0014025_2116_2739 207
467 3300053078 Ga0495612_0042793 Ga0495612_0042793_1087_1710 207
468 3300053084 Ga0495595_0000033 Ga0495595_0000033_53608_54246 207
469 3300053084 Ga0495595_0001344 Ga0495595_0001344_8413_9036 207
470 3300053084 Ga0495595_0001798 Ga0495595_0001798_2617_3240 207
471 3300053084 Ga0495595_0017852 Ga0495595_0017852_1077_1700 207
472 3300053084 Ga0495595_0308317 Ga0495595_0308317_160_783 207
473 3300053085 Ga0495619_0000007 Ga0495619_0000007_100831_101469 207
474 3300053085 Ga0495619_0001550 Ga0495619_0001550_2108_2731 207
475 3300053085 Ga0495619_0003438 Ga0495619_0003438_3157_3780 207
476 3300053085 Ga0495619_0006725 Ga0495619_0006725_5712_6335 207
477 3300053085 Ga0495619_0008428 Ga0495619_0008428_4615_5238 207
478 3300053085 Ga0495619_0083323 Ga0495619_0083323_1484_2146 207
479 3300005328 Ga0070676_10285226 Ga0070676_102852262 208
480 3300005334 Ga0068869_100005998 Ga0068869_1000059985 208
481 3300005335 Ga0070666_10078571 Ga0070666_100785712 208
482 3300005337 Ga0070682_100440790 Ga0070682_1004407902 208
483 3300005340 Ga0070689_100010204 Ga0070689_1000102042 208
484 3300005347 Ga0070668_100451793 Ga0070668_1004517931 208
485 3300005353 Ga0070669_100153401 Ga0070669_1001534012 208
486 3300005354 Ga0070675_100043373 Ga0070675_1000433734 208
487 3300005355 Ga0070671_100100707 Ga0070671_1001007072 208
488 3300005356 Ga0070674_100486227 Ga0070674_1004862271 208
489 3300005364 Ga0070673_100062776 Ga0070673_1000627762 208
490 3300005367 Ga0070667_100007283 Ga0070667_1000072832 208
491 3300005435 Ga0070714_100023933 Ga0070714_1000239332 208
492 3300005440 Ga0070705_100879489 Ga0070705_1008794891 208
493 3300005459 Ga0068867_100010444 Ga0068867_1000104444 208
494 3300005459 Ga0068867_100409671 Ga0068867_1004096712 208
495 3300005466 Ga0070685_10236773 Ga0070685_102367732 208
496 3300005467 Ga0070706_100234877 Ga0070706_1002348772 208
497 3300005468 Ga0070707_100020730 Ga0070707_1000207306 208
498 3300005518 Ga0070699_100455608 Ga0070699_1004556082 208
499 3300005536 Ga0070697_100117457 Ga0070697_1001174571 208
500 3300005543 Ga0070672_100022966 Ga0070672_1000229664 208
501 3300005546 Ga0070696_100189621 Ga0070696_1001896213 208
502 3300005548 Ga0070665_100902825 Ga0070665_1009028252 208
503 3300005549 Ga0070704_100016975 Ga0070704_1000169754 208
504 3300005549 Ga0070704_100443478 Ga0070704_1004434782 208
505 3300005563 Ga0068855_100039862 Ga0068855_1000398625 208
506 3300005563 Ga0068855_100547284 Ga0068855_1005472841 208
507 3300005577 Ga0068857_100048049 Ga0068857_1000480492 208
508 3300005617 Ga0068859_100006490 Ga0068859_1000064904 208
509 3300005618 Ga0068864_100002280 Ga0068864_1000022804 208
510 3300005719 Ga0068861_100001241 Ga0068861_1000012417 208
511 3300005840 Ga0068870_10001840 Ga0068870_100018402 208
512 3300005840 Ga0068870_10016150 Ga0068870_100161504 208
513 3300005841 Ga0068863_100002300 Ga0068863_1000023005 208
514 3300005841 Ga0068863_100046547 Ga0068863_1000465472 208
515 3300005842 Ga0068858_100010433 Ga0068858_1000104332 208
516 3300005843 Ga0068860_100024570 Ga0068860_1000245702 208
517 3300005844 Ga0068862_100010079 Ga0068862_1000100793 208
518 3300006237 Ga0097621_100519200 Ga0097621_1005192001 208
519 3300006852 Ga0075433_10088674 Ga0075433_100886744 208
520 3300006871 Ga0075434_100021290 Ga0075434_1000212902 208
521 3300006871 Ga0075434_100092651 Ga0075434_1000926513 208
522 3300006931 Ga0097620_100006489 Ga0097620_1000064894 208
523 3300009094 Ga0111539_10088096 Ga0111539_100880963 208
524 3300009094 Ga0111539_11155015 Ga0111539_111550152 208
525 3300009148 Ga0105243_10201542 Ga0105243_102015422 208
526 3300009177 Ga0105248_10021343 Ga0105248_100213433 208
527 3300009177 Ga0105248_10551725 Ga0105248_105517251 208
528 3300013102 Ga0157371_10000641 Ga0157371_1000064123 208
529 3300013104 Ga0157370_10345975 Ga0157370_103459752 208
530 3300013297 Ga0157378_10403580 Ga0157378_104035801 208
531 3300013306 Ga0163162_10088023 Ga0163162_100880232 208
532 3300013308 Ga0157375_10191935 Ga0157375_101919353 208
533 3300014326 Ga0157380_10023521 Ga0157380_100235212 208
534 3300014968 Ga0157379_10001029 Ga0157379_1000102917 208
535 3300014968 Ga0157379_10059384 Ga0157379_100593848 208
536 3300017792 Ga0163161_10010873 Ga0163161_100108732 208
537 3300025885 Ga0207653_10102183 Ga0207653_101021832 208
538 3300025899 Ga0207642_10029525 Ga0207642_100295252 208
539 3300025903 Ga0207680_10027293 Ga0207680_100272933 208
540 3300025910 Ga0207684_10302588 Ga0207684_103025882 208
541 3300025912 Ga0207707_10170080 Ga0207707_101700801 208
542 3300025925 Ga0207650_10037477 Ga0207650_100374773 208
543 3300025926 Ga0207659_10045844 Ga0207659_100458443 208
544 3300025929 Ga0207664_10029849 Ga0207664_100298492 208
545 3300025931 Ga0207644_10194269 Ga0207644_101942693 208
546 3300025933 Ga0207706_10055745 Ga0207706_100557452 208
547 3300025936 Ga0207670_10063324 Ga0207670_100633242 208
548 3300025940 Ga0207691_10315320 Ga0207691_103153202 208
549 3300025942 Ga0207689_10000949 Ga0207689_1000094920 208
550 3300025949 Ga0207667_10024078 Ga0207667_100240782 208
551 3300025949 Ga0207667_10127864 Ga0207667_101278642 208
552 3300025960 Ga0207651_10047665 Ga0207651_100476652 208
553 3300025986 Ga0207658_10059301 Ga0207658_100593013 208
554 3300026035 Ga0207703_10009417 Ga0207703_100094175 208
555 3300026078 Ga0207702_10163592 Ga0207702_101635922 208
556 3300026088 Ga0207641_10027073 Ga0207641_100270732 208
557 3300026089 Ga0207648_10004634 Ga0207648_100046348 208
558 3300026089 Ga0207648_10017246 Ga0207648_100172463 208
559 3300026095 Ga0207676_10016274 Ga0207676_100162745 208
560 3300026116 Ga0207674_10027319 Ga0207674_100273195 208
561 3300026118 Ga0207675_100001933 Ga0207675_1000019339 208
562 3300026118 Ga0207675_100117555 Ga0207675_1001175551 208
563 3300027907 Ga0207428_10216895 Ga0207428_102168952 208
564 3300028380 Ga0268265_10033425 Ga0268265_100334252 208
565 3300031247 Ga0265340_10044661 Ga0265340_100446612 208
566 3300031250 Ga0265331_10127499 Ga0265331_101274991 208
567 3300035117 Ga0373953_0003158 Ga0373953_0003158_3907_4554 208
568 3300035118 Ga0373954_0167945 Ga0373954_0167945_236_883 208
569 3300035170 Ga0373943_0049420 Ga0373943_0049420_1313_1939 208
570 3300035172 Ga0373955_0271399 Ga0373955_0271399_91_738 208
571 3300035724 Ga0373933_0210956 Ga0373933_0210956_263_910 208
572 3300036401 Ga0373937_0001469 Ga0373937_0001469_1293_1940 208
573 3300037068 Ga0373925_0889035 Ga0373925_0889035_67_702 208
574 3300041411 Ga0439466_0025830 Ga0439466_0025830_47_742 208
575 3300042006 Ga0439432_053152 Ga0439432_053152_524_1219 208
576 3300042007 Ga0439449_0002973 Ga0439449_0002973_83_709 208
577 3300042009 Ga0439451_005149 Ga0439451_005149_645_1340 208
578 3300042010 Ga0439452_003422 Ga0439452_003422_399_1025 208
579 3300042010 Ga0439452_028224 Ga0439452_028224_260_955 208
580 3300042013 Ga0439456_040289 Ga0439456_040289_285_980 208
581 3300042016 Ga0439463_009292 Ga0439463_009292_126_752 208
582 3300042115 Ga0450911_005287 Ga0450911_005287_935_1561 208
583 3300042127 Ga0450890_000101 Ga0450890_000101_10136_10762 208
584 3300046457 Ga0495590_0002436 Ga0495590_0002436_449_1075 208
585 3300046474 Ga0495605_0014878 Ga0495605_0014878_800_1426 208
586 3300046474 Ga0495605_0044806 Ga0495605_0044806_246_872 208
587 3300046476 Ga0495662_0365773 Ga0495662_0365773_25_672 208
588 3300046491 Ga0495584_0005465 Ga0495584_0005465_3601_4227 208
589 3300046501 Ga0495607_0006507 Ga0495607_0006507_4142_4798 208
590 3300046512 Ga0495610_0017853 Ga0495610_0017853_384_1010 208
591 3300046513 Ga0495616_0002369 Ga0495616_0002369_6625_7251 208
592 3300046516 Ga0495628_0653350 Ga0495628_0653350_96_722 208
593 3300046530 Ga0495654_0003084 Ga0495654_0003084_9538_10164 208
594 3300046530 Ga0495654_0128245 Ga0495654_0128245_344_970 208
595 3300046536 Ga0495587_0005223 Ga0495587_0005223_3868_4494 208
596 3300046538 Ga0495609_0009563 Ga0495609_0009563_604_1230 208
597 3300046542 Ga0495597_0011083 Ga0495597_0011083_3377_4003 208
598 3300046615 Ga0495656_0208682 Ga0495656_0208682_302_928 208
599 3300046663 Ga0495635_0002778 Ga0495635_0002778_8625_9251 208
600 3300046664 Ga0495659_0064274 Ga0495659_0064274_604_1260 208
601 3300046665 Ga0495661_0104991 Ga0495661_0104991_31_687 208
602 3300046679 Ga0495623_0012865 Ga0495623_0012865_2042_2668 208
603 3300046689 Ga0495613_0042752 Ga0495613_0042752_652_1278 208
604 3300046691 Ga0495670_0001106 Ga0495670_0001106_2926_3582 208
605 3300046692 Ga0495671_0066408 Ga0495671_0066408_77_703 208
606 3300046694 Ga0495649_0003407 Ga0495649_0003407_268_894 208
607 3300046794 Ga0495589_0011660 Ga0495589_0011660_2122_2748 208
608 3300047317 Ga0495604_0005948 Ga0495604_0005948_1487_2113 208
609 3300047317 Ga0495604_0188783 Ga0495604_0188783_111_737 208
610 3300047318 Ga0495636_0146976 Ga0495636_0146976_324_950 208
611 3300047319 Ga0495674_0082226 Ga0495674_0082226_58_684 208
612 3300047322 Ga0495680_0007247 Ga0495680_0007247_7401_8027 208
613 3300047322 Ga0495680_0351773 Ga0495680_0351773_76_702 208
614 3300047323 Ga0495683_0097355 Ga0495683_0097355_532_1158 208
615 3300047445 Ga0495677_0205660 Ga0495677_0205660_58_684 208
616 3300047469 Ga0495673_0016750 Ga0495673_0016750_3011_3637 208
617 3300047673 Ga0495593_0059774 Ga0495593_0059774_1038_1664 208
618 3300048091 Ga0495626_0002843 Ga0495626_0002843_8833_9459 208
619 3300048905 Ga0496102_0062418 Ga0496102_0062418_759_1466 208
620 3300048909 Ga0496106_0765336 Ga0496106_0765336_94_720 208
621 3300048927 Ga0496124_0009323 Ga0496124_0009323_2743_3381 208
622 3300048929 Ga0496126_0069460 Ga0496126_0069460_2273_2899 208
623 3300049460 Ga0495682_0026861 Ga0495682_0026861_902_1528 208
624 3300050489 nmdc:mga03683_360479_c1 nmdc:mga03683_360479_c1_46_672 208
625 3300050494 nmdc:mga06z11_464399_c1 nmdc:mga06z11_464399_c1_90_716 208
626 3300050511 nmdc:mga08y16_98542_c1 nmdc:mga08y16_98542_c1_172_810 208
627 3300050512 nmdc:mga0n895_1203541_c1 nmdc:mga0n895_1203541_c1_13_639 208
628 3300050512 nmdc:mga0n895_17270_c1 nmdc:mga0n895_17270_c1_5432_6058 208
629 3300050512 nmdc:mga0n895_756553_c1 nmdc:mga0n895_756553_c1_81_716 208
630 3300050513 nmdc:mga0rr50_261522_c1 nmdc:mga0rr50_261522_c1_204_830 208
631 3300050515 nmdc:mga0a205_497_c1 nmdc:mga0a205_497_c1_8224_8850 208
632 3300005295 Ga0065707_10176604 Ga0065707_101766041 209
633 3300005436 Ga0070713_100337791 Ga0070713_1003377912 209
634 3300005436 Ga0070713_101032103 Ga0070713_1010321031 209
635 3300005437 Ga0070710_10163574 Ga0070710_101635741 209
636 3300005439 Ga0070711_100163288 Ga0070711_1001632883 209
637 3300005439 Ga0070711_100275581 Ga0070711_1002755812 209
638 3300005440 Ga0070705_100019590 Ga0070705_1000195904 209
639 3300005445 Ga0070708_100537325 Ga0070708_1005373252 209
640 3300005459 Ga0068867_100063442 Ga0068867_1000634423 209
641 3300005530 Ga0070679_100008233 Ga0070679_1000082334 209
642 3300005530 Ga0070679_100277724 Ga0070679_1002777242 209
643 3300005545 Ga0070695_100005497 Ga0070695_1000054972 209
644 3300005549 Ga0070704_100184039 Ga0070704_1001840392 209
645 3300005614 Ga0068856_100533276 Ga0068856_1005332762 209
646 3300005618 Ga0068864_100849106 Ga0068864_1008491062 209
647 3300005841 Ga0068863_100080907 Ga0068863_1000809072 209
648 3300005844 Ga0068862_100933668 Ga0068862_1009336682 209
649 3300005937 Ga0081455_10019458 Ga0081455_100194587 209
650 3300006058 Ga0075432_10010171 Ga0075432_100101712 209
651 3300006173 Ga0070716_100119258 Ga0070716_1001192581 209
652 3300006173 Ga0070716_100165299 Ga0070716_1001652992 209
653 3300006237 Ga0097621_100179521 Ga0097621_1001795213 209
654 3300006358 Ga0068871_100108484 Ga0068871_1001084844 209
655 3300006847 Ga0075431_100056564 Ga0075431_1000565644 209
656 3300006847 Ga0075431_100389701 Ga0075431_1003897012 209
657 3300006871 Ga0075434_100073551 Ga0075434_1000735514 209
658 3300006880 Ga0075429_100033610 Ga0075429_1000336104 209
659 3300006914 Ga0075436_100004626 Ga0075436_1000046265 209
660 3300006914 Ga0075436_100196331 Ga0075436_1001963312 209
661 3300006914 Ga0075436_100403027 Ga0075436_1004030272 209
662 3300007076 Ga0075435_100269005 Ga0075435_1002690052 209
663 3300007265 Ga0099794_10010908 Ga0099794_100109084 209
664 3300007265 Ga0099794_10012586 Ga0099794_100125866 209
665 3300007265 Ga0099794_10174618 Ga0099794_101746181 209
666 3300009011 Ga0105251_10001212 Ga0105251_1000121210 209
667 3300009011 Ga0105251_10090960 Ga0105251_100909601 209
668 3300009093 Ga0105240_10128238 Ga0105240_101282382 209
669 3300009094 Ga0111539_10057327 Ga0111539_100573275 209
670 3300009177 Ga0105248_10386929 Ga0105248_103869292 209
671 3300010375 Ga0105239_11031009 Ga0105239_110310091 209
672 3300013104 Ga0157370_10065396 Ga0157370_100653963 209
673 3300013105 Ga0157369_10746905 Ga0157369_107469051 209
674 3300013105 Ga0157369_10842984 Ga0157369_108429842 209
675 3300013296 Ga0157374_10965470 Ga0157374_109654701 209
676 3300013307 Ga0157372_10031503 Ga0157372_100315032 209
677 3300013307 Ga0157372_10443499 Ga0157372_104434992 209
678 3300013308 Ga0157375_10215999 Ga0157375_102159993 209
679 3300014497 Ga0182008_10002767 Ga0182008_100027677 209
680 3300014497 Ga0182008_10035174 Ga0182008_100351743 209
681 3300014969 Ga0157376_10024125 Ga0157376_100241252 209
682 3300015265 Ga0182005_1009775 Ga0182005_10097752 209
683 3300025735 Ga0207713_1004860 Ga0207713_10048605 209
684 3300025735 Ga0207713_1015261 Ga0207713_10152615 209
685 3300025735 Ga0207713_1079390 Ga0207713_10793902 209
686 3300025913 Ga0207695_10074716 Ga0207695_100747163 209
687 3300025915 Ga0207693_10054236 Ga0207693_100542362 209
688 3300025916 Ga0207663_10246675 Ga0207663_102466751 209
689 3300025917 Ga0207660_10283502 Ga0207660_102835021 209
690 3300025921 Ga0207652_10024823 Ga0207652_100248231 209
691 3300025928 Ga0207700_10124675 Ga0207700_101246752 209
692 3300025931 Ga0207644_10782176 Ga0207644_107821761 209
693 3300025941 Ga0207711_10532147 Ga0207711_105321472 209
694 3300025944 Ga0207661_11226392 Ga0207661_112263921 209
695 3300026023 Ga0207677_10925031 Ga0207677_109250311 209
696 3300026088 Ga0207641_10022316 Ga0207641_100223166 209
697 3300026088 Ga0207641_10305379 Ga0207641_103053792 209
698 3300026095 Ga0207676_10105108 Ga0207676_101051082 209
699 3300026118 Ga0207675_100845108 Ga0207675_1008451082 209
700 3300027907 Ga0207428_10006751 Ga0207428_100067518 209
701 3300027907 Ga0207428_10025467 Ga0207428_100254674 209
702 3300028577 Ga0265318_10069229 Ga0265318_100692292 209
703 3300031235 Ga0265330_10008812 Ga0265330_100088123 209
704 3300031238 Ga0265332_10005649 Ga0265332_100056496 209
705 3300031239 Ga0265328_10009401 Ga0265328_100094014 209
706 3300031711 Ga0265314_10001270 Ga0265314_1000127027 209
707 3300031712 Ga0265342_10007741 Ga0265342_100077418 209
708 3300035111 Ga0373923_0074384 Ga0373923_0074384_119_757 209
709 3300035113 Ga0373936_0209570 Ga0373936_0209570_174_812 209
710 3300035116 Ga0373945_0135547 Ga0373945_0135547_40_678 209
711 3300035170 Ga0373943_0082986 Ga0373943_0082986_337_975 209
712 3300035171 Ga0373946_0096540 Ga0373946_0096540_262_900 209
713 3300035242 Ga0373962_0168887 Ga0373962_0168887_53_694 209
714 3300035692 Ga0373935_0117719 Ga0373935_0117719_413_1057 209
715 3300035725 Ga0373947_0112291 Ga0373947_0112291_439_1077 209
716 3300036401 Ga0373937_0159420 Ga0373937_0159420_151_798 209
717 3300041405 Ga0439438_001492 Ga0439438_001492_8738_9367 209
718 3300041405 Ga0439438_003823 Ga0439438_003823_2257_2886 209
719 3300041405 Ga0439438_023847 Ga0439438_023847_818_1447 209
720 3300041407 Ga0439447_000105 Ga0439447_000105_9243_9872 209
721 3300041411 Ga0439466_0003637 Ga0439466_0003637_1661_2290 209
722 3300041411 Ga0439466_0010505 Ga0439466_0010505_2508_3137 209
723 3300041411 Ga0439466_0094400 Ga0439466_0094400_290_919 209
724 3300041413 Ga0439465_0020468 Ga0439465_0020468_1265_1894 209
725 3300041413 Ga0439465_0096296 Ga0439465_0096296_86_715 209
726 3300042006 Ga0439432_001244 Ga0439432_001244_8099_8728 209
727 3300042006 Ga0439432_007162 Ga0439432_007162_3125_3754 209
728 3300042009 Ga0439451_003335 Ga0439451_003335_380_1009 209
729 3300042009 Ga0439451_037070 Ga0439451_037070_323_952 209
730 3300042009 Ga0439451_051901 Ga0439451_051901_55_684 209
731 3300042010 Ga0439452_018537 Ga0439452_018537_924_1553 209
732 3300042013 Ga0439456_002134 Ga0439456_002134_405_1034 209
733 3300042013 Ga0439456_007138 Ga0439456_007138_1633_2262 209
734 3300042013 Ga0439456_014413 Ga0439456_014413_89_718 209
735 3300042013 Ga0439456_025865 Ga0439456_025865_508_1137 209
736 3300042016 Ga0439463_006472 Ga0439463_006472_1863_2492 209
737 3300042115 Ga0450911_001949 Ga0450911_001949_1908_2537 209
738 3300042115 Ga0450911_002634 Ga0450911_002634_531_1160 209
739 3300042121 Ga0450919_000983 Ga0450919_000983_2601_3230 209
740 3300042124 Ga0450922_004291 Ga0450922_004291_598_1227 209
741 3300042137 Ga0450902_001611 Ga0450902_001611_584_1213 209
742 3300042137 Ga0450902_013595 Ga0450902_013595_205_834 209
743 3300042137 Ga0450902_016670 Ga0450902_016670_329_958 209
744 3300042138 Ga0450903_010294 Ga0450903_010294_179_808 209
745 3300042145 Ga0450906_010651 Ga0450906_010651_1079_1708 209
746 3300042145 Ga0450906_019807 Ga0450906_019807_79_708 209
747 3300042145 Ga0450906_037528 Ga0450906_037528_28_657 209
748 3300042147 Ga0450910_003043 Ga0450910_003043_307_936 209
749 3300042156 Ga0439446_0006756 Ga0439446_0006756_238_867 209
750 3300042184 Ga0450908_000382 Ga0450908_000382_7612_8241 209
751 3300042461 Ga0439460_0001065 Ga0439460_0001065_3901_4530 209
752 3300042461 Ga0439460_0007239 Ga0439460_0007239_1292_1921 209
753 3300042876 Ga0451577_0056502 Ga0451577_0056502_176_805 209
754 3300042993 Ga0439440_0003240 Ga0439440_0003240_1738_2367 209
755 3300045051 Ga0451576_0003712 Ga0451576_0003712_10296_10925 209
756 3300045051 Ga0451576_0069172 Ga0451576_0069172_1472_2101 209
757 3300046452 Ga0495617_024211 Ga0495617_024211_416_1045 209
758 3300046452 Ga0495617_037444 Ga0495617_037444_213_842 209
759 3300046452 Ga0495617_041106 Ga0495617_041106_882_1520 209
760 3300046453 Ga0495627_017242 Ga0495627_017242_1738_2367 209
761 3300046455 Ga0495603_0019806 Ga0495603_0019806_3091_3729 209
762 3300046455 Ga0495603_0024281 Ga0495603_0024281_82_711 209
763 3300046457 Ga0495590_0011474 Ga0495590_0011474_2462_3091 209
764 3300046457 Ga0495590_0013209 Ga0495590_0013209_1576_2205 209
765 3300046457 Ga0495590_0106352 Ga0495590_0106352_289_918 209
766 3300046458 Ga0495591_000194 Ga0495591_000194_26604_27233 209
767 3300046458 Ga0495591_023695 Ga0495591_023695_467_1096 209
768 3300046458 Ga0495591_044038 Ga0495591_044038_593_1222 209
769 3300046458 Ga0495591_056327 Ga0495591_056327_71_709 209
770 3300046459 Ga0495629_0141495 Ga0495629_0141495_211_858 209
771 3300046459 Ga0495629_0156653 Ga0495629_0156653_403_1041 209
772 3300046459 Ga0495629_0409188 Ga0495629_0409188_215_844 209
773 3300046460 Ga0495638_0006291 Ga0495638_0006291_2620_3249 209
774 3300046460 Ga0495638_0010334 Ga0495638_0010334_2590_3219 209
775 3300046460 Ga0495638_0027024 Ga0495638_0027024_2753_3382 209
776 3300046460 Ga0495638_0034295 Ga0495638_0034295_875_1504 209
777 3300046460 Ga0495638_0150042 Ga0495638_0150042_57_686 209
778 3300046461 Ga0495641_0325591 Ga0495641_0325591_12_650 209
779 3300046462 Ga0495651_0168906 Ga0495651_0168906_700_1338 209
780 3300046471 Ga0495650_0002333 Ga0495650_0002333_3743_4372 209
781 3300046471 Ga0495650_0068542 Ga0495650_0068542_308_937 209
782 3300046472 Ga0495580_0000157 Ga0495580_0000157_32542_33174 209
783 3300046473 Ga0495582_0049527 Ga0495582_0049527_223_861 209
784 3300046474 Ga0495605_0101852 Ga0495605_0101852_448_1083 209
785 3300046474 Ga0495605_0142283 Ga0495605_0142283_416_1045 209
786 3300046475 Ga0495639_0020279 Ga0495639_0020279_545_1183 209
787 3300046476 Ga0495662_0288985 Ga0495662_0288985_60_689 209
788 3300046477 Ga0495664_0091467 Ga0495664_0091467_544_1182 209
789 3300046491 Ga0495584_0000774 Ga0495584_0000774_7274_7903 209
790 3300046491 Ga0495584_0001348 Ga0495584_0001348_14049_14678 209
791 3300046491 Ga0495584_0002868 Ga0495584_0002868_8507_9136 209
792 3300046491 Ga0495584_0005468 Ga0495584_0005468_4369_4998 209
793 3300046491 Ga0495584_0018316 Ga0495584_0018316_2403_3041 209
794 3300046491 Ga0495584_0038977 Ga0495584_0038977_1428_2057 209
795 3300046491 Ga0495584_0077882 Ga0495584_0077882_1016_1645 209
796 3300046492 Ga0495585_0027067 Ga0495585_0027067_450_1088 209
797 3300046492 Ga0495585_0142003 Ga0495585_0142003_377_1006 209
798 3300046492 Ga0495585_0333727 Ga0495585_0333727_35_664 209
799 3300046499 Ga0495594_0020262 Ga0495594_0020262_2875_3504 209
800 3300046499 Ga0495594_0241056 Ga0495594_0241056_246_884 209
801 3300046500 Ga0495596_0000142 Ga0495596_0000142_14877_15506 209
802 3300046501 Ga0495607_0015350 Ga0495607_0015350_3226_3864 209
803 3300046501 Ga0495607_0019055 Ga0495607_0019055_2313_2942 209
804 3300046501 Ga0495607_0026409 Ga0495607_0026409_801_1430 209
805 3300046501 Ga0495607_0117204 Ga0495607_0117204_370_999 209
806 3300046506 Ga0495583_0097235 Ga0495583_0097235_152_781 209
807 3300046507 Ga0495606_0006616 Ga0495606_0006616_6604_7233 209
808 3300046512 Ga0495610_0087130 Ga0495610_0087130_53_682 209
809 3300046513 Ga0495616_0020167 Ga0495616_0020167_1026_1655 209
810 3300046513 Ga0495616_0020924 Ga0495616_0020924_727_1356 209
811 3300046513 Ga0495616_0047365 Ga0495616_0047365_1419_2048 209
812 3300046513 Ga0495616_0053390 Ga0495616_0053390_74_703 209
813 3300046514 Ga0495618_0237978 Ga0495618_0237978_124_762 209
814 3300046515 Ga0495620_0019251 Ga0495620_0019251_725_1354 209
815 3300046515 Ga0495620_0138614 Ga0495620_0138614_139_768 209
816 3300046516 Ga0495628_0511648 Ga0495628_0511648_116_754 209
817 3300046517 Ga0495630_0020050 Ga0495630_0020050_1937_2566 209
818 3300046517 Ga0495630_0199360 Ga0495630_0199360_312_950 209
819 3300046518 Ga0495631_0009830 Ga0495631_0009830_448_1077 209
820 3300046518 Ga0495631_0103630 Ga0495631_0103630_256_894 209
821 3300046519 Ga0495632_0002703 Ga0495632_0002703_801_1430 209
822 3300046519 Ga0495632_0019352 Ga0495632_0019352_887_1516 209
823 3300046519 Ga0495632_0057752 Ga0495632_0057752_380_1009 209
824 3300046520 Ga0495637_0001168 Ga0495637_0001168_12717_13346 209
825 3300046520 Ga0495637_0003054 Ga0495637_0003054_7966_8595 209
826 3300046520 Ga0495637_0064527 Ga0495637_0064527_169_807 209
827 3300046520 Ga0495637_0176363 Ga0495637_0176363_94_723 209
828 3300046522 Ga0495643_0013290 Ga0495643_0013290_3976_4605 209
829 3300046522 Ga0495643_0031487 Ga0495643_0031487_961_1590 209
830 3300046523 Ga0495644_0000468 Ga0495644_0000468_8318_8947 209
831 3300046523 Ga0495644_0001015 Ga0495644_0001015_3923_4552 209
832 3300046523 Ga0495644_0007759 Ga0495644_0007759_3058_3696 209
833 3300046524 Ga0495648_0070469 Ga0495648_0070469_1168_1797 209
834 3300046525 Ga0495663_0053033 Ga0495663_0053033_43_681 209
835 3300046526 Ga0495666_0020964 Ga0495666_0020964_1730_2368 209
836 3300046530 Ga0495654_0007825 Ga0495654_0007825_3933_4562 209
837 3300046530 Ga0495654_0008235 Ga0495654_0008235_3404_4033 209
838 3300046530 Ga0495654_0056035 Ga0495654_0056035_327_956 209
839 3300046530 Ga0495654_0101683 Ga0495654_0101683_567_1196 209
840 3300046530 Ga0495654_0177557 Ga0495654_0177557_67_696 209
841 3300046533 Ga0495640_0229015 Ga0495640_0229015_397_1035 209
842 3300046533 Ga0495640_0461363 Ga0495640_0461363_81_710 209
843 3300046537 Ga0495598_0018645 Ga0495598_0018645_880_1527 209
844 3300046537 Ga0495598_0028076 Ga0495598_0028076_192_830 209
845 3300046538 Ga0495609_0050094 Ga0495609_0050094_1096_1734 209
846 3300046539 Ga0495621_0004372 Ga0495621_0004372_3283_3921 209
847 3300046542 Ga0495597_0005357 Ga0495597_0005357_5356_5985 209
848 3300046542 Ga0495597_0026484 Ga0495597_0026484_113_742 209
849 3300046542 Ga0495597_0036119 Ga0495597_0036119_785_1414 209
850 3300046542 Ga0495597_0040991 Ga0495597_0040991_429_1058 209
851 3300046542 Ga0495597_0041134 Ga0495597_0041134_75_704 209
852 3300046542 Ga0495597_0102509 Ga0495597_0102509_508_1137 209
853 3300046558 Ga0495633_0014133 Ga0495633_0014133_2912_3550 209
854 3300046615 Ga0495656_0008898 Ga0495656_0008898_1651_2289 209
855 3300046616 Ga0495668_0001389 Ga0495668_0001389_12508_13137 209
856 3300046642 Ga0495634_0001609 Ga0495634_0001609_13717_14346 209
857 3300046642 Ga0495634_0037009 Ga0495634_0037009_221_865 209
858 3300046642 Ga0495634_0065130 Ga0495634_0065130_671_1309 209
859 3300046648 Ga0495611_0011154 Ga0495611_0011154_1520_2158 209
860 3300046648 Ga0495611_0029179 Ga0495611_0029179_95_724 209
861 3300046660 Ga0495625_0012035 Ga0495625_0012035_2832_3461 209
862 3300046660 Ga0495625_0043899 Ga0495625_0043899_2475_3173 209
863 3300046660 Ga0495625_0427325 Ga0495625_0427325_80_709 209
864 3300046664 Ga0495659_0004708 Ga0495659_0004708_2182_2820 209
865 3300046665 Ga0495661_0028142 Ga0495661_0028142_176_805 209
866 3300046665 Ga0495661_0058863 Ga0495661_0058863_354_983 209
867 3300046665 Ga0495661_0082540 Ga0495661_0082540_298_927 209
868 3300046674 Ga0495588_0048283 Ga0495588_0048283_102_740 209
869 3300046674 Ga0495588_0162337 Ga0495588_0162337_514_1143 209
870 3300046680 Ga0495646_0019757 Ga0495646_0019757_2250_2879 209
871 3300046683 Ga0495658_0030577 Ga0495658_0030577_101_739 209
872 3300046689 Ga0495613_0072681 Ga0495613_0072681_1504_2142 209
873 3300046690 Ga0495624_0081364 Ga0495624_0081364_1315_1953 209
874 3300046691 Ga0495670_0001964 Ga0495670_0001964_2800_3429 209
875 3300046691 Ga0495670_0012957 Ga0495670_0012957_3246_3884 209
876 3300046691 Ga0495670_0109139 Ga0495670_0109139_457_1089 209
877 3300046691 Ga0495670_0327684 Ga0495670_0327684_88_717 209
878 3300046692 Ga0495671_0000472 Ga0495671_0000472_11789_12418 209
879 3300046692 Ga0495671_0001142 Ga0495671_0001142_9826_10455 209
880 3300046692 Ga0495671_0010887 Ga0495671_0010887_3037_3666 209
881 3300046692 Ga0495671_0010924 Ga0495671_0010924_743_1372 209
882 3300046692 Ga0495671_0014858 Ga0495671_0014858_2669_3298 209
883 3300046692 Ga0495671_0017779 Ga0495671_0017779_2484_3113 209
884 3300046692 Ga0495671_0040182 Ga0495671_0040182_1334_1963 209
885 3300046692 Ga0495671_0051855 Ga0495671_0051855_903_1541 209
886 3300046694 Ga0495649_0004589 Ga0495649_0004589_8255_8884 209
887 3300046694 Ga0495649_0010429 Ga0495649_0010429_801_1430 209
888 3300046694 Ga0495649_0163273 Ga0495649_0163273_405_1034 209
889 3300046794 Ga0495589_0021606 Ga0495589_0021606_426_1055 209
890 3300046810 Ga0495660_0035332 Ga0495660_0035332_83_712 209
891 3300046810 Ga0495660_0043942 Ga0495660_0043942_180_809 209
892 3300046810 Ga0495660_0053198 Ga0495660_0053198_442_1071 209
893 3300046810 Ga0495660_0061073 Ga0495660_0061073_1227_1856 209
894 3300046810 Ga0495660_0133395 Ga0495660_0133395_517_1146 209
895 3300047318 Ga0495636_0107089 Ga0495636_0107089_572_1210 209
896 3300047319 Ga0495674_0120020 Ga0495674_0120020_129_773 209
897 3300047319 Ga0495674_0276992 Ga0495674_0276992_410_1048 209
898 3300047320 Ga0495672_0004200 Ga0495672_0004200_2851_3480 209
899 3300047320 Ga0495672_0006384 Ga0495672_0006384_3018_3647 209
900 3300047320 Ga0495672_0037638 Ga0495672_0037638_1967_2596 209
901 3300047320 Ga0495672_0050553 Ga0495672_0050553_1067_1696 209
902 3300047321 Ga0495676_0026342 Ga0495676_0026342_1582_2220 209
903 3300047322 Ga0495680_0328873 Ga0495680_0328873_387_1025 209
904 3300047323 Ga0495683_0000329 Ga0495683_0000329_34981_35610 209
905 3300047323 Ga0495683_0007352 Ga0495683_0007352_4903_5532 209
906 3300047323 Ga0495683_0019704 Ga0495683_0019704_69_698 209
907 3300047323 Ga0495683_0028815 Ga0495683_0028815_811_1440 209
908 3300047469 Ga0495673_0000684 Ga0495673_0000684_24700_25329 209
909 3300047469 Ga0495673_0003103 Ga0495673_0003103_2238_2867 209
910 3300047469 Ga0495673_0015134 Ga0495673_0015134_3072_3701 209
911 3300047469 Ga0495673_0036206 Ga0495673_0036206_220_849 209
912 3300047470 Ga0495681_0000571 Ga0495681_0000571_18845_19474 209
913 3300047470 Ga0495681_0001390 Ga0495681_0001390_13150_13779 209
914 3300047470 Ga0495681_0009001 Ga0495681_0009001_5359_5988 209
915 3300047470 Ga0495681_0014693 Ga0495681_0014693_3441_4070 209
916 3300047470 Ga0495681_0022862 Ga0495681_0022862_348_977 209
917 3300047471 Ga0495684_0118445 Ga0495684_0118445_889_1533 209
918 3300047471 Ga0495684_0485360 Ga0495684_0485360_38_667 209
919 3300047472 Ga0495686_0379704 Ga0495686_0379704_69_698 209
920 3300048091 Ga0495626_0000439 Ga0495626_0000439_14352_14981 209
921 3300048091 Ga0495626_0007916 Ga0495626_0007916_246_875 209
922 3300048091 Ga0495626_0117367 Ga0495626_0117367_338_967 209
923 3300048091 Ga0495626_0209339 Ga0495626_0209339_98_727 209
924 3300048905 Ga0496102_0000837 Ga0496102_0000837_13923_14552 209
925 3300048905 Ga0496102_0562277 Ga0496102_0562277_146_775 209
926 3300048906 Ga0496103_0004343 Ga0496103_0004343_1157_1786 209
927 3300048918 Ga0496115_0071689 Ga0496115_0071689_58_687 209
928 3300048919 Ga0496116_0028779 Ga0496116_0028779_523_1152 209
929 3300048920 Ga0496117_0006279 Ga0496117_0006279_4286_4915 209
930 3300048920 Ga0496117_0151120 Ga0496117_0151120_198_827 209
931 3300048921 Ga0496118_0008651 Ga0496118_0008651_7075_7704 209
932 3300048921 Ga0496118_0051925 Ga0496118_0051925_2462_3091 209
933 3300048924 Ga0496121_0054623 Ga0496121_0054623_1691_2320 209
934 3300048924 Ga0496121_0077684 Ga0496121_0077684_834_1463 209
935 3300048927 Ga0496124_0004885 Ga0496124_0004885_8763_9392 209
936 3300048927 Ga0496124_0078936 Ga0496124_0078936_219_848 209
937 3300048927 Ga0496124_0329738 Ga0496124_0329738_448_1077 209
938 3300049459 Ga0495678_002210 Ga0495678_002210_6819_7448 209
939 3300049459 Ga0495678_007559 Ga0495678_007559_2782_3411 209
940 3300049459 Ga0495678_038216 Ga0495678_038216_146_775 209
941 3300049459 Ga0495678_165543 Ga0495678_165543_35_664 209
942 3300050507 nmdc:mga05p37_49656_c1 nmdc:mga05p37_49656_c1_742_1380 209
943 3300050508 nmdc:mga09592_40616_c1 nmdc:mga09592_40616_c1_865_1503 209
944 3300050509 nmdc:mga0qj67_31004_c1 nmdc:mga0qj67_31004_c1_882_1520 209
945 3300050511 nmdc:mga08y16_1422931_c1 nmdc:mga08y16_1422931_c1_12_641 209
946 3300050511 nmdc:mga08y16_41205_c1 nmdc:mga08y16_41205_c1_2670_3308 209
947 3300050512 nmdc:mga0n895_48212_c1 nmdc:mga0n895_48212_c1_3464_4102 209
948 3300050513 nmdc:mga0rr50_56035_c1 nmdc:mga0rr50_56035_c1_2262_2900 209
949 3300050514 nmdc:mga08x19_161298_c1 nmdc:mga08x19_161298_c1_257_895 209
950 3300050514 nmdc:mga08x19_345160_c1 nmdc:mga08x19_345160_c1_158_820 209
951 3300050514 nmdc:mga08x19_35_c1 nmdc:mga08x19_35_c1_110364_111023 209
952 3300050515 nmdc:mga0a205_37485_c1 nmdc:mga0a205_37485_c1_1352_1990 209
953 3300053077 Ga0495601_0084223 Ga0495601_0084223_683_1321 209
954 3300053077 Ga0495601_0155333 Ga0495601_0155333_230_874 209
955 3300053085 Ga0495619_0111200 Ga0495619_0111200_507_1145 209
956 3300059424 Ga0590075_016342 Ga0590075_016342_565_1197 209
957 iso_pu_bacteria 2643221569 2643862977 209
958 3300005295 Ga0065707_10084390 Ga0065707_100843904 210
959 3300005328 Ga0070676_10026495 Ga0070676_100264953 210
960 3300005330 Ga0070690_100019324 Ga0070690_1000193242 210
961 3300005333 Ga0070677_10014886 Ga0070677_100148862 210
962 3300005334 Ga0068869_100663369 Ga0068869_1006633691 210
963 3300005338 Ga0068868_100010422 Ga0068868_1000104224 210
964 3300005340 Ga0070689_100082145 Ga0070689_1000821454 210
965 3300005343 Ga0070687_100055389 Ga0070687_1000553894 210
966 3300005344 Ga0070661_100211228 Ga0070661_1002112281 210
967 3300005347 Ga0070668_100197166 Ga0070668_1001971664 210
968 3300005353 Ga0070669_100046321 Ga0070669_1000463211 210
969 3300005354 Ga0070675_100013190 Ga0070675_1000131904 210
970 3300005354 Ga0070675_100115194 Ga0070675_1001151943 210
971 3300005355 Ga0070671_100031841 Ga0070671_1000318417 210
972 3300005355 Ga0070671_100048815 Ga0070671_1000488152 210
973 3300005355 Ga0070671_100820947 Ga0070671_1008209471 210
974 3300005356 Ga0070674_100006022 Ga0070674_1000060224 210
975 3300005364 Ga0070673_100043939 Ga0070673_1000439392 210
976 3300005364 Ga0070673_100357816 Ga0070673_1003578162 210
977 3300005365 Ga0070688_100094651 Ga0070688_1000946512 210
978 3300005366 Ga0070659_100104224 Ga0070659_1001042242 210
979 3300005406 Ga0070703_10132783 Ga0070703_101327831 210
980 3300005438 Ga0070701_10024863 Ga0070701_100248631 210
981 3300005438 Ga0070701_10494549 Ga0070701_104945491 210
982 3300005440 Ga0070705_100022328 Ga0070705_1000223283 210
983 3300005440 Ga0070705_100073413 Ga0070705_1000734132 210
984 3300005441 Ga0070700_100024557 Ga0070700_1000245573 210
985 3300005444 Ga0070694_100280065 Ga0070694_1002800651 210
986 3300005456 Ga0070678_100236989 Ga0070678_1002369892 210
987 3300005457 Ga0070662_100009224 Ga0070662_1000092246 210
988 3300005459 Ga0068867_100057704 Ga0068867_1000577042 210
989 3300005466 Ga0070685_10036395 Ga0070685_100363953 210
990 3300005467 Ga0070706_100027600 Ga0070706_1000276002 210
991 3300005468 Ga0070707_100037786 Ga0070707_1000377864 210
992 3300005468 Ga0070707_100308809 Ga0070707_1003088091 210
993 3300005471 Ga0070698_100039164 Ga0070698_1000391647 210
994 3300005471 Ga0070698_100215957 Ga0070698_1002159572 210
995 3300005471 Ga0070698_100366152 Ga0070698_1003661521 210
996 3300005518 Ga0070699_100053171 Ga0070699_1000531713 210
997 3300005518 Ga0070699_100463321 Ga0070699_1004633212 210
998 3300005536 Ga0070697_100542453 Ga0070697_1005424531 210
999 3300005543 Ga0070672_100001272 Ga0070672_1000012722 210
1000 3300005543 Ga0070672_100018421 Ga0070672_1000184215 210
1001 3300005544 Ga0070686_100013198 Ga0070686_1000131985 210
1002 3300005545 Ga0070695_100109814 Ga0070695_1001098142 210
1003 3300005546 Ga0070696_100408956 Ga0070696_1004089562 210
1004 3300005548 Ga0070665_100025093 Ga0070665_1000250937 210
1005 3300005548 Ga0070665_100188230 Ga0070665_1001882304 210
1006 3300005578 Ga0068854_100069210 Ga0068854_1000692102 210
1007 3300005615 Ga0070702_100033364 Ga0070702_1000333641 210
1008 3300005616 Ga0068852_100266552 Ga0068852_1002665522 210
1009 3300005617 Ga0068859_100030341 Ga0068859_1000303413 210
1010 3300005718 Ga0068866_10036933 Ga0068866_100369334 210
1011 3300005841 Ga0068863_100081515 Ga0068863_1000815154 210
1012 3300005841 Ga0068863_100232165 Ga0068863_1002321651 210
1013 3300005842 Ga0068858_100065254 Ga0068858_1000652542 210
1014 3300005843 Ga0068860_100065276 Ga0068860_1000652762 210
1015 3300005843 Ga0068860_100833222 Ga0068860_1008332221 210
1016 3300005844 Ga0068862_100047828 Ga0068862_1000478282 210
1017 3300005844 Ga0068862_100224879 Ga0068862_1002248792 210
1018 3300005937 Ga0081455_10005916 Ga0081455_100059163 210
1019 3300005937 Ga0081455_10047557 Ga0081455_100475575 210
1020 3300005983 Ga0081540_1023860 Ga0081540_10238604 210
1021 3300006173 Ga0070716_100240273 Ga0070716_1002402732 210
1022 3300006237 Ga0097621_100024206 Ga0097621_1000242061 210
1023 3300006881 Ga0068865_100006542 Ga0068865_1000065426 210
1024 3300006881 Ga0068865_100210426 Ga0068865_1002104262 210
1025 3300006914 Ga0075436_100187069 Ga0075436_1001870692 210
1026 3300006931 Ga0097620_100030340 Ga0097620_1000303407 210
1027 3300009094 Ga0111539_10366814 Ga0111539_103668142 210
1028 3300009098 Ga0105245_10011365 Ga0105245_100113658 210
1029 3300009101 Ga0105247_10054226 Ga0105247_100542262 210
1030 3300009148 Ga0105243_10033209 Ga0105243_100332093 210
1031 3300009176 Ga0105242_10014872 Ga0105242_100148724 210
1032 3300009176 Ga0105242_10514668 Ga0105242_105146682 210
1033 3300009177 Ga0105248_10055005 Ga0105248_100550055 210
1034 3300009177 Ga0105248_10070296 Ga0105248_100702966 210
1035 3300009553 Ga0105249_10014543 Ga0105249_100145432 210
1036 3300009553 Ga0105249_10608032 Ga0105249_106080321 210
1037 3300013296 Ga0157374_10049694 Ga0157374_100496945 210
1038 3300013297 Ga0157378_10046058 Ga0157378_100460582 210
1039 3300013306 Ga0163162_10021024 Ga0163162_100210248 210
1040 3300013306 Ga0163162_10063090 Ga0163162_100630901 210
1041 3300013306 Ga0163162_10195538 Ga0163162_101955381 210
1042 3300013308 Ga0157375_10036284 Ga0157375_100362844 210
1043 3300014325 Ga0163163_10124024 Ga0163163_101240245 210
1044 3300014326 Ga0157380_10056047 Ga0157380_100560473 210
1045 3300014968 Ga0157379_10021816 Ga0157379_100218161 210
1046 3300017792 Ga0163161_10018858 Ga0163161_100188584 210
1047 3300025271 Ga0207666_1008649 Ga0207666_10086492 210
1048 3300025893 Ga0207682_10001025 Ga0207682_100010259 210
1049 3300025901 Ga0207688_10003169 Ga0207688_100031695 210
1050 3300025903 Ga0207680_10049824 Ga0207680_100498242 210
1051 3300025907 Ga0207645_10003583 Ga0207645_100035833 210
1052 3300025908 Ga0207643_10002409 Ga0207643_100024097 210
1053 3300025908 Ga0207643_10088070 Ga0207643_100880702 210
1054 3300025910 Ga0207684_10162658 Ga0207684_101626582 210
1055 3300025916 Ga0207663_10367264 Ga0207663_103672642 210
1056 3300025918 Ga0207662_10004161 Ga0207662_100041611 210
1057 3300025922 Ga0207646_10029939 Ga0207646_100299392 210
1058 3300025922 Ga0207646_10257118 Ga0207646_102571182 210
1059 3300025923 Ga0207681_10006962 Ga0207681_100069625 210
1060 3300025923 Ga0207681_10040738 Ga0207681_100407384 210
1061 3300025925 Ga0207650_10018357 Ga0207650_100183573 210
1062 3300025925 Ga0207650_10111526 Ga0207650_101115261 210
1063 3300025925 Ga0207650_10714599 Ga0207650_107145991 210
1064 3300025926 Ga0207659_10035166 Ga0207659_100351662 210
1065 3300025926 Ga0207659_10043726 Ga0207659_100437262 210
1066 3300025927 Ga0207687_10146702 Ga0207687_101467021 210
1067 3300025931 Ga0207644_10047864 Ga0207644_100478643 210
1068 3300025931 Ga0207644_10105804 Ga0207644_101058042 210
1069 3300025931 Ga0207644_10119497 Ga0207644_101194974 210
1070 3300025932 Ga0207690_10097638 Ga0207690_100976382 210
1071 3300025933 Ga0207706_10016249 Ga0207706_100162496 210
1072 3300025933 Ga0207706_10027272 Ga0207706_100272723 210
1073 3300025934 Ga0207686_10055859 Ga0207686_100558593 210
1074 3300025935 Ga0207709_10179171 Ga0207709_101791712 210
1075 3300025936 Ga0207670_10024309 Ga0207670_100243096 210
1076 3300025938 Ga0207704_10073124 Ga0207704_100731242 210
1077 3300025938 Ga0207704_10151871 Ga0207704_101518711 210
1078 3300025940 Ga0207691_10001198 Ga0207691_1000119810 210
1079 3300025942 Ga0207689_10023429 Ga0207689_100234295 210
1080 3300025960 Ga0207651_10221879 Ga0207651_102218793 210
1081 3300025960 Ga0207651_10376413 Ga0207651_103764132 210
1082 3300025961 Ga0207712_10085661 Ga0207712_100856611 210
1083 3300025972 Ga0207668_10067082 Ga0207668_100670821 210
1084 3300025986 Ga0207658_10113071 Ga0207658_101130711 210
1085 3300026023 Ga0207677_10223930 Ga0207677_102239301 210
1086 3300026035 Ga0207703_10169868 Ga0207703_101698684 210
1087 3300026075 Ga0207708_10006559 Ga0207708_100065594 210
1088 3300026095 Ga0207676_10046220 Ga0207676_100462203 210
1089 3300026118 Ga0207675_100006074 Ga0207675_1000060743 210
1090 3300026121 Ga0207683_10009783 Ga0207683_100097834 210
1091 3300026121 Ga0207683_10265192 Ga0207683_102651922 210
1092 3300028379 Ga0268266_10056127 Ga0268266_100561271 210
1093 3300028380 Ga0268265_10163484 Ga0268265_101634841 210
1094 3300028381 Ga0268264_10169576 Ga0268264_101695764 210
1095 3300028381 Ga0268264_10555657 Ga0268264_105556571 210
1096 3300031090 Ga0265760_10102095 Ga0265760_101020952 210
1097 3300035117 Ga0373953_0148278 Ga0373953_0148278_60_713 210
1098 3300035118 Ga0373954_0218060 Ga0373954_0218060_26_658 210
1099 3300035695 Ga0373927_0139214 Ga0373927_0139214_331_987 210
1100 3300035724 Ga0373933_0090603 Ga0373933_0090603_1056_1697 210
1101 3300035724 Ga0373933_0162421 Ga0373933_0162421_286_939 210
1102 3300035724 Ga0373933_0518679 Ga0373933_0518679_39_671 210
1103 3300036401 Ga0373937_0063706 Ga0373937_0063706_933_1586 210
1104 3300036401 Ga0373937_0137131 Ga0373937_0137131_1116_1748 210
1105 3300041496 Ga0451839_0934718 Ga0451839_0934718_70_717 210
1106 3300044673 Ga0453683_0000623 Ga0453683_0000623_16682_17314 210
1107 3300044712 Ga0453684_0060792 Ga0453684_0060792_2465_3097 210
1108 3300046452 Ga0495617_094802 Ga0495617_094802_278_913 210
1109 3300046454 Ga0495592_0021167 Ga0495592_0021167_1444_2214 210
1110 3300046471 Ga0495650_0034994 Ga0495650_0034994_188_823 210
1111 3300046472 Ga0495580_0123458 Ga0495580_0123458_1106_1738 210
1112 3300046474 Ga0495605_0145495 Ga0495605_0145495_293_928 210
1113 3300046507 Ga0495606_0006667 Ga0495606_0006667_8489_9124 210
1114 3300046511 Ga0495608_0057618 Ga0495608_0057618_460_1230 210
1115 3300046512 Ga0495610_0004766 Ga0495610_0004766_2166_2801 210
1116 3300046515 Ga0495620_0002433 Ga0495620_0002433_8922_9557 210
1117 3300046518 Ga0495631_0185240 Ga0495631_0185240_76_711 210
1118 3300046519 Ga0495632_0003386 Ga0495632_0003386_10601_11236 210
1119 3300046520 Ga0495637_0033297 Ga0495637_0033297_1418_2053 210
1120 3300046524 Ga0495648_0011641 Ga0495648_0011641_4261_4896 210
1121 3300046529 Ga0495652_0031385 Ga0495652_0031385_1347_1994 210
1122 3300046531 Ga0495665_0196999 Ga0495665_0196999_14_784 210
1123 3300046533 Ga0495640_0025477 Ga0495640_0025477_2900_3670 210
1124 3300046537 Ga0495598_0167395 Ga0495598_0167395_82_723 210
1125 3300046543 Ga0495645_0184950 Ga0495645_0184950_375_1022 210
1126 3300046660 Ga0495625_0018672 Ga0495625_0018672_1716_2351 210
1127 3300046663 Ga0495635_0112379 Ga0495635_0112379_1170_1817 210
1128 3300046665 Ga0495661_0010360 Ga0495661_0010360_3501_4136 210
1129 3300046678 Ga0495599_0155072 Ga0495599_0155072_446_1216 210
1130 3300046683 Ga0495658_0096942 Ga0495658_0096942_968_1621 210
1131 3300046683 Ga0495658_0272888 Ga0495658_0272888_14_655 210
1132 3300046691 Ga0495670_0128649 Ga0495670_0128649_644_1279 210
1133 3300046694 Ga0495649_0043315 Ga0495649_0043315_1419_2054 210
1134 3300047319 Ga0495674_0014128 Ga0495674_0014128_2041_2811 210
1135 3300047321 Ga0495676_0028518 Ga0495676_0028518_2408_3178 210
1136 3300047446 Ga0495679_013688 Ga0495679_013688_944_1579 210
1137 3300047469 Ga0495673_0008822 Ga0495673_0008822_3275_3910 210
1138 3300047470 Ga0495681_0017362 Ga0495681_0017362_2841_3476 210
1139 3300047471 Ga0495684_0138874 Ga0495684_0138874_1068_1715 210
1140 3300048091 Ga0495626_0000510 Ga0495626_0000510_34921_35556 210
1141 3300048904 Ga0496101_0079623 Ga0496101_0079623_1031_1669 210
1142 3300048906 Ga0496103_0547401 Ga0496103_0547401_82_714 210
1143 3300048907 Ga0496104_0005082 Ga0496104_0005082_6346_6978 210
1144 3300048911 Ga0496108_0436198 Ga0496108_0436198_343_984 210
1145 3300048914 Ga0496111_0692311 Ga0496111_0692311_72_704 210
1146 3300048916 Ga0496113_0502051 Ga0496113_0502051_188_820 210
1147 3300048917 Ga0496114_0772617 Ga0496114_0772617_103_744 210
1148 3300048918 Ga0496115_0154878 Ga0496115_0154878_135_767 210
1149 3300049571 Ga0501034_0801201 Ga0501034_0801201_38_679 210
1150 3300049573 Ga0501037_0117428 Ga0501037_0117428_1128_1778 210
1151 3300049587 Ga0501071_0182209 Ga0501071_0182209_585_1217 210
1152 3300050512 nmdc:mga0n895_209223_c1 nmdc:mga0n895_209223_c1_1173_1844 210
1153 3300050515 nmdc:mga0a205_844721_c1 nmdc:mga0a205_844721_c1_66_737 210
1154 3300053083 Ga0495655_0178544 Ga0495655_0178544_24_656 210
1155 3300053085 Ga0495619_0153905 Ga0495619_0153905_813_1454 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

54

143

0.97

PF08241

Methyltransf_11

Methyltransferase domain

55

147

0.96

PF08242

Methyltransf_12

Methyltransferase domain

55

145

0.94

PF13847

Methyltransf_31

Methyltransferase domain

49

179

0.83

PF13489

Methyltransf_23

Methyltransferase domain

27

186

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e23-assembly1.cif.gz_A crystal structure of the rpa2492 protein in complex with sam from rhodopseudomonas palustris, northeast structural genomics consortium target rpr299 0.8545 13 208
2ex4-assembly1.cif.gz_B crystal structure of human methyltransferase ad-003 in complex with s-adenosyl-l-homocysteine 0.8508 6 206
3sm3-assembly1.cif.gz_A-2 crystal structure of sam-dependent methyltransferases q8puk2_metma from methanosarcina mazei. northeast structural genomics consortium target mar262. 0.85 43 210
6wh8-assembly1.cif.gz_B the structure of ntmt1 in complex with compound bm-30 0.8475 6 206
3h2b-assembly1.cif.gz_A crystal structure of the sam-dependent methyltransferase cg3271 from corynebacterium glutamicum in complex with s-adenosyl-l-homocysteine and pyrophosphate. northeast structural genomics consortium target cgr113a 0.8456 12 209
ID Description Score Start End Superfamily
af_Q4DGB0_458_609_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8882 65 98 3.40.50.1010
af_A0A1D6QMW6_179_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8807 55 145 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8702 53 100 3.40.50.150
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8671 40 147 3.40.50.150
af_Q9P3E7_8_144_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8632 53 160 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6I1VMB8-F1-model_v4 Methyltransferase domain-containing protein 0.9949 1 209 GO:0008168
GO:0032259
AF-A0A523G3N5-F1-model_v4 Methyltransferase domain-containing protein 0.9943 3 208 GO:0000150
GO:0003677
GO:0008168
GO:0032259
AF-A0A2S6R7N8-F1-model_v4 Methyltransferase domain-containing protein 0.9938 6 207 GO:0008168
GO:0032259
AF-A0A3M6I8Y5-F1-model_v4 Ubiquinone/menaquinone biosynthesis methyltransferase ubie 0.9932 44 208 GO:0008168
GO:0032259
AF-A0A7U7EEM4-F1-model_v4 deleted 0.9922 6 210

Feature Viewer

pLDDT pTM Quality
96.35 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map