F490786

General Info

Members Datasets Scaffolds Average Seq Length
1145 836 2290 250

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2558860983|2561468365
Length 248
Sequence TADFAGAVVAPSPNHGERVECAAPDTIILHYTGMPTEDGAISWLCDLQSEVSSHYVVRGSGEVVQLVPEARRAWHAGKSFWAGATDMNSRSIGIEICNAGHPTLPEYPQAQIEAVIRLCQDCASRWQIRPERVLAHSDVAPVRKVDPGERFPWAVLARNGVGHWVEPGQITGGRFFQRGDCGQPVEALQSMLSLYGYKIEITGEFDDVTEGVLRSFQLHFRQQQVDGIADFSTIDTLHRLLSALPRFA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
55 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
68 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
69 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
70 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
71 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
72 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
73 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
104 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
109 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
119 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
126 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
127 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
130 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
131 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
132 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
133 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
134 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
135 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
136 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
137 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
142 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
143 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
144 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
145 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
161 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
217 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
244 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
245 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
246 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
247 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
248 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
249 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
250 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
251 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
252 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
253 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
254 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
255 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
256 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
257 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
258 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
261 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
264 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
270 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
271 2509276019 Ensifer aridi TW10 Isolate Nodule
272 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
273 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
274 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
275 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
276 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
277 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
278 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
279 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
280 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
281 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
282 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
283 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
284 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
285 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
286 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
287 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
288 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
289 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
290 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
291 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
292 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
293 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
294 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
295 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
296 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
297 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
298 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
299 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
300 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
301 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
302 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
303 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
304 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
305 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
306 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
307 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
308 2516143018 Ensifer sp. BR816 Isolate Nodule
309 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
310 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
311 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
312 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
313 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
314 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
315 2519899620 Rhizobium sp. Pop5 Isolate Nodule
316 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
317 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
318 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
319 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
320 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
321 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
322 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
323 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
324 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
325 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
326 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
327 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
328 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
329 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
330 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
331 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
332 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
333 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
334 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
335 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
336 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
337 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
338 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
339 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
340 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
341 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
342 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
343 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
344 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
345 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
346 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
347 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
348 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
349 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
350 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
351 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
352 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
353 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
354 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
355 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
356 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
357 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
358 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
359 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
360 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
361 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
362 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
363 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
364 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
365 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
366 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
367 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
368 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
369 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
370 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
371 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
372 2643221557 Ensifer sp. Root558 Isolate Unclassified
373 2643221558 Rhizobium sp. Root149 Isolate Unclassified
374 2643221568 Rhizobium sp. Root564 Isolate Unclassified
375 2643221582 Rhizobium sp. Root651 Isolate Unclassified
376 2643221599 Rhizobium sp. Root708 Isolate Unclassified
377 2643221607 Rhizobium sp. Root73 Isolate Unclassified
378 2643221610 Ensifer sp. Root74 Isolate Unclassified
379 2643221618 Ensifer sp. Root231 Isolate Unclassified
380 2643221626 Ensifer sp. Root31 Isolate Unclassified
381 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
382 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
383 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
384 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
385 2643221655 Ensifer sp. Root1252 Isolate Unclassified
386 2643221659 Ensifer sp. Root127 Isolate Unclassified
387 2643221668 Ensifer sp. Root423 Isolate Unclassified
388 2643221675 Ensifer sp. Root1298 Isolate Unclassified
389 2643221680 Ensifer sp. Root1312 Isolate Unclassified
390 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
391 2643221688 Rhizobium sp. Root482 Isolate Unclassified
392 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
393 2643221693 Rhizobium sp. Root491 Isolate Unclassified
394 2643221698 Ensifer sp. Root142 Isolate Unclassified
395 2643221712 Ensifer sp. Root258 Isolate Unclassified
396 2643221719 Rhizobium sp. Root274 Isolate Unclassified
397 2643221723 Ensifer sp. Root278 Isolate Unclassified
398 2643221726 Ensifer sp. Root954 Isolate Unclassified
399 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
400 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
401 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
402 2718217882 Rhizobium sp. N741 Isolate Nodule
403 2718217927 Rhizobium sp. N324 Isolate Nodule
404 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
405 2718218009 Rhizobium sp. N561 Isolate Nodule
406 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
407 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
408 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
409 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
410 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
411 2718218363 Rhizobium sp. N113 Isolate Nodule
412 2718218365 Rhizobium sp. N731 Isolate Nodule
413 2718218366 Rhizobium sp. N621 Isolate Nodule
414 2718218423 Rhizobium sp. N941 Isolate Nodule
415 2721755514 Rhizobium sp. N6212 Isolate Nodule
416 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
417 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
418 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
419 2721755809 Rhizobium sp. N541 Isolate Nodule
420 2721755810 Rhizobium sp. N871 Isolate Nodule
421 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
422 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
423 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
424 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
425 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
426 2728369365 Rhizobium sp. N1341 Isolate Nodule
427 2728369397 Rhizobium sp. N1314 Isolate Nodule
428 2738541293 Rhizobium sp. GV031 Isolate Unclassified
429 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
430 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
431 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
432 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
433 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
434 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
435 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
436 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
437 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
438 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
439 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
440 2791355256 Rhizobium sp. M10 Isolate Nodule
441 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
442 2791355260 Rhizobium sp. L9 Isolate Nodule
443 2791355261 Rhizobium sp. J15 Isolate Nodule
444 2791355262 Rhizobium sp. M1 Isolate Nodule
445 2791355263 Rhizobium chutanense C5 Isolate Nodule
446 2791355264 Rhizobium sp. S9 Isolate Nodule
447 2791355265 Rhizobium sp. H4 Isolate Nodule
448 2791355266 Rhizobium sp. L43 Isolate Nodule
449 2791355267 Rhizobium sp. L18 Isolate Nodule
450 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
451 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
452 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
453 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
454 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
455 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
456 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
457 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
458 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
459 2802429633 Rhizobium anhuiense J3 Isolate Nodule
460 2802429634 Rhizobium anhuiense S10 Isolate Nodule
461 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
462 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
463 2802429637 Rhizobium anhuiense C15 Isolate Nodule
464 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
465 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
466 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
467 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
468 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
469 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
470 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
471 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
472 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
473 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
474 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
475 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
476 2838048938 Rhizobium pisi 27/80 Isolate Nodule
477 2838061910 Rhizobium phaseoli L15 Isolate Nodule
478 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
479 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
480 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
481 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
482 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
483 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
484 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
485 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
486 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
487 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
488 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
489 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
490 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
491 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
492 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
493 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
494 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
495 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
496 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
497 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
498 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
499 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
500 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
501 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
502 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
503 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
504 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
505 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
506 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
507 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
508 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
509 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
510 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
511 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
512 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
513 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
514 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
515 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
516 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
517 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
518 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
519 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
520 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
521 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
522 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
523 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
524 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
525 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
526 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
527 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
528 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
529 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
530 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
531 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
532 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
533 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
534 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
535 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
536 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
537 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
538 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
539 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
540 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
541 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
542 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
543 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
544 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
545 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
546 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
547 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
548 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
549 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
550 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
551 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
552 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
553 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
554 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
555 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
556 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
557 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
558 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
559 2844163670 Ensifer sp. 1H6 Isolate Unclassified
560 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
561 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
562 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
563 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
564 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
565 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
566 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
567 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
568 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
569 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
570 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
571 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
572 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
573 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
574 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
575 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
576 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
577 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
578 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
579 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
580 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
581 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
582 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
583 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
584 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
585 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
586 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
587 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
588 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
589 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
590 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
591 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
592 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
593 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
594 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
595 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
596 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
597 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
598 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
599 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
600 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
601 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
602 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
603 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
604 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
605 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
606 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
607 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
608 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
609 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
610 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
611 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
612 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
613 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
614 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
615 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
616 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
617 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
618 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
619 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
620 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
621 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
622 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
623 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
624 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
625 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
626 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
627 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
628 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
629 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
630 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
631 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
632 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
633 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
634 2933599457 Rhizobium phaseoli M3 Isolate Nodule
635 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
636 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
637 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
638 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
639 2936381700 Rhizobium chutanense C16 Isolate Unclassified
640 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
641 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
642 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
643 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
644 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
645 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
646 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
647 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
648 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
649 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
650 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
651 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
652 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
653 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
654 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
655 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
656 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
657 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
658 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
659 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
660 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
661 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
662 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
663 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
664 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
665 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
666 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
667 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
668 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
669 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
670 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
671 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
672 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
673 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
674 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
675 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
676 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
677 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
678 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
679 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
680 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
681 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
682 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
683 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
684 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
685 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
686 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
687 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
688 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
689 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
690 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
691 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
692 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
693 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
694 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
695 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
696 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
697 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
698 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
699 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
700 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
701 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
702 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
703 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
704 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
705 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
706 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
707 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
708 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
709 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
710 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
711 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
712 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
713 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
714 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
715 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
716 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
717 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
718 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
719 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
720 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
721 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
722 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
723 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
724 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
725 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
726 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
727 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
728 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
729 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
730 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
731 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
732 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
733 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
734 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
735 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
736 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
737 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
738 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
739 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
740 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
741 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
742 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
743 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
744 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
745 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
746 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
747 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
748 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
749 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
750 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
751 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
752 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
753 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
754 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
755 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
756 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
757 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
758 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
759 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
760 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
761 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
762 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
763 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
764 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
765 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
766 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
767 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
768 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
769 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
770 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
771 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
772 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
773 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
774 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
775 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
776 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
777 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
778 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
779 2996887358 Rhizobium sp. R711 Isolate Nodule
780 2996893221 Rhizobium sp. R635 Isolate Nodule
781 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
782 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
783 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
784 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
785 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
786 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
787 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
788 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
789 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
790 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
791 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
792 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
793 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
794 8005258706 Rhizobium sp. R693 Isolate Nodule
795 8005275841 Rhizobium sp. N4311 Isolate Nodule
796 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
797 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
798 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
799 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
800 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
801 8005321885 Rhizobium sp. R72 Isolate Nodule
802 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
803 8005382845 Rhizobium sp. R634 Isolate Nodule
804 8005395548 Rhizobium sp. R339 Isolate Nodule
805 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
806 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
807 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
808 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
809 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
810 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
811 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
812 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
813 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
814 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
815 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
816 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
817 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
818 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
819 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
820 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
821 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
822 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
823 8018176218 Rhizobium sp. N122 Isolate Nodule
824 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
825 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
826 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
827 8024501048 Rhizobium sp. H4 Isolate Nodule
828 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
829 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
830 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
831 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
832 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
833 8056382006 Rhizobium croatiense 13T Isolate Nodule
834 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
835 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
836 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.13
Metatranscriptomes 0.09
Isolates 49.78

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 19.91
Nodule 38.25
Rhizoplane 1.66
Rhizosphere 21.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000015 3300001979 Bacteria 58951
2 JGI25155J39150_1000001 3300002704 Bacteria 354543
3 JGI25156J39149_1000001 3300002705 Bacteria 354557
4 JGI25162J39368_1000366 3300002737 Bacteria 38535
5 JGI25162J39368_1000368 3300002737 Bacteria 38495
6 JGI25154J39366_1000122 3300002738 Bacteria 61892
7 JGI25158J39367_1000038 3300002739 Bacteria 30017
8 JGI25158J39367_1003428 3300002739 Bacteria 2447
9 JGI25157J39369_1000044 3300002741 Bacteria 122466
10 JGI25152J39213_1002709 3300002773 Bacteria 6476
11 JGI25152J39213_1003769 3300002773 Bacteria 5045
12 JGI25152J39213_1006759 3300002773 Bacteria 3053
13 JGI25152J39213_1010922 3300002773 Bacteria 2040
14 JGI25150J39212_1000074 3300002774 Bacteria 60735
15 JGI25159J45721_1000014 3300002987 Bacteria 147809
16 JGI25159J45721_1000424 3300002987 Bacteria 19457
17 JGI25151J46595_10000486 3300003187 Bacteria 37582
18 JGI25151J46595_10001329 3300003187 Bacteria 17282
19 JGI25151J46595_10006888 3300003187 Bacteria 5644
20 JGI25151J46595_10009741 3300003187 Bacteria 4526
21 JGI25151J46595_10021770 3300003187 Bacteria 2675
22 JGI25165J46597_1000516 3300003214 Bacteria 36635
23 JGI25165J46597_1002609 3300003214 Bacteria 5464
24 JGI25165J46597_1004187 3300003214 Bacteria 3195
25 JGI25153J46596_10000267 3300003215 Bacteria 41505
26 JGI25153J46596_10005687 3300003215 Bacteria 6506
27 JGI25153J46596_10014643 3300003215 Bacteria 3247
28 JGI25153J46596_10023825 3300003215 Bacteria 2221
29 JGI25153J46596_10025080 3300003215 Bacteria 2137
30 rootH2_10031784 3300003320 Bacteria 2624
31 rootH2_10038973 3300003320 Bacteria 2003
32 rootH2_10147384 3300003320 Bacteria 4433
33 rootL2_10010590 3300003322 Bacteria 17548
34 rootL2_10031133 3300003322 Bacteria 1989
35 rootL2_10074214 3300003322 Bacteria 3307
36 rootH1_10104560 3300003323 Bacteria 1750
37 rootH1_10118526 3300003323 Bacteria 1948
38 rootH1_10168981 3300003323 Bacteria 3547
39 rootH1_10280001 3300003323 Bacteria 1246
40 JGI25160J50197_1000001 3300003354 Bacteria 782301
41 JGI25160J50197_1000020 3300003354 Bacteria 232739
42 JGI25160J50197_1001033 3300003354 Bacteria 14383
43 JGI25160J50197_1004772 3300003354 Bacteria 5786
44 JGI25160J50197_1015759 3300003354 Bacteria 2467
45 JGI25161J50226_1000001 3300003374 Bacteria 655036
46 JGI25161J50226_1000301 3300003374 Bacteria 27747
47 JGI25161J50226_1001138 3300003374 Bacteria 8895
48 JGI25161J50226_1003662 3300003374 Bacteria 3442
49 Ga0055539_1011212 3300003752 Bacteria 1105
50 Ga0055526_1001900 3300003771 Bacteria 14483
51 Ga0055526_1003283 3300003771 Bacteria 10372
52 Ga0055526_1004831 3300003771 Bacteria 7960
53 Ga0055526_1020732 3300003771 Bacteria 2320
54 Ga0055524_1001431 3300003775 Bacteria 13709
55 Ga0055524_1002290 3300003775 Bacteria 9985
56 Ga0055524_1003478 3300003775 Bacteria 7633
57 Ga0055524_1008231 3300003775 Bacteria 4351
58 Ga0055524_1008366 3300003775 Bacteria 4304
59 Ga0055524_1015935 3300003775 Bacteria 2720
60 Ga0055536_1001187 3300003781 Bacteria 16224
61 Ga0055536_1002960 3300003781 Bacteria 9313
62 Ga0055528_1002428 3300003790 Bacteria 9983
63 Ga0055528_1005294 3300003790 Bacteria 6038
64 Ga0055528_1006853 3300003790 Bacteria 5116
65 Ga0055528_1007628 3300003790 Bacteria 4754
66 Ga0055528_1031518 3300003790 Bacteria 1377
67 Ga0055530_10006221 3300003791 Bacteria 5392
68 Ga0055530_10012273 3300003791 Bacteria 3000
69 Ga0055540_1006139 3300003792 Bacteria 4840
70 Ga0055540_1006965 3300003792 Bacteria 4369
71 Ga0055540_1025456 3300003792 Bacteria 1450
72 Ga0055540_1028089 3300003792 Bacteria 1335
73 Ga0055531_10003157 3300003794 Bacteria 10596
74 Ga0055531_10010496 3300003794 Bacteria 4593
75 Ga0058692_1004699 3300003856 Bacteria 4007
76 Ga0058692_1019319 3300003856 Bacteria 1454
77 Ga0055543_1000003 3300004625 Bacteria 358656
78 Ga0055543_1000047 3300004625 Bacteria 111073
79 Ga0055543_1000355 3300004625 Bacteria 31085
80 Ga0055543_1000776 3300004625 Bacteria 15875
81 Ga0065165_1000013 3300005262 Bacteria 301887
82 Ga0065165_1000068 3300005262 Bacteria 170609
83 Ga0065165_1002171 3300005262 Bacteria 17718
84 Ga0065165_1005897 3300005262 Bacteria 6653
85 Ga0065165_1006326 3300005262 Bacteria 6255
86 Ga0065165_1015698 3300005262 Bacteria 2876
87 Ga0070671_100118406 3300005355 Bacteria 2228
88 Ga0070678_100149984 3300005456 Bacteria 1877
89 Ga0070665_100006919 3300005548 Bacteria 11523
90 Ga0070665_100081111 3300005548 Bacteria 3250
91 Ga0070665_100295842 3300005548 Bacteria 1621
92 Ga0068854_100023445 3300005578 Bacteria 4216
93 Ga0068856_100066004 3300005614 Bacteria 3576
94 Ga0068856_100334254 3300005614 Bacteria 1533
95 Ga0068852_100028039 3300005616 Bacteria 4602
96 Ga0081455_10116383 3300005937 Bacteria 2114
97 Ga0081455_10206596 3300005937 Bacteria 1466
98 Ga0075365_10000068 3300006038 Bacteria 31130
99 Ga0075365_10013565 3300006038 Bacteria 4880
100 Ga0075365_10018782 3300006038 Bacteria 4256
101 Ga0075368_10003730 3300006042 Bacteria 5112
102 Ga0075363_100044018 3300006048 Bacteria 2363
103 Ga0075364_10001683 3300006051 Bacteria 12137
104 Ga0075364_10022616 3300006051 Bacteria 3972
105 Ga0075362_10002960 3300006177 Bacteria 5834
106 Ga0075367_10011208 3300006178 Bacteria 4733
107 Ga0075367_10013202 3300006178 Bacteria 4432
108 Ga0075367_10017830 3300006178 Bacteria 3904
109 Ga0075367_10225134 3300006178 Bacteria 1174
110 Ga0075369_10006620 3300006186 Bacteria 4389
111 Ga0075366_10007565 3300006195 Bacteria 6009
112 Ga0075370_10019522 3300006353 Bacteria 3693
113 Ga0075370_10125023 3300006353 Bacteria 1499
114 Ga0075370_10128388 3300006353 Bacteria 1479
115 Ga0079104_1000193 3300006946 Bacteria 85489
116 Ga0079104_1002321 3300006946 Bacteria 10454
117 Ga0079104_1015306 3300006946 Bacteria 2277
118 Ga0099826_10002145 3300006948 Bacteria 12541
119 Ga0105251_10029595 3300009011 Bacteria 2757
120 Ga0105244_10032457 3300009036 Bacteria 2763
121 Ga0105244_10062358 3300009036 Bacteria 1874
122 Ga0105240_10000076 3300009093 Bacteria 198848
123 Ga0105243_10041164 3300009148 Bacteria 3613
124 Ga0105248_10151986 3300009177 Bacteria 2612
125 Ga0105237_10000226 3300009545 Bacteria 79798
126 Ga0123341_1000007 3300009765 Bacteria 147072
127 Ga0123342_1004784 3300009766 Bacteria 20320
128 Ga0123342_1008862 3300009766 Bacteria 12394
129 Ga0105239_10051366 3300010375 Bacteria 4519
130 Ga0157322_1000291 3300012490 Bacteria 1655
131 Ga0157373_10006018 3300013100 Bacteria 9071
132 Ga0157373_10036348 3300013100 Bacteria 3535
133 Ga0157371_10000017 3300013102 Bacteria 320830
134 Ga0157370_10000455 3300013104 Bacteria 51231
135 Ga0157370_10000461 3300013104 Bacteria 50850
136 Ga0157369_10036064 3300013105 Bacteria 5421
137 Ga0157369_10040941 3300013105 Bacteria 5057
138 Ga0171463_1003 3300013249 Bacteria 695693
139 Ga0157378_10533226 3300013297 Bacteria 1177
140 Ga0163163_10453124 3300014325 Bacteria 1343
141 Ga0182008_10035774 3300014497 Bacteria 2485
142 Ga0182007_10004725 3300015262 Bacteria 6127
143 Ga0183363_1156 3300015690 Bacteria 16690
144 Ga0214542_1027627 3300021321 Bacteria 2571
145 Ga0214543_1000038 3300021327 Bacteria 182106
146 Ga0228711_1000008 3300022739 Bacteria 169893
147 Ga0228710_1000009 3300022740 Bacteria 169770
148 Ga0209435_100012 3300025206 Bacteria 401621
149 Ga0209436_100150 3300025208 Bacteria 33510
150 Ga0209436_100915 3300025208 Bacteria 11678
151 Ga0209436_105064 3300025208 Bacteria 3110
152 Ga0209437_100051 3300025233 Bacteria 392523
153 Ga0209437_100098 3300025233 Bacteria 229766
154 Ga0207425_1000075 3300025245 Bacteria 107452
155 Ga0207425_1001161 3300025245 Bacteria 11793
156 Ga0207425_1004045 3300025245 Bacteria 4496
157 Ga0207425_1005962 3300025245 Bacteria 3399
158 Ga0207425_1011323 3300025245 Bacteria 2133
159 Ga0209646_1000026 3300025246 Bacteria 401621
160 Ga0209026_1000014 3300025250 Bacteria 401621
161 Ga0209677_101343 3300025253 Bacteria 10810
162 Ga0209759_1000012 3300025256 Bacteria 401621
163 Ga0209129_1000156 3300025258 Bacteria 107484
164 Ga0209129_1000218 3300025258 Bacteria 66076
165 Ga0209129_1001121 3300025258 Bacteria 15560
166 Ga0209129_1006883 3300025258 Bacteria 3538
167 Ga0209129_1007345 3300025258 Bacteria 3306
168 Ga0209129_1011154 3300025258 Bacteria 2169
169 Ga0209233_1000095 3300025261 Bacteria 303783
170 Ga0209233_1000113 3300025261 Bacteria 253455
171 Ga0209233_1000148 3300025261 Bacteria 185135
172 Ga0209455_1026145 3300025272 Bacteria 1051
173 Ga0209673_1000010 3300025273 Bacteria 596656
174 Ga0209673_1000117 3300025273 Bacteria 172081
175 Ga0209673_1000151 3300025273 Bacteria 148103
176 Ga0209673_1003130 3300025273 Bacteria 10109
177 Ga0209673_1010663 3300025273 Bacteria 3852
178 Ga0209673_1011080 3300025273 Bacteria 3747
179 Ga0209673_1016282 3300025273 Bacteria 2787
180 Ga0209130_1000003 3300025284 Bacteria 677988
181 Ga0209130_1000020 3300025284 Bacteria 379297
182 Ga0209130_1000034 3300025284 Bacteria 302439
183 Ga0209130_1009757 3300025284 Bacteria 2705
184 Ga0209130_1024847 3300025284 Bacteria 1304
185 Ga0209676_1000482 3300025292 Bacteria 65372
186 Ga0209676_1004918 3300025292 Bacteria 7193
187 Ga0209676_1011536 3300025292 Bacteria 3554
188 Ga0209025_1000070 3300025294 Bacteria 287776
189 Ga0209025_1000140 3300025294 Bacteria 184765
190 Ga0209025_1000314 3300025294 Bacteria 107720
191 Ga0209025_1000571 3300025294 Bacteria 66955
192 Ga0209025_1006423 3300025294 Bacteria 9128
193 Ga0209025_1008410 3300025294 Bacteria 7434
194 Ga0209025_1016283 3300025294 Bacteria 4403
195 Ga0209025_1017662 3300025294 Bacteria 4099
196 Ga0209025_1022956 3300025294 Bacteria 3285
197 Ga0209025_1046962 3300025294 Bacteria 1769
198 Ga0209564_1000013 3300025295 Bacteria 775755
199 Ga0209564_1000386 3300025295 Bacteria 79939
200 Ga0209564_1000424 3300025295 Bacteria 74299
201 Ga0209564_1000647 3300025295 Bacteria 52658
202 Ga0209564_1011426 3300025295 Bacteria 3979
203 Ga0209564_1013617 3300025295 Bacteria 3435
204 Ga0209564_1023691 3300025295 Bacteria 2122
205 Ga0209758_1000094 3300025297 Bacteria 241068
206 Ga0209758_1000405 3300025297 Bacteria 73971
207 Ga0209758_1000413 3300025297 Bacteria 72744
208 Ga0209758_1001750 3300025297 Bacteria 24144
209 Ga0209758_1002998 3300025297 Bacteria 16172
210 Ga0209758_1013575 3300025297 Bacteria 4426
211 Ga0209758_1028856 3300025297 Bacteria 2336
212 Ga0209758_1031578 3300025297 Bacteria 2169
213 Ga0209758_1031598 3300025297 Bacteria 2169
214 Ga0209050_1000646 3300025298 Bacteria 54050
215 Ga0209050_1005849 3300025298 Bacteria 7535
216 Ga0209050_1006458 3300025298 Bacteria 6933
217 Ga0209256_1000396 3300025299 Bacteria 69216
218 Ga0209256_1001575 3300025299 Bacteria 22398
219 Ga0209256_1001585 3300025299 Bacteria 22292
220 Ga0209256_1001653 3300025299 Bacteria 21690
221 Ga0209256_1001736 3300025299 Bacteria 20844
222 Ga0209256_1002474 3300025299 Bacteria 14990
223 Ga0209256_1007740 3300025299 Bacteria 5202
224 Ga0209256_1008167 3300025299 Bacteria 4919
225 Ga0207426_1000006 3300025302 Bacteria 1025969
226 Ga0207426_1000008 3300025302 Bacteria 848730
227 Ga0207426_1000011 3300025302 Bacteria 791203
228 Ga0207426_1000449 3300025302 Bacteria 65802
229 Ga0207426_1000869 3300025302 Bacteria 31530
230 Ga0209051_1000097 3300025303 Bacteria 167378
231 Ga0209051_1000314 3300025303 Bacteria 74316
232 Ga0209051_1001414 3300025303 Bacteria 20618
233 Ga0209051_1003601 3300025303 Bacteria 10067
234 Ga0209051_1003927 3300025303 Bacteria 9473
235 Ga0209051_1010049 3300025303 Bacteria 4817
236 Ga0209051_1011123 3300025303 Bacteria 4471
237 Ga0209257_1003315 3300025304 Bacteria 13958
238 Ga0209257_1005890 3300025304 Bacteria 8260
239 Ga0209257_1007337 3300025304 Bacteria 6685
240 Ga0209257_1019303 3300025304 Bacteria 2574
241 Ga0209257_1026874 3300025304 Bacteria 1928
242 Ga0207695_10000011 3300025913 Bacteria 910221
243 Ga0207671_10000093 3300025914 Bacteria 138939
244 Ga0207650_10000837 3300025925 Bacteria 23356
245 Ga0207644_10214473 3300025931 Bacteria 1523
246 Ga0207709_10071991 3300025935 Bacteria 2197
247 Ga0207667_10056825 3300025949 Bacteria 4109
248 Ga0207640_10065727 3300025981 Bacteria 2421
249 Ga0207702_10115084 3300026078 Bacteria 2398
250 Ga0207698_10014845 3300026142 Bacteria 5192
251 Ga0209281_1000034 3300027111 Bacteria 382562
252 Ga0209281_1000106 3300027111 Bacteria 219666
253 Ga0209281_1000318 3300027111 Bacteria 85039
254 Ga0209371_1000022 3300027312 Bacteria 536342
255 Ga0209371_1002282 3300027312 Bacteria 10948
256 Ga0209371_1004346 3300027312 Bacteria 6228
257 Ga0209282_1000024 3300027666 Bacteria 170348
258 Ga0209282_1000628 3300027666 Bacteria 17386
259 Ga0268266_10005370 3300028379 Bacteria 11974
260 Ga0268266_10096739 3300028379 Bacteria 2596
261 Ga0268266_10128793 3300028379 Bacteria 2262
262 Ga0268266_10317276 3300028379 Bacteria 1458
263 Ga0307515_10001559 3300028794 Bacteria 51153
264 Ga0307515_10001978 3300028794 Bacteria 45366
265 Ga0307515_10015685 3300028794 Bacteria 13943
266 Ga0307515_10066747 3300028794 Bacteria 4977
267 Ga0268256_1000019 3300030500 Bacteria 587949
268 Ga0268256_1006518 3300030500 Bacteria 4321
269 Ga0316181_1142512 3300030744 Bacteria 2563
270 Ga0307513_10014518 3300031456 Bacteria 9601
271 Ga0307513_10026616 3300031456 Bacteria 6664
272 Ga0307408_100181232 3300031548 Bacteria 1689
273 Ga0307516_10269110 3300031730 Bacteria 1391
274 Ga0307406_10084862 3300031901 Bacteria 2116
275 Ga0307412_10000493 3300031911 Bacteria 23544
276 Ga0307412_10137209 3300031911 Bacteria 1786
277 Ga0315914_1000012 3300031967 Bacteria 169896
278 Ga0307416_101135659 3300032002 Bacteria 886
279 Ga0307414_10108275 3300032004 Bacteria 2108
280 Ga0315913_1000006 3300033430 Bacteria 169893
281 Ga0315915_1000010 3300033464 Bacteria 240214
282 Ga0373946_0158060 3300035171 Bacteria 1062
283 Ga0373927_0000350 3300035695 Bacteria 36173
284 Ga0373925_0001916 3300037068 Bacteria 17236
285 Ga0395905_0005044 3300037471 Bacteria 13597
286 Ga0395905_0007902 3300037471 Bacteria 10522
287 Ga0436363_0187511 3300039450 Bacteria 2091
288 Ga0439436_0000496 3300041404 Bacteria 10234
289 Ga0439439_0031232 3300041406 Bacteria 1356
290 Ga0439439_0036802 3300041406 Bacteria 1260
291 Ga0439466_0090018 3300041411 Bacteria 962
292 Ga0439465_0030157 3300041413 Bacteria 1724
293 Ga0439465_0062304 3300041413 Bacteria 1237
294 Ga0451787_403588 3300041441 Bacteria 917
295 Ga0451833_1206493 3300041491 Bacteria 1400
296 Ga0451833_1241071 3300041491 Bacteria 1682
297 Ga0451835_0051667 3300041492 Bacteria 787
298 Ga0451835_0594400 3300041492 Bacteria 4209
299 Ga0451837_0397796 3300041494 Bacteria 1554
300 Ga0451837_0670375 3300041494 Bacteria 791
301 Ga0451839_0280741 3300041496 Bacteria 964
302 Ga0451841_1352391 3300041498 Bacteria 805
303 Ga0451846_20130 3300041502 Bacteria 946
304 Ga0451847_0915316 3300041503 Bacteria 781
305 Ga0451849_0974996 3300041505 Bacteria 2358
306 Ga0451853_3570678 3300041512 Bacteria 3641
307 Ga0439432_018691 3300042006 Bacteria 2314
308 Ga0439449_0062011 3300042007 Bacteria 1380
309 Ga0439449_0097640 3300042007 Bacteria 1085
310 Ga0439457_041727 3300042014 Bacteria 1023
311 Ga0439462_0008309 3300042015 Bacteria 2613
312 Ga0450906_002279 3300042145 Bacteria 4200
313 Ga0450910_002846 3300042147 Bacteria 2279
314 Ga0450918_001837 3300042531 Bacteria 4130
315 Ga0466965_0030633 3300044683 Bacteria 2622
316 Ga0466963_0003125 3300044694 Bacteria 9388
317 Ga0466970_0001301 3300044765 Bacteria 12082
318 Ga0466957_0003335 3300044842 Bacteria 8803
319 Ga0466959_0092405 3300045049 Bacteria 2172
320 Ga0466958_0028346 3300045836 Bacteria 3320
321 Ga0495592_0168287 3300046454 Bacteria 1502
322 Ga0495629_0033992 3300046459 Bacteria 3606
323 Ga0495638_0001181 3300046460 Bacteria 25058
324 Ga0495638_0014328 3300046460 Bacteria 5365
325 Ga0495650_0121724 3300046471 Bacteria 960
326 Ga0495605_0001874 3300046474 Bacteria 13445
327 Ga0495605_0043149 3300046474 Bacteria 2237
328 Ga0495639_0089446 3300046475 Bacteria 1443
329 Ga0495662_0028272 3300046476 Bacteria 2707
330 Ga0495585_0008307 3300046492 Bacteria 6300
331 Ga0495585_0097611 3300046492 Bacteria 1575
332 Ga0495596_0030183 3300046500 Bacteria 2171
333 Ga0495607_0138267 3300046501 Bacteria 1259
334 Ga0495583_0007463 3300046506 Bacteria 6858
335 Ga0495583_0037130 3300046506 Bacteria 2312
336 Ga0495606_0002324 3300046507 Bacteria 22407
337 Ga0495606_0008541 3300046507 Bacteria 8871
338 Ga0495606_0041164 3300046507 Bacteria 3100
339 Ga0495606_0052945 3300046507 Bacteria 2636
340 Ga0495606_0120941 3300046507 Bacteria 1567
341 Ga0495606_0129718 3300046507 Bacteria 1500
342 Ga0495610_0003066 3300046512 Bacteria 13350
343 Ga0495610_0019089 3300046512 Bacteria 3847
344 Ga0495610_0084790 3300046512 Bacteria 1447
345 Ga0495616_0010551 3300046513 Bacteria 5342
346 Ga0495618_0176205 3300046514 Bacteria 1360
347 Ga0495620_0006225 3300046515 Bacteria 6572
348 Ga0495620_0043787 3300046515 Bacteria 1949
349 Ga0495628_0332654 3300046516 Bacteria 1119
350 Ga0495631_0000327 3300046518 Bacteria 32708
351 Ga0495631_0033626 3300046518 Bacteria 2302
352 Ga0495632_0002058 3300046519 Bacteria 15803
353 Ga0495632_0005265 3300046519 Bacteria 8596
354 Ga0495632_0012672 3300046519 Bacteria 4849
355 Ga0495632_0189031 3300046519 Bacteria 941
356 Ga0495643_0002802 3300046522 Bacteria 13314
357 Ga0495648_0057050 3300046524 Bacteria 2345
358 Ga0495648_0068321 3300046524 Bacteria 2074
359 Ga0495652_0098135 3300046529 Bacteria 2382
360 Ga0495654_0000110 3300046530 Bacteria 93042
361 Ga0495654_0095491 3300046530 Bacteria 1374
362 Ga0495654_0236177 3300046530 Bacteria 767
363 Ga0495587_0045585 3300046536 Bacteria 2606
364 Ga0495609_0047436 3300046538 Bacteria 1922
365 Ga0495622_0023041 3300046557 Bacteria 2902
366 Ga0495668_0001961 3300046616 Bacteria 18215
367 Ga0495668_0012334 3300046616 Bacteria 5070
368 Ga0495634_0118027 3300046642 Bacteria 1701
369 Ga0495611_0002327 3300046648 Bacteria 8788
370 Ga0495625_0001387 3300046660 Bacteria 29722
371 Ga0495625_0021097 3300046660 Bacteria 5020
372 Ga0495625_0035378 3300046660 Bacteria 3682
373 Ga0495625_0120470 3300046660 Bacteria 1786
374 Ga0495625_0181155 3300046660 Bacteria 1401
375 Ga0495625_0412075 3300046660 Bacteria 842
376 Ga0495661_0092598 3300046665 Bacteria 1717
377 Ga0495588_0000895 3300046674 Bacteria 13095
378 Ga0495588_0112648 3300046674 Bacteria 1433
379 Ga0495588_0216023 3300046674 Bacteria 1012
380 Ga0495658_0226279 3300046683 Bacteria 1172
381 Ga0495624_0029721 3300046690 Bacteria 3564
382 Ga0495670_0100351 3300046691 Bacteria 1490
383 Ga0495670_0248799 3300046691 Bacteria 947
384 Ga0495671_0057639 3300046692 Bacteria 1922
385 Ga0495671_0171771 3300046692 Bacteria 1054
386 Ga0495649_0001505 3300046694 Bacteria 17487
387 Ga0495649_0014781 3300046694 Bacteria 4461
388 Ga0495600_0087271 3300046809 Bacteria 2035
389 Ga0495660_0009309 3300046810 Bacteria 5728
390 Ga0495660_0026561 3300046810 Bacteria 3281
391 Ga0495604_0279013 3300047317 Bacteria 1129
392 Ga0495672_0134241 3300047320 Bacteria 1299
393 Ga0495683_0032267 3300047323 Bacteria 2668
394 Ga0495687_050812 3300047443 Bacteria 1764
395 Ga0495687_059923 3300047443 Bacteria 1572
396 Ga0495673_0059394 3300047469 Bacteria 1644
397 Ga0495686_0002638 3300047472 Bacteria 16585
398 Ga0495686_0018209 3300047472 Bacteria 4718
399 Ga0495686_0033938 3300047472 Bacteria 3290
400 Ga0495686_0129881 3300047472 Bacteria 1495
401 Ga0495686_0158696 3300047472 Bacteria 1323
402 Ga0495686_0185849 3300047472 Bacteria 1201
403 Ga0495626_0042954 3300048091 Bacteria 2122
404 Ga0496101_0455939 3300048904 Bacteria 1009
405 Ga0496101_0837430 3300048904 Bacteria 725
406 Ga0496104_0044897 3300048907 Bacteria 4154
407 Ga0496104_0073999 3300048907 Bacteria 3242
408 Ga0496105_0393661 3300048908 Bacteria 1101
409 Ga0496106_0001376 3300048909 Bacteria 18218
410 Ga0496110_0120975 3300048913 Bacteria 2358
411 Ga0496111_0001270 3300048914 Bacteria 14143
412 Ga0496114_0082492 3300048917 Bacteria 2718
413 Ga0496116_0000142 3300048919 Bacteria 150342
414 Ga0496116_0003173 3300048919 Bacteria 16471
415 Ga0496116_0004575 3300048919 Bacteria 13122
416 Ga0496116_0031943 3300048919 Bacteria 3759
417 Ga0496116_0105490 3300048919 Bacteria 1671
418 Ga0496116_0172585 3300048919 Bacteria 1170
419 Ga0496117_0000002 3300048920 Bacteria 2483758
420 Ga0496117_0001574 3300048920 Bacteria 32408
421 Ga0496117_0004520 3300048920 Bacteria 15278
422 Ga0496117_0007646 3300048920 Bacteria 10484
423 Ga0496117_0058327 3300048920 Bacteria 2674
424 Ga0496117_0081757 3300048920 Bacteria 2118
425 Ga0496118_0000087 3300048921 Bacteria 176693
426 Ga0496118_0003357 3300048921 Bacteria 20255
427 Ga0496118_0044701 3300048921 Bacteria 3465
428 Ga0496118_0048854 3300048921 Bacteria 3263
429 Ga0496118_0074610 3300048921 Bacteria 2423
430 Ga0496118_0373076 3300048921 Bacteria 752
431 Ga0496119_0012193 3300048922 Bacteria 7013
432 Ga0496119_0042799 3300048922 Bacteria 2868
433 Ga0496119_0046317 3300048922 Bacteria 2717
434 Ga0496119_0055767 3300048922 Bacteria 2398
435 Ga0496119_0077546 3300048922 Bacteria 1924
436 Ga0496119_0202038 3300048922 Bacteria 1028
437 Ga0496120_0000413 3300048923 Bacteria 68125
438 Ga0496120_0004953 3300048923 Bacteria 10819
439 Ga0496120_0019971 3300048923 Bacteria 4271
440 Ga0496120_0029837 3300048923 Bacteria 3325
441 Ga0496120_0140753 3300048923 Bacteria 1225
442 Ga0496121_0000003 3300048924 Bacteria 1191431
443 Ga0496121_0001116 3300048924 Bacteria 47237
444 Ga0496121_0002536 3300048924 Bacteria 27686
445 Ga0496121_0016918 3300048924 Bacteria 7494
446 Ga0496121_0026498 3300048924 Bacteria 5461
447 Ga0496121_0078361 3300048924 Bacteria 2627
448 Ga0496121_0129814 3300048924 Bacteria 1888
449 Ga0496122_0000004 3300048925 Bacteria 645283
450 Ga0496122_0000190 3300048925 Bacteria 140376
451 Ga0496122_0000215 3300048925 Bacteria 128810
452 Ga0496122_0007584 3300048925 Bacteria 11999
453 Ga0496122_0009083 3300048925 Bacteria 10541
454 Ga0496122_0011669 3300048925 Bacteria 8854
455 Ga0496122_0017311 3300048925 Bacteria 6750
456 Ga0496122_0029558 3300048925 Bacteria 4619
457 Ga0496122_0055676 3300048925 Bacteria 2956
458 Ga0496122_0079235 3300048925 Bacteria 2296
459 Ga0496122_0095593 3300048925 Bacteria 2007
460 Ga0496122_0169891 3300048925 Bacteria 1316
461 Ga0496122_0239301 3300048925 Bacteria 1025
462 Ga0496123_0000007 3300048926 Bacteria 645283
463 Ga0496123_0000306 3300048926 Bacteria 95266
464 Ga0496123_0000336 3300048926 Bacteria 89161
465 Ga0496123_0026962 3300048926 Bacteria 4290
466 Ga0496123_0030382 3300048926 Bacteria 3955
467 Ga0496123_0040340 3300048926 Bacteria 3253
468 Ga0496123_0067719 3300048926 Bacteria 2253
469 Ga0496123_0121333 3300048926 Bacteria 1469
470 Ga0496124_0001040 3300048927 Bacteria 43813
471 Ga0496124_0002399 3300048927 Bacteria 24609
472 Ga0496124_0003209 3300048927 Bacteria 20191
473 Ga0496124_0022030 3300048927 Bacteria 5853
474 Ga0496124_0027287 3300048927 Bacteria 5129
475 Ga0496124_0036879 3300048927 Bacteria 4257
476 Ga0496124_0043621 3300048927 Bacteria 3854
477 Ga0496124_0062434 3300048927 Bacteria 3118
478 Ga0496124_0148456 3300048927 Bacteria 1842
479 Ga0496124_0274494 3300048927 Bacteria 1232
480 Ga0496124_0275603 3300048927 Bacteria 1229
481 Ga0496124_0326166 3300048927 Bacteria 1097
482 Ga0496124_0557791 3300048927 Bacteria 755
483 Ga0496125_0000039 3300048928 Bacteria 318665
484 Ga0496125_0000248 3300048928 Bacteria 110840
485 Ga0496125_0015960 3300048928 Bacteria 7233
486 Ga0496125_0026672 3300048928 Bacteria 5255
487 Ga0496125_0210615 3300048928 Bacteria 1263
488 Ga0496125_0252570 3300048928 Bacteria 1111
489 Ga0496125_0276255 3300048928 Bacteria 1044
490 Ga0496126_0000866 3300048929 Bacteria 53241
491 Ga0496126_0001294 3300048929 Bacteria 39967
492 Ga0496126_0032719 3300048929 Bacteria 4897
493 Ga0496126_0036037 3300048929 Bacteria 4631
494 Ga0496126_0084575 3300048929 Bacteria 2798
495 Ga0496126_0162796 3300048929 Bacteria 1905
496 Ga0496126_0200189 3300048929 Bacteria 1687
497 Ga0495678_027687 3300049459 Bacteria 2402
498 Ga0495682_0014014 3300049460 Bacteria 3044
499 Ga0501031_0032195 3300049568 Bacteria 3419
500 Ga0501032_0053435 3300049569 Bacteria 2721
501 Ga0501032_0074100 3300049569 Bacteria 2268
502 Ga0501032_0078462 3300049569 Bacteria 2198
503 Ga0501033_0144468 3300049570 Bacteria 1719
504 Ga0501034_0176057 3300049571 Bacteria 2105
505 Ga0501034_0193571 3300049571 Bacteria 1995
506 Ga0501036_0251463 3300049572 Bacteria 1481
507 Ga0501037_0028615 3300049573 Bacteria 4116
508 Ga0501039_0036462 3300049575 Bacteria 3795
509 Ga0501043_0030188 3300049579 Bacteria 4259
510 Ga0501043_0042521 3300049579 Bacteria 3571
511 Ga0501046_0126836 3300049580 Bacteria 1938
512 Ga0501047_0189229 3300049581 Bacteria 1922
513 Ga0501073_0071596 3300049589 Bacteria 2415
514 Ga0501238_003465 3300049671 Bacteria 1938
515 Ga0501083_0008527 3300049744 Bacteria 7236
516 Ga0501083_0025205 3300049744 Bacteria 4118
517 Ga0501035_0275249 3300049822 Bacteria 1424
518 Ga0501044_0125399 3300049823 Bacteria 2565
519 Ga0501044_0309140 3300049823 Bacteria 1508
520 nmdc:mga03683_3822_c1 3300050489 Bacteria 4918
521 nmdc:mga03n38_256923_c1 3300050490 Bacteria 925
522 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
523 nmdc:mga00v17_1367_c2 3300050491 Bacteria 12172
524 nmdc:mga00v17_22579_c1 3300050491 Bacteria 3632
525 nmdc:mga0yw44_175_c1 3300050492 Bacteria 22466
526 nmdc:mga0yw44_90866_c1 3300050492 Bacteria 1929
527 nmdc:mga0k408_6637_c2 3300050493 Bacteria 1420
528 nmdc:mga06z11_151694_c1 3300050494 Bacteria 1318
529 nmdc:mga06z11_257441_c1 3300050494 Bacteria 1029
530 nmdc:mga06z11_3925_c1 3300050494 Bacteria 5803
531 nmdc:mga07m45_15683_c1 3300050496 Bacteria 4047
532 nmdc:mga07m45_82281_c1 3300050496 Bacteria 1839
533 nmdc:mga0sz30_192218_c1 3300050516 Bacteria 906
534 Ga0495601_0086265 3300053077 Bacteria 2017
535 Ga0495619_0015887 3300053085 Bacteria 4766
536 Ga0500578_0173505 3300053086 Bacteria 1332
537 Ga0500651_0017859 3300053093 Bacteria 4384
538 Ga0500556_0085875 3300053104 Bacteria 1196
539 Ga0500560_000110 3300053107 Bacteria 8564
540 Ga0500562_009899 3300053108 Bacteria 2411
541 Ga0500562_022629 3300053108 Bacteria 1639
542 Ga0500569_001359 3300053109 Bacteria 4591
543 Ga0500569_018508 3300053109 Bacteria 1800
544 Ga0500594_0001416 3300053118 Bacteria 5205
545 Ga0500607_075723 3300053121 Bacteria 1727
546 Ga0500618_000314 3300053125 Bacteria 35813
547 Ga0500618_000328 3300053125 Bacteria 34407
548 Ga0500618_011400 3300053125 Bacteria 2357
549 Ga0500628_010456 3300053129 Bacteria 1663
550 Ga0500655_004619 3300053133 Bacteria 2473
551 Ga0500658_0000465 3300053134 Bacteria 17285
552 Ga0500658_0022781 3300053134 Bacteria 2386
553 Ga0500561_0001085 3300053137 Bacteria 4381
554 Ga0500568_0000441 3300053139 Bacteria 31147
555 Ga0500568_0006290 3300053139 Bacteria 5981
556 Ga0500568_0044442 3300053139 Bacteria 1772
557 Ga0500573_0014329 3300053140 Bacteria 4483
558 Ga0500573_0017737 3300053140 Bacteria 4054
559 Ga0500590_000286 3300053148 Bacteria 16015
560 Ga0500616_0000277 3300053153 Bacteria 76399
561 Ga0500616_0001018 3300053153 Bacteria 29841
562 Ga0500616_0011531 3300053153 Bacteria 5212
563 Ga0500622_0000458 3300053156 Bacteria 38693
564 Ga0500622_0000627 3300053156 Bacteria 31781
565 Ga0500622_0027111 3300053156 Bacteria 3021
566 Ga0500624_001663 3300053157 Bacteria 3330
567 Ga0500627_0133446 3300053158 Bacteria 1121
568 Ga0500633_0003641 3300053160 Bacteria 3400
569 Ga0500633_0115643 3300053160 Bacteria 996
570 Ga0500634_0000261 3300053161 Bacteria 16846
571 Ga0500634_0011554 3300053161 Bacteria 4564
572 Ga0500636_0000180 3300053177 Bacteria 33813
573 Ga0500645_063433 3300053730 Bacteria 1066
574 Ga0501084_0141536 3300054114 Bacteria 2026
575 Ga0501082_0278654 3300060353 Bacteria 1455
576 2561468365 2558860983 Bacteria 4133860
577 2509108390 2508501122 Bacteria 6292184
578 2509376477 2509276019 Bacteria 6802256
579 2509392049 2509276021 Bacteria 7634384
580 2509445641 2509276033 Bacteria 7180565
581 2509447058 2509276033 Bacteria 7180565
582 2510133960 2510065019 Bacteria 6903379
583 2510306461 2510065057 Bacteria 6649661
584 2510841909 2510461069 Bacteria 5505000
585 2510895379 2510461076 Bacteria 8618824
586 2511135407 2510917022 Bacteria 6504556
587 2511174303 2510917026 Bacteria 7046020
588 2511187061 2510917028 Bacteria 6185411
589 2511199034 2510917030 Bacteria 7460662
590 2511502251 2511231052 Bacteria 6974333
591 2512533624 2512047086 Bacteria 6850303
592 2512970677 2512875026 Bacteria 6861065
593 2513567967 2513237084 Bacteria 7231967
594 2513576948 2513237085 Bacteria 7695351
595 2513584377 2513237086 Bacteria 7265287
596 2513596481 2513237088 Bacteria 6927906
597 2513604279 2513237089 Bacteria 6553624
598 2513618811 2513237091 Bacteria 6900273
599 2513633380 2513237093 Bacteria 7545552
600 2513708042 2513237103 Bacteria 7647401
601 2513865606 2513237138 Bacteria 7368160
602 2513884398 2513237140 Bacteria 7076289
603 2513905016 2513237143 Bacteria 6664116
604 2513908995 2513237144 Bacteria 7530820
605 2513925378 2513237146 Bacteria 7166346
606 2513988383 2513237156 Bacteria 6402557
607 2514001497 2513237159 Bacteria 6810126
608 2514006372 2513237160 Bacteria 6650282
609 2514020001 2513237162 Bacteria 7468464
610 2515113009 2515075009 Bacteria 7288508
611 2515609027 2515154107 Bacteria 6795637
612 2515638520 2515154113 Bacteria 7807172
613 2515640969 2515154114 Bacteria 7848616
614 2515655349 2515154116 Bacteria 7552979
615 2515739488 2515154134 Bacteria 7220242
616 2516204152 2516143018 Bacteria 6951533
617 2516893630 2516653046 Bacteria 6989037
618 2517036711 2516653077 Bacteria 7555578
619 2517077069 2516653085 Bacteria 7346596
620 2517095837 2517093000 Bacteria 7412387
621 2517407409 2517287029 Bacteria 6905599
622 2517570352 2517487022 Bacteria 7227575
623 2520377186 2519899620 Bacteria 6499161
624 2524448549 2524023207 Bacteria 6813453
625 2524459594 2524023209 Bacteria 6679728
626 2530645948 2529292951 Bacteria 6916614
627 2535516872 2534681796 Bacteria 7146037
628 2537875428 2537561587 Bacteria 5425293
629 2551674536 2551306084 Bacteria 8942552
630 2551677917 2551306084 Bacteria 8942552
631 2551687730 2551306085 Bacteria 7347181
632 2551691418 2551306086 Bacteria 6843938
633 2551698971 2551306087 Bacteria 7351905
634 2551715586 2551306089 Bacteria 7162724
635 2551715872 2551306090 Bacteria 7953713
636 2551726517 2551306091 Bacteria 7086830
637 2551733680 2551306092 Bacteria 6992595
638 2551744437 2551306093 Bacteria 7064773
639 2554248239 2554235003 Bacteria 5877155
640 2558864455 2558860100 Bacteria 8458965
641 2559295355 2558860242 Bacteria 5568029
642 2585166354 2582581283 Bacteria 6030556
643 2585202264 2582581294 Bacteria 6626667
644 2585222837 2582581298 Bacteria 7315509
645 2585231749 2582581299 Bacteria 6518058
646 2585255091 2582581304 Bacteria 5831370
647 2585267418 2582581306 Bacteria 6450535
648 2585271144 2582581307 Bacteria 6597605
649 2585277489 2582581308 Bacteria 7413247
650 2585323327 2582581315 Bacteria 7318924
651 2585331470 2582581316 Bacteria 7774528
652 2585386486 2582581865 Bacteria 6644329
653 2585393262 2582581866 Bacteria 6859583
654 2585402391 2582581867 Bacteria 7184437
655 2585527449 2585427526 Bacteria 7258840
656 2585535116 2585427527 Bacteria 7273426
657 2585538190 2585427528 Bacteria 6842387
658 2585545420 2585427529 Bacteria 7395659
659 2585555966 2585427530 Bacteria 7383882
660 2585558868 2585427531 Bacteria 6992870
661 2585822922 2585427590 Bacteria 6824633
662 2585836139 2585427593 Bacteria 7141551
663 2585843233 2585427594 Bacteria 6180594
664 2585898250 2585427608 Bacteria 6544331
665 2585904162 2585427609 Bacteria 6667127
666 2585996208 2585427633 Bacteria 6413184
667 2586000818 2585427634 Bacteria 6455027
668 2587980721 2585428125 Bacteria 6662905
669 2599331757 2599185156 Bacteria 5403036
670 2599417294 2599185170 Bacteria 7295545
671 2599601667 2599185210 Bacteria 5624189
672 2599721907 2599185236 Bacteria 6875203
673 2600194399 2599185352 Bacteria 7228948
674 2600374353 2600254933 Bacteria 4750527
675 2601610073 2600255279 Bacteria 5605316
676 2601746848 2600255308 Bacteria 5611129
677 2616293358 2615840624 Bacteria 6557588
678 2616308964 2615840626 Bacteria 7921970
679 2616554234 2615840698 Bacteria 7319877
680 2617384712 2617270742 Bacteria 6808054
681 2643803082 2643221557 Bacteria 7184309
682 2643811527 2643221558 Bacteria 5460675
683 2643856763 2643221568 Bacteria 5187270
684 2643920334 2643221582 Bacteria 5804683
685 2644003150 2643221599 Bacteria 6292121
686 2644050513 2643221607 Bacteria 6314006
687 2644063444 2643221610 Bacteria 7480339
688 2644107273 2643221618 Bacteria 7717186
689 2644150839 2643221626 Bacteria 8069654
690 2644193515 2643221634 Bacteria 6705461
691 2644205741 2643221636 Bacteria 6583769
692 2644238672 2643221643 Bacteria 5749658
693 2644298676 2643221653 Bacteria 4569637
694 2644308668 2643221655 Bacteria 7722067
695 2644335486 2643221659 Bacteria 7890716
696 2644374727 2643221668 Bacteria 7306521
697 2644414207 2643221675 Bacteria 7473456
698 2644447735 2643221680 Bacteria 7473610
699 2644483431 2643221686 Bacteria 6310811
700 2644492035 2643221688 Bacteria 5260751
701 2644499642 2643221689 Bacteria 6042950
702 2644521951 2643221693 Bacteria 5513853
703 2644539891 2643221698 Bacteria 7756764
704 2644614609 2643221712 Bacteria 7729434
705 2644656905 2643221719 Bacteria 4568197
706 2644676073 2643221723 Bacteria 7095460
707 2644690208 2643221726 Bacteria 7455827
708 2657681567 2657244999 Bacteria 5946535
709 2671111424 2667528174 Bacteria 6435400
710 2692315535 2690316117 Bacteria 6800650
711 2719181812 2718217882 Bacteria 6556348
712 2719386415 2718217927 Bacteria 6972593
713 2719666163 2718217997 Bacteria 6740740
714 2719732476 2718218009 Bacteria 6478651
715 2720492583 2718218199 Bacteria 6740745
716 2720614018 2718218232 Bacteria 6720332
717 2720620823 2718218233 Bacteria 6662049
718 2720632148 2718218235 Bacteria 6630699
719 2720775876 2718218269 Bacteria 6906114
720 2721147903 2718218363 Bacteria 6524337
721 2721159354 2718218365 Bacteria 6274507
722 2721164739 2718218366 Bacteria 6425255
723 2721400119 2718218423 Bacteria 6438183
724 2722840909 2721755514 Bacteria 6424414
725 2723027480 2721755556 Bacteria 6745503
726 2723561099 2721755684 Bacteria 6859907
727 2723567695 2721755685 Bacteria 6704835
728 2724038932 2721755809 Bacteria 6438790
729 2724045232 2721755810 Bacteria 6479005
730 2724090483 2721755819 Bacteria 6906405
731 2724104960 2721755822 Bacteria 6726041
732 2724110819 2721755823 Bacteria 6752556
733 2725952555 2724679232 Bacteria 7646494
734 2730108416 2728369352 Bacteria 6745171
735 2730165047 2728369365 Bacteria 6555560
736 2730298986 2728369397 Bacteria 6274511
737 2738800092 2738541293 Bacteria 7065685
738 2738947328 2738541317 Bacteria 5340176
739 2739032847 2738541333 Bacteria 7106503
740 2753462035 2751185821 Bacteria 6189929
741 2766065875 2765235942 Bacteria 7445910
742 2776913931 2775507049 Bacteria 6284736
743 2778175421 2775507266 Bacteria 7392367
744 2792585121 2791355082 Bacteria 5973319
745 2792620764 2791355091 Bacteria 6135441
746 2792626123 2791355092 Bacteria 6248105
747 2792639060 2791355094 Bacteria 7011481
748 2793280299 2791355253 Bacteria 5171699
749 2793294431 2791355256 Bacteria 6798008
750 2793314538 2791355259 Bacteria 7254731
751 2793320365 2791355260 Bacteria 6598818
752 2793329534 2791355261 Bacteria 6661293
753 2793334496 2791355262 Bacteria 6774204
754 2793339213 2791355263 Bacteria 6872478
755 2793348886 2791355264 Bacteria 6429314
756 2793351826 2791355265 Bacteria 6539969
757 2793362577 2791355266 Bacteria 7116587
758 2793368868 2791355267 Bacteria 7222458
759 2802720048 2802428858 Bacteria 6636079
760 2802727019 2802428859 Bacteria 6667919
761 2802731978 2802428860 Bacteria 6525526
762 2802739309 2802428861 Bacteria 6534206
763 2802745710 2802428862 Bacteria 6633353
764 2802752311 2802428863 Bacteria 6410669
765 2804752758 2802429268 Bacteria 6094027
766 2805928795 2802429605 Bacteria 6875453
767 2805935077 2802429606 Bacteria 6346811
768 2806043827 2802429633 Bacteria 7341974
769 2806050242 2802429634 Bacteria 7083200
770 2806057058 2802429635 Bacteria 7650140
771 2806064440 2802429636 Bacteria 7597525
772 2806071707 2802429637 Bacteria 7067217
773 2808987911 2808606387 Bacteria 5697198
774 2819241397 2818991272 Bacteria 4622173
775 2819559068 2818991439 Bacteria 6907412
776 2819609154 2818991448 Bacteria 6772224
777 2819637617 2818991453 Bacteria 7181617
778 2819684917 2818991461 Bacteria 7026071
779 2821127486 2821123053 Bacteria 7836056
780 2838017647 2838016132 Bacteria 6577831
781 2838027552 2838022645 Bacteria 6494267
782 2838029800 2838029111 Bacteria 6603031
783 2838038506 2838035591 Bacteria 7166484
784 2838043974 2838042994 Bacteria 6046894
785 2838054380 2838048938 Bacteria 6044578
786 2838068009 2838061910 Bacteria 6794874
787 2838070137 2838068647 Bacteria 6208656
788 2838076853 2838074704 Bacteria 6785777
789 2838661583 2838661181 Bacteria 7385261
790 2838670366 2838668709 Bacteria 6671819
791 2838675767 2838675328 Bacteria 4909118
792 2838683462 2838680041 Bacteria 6545511
793 2838687049 2838686498 Bacteria 7807632
794 2838697595 2838694306 Bacteria 6853137
795 2838702737 2838701080 Bacteria 6669771
796 2838710711 2838707686 Bacteria 6619912
797 2838714649 2838714209 Bacteria 5525906
798 2838721550 2838719591 Bacteria 5523910
799 2838725409 2838724970 Bacteria 4908691
800 2838729978 2838729681 Bacteria 7400765
801 2838738010 2838736955 Bacteria 5760694
802 2838743007 2838742623 Bacteria 7396178
803 2841841621 2841840854 Bacteria 5761912
804 2841848502 2841846520 Bacteria 5345850
805 2841852493 2841851746 Bacteria 7532261
806 2841862132 2841859092 Bacteria 5436171
807 2841870788 2841864319 Bacteria 6742987
808 2842078884 2842077413 Bacteria 6508645
809 2842113264 2842110456 Bacteria 7656360
810 2842118606 2842118031 Bacteria 7033875
811 2842125467 2842124991 Bacteria 5346824
812 2842130662 2842130223 Bacteria 4909145
813 2842141399 2842140634 Bacteria 5759631
814 2842148005 2842146304 Bacteria 5957337
815 2842154168 2842152218 Bacteria 4908957
816 2842158047 2842156927 Bacteria 6894975
817 2842168789 2842163707 Bacteria 6916235
818 2842170893 2842170452 Bacteria 5525737
819 2842177788 2842175837 Bacteria 4908771
820 2842181666 2842180545 Bacteria 6888678
821 2842187758 2842187318 Bacteria 5524014
822 2842197363 2842192696 Bacteria 6147454
823 2842203562 2842198810 Bacteria 6608673
824 2842205475 2842205361 Bacteria 6340321
825 2842212069 2842211629 Bacteria 5523832
826 2842217942 2842217011 Bacteria 7497767
827 2842226312 2842224351 Bacteria 5524473
828 2842230283 2842229732 Bacteria 7475766
829 2842240518 2842237096 Bacteria 6620661
830 2842244185 2842243621 Bacteria 7421798
831 2842253071 2842250916 Bacteria 6579627
832 2842257729 2842257432 Bacteria 7401195
833 2842266272 2842264693 Bacteria 6472963
834 2842271413 2842271015 Bacteria 7807131
835 2842278932 2842278818 Bacteria 6340002
836 2842285595 2842285085 Bacteria 6011953
837 2842292546 2842291075 Bacteria 7076806
838 2842301375 2842298080 Bacteria 6123127
839 2842305041 2842304105 Bacteria 7023636
840 2842314907 2842311132 Bacteria 6616990
841 2842320715 2842317721 Bacteria 6793725
842 2842346464 2842341865 Bacteria 7003929
843 2842357912 2842357229 Bacteria 6485165
844 2842368957 2842363717 Bacteria 6844742
845 2842374093 2842370503 Bacteria 7038661
846 2842378944 2842377471 Bacteria 7140707
847 2842385117 2842384541 Bacteria 7057858
848 2842399878 2842395702 Bacteria 6780583
849 2842402955 2842402390 Bacteria 6681310
850 2842409673 2842409023 Bacteria 6687331
851 2842416324 2842415677 Bacteria 6596907
852 2842423751 2842422224 Bacteria 6239196
853 2842430735 2842428310 Bacteria 6767288
854 2842437278 2842434925 Bacteria 6502746
855 2842443648 2842441272 Bacteria 6769273
856 2842454057 2842447887 Bacteria 6754142
857 2842464878 2842462802 Bacteria 6588055
858 2842471896 2842469257 Bacteria 6752936
859 2842476915 2842475841 Bacteria 6603183
860 2842484555 2842482326 Bacteria 7212537
861 2842491983 2842489311 Bacteria 6620893
862 2842496821 2842495871 Bacteria 6820686
863 2842503328 2842502639 Bacteria 6604161
864 2842511124 2842509118 Bacteria 6850950
865 2842518916 2842515876 Bacteria 5436280
866 2842521820 2842521101 Bacteria 6569494
867 2842924162 2842922631 Bacteria 5824079
868 2844164579 2844163670 Bacteria 7266046
869 2844458416 2844454524 Bacteria 7952546
870 2847419403 2847417321 Bacteria 6913799
871 2848994430 2848992105 Bacteria 6810864
872 2850081473 2850079185 Bacteria 6848280
873 2852390230 2852387548 Bacteria 8025568
874 2854899594 2854896431 Bacteria 5869725
875 2854918419 2854916844 Bacteria 5725939
876 2855826350 2855825444 Bacteria 6785811
877 2855841740 2855839649 Bacteria 7135830
878 2855872515 2855872281 Bacteria 6964271
879 2857517428 2857516855 Bacteria 7787325
880 2857536501 2857531043 Bacteria 6754041
881 2858802525 2858800743 Bacteria 6603254
882 2891373353 2891373044 Bacteria 5202277
883 2896389020 2896384573 Bacteria 7700774
884 2899796044 2899792073 Bacteria 4926588
885 2899850621 2899845264 Bacteria 5672268
886 2913299305 2913295892 Bacteria 6333755
887 2913312574 2913308742 Bacteria 5350706
888 2915981459 2915980308 Bacteria 6624279
889 2915991453 2915986958 Bacteria 6739310
890 2915998710 2915993759 Bacteria 7016183
891 2916003476 2916000859 Bacteria 6865702
892 2916011647 2916007675 Bacteria 6898660
893 2916019550 2916014648 Bacteria 6946486
894 2916024948 2916021584 Bacteria 6854472
895 2916033761 2916028427 Bacteria 6748433
896 2916037876 2916035215 Bacteria 6755766
897 2916045324 2916041962 Bacteria 6820487
898 2916049052 2916048683 Bacteria 6543552
899 2916055710 2916055098 Bacteria 6758838
900 2916064884 2916061851 Bacteria 6737736
901 2916072205 2916068649 Bacteria 6943657
902 2916083207 2916076590 Bacteria 6596108
903 2919107652 2919100787 Bacteria 7710546
904 2919114687 2919114240 Bacteria 5700270
905 2919169249 2919166419 Bacteria 4952238
906 2919174705 2919171160 Bacteria 6499771
907 2919409985 2919408235 Bacteria 6149349
908 2920761514 2920760137 Bacteria 7427611
909 2920825220 2920822456 Bacteria 6897201
910 2921201860 2921201388 Bacteria 6926299
911 2921211102 2921208531 Bacteria 6745326
912 2921240920 2921237296 Bacteria 6876710
913 2921246764 2921244191 Bacteria 6568419
914 2921252106 2921250672 Bacteria 6677771
915 2921263775 2921257292 Bacteria 6808382
916 2921266219 2921263974 Bacteria 6864552
917 2921287985 2921282425 Bacteria 6826397
918 2921290946 2921289301 Bacteria 7316391
919 2921299047 2921296804 Bacteria 7176999
920 2923558579 2923556063 Bacteria 6793593
921 2924146744 2924144063 Bacteria 6883928
922 2924157982 2924150972 Bacteria 7169444
923 2924159284 2924158325 Bacteria 7188855
924 2924169150 2924165586 Bacteria 7260590
925 2924174559 2924172951 Bacteria 6749356
926 2924182990 2924179722 Bacteria 6843264
927 2924192701 2924186466 Bacteria 6876637
928 2924195394 2924193448 Bacteria 6955718
929 2924203315 2924200457 Bacteria 6757188
930 2924210734 2924207177 Bacteria 6917007
931 2924219239 2924214083 Bacteria 7080103
932 2924223284 2924221636 Bacteria 7113495
933 2924230530 2924228884 Bacteria 6633132
934 2926755703 2926754445 Bacteria 5964435
935 2926762821 2926760298 Bacteria 5505990
936 2929140877 2929138655 Bacteria 5810547
937 2933008813 2933006813 Bacteria 4912075
938 2933014910 2933011516 Bacteria 5439334
939 2933022315 2933016740 Bacteria 6355406
940 2933570849 2933570622 Bacteria 7023390
941 2933588680 2933586486 Bacteria 7667493
942 2933596588 2933594066 Bacteria 5594265
943 2933600943 2933599457 Bacteria 5858799
944 2935897019 2935894831 Bacteria 6620579
945 2935901953 2935901341 Bacteria 7341747
946 2936372032 2936367885 Bacteria 7324495
947 2936379895 2936375103 Bacteria 6652732
948 2936382798 2936381700 Bacteria 7006523
949 2937000714 2936996657 Bacteria 6298727
950 2937004549 2937002841 Bacteria 6934057
951 2937011207 2937009748 Bacteria 6746052
952 2937019814 2937016420 Bacteria 6782579
953 2937024593 2937023124 Bacteria 6815156
954 2937030306 2937029754 Bacteria 6424026
955 2937042688 2937036028 Bacteria 6846469
956 2937045549 2937042894 Bacteria 6741576
957 2937056163 2937049772 Bacteria 6757901
958 2937063561 2937056579 Bacteria 7107896
959 2937067783 2937063883 Bacteria 7199456
960 2937074400 2937071275 Bacteria 6984483
961 2937080256 2937078374 Bacteria 6610289
962 2937085819 2937084907 Bacteria 6618516
963 2937097230 2937091812 Bacteria 6979387
964 2937103026 2937098957 Bacteria 7249374
965 2937111266 2937106411 Bacteria 6947143
966 2937116135 2937113482 Bacteria 6505872
967 2937121994 2937119839 Bacteria 6597547
968 2937128835 2937126314 Bacteria 6771275
969 2941502130 2941499720 Bacteria 7599444
970 2957376365 2957375807 Bacteria 6425588
971 2957384268 2957382221 Bacteria 6737050
972 2957390731 2957388812 Bacteria 6778072
973 2957395887 2957395598 Bacteria 6822399
974 2957404493 2957402308 Bacteria 6741770
975 2957412080 2957408893 Bacteria 6558585
976 2957421218 2957415311 Bacteria 6991633
977 2957429645 2957422303 Bacteria 7172205
978 2957431725 2957430029 Bacteria 7022557
979 2957440460 2957437181 Bacteria 6568994
980 2957446899 2957443900 Bacteria 6869977
981 2957453741 2957450854 Bacteria 6765715
982 2957461937 2957457609 Bacteria 6967680
983 2957467035 2957464669 Bacteria 6568877
984 2957473259 2957471148 Bacteria 6797643
985 2957479595 2957478035 Bacteria 6756658
986 2957490453 2957484790 Bacteria 6703082
987 2957494116 2957491536 Bacteria 6695180
988 2957503319 2957498199 Bacteria 7126688
989 2957510623 2957505466 Bacteria 7253085
990 2960584510 2960584000 Bacteria 6864594
991 2960592106 2960591022 Bacteria 6622873
992 2960599984 2960597568 Bacteria 6550735
993 2960610598 2960603979 Bacteria 6898737
994 2960612307 2960610863 Bacteria 6691244
995 2960620473 2960617483 Bacteria 6727748
996 2960624472 2960624210 Bacteria 6875384
997 2960632066 2960631154 Bacteria 6732508
998 2960644115 2960637947 Bacteria 7296468
999 2960648406 2960645483 Bacteria 7211087
1000 2960656517 2960652885 Bacteria 7083688
1001 2960665558 2960660292 Bacteria 7041660
1002 2960669667 2960667422 Bacteria 6763020
1003 2960675151 2960674078 Bacteria 6609048
1004 2960681641 2960680706 Bacteria 6624464
1005 2960691459 2960687367 Bacteria 6535474
1006 2960694783 2960693952 Bacteria 6749742
1007 2964614134 2964607997 Bacteria 7101408
1008 2964617739 2964615318 Bacteria 6809089
1009 2964623624 2964621998 Bacteria 6834995
1010 2964632595 2964628898 Bacteria 7083044
1011 2964640810 2964636051 Bacteria 7091832
1012 2964645677 2964643177 Bacteria 6820887
1013 2964651564 2964649959 Bacteria 6675118
1014 2964660534 2964656573 Bacteria 7100150
1015 2964666914 2964663802 Bacteria 7019362
1016 2964675041 2964670856 Bacteria 6851364
1017 2964682883 2964678106 Bacteria 6792020
1018 2964688491 2964685014 Bacteria 6839111
1019 2964692488 2964691889 Bacteria 6802758
1020 2964701634 2964698721 Bacteria 6765331
1021 2964711084 2964705432 Bacteria 7114648
1022 2964715151 2964712639 Bacteria 6695970
1023 2964720687 2964719344 Bacteria 7286602
1024 2967665116 2967664464 Bacteria 6948836
1025 2967678405 2967671571 Bacteria 7021409
1026 2967684417 2967678726 Bacteria 7264382
1027 2967692113 2967686174 Bacteria 6678622
1028 2967694652 2967693043 Bacteria 6804451
1029 2967706456 2967699805 Bacteria 6854538
1030 2967708630 2967706974 Bacteria 7186053
1031 2967714883 2967714385 Bacteria 7000047
1032 2967726115 2967721400 Bacteria 7073753
1033 2967728975 2967728569 Bacteria 6641507
1034 2967737156 2967735183 Bacteria 6827012
1035 2967742563 2967742019 Bacteria 6794534
1036 2967751594 2967748971 Bacteria 6733771
1037 2967757904 2967755722 Bacteria 6814706
1038 2967767523 2967762386 Bacteria 6923502
1039 2967772112 2967769361 Bacteria 6587838
1040 2967778989 2967775926 Bacteria 6738189
1041 2970021053 2970019648 Bacteria 7072033
1042 2970028325 2970026789 Bacteria 6785236
1043 2970040298 2970033650 Bacteria 7118744
1044 2970042648 2970040964 Bacteria 6731123
1045 2970050979 2970047711 Bacteria 7088379
1046 2970056709 2970054988 Bacteria 6611507
1047 2970067151 2970061556 Bacteria 7099761
1048 2970071595 2970068827 Bacteria 7123112
1049 2970078271 2970076120 Bacteria 6697332
1050 2970085253 2970082768 Bacteria 6183754
1051 2970092555 2970088815 Bacteria 6933825
1052 2970097305 2970095765 Bacteria 6936963
1053 2970107990 2970102677 Bacteria 6812532
1054 2970110717 2970109326 Bacteria 6863976
1055 2970117363 2970116247 Bacteria 6501857
1056 2970125804 2970122695 Bacteria 6625855
1057 2970131157 2970129317 Bacteria 6806560
1058 2970136301 2970136068 Bacteria 7207982
1059 2970146710 2970143518 Bacteria 6446480
1060 2970151607 2970149975 Bacteria 6779706
1061 2970159576 2970156795 Bacteria 7168044
1062 2970166969 2970164137 Bacteria 6861252
1063 2970174251 2970170962 Bacteria 6876229
1064 2970180833 2970177841 Bacteria 6768001
1065 2970189178 2970184632 Bacteria 7054431
1066 2970193608 2970191845 Bacteria 7032787
1067 2977519124 2977516862 Bacteria 6940108
1068 2977528861 2977523885 Bacteria 6960446
1069 2977534037 2977530762 Bacteria 6951399
1070 2977539634 2977537788 Bacteria 6929320
1071 2977546378 2977544691 Bacteria 6875412
1072 2977558440 2977551784 Bacteria 7125765
1073 2977563181 2977558990 Bacteria 6863948
1074 2977567673 2977565890 Bacteria 6901543
1075 2977575738 2977572785 Bacteria 6763888
1076 2977581989 2977579622 Bacteria 6772100
1077 2978974625 2978969890 Bacteria 5400756
1078 2979094689 2979089926 Bacteria 5670289
1079 2979100746 2979095461 Bacteria 5669583
1080 2979103921 2979100975 Bacteria 5423623
1081 2984522128 2984518228 Bacteria 5277463
1082 2984541426 2984537506 Bacteria 5277481
1083 2984589947 2984587000 Bacteria 5263363
1084 2984603703 2984601300 Bacteria 5455244
1085 2989349677 2989349275 Bacteria 6349068
1086 2989774292 2989771324 Bacteria 5605128
1087 2989779211 2989776772 Bacteria 4843317
1088 2996889031 2996887358 Bacteria 5795980
1089 2996894325 2996893221 Bacteria 5823108
1090 3002144761 3002141150 Bacteria 5254435
1091 3003934070 3003930520 Bacteria 5667563
1092 3005414593 3005409236 Bacteria 7188837
1093 3005419464 3005416602 Bacteria 7064308
1094 3005448451 3005445848 Bacteria 6906074
1095 3005454643 3005452660 Bacteria 5889319
1096 639649193 639633055 Bacteria 7751309
1097 643826318 643692032 Bacteria 6891900
1098 648739219 648276728 Bacteria 6968865
1099 650740564 650716007 Bacteria 5573770
1100 8003571632 8003570095 Bacteria 5747666
1101 8003994174 8003992118 Bacteria 7266902
1102 8004001816 8003999396 Bacteria 7063185
1103 8005260312 8005258706 Bacteria 6184835
1104 8005281212 8005275841 Bacteria 6929066
1105 8005283252 8005282627 Bacteria 6675747
1106 8005293642 8005289223 Bacteria 6634003
1107 8005303127 8005301065 Bacteria 6614431
1108 8005312836 8005307578 Bacteria 7395396
1109 8005316755 8005314921 Bacteria 7072929
1110 8005323558 8005321885 Bacteria 5795980
1111 8005380930 8005376324 Bacteria 6590079
1112 8005389119 8005382845 Bacteria 6732062
1113 8005396099 8005395548 Bacteria 6806915
1114 8005435159 8005430974 Bacteria 6689030
1115 8005463689 8005460587 Bacteria 7157962
1116 8005489182 8005484373 Bacteria 6297373
1117 8005500901 8005497431 Bacteria 6477605
1118 8005545624 8005542996 Bacteria 7077758
1119 8005557013 8005556819 Bacteria 6908598
1120 8005567995 8005563573 Bacteria 7153261
1121 8005573460 8005570704 Bacteria 6957481
1122 8005622274 8005619151 Bacteria 7030230
1123 8005632246 8005626139 Bacteria 6534237
1124 8005648142 8005645114 Bacteria 6950293
1125 8005672319 8005668836 Bacteria 6953162
1126 8005682884 8005682033 Bacteria 6726518
1127 8005692105 8005688590 Bacteria 6610080
1128 8005697402 8005695170 Bacteria 6912330
1129 8018134096 8018127388 Bacteria 7351159
1130 8018153234 8018150411 Bacteria 5549903
1131 8018164624 8018163183 Bacteria 7277977
1132 8018181323 8018176218 Bacteria 6896178
1133 8023683166 8023680758 Bacteria 7729763
1134 8024482861 8024479707 Bacteria 6954785
1135 8024488032 8024486573 Bacteria 6540512
1136 8024504425 8024501048 Bacteria 6427847
1137 8046771938 8046767195 Bacteria 7547379
1138 8049295327 8049293176 Bacteria 6128433
1139 8054462982 8054460903 Bacteria 4872905
1140 8054558642 8054558443 Bacteria 5204801
1141 8056375936 8056375014 Bacteria 7006639
1142 8056386727 8056382006 Bacteria 6408074
1143 8056877292 8056875544 Bacteria 4355797
1144 8057575732 8057575449 Bacteria 7367519
1145 8057877671 8057874678 Bacteria 7494653
1146 JGI24740J21852_10000015
1147 JGI25155J39150_1000001
1148 JGI25156J39149_1000001
1149 JGI25162J39368_1000366
1150 JGI25162J39368_1000368
1151 JGI25154J39366_1000122
1152 JGI25158J39367_1000038
1153 JGI25158J39367_1003428
1154 JGI25157J39369_1000044
1155 JGI25152J39213_1002709
1156 JGI25152J39213_1003769
1157 JGI25152J39213_1006759
1158 JGI25152J39213_1010922
1159 JGI25150J39212_1000074
1160 JGI25159J45721_1000014
1161 JGI25159J45721_1000424
1162 JGI25151J46595_10000486
1163 JGI25151J46595_10001329
1164 JGI25151J46595_10006888
1165 JGI25151J46595_10009741
1166 JGI25151J46595_10021770
1167 JGI25165J46597_1000516
1168 JGI25165J46597_1002609
1169 JGI25165J46597_1004187
1170 JGI25153J46596_10000267
1171 JGI25153J46596_10005687
1172 JGI25153J46596_10014643
1173 JGI25153J46596_10023825
1174 JGI25153J46596_10025080
1175 rootH2_10031784
1176 rootH2_10038973
1177 rootH2_10147384
1178 rootL2_10010590
1179 rootL2_10031133
1180 rootL2_10074214
1181 rootH1_10104560
1182 rootH1_10118526
1183 rootH1_10168981
1184 rootH1_10280001
1185 JGI25160J50197_1000001
1186 JGI25160J50197_1000020
1187 JGI25160J50197_1001033
1188 JGI25160J50197_1004772
1189 JGI25160J50197_1015759
1190 JGI25161J50226_1000001
1191 JGI25161J50226_1000301
1192 JGI25161J50226_1001138
1193 JGI25161J50226_1003662
1194 Ga0055539_1011212
1195 Ga0055526_1001900
1196 Ga0055526_1003283
1197 Ga0055526_1004831
1198 Ga0055526_1020732
1199 Ga0055524_1001431
1200 Ga0055524_1002290
1201 Ga0055524_1003478
1202 Ga0055524_1008231
1203 Ga0055524_1008366
1204 Ga0055524_1015935
1205 Ga0055536_1001187
1206 Ga0055536_1002960
1207 Ga0055528_1002428
1208 Ga0055528_1005294
1209 Ga0055528_1006853
1210 Ga0055528_1007628
1211 Ga0055528_1031518
1212 Ga0055530_10006221
1213 Ga0055530_10012273
1214 Ga0055540_1006139
1215 Ga0055540_1006965
1216 Ga0055540_1025456
1217 Ga0055540_1028089
1218 Ga0055531_10003157
1219 Ga0055531_10010496
1220 Ga0058692_1004699
1221 Ga0058692_1019319
1222 Ga0055543_1000003
1223 Ga0055543_1000047
1224 Ga0055543_1000355
1225 Ga0055543_1000776
1226 Ga0065165_1000013
1227 Ga0065165_1000068
1228 Ga0065165_1002171
1229 Ga0065165_1005897
1230 Ga0065165_1006326
1231 Ga0065165_1015698
1232 Ga0070671_100118406
1233 Ga0070678_100149984
1234 Ga0070665_100006919
1235 Ga0070665_100081111
1236 Ga0070665_100295842
1237 Ga0068854_100023445
1238 Ga0068856_100066004
1239 Ga0068856_100334254
1240 Ga0068852_100028039
1241 Ga0081455_10116383
1242 Ga0081455_10206596
1243 Ga0075365_10000068
1244 Ga0075365_10013565
1245 Ga0075365_10018782
1246 Ga0075368_10003730
1247 Ga0075363_100044018
1248 Ga0075364_10001683
1249 Ga0075364_10022616
1250 Ga0075362_10002960
1251 Ga0075367_10011208
1252 Ga0075367_10013202
1253 Ga0075367_10017830
1254 Ga0075367_10225134
1255 Ga0075369_10006620
1256 Ga0075366_10007565
1257 Ga0075370_10019522
1258 Ga0075370_10125023
1259 Ga0075370_10128388
1260 Ga0079104_1000193
1261 Ga0079104_1002321
1262 Ga0079104_1015306
1263 Ga0099826_10002145
1264 Ga0105251_10029595
1265 Ga0105244_10032457
1266 Ga0105244_10062358
1267 Ga0105240_10000076
1268 Ga0105243_10041164
1269 Ga0105248_10151986
1270 Ga0105237_10000226
1271 Ga0123341_1000007
1272 Ga0123342_1004784
1273 Ga0123342_1008862
1274 Ga0105239_10051366
1275 Ga0157322_1000291
1276 Ga0157373_10006018
1277 Ga0157373_10036348
1278 Ga0157371_10000017
1279 Ga0157370_10000455
1280 Ga0157370_10000461
1281 Ga0157369_10036064
1282 Ga0157369_10040941
1283 Ga0171463_1003
1284 Ga0157378_10533226
1285 Ga0163163_10453124
1286 Ga0182008_10035774
1287 Ga0182007_10004725
1288 Ga0183363_1156
1289 Ga0214542_1027627
1290 Ga0214543_1000038
1291 Ga0228711_1000008
1292 Ga0228710_1000009
1293 Ga0209435_100012
1294 Ga0209436_100150
1295 Ga0209436_100915
1296 Ga0209436_105064
1297 Ga0209437_100051
1298 Ga0209437_100098
1299 Ga0207425_1000075
1300 Ga0207425_1001161
1301 Ga0207425_1004045
1302 Ga0207425_1005962
1303 Ga0207425_1011323
1304 Ga0209646_1000026
1305 Ga0209026_1000014
1306 Ga0209677_101343
1307 Ga0209759_1000012
1308 Ga0209129_1000156
1309 Ga0209129_1000218
1310 Ga0209129_1001121
1311 Ga0209129_1006883
1312 Ga0209129_1007345
1313 Ga0209129_1011154
1314 Ga0209233_1000095
1315 Ga0209233_1000113
1316 Ga0209233_1000148
1317 Ga0209455_1026145
1318 Ga0209673_1000010
1319 Ga0209673_1000117
1320 Ga0209673_1000151
1321 Ga0209673_1003130
1322 Ga0209673_1010663
1323 Ga0209673_1011080
1324 Ga0209673_1016282
1325 Ga0209130_1000003
1326 Ga0209130_1000020
1327 Ga0209130_1000034
1328 Ga0209130_1009757
1329 Ga0209130_1024847
1330 Ga0209676_1000482
1331 Ga0209676_1004918
1332 Ga0209676_1011536
1333 Ga0209025_1000070
1334 Ga0209025_1000140
1335 Ga0209025_1000314
1336 Ga0209025_1000571
1337 Ga0209025_1006423
1338 Ga0209025_1008410
1339 Ga0209025_1016283
1340 Ga0209025_1017662
1341 Ga0209025_1022956
1342 Ga0209025_1046962
1343 Ga0209564_1000013
1344 Ga0209564_1000386
1345 Ga0209564_1000424
1346 Ga0209564_1000647
1347 Ga0209564_1011426
1348 Ga0209564_1013617
1349 Ga0209564_1023691
1350 Ga0209758_1000094
1351 Ga0209758_1000405
1352 Ga0209758_1000413
1353 Ga0209758_1001750
1354 Ga0209758_1002998
1355 Ga0209758_1013575
1356 Ga0209758_1028856
1357 Ga0209758_1031578
1358 Ga0209758_1031598
1359 Ga0209050_1000646
1360 Ga0209050_1005849
1361 Ga0209050_1006458
1362 Ga0209256_1000396
1363 Ga0209256_1001575
1364 Ga0209256_1001585
1365 Ga0209256_1001653
1366 Ga0209256_1001736
1367 Ga0209256_1002474
1368 Ga0209256_1007740
1369 Ga0209256_1008167
1370 Ga0207426_1000006
1371 Ga0207426_1000008
1372 Ga0207426_1000011
1373 Ga0207426_1000449
1374 Ga0207426_1000869
1375 Ga0209051_1000097
1376 Ga0209051_1000314
1377 Ga0209051_1001414
1378 Ga0209051_1003601
1379 Ga0209051_1003927
1380 Ga0209051_1010049
1381 Ga0209051_1011123
1382 Ga0209257_1003315
1383 Ga0209257_1005890
1384 Ga0209257_1007337
1385 Ga0209257_1019303
1386 Ga0209257_1026874
1387 Ga0207695_10000011
1388 Ga0207671_10000093
1389 Ga0207650_10000837
1390 Ga0207644_10214473
1391 Ga0207709_10071991
1392 Ga0207667_10056825
1393 Ga0207640_10065727
1394 Ga0207702_10115084
1395 Ga0207698_10014845
1396 Ga0209281_1000034
1397 Ga0209281_1000106
1398 Ga0209281_1000318
1399 Ga0209371_1000022
1400 Ga0209371_1002282
1401 Ga0209371_1004346
1402 Ga0209282_1000024
1403 Ga0209282_1000628
1404 Ga0268266_10005370
1405 Ga0268266_10096739
1406 Ga0268266_10128793
1407 Ga0268266_10317276
1408 Ga0307515_10001559
1409 Ga0307515_10001978
1410 Ga0307515_10015685
1411 Ga0307515_10066747
1412 Ga0268256_1000019
1413 Ga0268256_1006518
1414 Ga0316181_1142512
1415 Ga0307513_10014518
1416 Ga0307513_10026616
1417 Ga0307408_100181232
1418 Ga0307516_10269110
1419 Ga0307406_10084862
1420 Ga0307412_10000493
1421 Ga0307412_10137209
1422 Ga0315914_1000012
1423 Ga0307416_101135659
1424 Ga0307414_10108275
1425 Ga0315913_1000006
1426 Ga0315915_1000010
1427 Ga0373946_0158060
1428 Ga0373927_0000350
1429 Ga0373925_0001916
1430 Ga0395905_0005044
1431 Ga0395905_0007902
1432 Ga0436363_0187511
1433 Ga0439436_0000496
1434 Ga0439439_0031232
1435 Ga0439439_0036802
1436 Ga0439466_0090018
1437 Ga0439465_0030157
1438 Ga0439465_0062304
1439 Ga0451787_403588
1440 Ga0451833_1206493
1441 Ga0451833_1241071
1442 Ga0451835_0051667
1443 Ga0451835_0594400
1444 Ga0451837_0397796
1445 Ga0451837_0670375
1446 Ga0451839_0280741
1447 Ga0451841_1352391
1448 Ga0451846_20130
1449 Ga0451847_0915316
1450 Ga0451849_0974996
1451 Ga0451853_3570678
1452 Ga0439432_018691
1453 Ga0439449_0062011
1454 Ga0439449_0097640
1455 Ga0439457_041727
1456 Ga0439462_0008309
1457 Ga0450906_002279
1458 Ga0450910_002846
1459 Ga0450918_001837
1460 Ga0466965_0030633
1461 Ga0466963_0003125
1462 Ga0466970_0001301
1463 Ga0466957_0003335
1464 Ga0466959_0092405
1465 Ga0466958_0028346
1466 Ga0495592_0168287
1467 Ga0495629_0033992
1468 Ga0495638_0001181
1469 Ga0495638_0014328
1470 Ga0495650_0121724
1471 Ga0495605_0001874
1472 Ga0495605_0043149
1473 Ga0495639_0089446
1474 Ga0495662_0028272
1475 Ga0495585_0008307
1476 Ga0495585_0097611
1477 Ga0495596_0030183
1478 Ga0495607_0138267
1479 Ga0495583_0007463
1480 Ga0495583_0037130
1481 Ga0495606_0002324
1482 Ga0495606_0008541
1483 Ga0495606_0041164
1484 Ga0495606_0052945
1485 Ga0495606_0120941
1486 Ga0495606_0129718
1487 Ga0495610_0003066
1488 Ga0495610_0019089
1489 Ga0495610_0084790
1490 Ga0495616_0010551
1491 Ga0495618_0176205
1492 Ga0495620_0006225
1493 Ga0495620_0043787
1494 Ga0495628_0332654
1495 Ga0495631_0000327
1496 Ga0495631_0033626
1497 Ga0495632_0002058
1498 Ga0495632_0005265
1499 Ga0495632_0012672
1500 Ga0495632_0189031
1501 Ga0495643_0002802
1502 Ga0495648_0057050
1503 Ga0495648_0068321
1504 Ga0495652_0098135
1505 Ga0495654_0000110
1506 Ga0495654_0095491
1507 Ga0495654_0236177
1508 Ga0495587_0045585
1509 Ga0495609_0047436
1510 Ga0495622_0023041
1511 Ga0495668_0001961
1512 Ga0495668_0012334
1513 Ga0495634_0118027
1514 Ga0495611_0002327
1515 Ga0495625_0001387
1516 Ga0495625_0021097
1517 Ga0495625_0035378
1518 Ga0495625_0120470
1519 Ga0495625_0181155
1520 Ga0495625_0412075
1521 Ga0495661_0092598
1522 Ga0495588_0000895
1523 Ga0495588_0112648
1524 Ga0495588_0216023
1525 Ga0495658_0226279
1526 Ga0495624_0029721
1527 Ga0495670_0100351
1528 Ga0495670_0248799
1529 Ga0495671_0057639
1530 Ga0495671_0171771
1531 Ga0495649_0001505
1532 Ga0495649_0014781
1533 Ga0495600_0087271
1534 Ga0495660_0009309
1535 Ga0495660_0026561
1536 Ga0495604_0279013
1537 Ga0495672_0134241
1538 Ga0495683_0032267
1539 Ga0495687_050812
1540 Ga0495687_059923
1541 Ga0495673_0059394
1542 Ga0495686_0002638
1543 Ga0495686_0018209
1544 Ga0495686_0033938
1545 Ga0495686_0129881
1546 Ga0495686_0158696
1547 Ga0495686_0185849
1548 Ga0495626_0042954
1549 Ga0496101_0455939
1550 Ga0496101_0837430
1551 Ga0496104_0044897
1552 Ga0496104_0073999
1553 Ga0496105_0393661
1554 Ga0496106_0001376
1555 Ga0496110_0120975
1556 Ga0496111_0001270
1557 Ga0496114_0082492
1558 Ga0496116_0000142
1559 Ga0496116_0003173
1560 Ga0496116_0004575
1561 Ga0496116_0031943
1562 Ga0496116_0105490
1563 Ga0496116_0172585
1564 Ga0496117_0000002
1565 Ga0496117_0001574
1566 Ga0496117_0004520
1567 Ga0496117_0007646
1568 Ga0496117_0058327
1569 Ga0496117_0081757
1570 Ga0496118_0000087
1571 Ga0496118_0003357
1572 Ga0496118_0044701
1573 Ga0496118_0048854
1574 Ga0496118_0074610
1575 Ga0496118_0373076
1576 Ga0496119_0012193
1577 Ga0496119_0042799
1578 Ga0496119_0046317
1579 Ga0496119_0055767
1580 Ga0496119_0077546
1581 Ga0496119_0202038
1582 Ga0496120_0000413
1583 Ga0496120_0004953
1584 Ga0496120_0019971
1585 Ga0496120_0029837
1586 Ga0496120_0140753
1587 Ga0496121_0000003
1588 Ga0496121_0001116
1589 Ga0496121_0002536
1590 Ga0496121_0016918
1591 Ga0496121_0026498
1592 Ga0496121_0078361
1593 Ga0496121_0129814
1594 Ga0496122_0000004
1595 Ga0496122_0000190
1596 Ga0496122_0000215
1597 Ga0496122_0007584
1598 Ga0496122_0009083
1599 Ga0496122_0011669
1600 Ga0496122_0017311
1601 Ga0496122_0029558
1602 Ga0496122_0055676
1603 Ga0496122_0079235
1604 Ga0496122_0095593
1605 Ga0496122_0169891
1606 Ga0496122_0239301
1607 Ga0496123_0000007
1608 Ga0496123_0000306
1609 Ga0496123_0000336
1610 Ga0496123_0026962
1611 Ga0496123_0030382
1612 Ga0496123_0040340
1613 Ga0496123_0067719
1614 Ga0496123_0121333
1615 Ga0496124_0001040
1616 Ga0496124_0002399
1617 Ga0496124_0003209
1618 Ga0496124_0022030
1619 Ga0496124_0027287
1620 Ga0496124_0036879
1621 Ga0496124_0043621
1622 Ga0496124_0062434
1623 Ga0496124_0148456
1624 Ga0496124_0274494
1625 Ga0496124_0275603
1626 Ga0496124_0326166
1627 Ga0496124_0557791
1628 Ga0496125_0000039
1629 Ga0496125_0000248
1630 Ga0496125_0015960
1631 Ga0496125_0026672
1632 Ga0496125_0210615
1633 Ga0496125_0252570
1634 Ga0496125_0276255
1635 Ga0496126_0000866
1636 Ga0496126_0001294
1637 Ga0496126_0032719
1638 Ga0496126_0036037
1639 Ga0496126_0084575
1640 Ga0496126_0162796
1641 Ga0496126_0200189
1642 Ga0495678_027687
1643 Ga0495682_0014014
1644 Ga0501031_0032195
1645 Ga0501032_0053435
1646 Ga0501032_0074100
1647 Ga0501032_0078462
1648 Ga0501033_0144468
1649 Ga0501034_0176057
1650 Ga0501034_0193571
1651 Ga0501036_0251463
1652 Ga0501037_0028615
1653 Ga0501039_0036462
1654 Ga0501043_0030188
1655 Ga0501043_0042521
1656 Ga0501046_0126836
1657 Ga0501047_0189229
1658 Ga0501073_0071596
1659 Ga0501238_003465
1660 Ga0501083_0008527
1661 Ga0501083_0025205
1662 Ga0501035_0275249
1663 Ga0501044_0125399
1664 Ga0501044_0309140
1665 nmdc:mga03683_3822_c1
1666 nmdc:mga03n38_256923_c1
1667 nmdc:mga00v17_12_c1
1668 nmdc:mga00v17_1367_c2
1669 nmdc:mga00v17_22579_c1
1670 nmdc:mga0yw44_175_c1
1671 nmdc:mga0yw44_90866_c1
1672 nmdc:mga0k408_6637_c2
1673 nmdc:mga06z11_151694_c1
1674 nmdc:mga06z11_257441_c1
1675 nmdc:mga06z11_3925_c1
1676 nmdc:mga07m45_15683_c1
1677 nmdc:mga07m45_82281_c1
1678 nmdc:mga0sz30_192218_c1
1679 Ga0495601_0086265
1680 Ga0495619_0015887
1681 Ga0500578_0173505
1682 Ga0500651_0017859
1683 Ga0500556_0085875
1684 Ga0500560_000110
1685 Ga0500562_009899
1686 Ga0500562_022629
1687 Ga0500569_001359
1688 Ga0500569_018508
1689 Ga0500594_0001416
1690 Ga0500607_075723
1691 Ga0500618_000314
1692 Ga0500618_000328
1693 Ga0500618_011400
1694 Ga0500628_010456
1695 Ga0500655_004619
1696 Ga0500658_0000465
1697 Ga0500658_0022781
1698 Ga0500561_0001085
1699 Ga0500568_0000441
1700 Ga0500568_0006290
1701 Ga0500568_0044442
1702 Ga0500573_0014329
1703 Ga0500573_0017737
1704 Ga0500590_000286
1705 Ga0500616_0000277
1706 Ga0500616_0001018
1707 Ga0500616_0011531
1708 Ga0500622_0000458
1709 Ga0500622_0000627
1710 Ga0500622_0027111
1711 Ga0500624_001663
1712 Ga0500627_0133446
1713 Ga0500633_0003641
1714 Ga0500633_0115643
1715 Ga0500634_0000261
1716 Ga0500634_0011554
1717 Ga0500636_0000180
1718 Ga0500645_063433
1719 Ga0501084_0141536
1720 Ga0501082_0278654
1721 2561468365
1722 2509108390
1723 2509376477
1724 2509392049
1725 2509445641
1726 2509447058
1727 2510133960
1728 2510306461
1729 2510841909
1730 2510895379
1731 2511135407
1732 2511174303
1733 2511187061
1734 2511199034
1735 2511502251
1736 2512533624
1737 2512970677
1738 2513567967
1739 2513576948
1740 2513584377
1741 2513596481
1742 2513604279
1743 2513618811
1744 2513633380
1745 2513708042
1746 2513865606
1747 2513884398
1748 2513905016
1749 2513908995
1750 2513925378
1751 2513988383
1752 2514001497
1753 2514006372
1754 2514020001
1755 2515113009
1756 2515609027
1757 2515638520
1758 2515640969
1759 2515655349
1760 2515739488
1761 2516204152
1762 2516893630
1763 2517036711
1764 2517077069
1765 2517095837
1766 2517407409
1767 2517570352
1768 2520377186
1769 2524448549
1770 2524459594
1771 2530645948
1772 2535516872
1773 2537875428
1774 2551674536
1775 2551677917
1776 2551687730
1777 2551691418
1778 2551698971
1779 2551715586
1780 2551715872
1781 2551726517
1782 2551733680
1783 2551744437
1784 2554248239
1785 2558864455
1786 2559295355
1787 2585166354
1788 2585202264
1789 2585222837
1790 2585231749
1791 2585255091
1792 2585267418
1793 2585271144
1794 2585277489
1795 2585323327
1796 2585331470
1797 2585386486
1798 2585393262
1799 2585402391
1800 2585527449
1801 2585535116
1802 2585538190
1803 2585545420
1804 2585555966
1805 2585558868
1806 2585822922
1807 2585836139
1808 2585843233
1809 2585898250
1810 2585904162
1811 2585996208
1812 2586000818
1813 2587980721
1814 2599331757
1815 2599417294
1816 2599601667
1817 2599721907
1818 2600194399
1819 2600374353
1820 2601610073
1821 2601746848
1822 2616293358
1823 2616308964
1824 2616554234
1825 2617384712
1826 2643803082
1827 2643811527
1828 2643856763
1829 2643920334
1830 2644003150
1831 2644050513
1832 2644063444
1833 2644107273
1834 2644150839
1835 2644193515
1836 2644205741
1837 2644238672
1838 2644298676
1839 2644308668
1840 2644335486
1841 2644374727
1842 2644414207
1843 2644447735
1844 2644483431
1845 2644492035
1846 2644499642
1847 2644521951
1848 2644539891
1849 2644614609
1850 2644656905
1851 2644676073
1852 2644690208
1853 2657681567
1854 2671111424
1855 2692315535
1856 2719181812
1857 2719386415
1858 2719666163
1859 2719732476
1860 2720492583
1861 2720614018
1862 2720620823
1863 2720632148
1864 2720775876
1865 2721147903
1866 2721159354
1867 2721164739
1868 2721400119
1869 2722840909
1870 2723027480
1871 2723561099
1872 2723567695
1873 2724038932
1874 2724045232
1875 2724090483
1876 2724104960
1877 2724110819
1878 2725952555
1879 2730108416
1880 2730165047
1881 2730298986
1882 2738800092
1883 2738947328
1884 2739032847
1885 2753462035
1886 2766065875
1887 2776913931
1888 2778175421
1889 2792585121
1890 2792620764
1891 2792626123
1892 2792639060
1893 2793280299
1894 2793294431
1895 2793314538
1896 2793320365
1897 2793329534
1898 2793334496
1899 2793339213
1900 2793348886
1901 2793351826
1902 2793362577
1903 2793368868
1904 2802720048
1905 2802727019
1906 2802731978
1907 2802739309
1908 2802745710
1909 2802752311
1910 2804752758
1911 2805928795
1912 2805935077
1913 2806043827
1914 2806050242
1915 2806057058
1916 2806064440
1917 2806071707
1918 2808987911
1919 2819241397
1920 2819559068
1921 2819609154
1922 2819637617
1923 2819684917
1924 2821127486
1925 2838017647
1926 2838027552
1927 2838029800
1928 2838038506
1929 2838043974
1930 2838054380
1931 2838068009
1932 2838070137
1933 2838076853
1934 2838661583
1935 2838670366
1936 2838675767
1937 2838683462
1938 2838687049
1939 2838697595
1940 2838702737
1941 2838710711
1942 2838714649
1943 2838721550
1944 2838725409
1945 2838729978
1946 2838738010
1947 2838743007
1948 2841841621
1949 2841848502
1950 2841852493
1951 2841862132
1952 2841870788
1953 2842078884
1954 2842113264
1955 2842118606
1956 2842125467
1957 2842130662
1958 2842141399
1959 2842148005
1960 2842154168
1961 2842158047
1962 2842168789
1963 2842170893
1964 2842177788
1965 2842181666
1966 2842187758
1967 2842197363
1968 2842203562
1969 2842205475
1970 2842212069
1971 2842217942
1972 2842226312
1973 2842230283
1974 2842240518
1975 2842244185
1976 2842253071
1977 2842257729
1978 2842266272
1979 2842271413
1980 2842278932
1981 2842285595
1982 2842292546
1983 2842301375
1984 2842305041
1985 2842314907
1986 2842320715
1987 2842346464
1988 2842357912
1989 2842368957
1990 2842374093
1991 2842378944
1992 2842385117
1993 2842399878
1994 2842402955
1995 2842409673
1996 2842416324
1997 2842423751
1998 2842430735
1999 2842437278
2000 2842443648
2001 2842454057
2002 2842464878
2003 2842471896
2004 2842476915
2005 2842484555
2006 2842491983
2007 2842496821
2008 2842503328
2009 2842511124
2010 2842518916
2011 2842521820
2012 2842924162
2013 2844164579
2014 2844458416
2015 2847419403
2016 2848994430
2017 2850081473
2018 2852390230
2019 2854899594
2020 2854918419
2021 2855826350
2022 2855841740
2023 2855872515
2024 2857517428
2025 2857536501
2026 2858802525
2027 2891373353
2028 2896389020
2029 2899796044
2030 2899850621
2031 2913299305
2032 2913312574
2033 2915981459
2034 2915991453
2035 2915998710
2036 2916003476
2037 2916011647
2038 2916019550
2039 2916024948
2040 2916033761
2041 2916037876
2042 2916045324
2043 2916049052
2044 2916055710
2045 2916064884
2046 2916072205
2047 2916083207
2048 2919107652
2049 2919114687
2050 2919169249
2051 2919174705
2052 2919409985
2053 2920761514
2054 2920825220
2055 2921201860
2056 2921211102
2057 2921240920
2058 2921246764
2059 2921252106
2060 2921263775
2061 2921266219
2062 2921287985
2063 2921290946
2064 2921299047
2065 2923558579
2066 2924146744
2067 2924157982
2068 2924159284
2069 2924169150
2070 2924174559
2071 2924182990
2072 2924192701
2073 2924195394
2074 2924203315
2075 2924210734
2076 2924219239
2077 2924223284
2078 2924230530
2079 2926755703
2080 2926762821
2081 2929140877
2082 2933008813
2083 2933014910
2084 2933022315
2085 2933570849
2086 2933588680
2087 2933596588
2088 2933600943
2089 2935897019
2090 2935901953
2091 2936372032
2092 2936379895
2093 2936382798
2094 2937000714
2095 2937004549
2096 2937011207
2097 2937019814
2098 2937024593
2099 2937030306
2100 2937042688
2101 2937045549
2102 2937056163
2103 2937063561
2104 2937067783
2105 2937074400
2106 2937080256
2107 2937085819
2108 2937097230
2109 2937103026
2110 2937111266
2111 2937116135
2112 2937121994
2113 2937128835
2114 2941502130
2115 2957376365
2116 2957384268
2117 2957390731
2118 2957395887
2119 2957404493
2120 2957412080
2121 2957421218
2122 2957429645
2123 2957431725
2124 2957440460
2125 2957446899
2126 2957453741
2127 2957461937
2128 2957467035
2129 2957473259
2130 2957479595
2131 2957490453
2132 2957494116
2133 2957503319
2134 2957510623
2135 2960584510
2136 2960592106
2137 2960599984
2138 2960610598
2139 2960612307
2140 2960620473
2141 2960624472
2142 2960632066
2143 2960644115
2144 2960648406
2145 2960656517
2146 2960665558
2147 2960669667
2148 2960675151
2149 2960681641
2150 2960691459
2151 2960694783
2152 2964614134
2153 2964617739
2154 2964623624
2155 2964632595
2156 2964640810
2157 2964645677
2158 2964651564
2159 2964660534
2160 2964666914
2161 2964675041
2162 2964682883
2163 2964688491
2164 2964692488
2165 2964701634
2166 2964711084
2167 2964715151
2168 2964720687
2169 2967665116
2170 2967678405
2171 2967684417
2172 2967692113
2173 2967694652
2174 2967706456
2175 2967708630
2176 2967714883
2177 2967726115
2178 2967728975
2179 2967737156
2180 2967742563
2181 2967751594
2182 2967757904
2183 2967767523
2184 2967772112
2185 2967778989
2186 2970021053
2187 2970028325
2188 2970040298
2189 2970042648
2190 2970050979
2191 2970056709
2192 2970067151
2193 2970071595
2194 2970078271
2195 2970085253
2196 2970092555
2197 2970097305
2198 2970107990
2199 2970110717
2200 2970117363
2201 2970125804
2202 2970131157
2203 2970136301
2204 2970146710
2205 2970151607
2206 2970159576
2207 2970166969
2208 2970174251
2209 2970180833
2210 2970189178
2211 2970193608
2212 2977519124
2213 2977528861
2214 2977534037
2215 2977539634
2216 2977546378
2217 2977558440
2218 2977563181
2219 2977567673
2220 2977575738
2221 2977581989
2222 2978974625
2223 2979094689
2224 2979100746
2225 2979103921
2226 2984522128
2227 2984541426
2228 2984589947
2229 2984603703
2230 2989349677
2231 2989774292
2232 2989779211
2233 2996889031
2234 2996894325
2235 3002144761
2236 3003934070
2237 3005414593
2238 3005419464
2239 3005448451
2240 3005454643
2241 639649193
2242 643826318
2243 648739219
2244 650740564
2245 8003571632
2246 8003994174
2247 8004001816
2248 8005260312
2249 8005281212
2250 8005283252
2251 8005293642
2252 8005303127
2253 8005312836
2254 8005316755
2255 8005323558
2256 8005380930
2257 8005389119
2258 8005396099
2259 8005435159
2260 8005463689
2261 8005489182
2262 8005500901
2263 8005545624
2264 8005557013
2265 8005567995
2266 8005573460
2267 8005622274
2268 8005632246
2269 8005648142
2270 8005672319
2271 8005682884
2272 8005692105
2273 8005697402
2274 8018134096
2275 8018153234
2276 8018164624
2277 8018181323
2278 8023683166
2279 8024482861
2280 8024488032
2281 8024504425
2282 8046771938
2283 8049295327
2284 8054462982
2285 8054558642
2286 8056375936
2287 8056386727
2288 8056877292
2289 8057575732
2290 8057877671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01510

Amidase_2

N-acetylmuramoyl-L-alanine amidase

20

149

0.96

PF01471

PG_binding_1

Putative peptidoglycan binding domain

181

237

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xxt-assembly1.cif.gz_A crystal structure of fused zn-dependent amidase/peptidase/peptodoglycan-binding domain-containing protein from clostridium acetobutylicum atcc 824 0.9119 177 242
5tv7-assembly2.cif.gz_B 2.05 angstrom resolution crystal structure of peptidoglycan-binding protein from clostridioides difficile in complex with glutamine hydroxamate. 0.9071 179 245
5nm7-assembly2.cif.gz_A crystal structure of burkholderia ap3 phage endolysin 0.857 179 242
5nm7-assembly1.cif.gz_G crystal structure of burkholderia ap3 phage endolysin 0.8481 178 243
2y28-assembly3.cif.gz_C crystal structure of se-met ampd derivative 0.8236 8 164
ID Description Score Start End Superfamily
4bxjA01 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.903 26 167 3.40.80.10
af_P75820_43_192_3.40.80.10 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.9012 27 167 3.40.80.10
4bpaB01 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.8837 26 166 3.40.80.10
4bpaB01 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.849 26 166 3.40.80.10
af_P75820_43_192_3.40.80.10 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.8437 27 167 3.40.80.10
ID Description Score Start End GO Terms
AF-A0A528V8L5-F1-model_v4 N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) 0.9919 1 96 GO:0005576
GO:0008745
GO:0009253
GO:0009254
GO:0019867
GO:0071555
AF-W1KMW2-F1-model_v4 deleted 0.9896 13 101
AF-A0A3B9H1Z2-F1-model_v4 N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) 0.9872 11 106 GO:0005576
GO:0008745
GO:0009253
GO:0009254
GO:0019867
GO:0071555
AF-A0A3S2I6I8-F1-model_v4 deleted 0.9866 170 248
AF-A0A7V8AI62-F1-model_v4 N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) 0.9845 12 102 GO:0005576
GO:0008745
GO:0009253
GO:0009254
GO:0071555

Map