F490648

General Info

Members Datasets Scaffolds Average Seq Length
1137 432 1001 255

Family's Representative Sequence

Representative Sequence 3300044672|Ga0466982_0000040|Ga0466982_0000040_35719_36549
Length 276
Sequence VTKRPEEIALLAASGRLLADVFAHLDRLDLVGMSTLQVNDLVESFIVDGLGARPASKGQYGYAYALNASRNDVVCHGVPSAADVLRSGDIVNFDITLEKHGYIADSSKTYLVGEVDPAARRLVQVTYEAMWKGIEAVRPGARLGDVGHAIERHARRNGYSIVREYCGHGIGREMHEEPQVLHWGKPGTGLMLREGMVFTIEPMLNQGRPAVRTESDGWTVVTRDGRLSAQFEHTVAVTRHGARVLTLRADEKPRSPLTRPQARRASPHDARARHGS

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
6 2511231006 Pseudomonas sp. GM17 Isolate Nodule
7 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
8 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
9 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
10 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
11 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
12 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
13 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
14 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
15 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
16 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
17 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
18 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
19 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
20 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
21 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
22 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
23 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
24 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
25 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
26 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
27 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
28 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
29 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
30 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
31 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
32 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
33 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
34 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
35 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
36 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
37 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
38 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
39 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
40 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
41 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
42 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
43 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
44 2643221556 Massilia sp. Root1485 Isolate Unclassified
45 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
46 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
47 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
48 2643221638 Duganella sp. Root336D2 Isolate Unclassified
49 2643221684 Massilia sp. Root133 Isolate Unclassified
50 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
51 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
52 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
53 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
54 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
55 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
56 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
57 2738541297 Duganella sp. GV083 Isolate Unclassified
58 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
59 2738541357 Duganella sp. GV053 Isolate Unclassified
60 2738543003 Duganella sp. GV066 Isolate Unclassified
61 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
62 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
63 2738543026 Duganella sp. GV089 Isolate Unclassified
64 2738543029 Duganella sp. GV039 Isolate Unclassified
65 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
66 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
67 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
68 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
69 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
70 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
71 2821131069 Duganella sp. 1224 Isolate Unclassified
72 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
73 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
74 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
75 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
76 2842711865 Duganella sp. R-73148 Isolate Unclassified
77 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
78 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
79 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
80 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
81 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
82 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
83 2855730933 Achromobacter sp. HZ28 Isolate Nodule
84 2855767633 Achromobacter sp. HZ34 Isolate Nodule
85 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
86 2857553236 Duganella sp. R-74557 Isolate Unclassified
87 2857558681 Duganella sp. R-74565 Isolate Unclassified
88 2857564685 Duganella sp. R-74599 Isolate Unclassified
89 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
90 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
91 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
92 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
93 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
94 2904424332 Duganella sp. 1411 Isolate Rhizosphere
95 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
96 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
97 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
98 2919476304 Duganella sp. 3397 Isolate Unclassified
99 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
100 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
101 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
102 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
103 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
104 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
105 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
106 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
107 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
108 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
109 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
110 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
111 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
112 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
113 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
114 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
115 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
116 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
117 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
118 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
119 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
120 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
121 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
122 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
123 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
124 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
125 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
126 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
127 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
128 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
129 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
130 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
131 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
132 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
133 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
134 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
135 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
136 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
137 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
138 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
139 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
140 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
141 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
142 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
143 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
144 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
145 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
146 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
147 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
148 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
149 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
150 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
151 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
152 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
153 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
154 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
155 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
156 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
157 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
158 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
159 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
160 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
161 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
162 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
163 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
164 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
165 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
166 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
167 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
168 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
169 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
170 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
171 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
172 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
173 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
174 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
175 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
176 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
177 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
178 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
179 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
180 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
181 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
182 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
183 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
184 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
185 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
186 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
187 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
188 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
189 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
190 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
191 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
192 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
195 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
198 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
206 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
207 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
209 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
212 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
213 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
215 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
217 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
243 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
245 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
247 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
248 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
249 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
250 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
253 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
256 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
257 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
263 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
264 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
265 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
266 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
267 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
268 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
269 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
270 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
271 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
272 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
273 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
274 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
275 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
276 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
280 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
283 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
290 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
291 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
292 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
293 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
294 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
295 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
296 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
297 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
298 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
299 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
302 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
303 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
304 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
305 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
306 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
307 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
308 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
309 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
310 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
311 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
312 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
313 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
316 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
317 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
318 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
319 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
320 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
321 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
322 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
323 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
324 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
325 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
326 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
327 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
328 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
329 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
330 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
331 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
332 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
333 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
334 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
335 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
336 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
337 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
338 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
339 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
340 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
341 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
342 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
343 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
344 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
347 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
348 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
349 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
350 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
351 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
352 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
353 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
354 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
355 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
356 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
357 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
358 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
362 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
363 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
364 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
365 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
366 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
367 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
368 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
369 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
370 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
371 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
372 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
373 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
374 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
375 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
376 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
377 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
378 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
379 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
380 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
384 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
385 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
391 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
392 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
393 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
394 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
395 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
396 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
397 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
398 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
399 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
400 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
416 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
417 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
418 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
419 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
420 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
421 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
422 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
423 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
424 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
425 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
426 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
427 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
428 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
429 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
430 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
431 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
432 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.1
Metatranscriptomes 1.93
Isolates 11.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.18
Nodule 0.79
Rhizoplane 4.93
Rhizosphere 74.14
Stem 0
Stem Tuber 0
Unclassified 11.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000149 3300001915 Bacteria 19701
2 JGI24740J21852_10003968 3300001979 Bacteria 6425
3 JGI25156J39149_1011038 3300002705 Bacteria 2073
4 JGI25162J39368_1000004 3300002737 Bacteria 441040
5 JGI25162J39368_1003457 3300002737 Bacteria 4545
6 JGI25154J39366_1000359 3300002738 Bacteria 25837
7 JGI25163J39215_1000047 3300002771 Bacteria 53654
8 JGI25164J39214_1000031 3300002772 Bacteria 144582
9 JGI25159J45721_1000757 3300002987 Bacteria 14011
10 JGI25165J46597_1000011 3300003214 Bacteria 441040
11 rootL2_10031707 3300003322 Bacteria 6903
12 Ga0055538_1000123 3300003751 Bacteria 58939
13 Ga0055538_1004657 3300003751 Bacteria 1523
14 Ga0055539_1000073 3300003752 Bacteria 131094
15 Ga0055539_1000167 3300003752 Bacteria 58939
16 Ga0055533_1000171 3300003756 Bacteria 58939
17 Ga0055533_1005112 3300003756 Bacteria 2187
18 Ga0055533_1005878 3300003756 Bacteria 1903
19 Ga0055532_1000090 3300003758 Bacteria 104391
20 Ga0055532_1000159 3300003758 Bacteria 59066
21 Ga0055525_1000232 3300003759 Bacteria 58939
22 Ga0055525_1000383 3300003759 Bacteria 28771
23 Ga0055527_1000479 3300003760 Bacteria 14726
24 Ga0055535_1000085 3300003761 Bacteria 104391
25 Ga0055535_1006235 3300003761 Bacteria 2455
26 Ga0055529_1000134 3300003763 Bacteria 104391
27 Ga0055526_1000007 3300003771 Bacteria 321998
28 Ga0055526_1000116 3300003771 Bacteria 70518
29 Ga0055536_1000014 3300003781 Bacteria 240624
30 Ga0055536_1000820 3300003781 Bacteria 20498
31 Ga0055530_10000126 3300003791 Bacteria 66675
32 Ga0055530_10000182 3300003791 Bacteria 56371
33 Ga0055530_10000529 3300003791 Bacteria 33175
34 Ga0055540_1000566 3300003792 Bacteria 27221
35 Ga0055531_10000165 3300003794 Bacteria 74768
36 Ga0055531_10001146 3300003794 Bacteria 20498
37 Ga0055541_1000112 3300003841 Bacteria 58923
38 Ga0055541_1009305 3300003841 Bacteria 1525
39 Ga0058692_1000002 3300003856 Bacteria 508401
40 Ga0055543_1002524 3300004625 Bacteria 5985
41 Ga0065165_1000005 3300005262 Bacteria 370361
42 Ga0065165_1000286 3300005262 Bacteria 85993
43 Ga0065714_10064654 3300005288 Bacteria 25523
44 Ga0065704_10071150 3300005289 Bacteria 12831
45 Ga0065704_10092201 3300005289 Bacteria 2668
46 Ga0065704_10135927 3300005289 Bacteria 1571
47 Ga0065712_10009916 3300005290 Bacteria 4202
48 Ga0070658_10583537 3300005327 Bacteria 968
49 Ga0070670_100000087 3300005331 Bacteria 88228
50 Ga0070670_100001916 3300005331 Bacteria 17030
51 Ga0070660_100511446 3300005339 Bacteria 999
52 Ga0070661_100000141 3300005344 Bacteria 58825
53 Ga0070661_100004776 3300005344 Bacteria 9328
54 Ga0070669_100009854 3300005353 Bacteria 6806
55 Ga0070663_100000034 3300005455 Bacteria 68516
56 Ga0070662_100005950 3300005457 Bacteria 7824
57 Ga0070662_100203365 3300005457 Bacteria 1572
58 Ga0068867_100283963 3300005459 Bacteria 1358
59 Ga0068853_100077825 3300005539 Bacteria 2898
60 Ga0070665_100000335 3300005548 Bacteria 71847
61 Ga0070664_100000044 3300005564 Bacteria 74926
62 Ga0070664_100000057 3300005564 Bacteria 68516
63 Ga0070664_100051154 3300005564 Bacteria 3498
64 Ga0068854_100000937 3300005578 Bacteria 17545
65 Ga0068856_100004528 3300005614 Bacteria 13821
66 Ga0068852_100115207 3300005616 Bacteria 2450
67 Ga0068851_10000752 3300005834 Bacteria 13928
68 Ga0068851_10215765 3300005834 Bacteria 1076
69 Ga0075363_100130804 3300006048 Bacteria 1407
70 Ga0075364_10012986 3300006051 Bacteria 5111
71 Ga0075364_10034882 3300006051 Bacteria 3249
72 Ga0079104_1006764 3300006946 Bacteria 4263
73 Ga0099826_10000013 3300006948 Bacteria 265459
74 Ga0105251_10003715 3300009011 Bacteria 10936
75 Ga0105251_10005101 3300009011 Bacteria 8693
76 Ga0105251_10013329 3300009011 Bacteria 4603
77 Ga0105251_10039117 3300009011 Bacteria 2319
78 Ga0105251_10055154 3300009011 Bacteria 1885
79 Ga0105244_10000014 3300009036 Bacteria 257018
80 Ga0105244_10000134 3300009036 Bacteria 75961
81 Ga0105244_10002934 3300009036 Bacteria 12584
82 Ga0105244_10015891 3300009036 Bacteria 4305
83 Ga0105244_10050756 3300009036 Bacteria 2115
84 Ga0105244_10206415 3300009036 Bacteria 925
85 Ga0105250_10000661 3300009092 Bacteria 21815
86 Ga0105250_10021366 3300009092 Bacteria 2613
87 Ga0105240_10031977 3300009093 Bacteria 6815
88 Ga0105240_10042292 3300009093 Bacteria 5807
89 Ga0105243_10007675 3300009148 Bacteria 8287
90 Ga0105243_10014001 3300009148 Bacteria 6069
91 Ga0105243_10062782 3300009148 Bacteria 2975
92 Ga0105241_10071225 3300009174 Bacteria 2698
93 Ga0105242_10000661 3300009176 Bacteria 26974
94 Ga0105237_10000116 3300009545 Bacteria 111312
95 Ga0105237_10053888 3300009545 Bacteria 4032
96 Ga0105237_10181195 3300009545 Bacteria 2107
97 Ga0105237_10359267 3300009545 Bacteria 1461
98 Ga0105238_10217878 3300009551 Bacteria 1885
99 Ga0105246_10001733 3300011119 Bacteria 13031
100 Ga0105246_10011605 3300011119 Bacteria 5469
101 Ga0157373_10006159 3300013100 Bacteria 8970
102 Ga0157373_10009246 3300013100 Bacteria 7287
103 Ga0157373_10011962 3300013100 Bacteria 6376
104 Ga0157373_10025897 3300013100 Bacteria 4238
105 Ga0157371_10000323 3300013102 Bacteria 61980
106 Ga0157371_10004329 3300013102 Bacteria 12448
107 Ga0157370_10000038 3300013104 Bacteria 135182
108 Ga0157370_10018703 3300013104 Bacteria 6967
109 Ga0157370_10024498 3300013104 Bacteria 5977
110 Ga0157369_10003855 3300013105 Bacteria 17824
111 Ga0157369_10007043 3300013105 Bacteria 12966
112 Ga0157369_10007727 3300013105 Bacteria 12368
113 Ga0157369_10034990 3300013105 Bacteria 5508
114 Ga0157369_10037652 3300013105 Bacteria 5295
115 Ga0163162_10085005 3300013306 Bacteria 3240
116 Ga0157372_10000776 3300013307 Bacteria 34547
117 Ga0157372_10323738 3300013307 Bacteria 1795
118 Ga0157372_10604177 3300013307 Bacteria 1278
119 Ga0157375_10003691 3300013308 Bacteria 13289
120 Ga0157375_10007576 3300013308 Bacteria 9492
121 Ga0157375_10121243 3300013308 Bacteria 2724
122 Ga0182008_10000261 3300014497 Bacteria 41195
123 Ga0182008_10001346 3300014497 Bacteria 16710
124 Ga0182008_10003524 3300014497 Bacteria 9413
125 Ga0157379_10186755 3300014968 Bacteria 1873
126 Ga0157376_10082633 3300014969 Bacteria 2761
127 Ga0182006_1000206 3300015261 Bacteria 59352
128 Ga0182006_1002616 3300015261 Bacteria 9730
129 Ga0182006_1004672 3300015261 Bacteria 6706
130 Ga0182007_10003019 3300015262 Bacteria 8131
131 Ga0163161_10007916 3300017792 Bacteria 7357
132 Ga0163161_10008504 3300017792 Bacteria 7108
133 Ga0163161_10011745 3300017792 Bacteria 6073
134 Ga0163161_10013050 3300017792 Bacteria 5774
135 Ga0163161_10015040 3300017792 Bacteria 5393
136 Ga0197907_11440316 3300020069 Bacteria 1510
137 Ga0206356_10624618 3300020070 Bacteria 1284
138 Ga0206351_10978011 3300020077 Bacteria 1397
139 Ga0206351_10989253 3300020077 Bacteria 1347
140 Ga0206350_11491042 3300020080 Bacteria 1763
141 Ga0154015_1552384 3300020610 Bacteria 22900
142 Ga0224712_10002754 3300022467 Bacteria 4421
143 Ga0209435_100840 3300025206 Bacteria 4828
144 Ga0209760_100032 3300025207 Bacteria 138015
145 Ga0209784_100006 3300025224 Bacteria 930704
146 Ga0209784_100058 3300025224 Bacteria 167327
147 Ga0209566_100002 3300025225 Bacteria 2614868
148 Ga0209566_100045 3300025225 Bacteria 258557
149 Ga0209674_100096 3300025226 Bacteria 167418
150 Ga0209674_100097 3300025226 Bacteria 167285
151 Ga0209674_100403 3300025226 Bacteria 21586
152 Ga0209672_100208 3300025228 Bacteria 46403
153 Ga0209147_100018 3300025229 Bacteria 515719
154 Ga0209147_100056 3300025229 Bacteria 258557
155 Ga0209563_100007 3300025230 Bacteria 1579402
156 Ga0209563_100041 3300025230 Bacteria 407467
157 Ga0209563_100064 3300025230 Bacteria 258557
158 Ga0207427_100003 3300025231 Bacteria 1035004
159 Ga0209437_100002 3300025233 Bacteria 1574801
160 Ga0209437_101405 3300025233 Bacteria 6017
161 Ga0209258_100028 3300025242 Bacteria 515719
162 Ga0209258_100243 3300025242 Bacteria 100317
163 Ga0209646_1000007 3300025246 Bacteria 670994
164 Ga0209646_1000207 3300025246 Bacteria 67740
165 Ga0209677_100007 3300025253 Bacteria 1021332
166 Ga0209677_100053 3300025253 Bacteria 167537
167 Ga0209148_1000640 3300025254 Bacteria 30511
168 Ga0209759_1002850 3300025256 Bacteria 7288
169 Ga0209759_1013956 3300025256 Bacteria 2148
170 Ga0209233_1000004 3300025261 Bacteria 1574798
171 Ga0209455_1000107 3300025272 Bacteria 195136
172 Ga0209130_1000254 3300025284 Bacteria 67210
173 Ga0209676_1000003 3300025292 Bacteria 1454178
174 Ga0209676_1001558 3300025292 Bacteria 20540
175 Ga0209564_1000010 3300025295 Bacteria 885399
176 Ga0209564_1000202 3300025295 Bacteria 136555
177 Ga0209564_1001636 3300025295 Bacteria 21656
178 Ga0209050_1000004 3300025298 Bacteria 1600040
179 Ga0209050_1000010 3300025298 Bacteria 980454
180 Ga0209050_1000069 3300025298 Bacteria 297615
181 Ga0209050_1015681 3300025298 Bacteria 3161
182 Ga0209256_1000921 3300025299 Bacteria 35969
183 Ga0209051_1000006 3300025303 Bacteria 1015785
184 Ga0209257_1000027 3300025304 Bacteria 703541
185 Ga0209257_1001484 3300025304 Bacteria 27531
186 Ga0207656_10000394 3300025321 Bacteria 14693
187 Ga0207696_1000041 3300025711 Bacteria 311695
188 Ga0207655_1000002 3300025728 Bacteria 1148694
189 Ga0207655_1000022 3300025728 Bacteria 483933
190 Ga0207655_1000063 3300025728 Bacteria 257028
191 Ga0207655_1000191 3300025728 Bacteria 108382
192 Ga0207655_1002838 3300025728 Bacteria 13411
193 Ga0207655_1014974 3300025728 Bacteria 4342
194 Ga0207655_1037820 3300025728 Bacteria 2119
195 Ga0207655_1111208 3300025728 Bacteria 925
196 Ga0207713_1000004 3300025735 Bacteria 702781
197 Ga0207713_1000682 3300025735 Bacteria 31836
198 Ga0207713_1008675 3300025735 Bacteria 5811
199 Ga0207713_1042527 3300025735 Bacteria 1885
200 Ga0207713_1064545 3300025735 Bacteria 1377
201 Ga0207705_10127390 3300025909 Bacteria 1893
202 Ga0207695_10002492 3300025913 Bacteria 27113
203 Ga0207671_10000166 3300025914 Bacteria 102694
204 Ga0207660_10563602 3300025917 Bacteria 927
205 Ga0207657_10007356 3300025919 Bacteria 11298
206 Ga0207649_10000056 3300025920 Bacteria 102891
207 Ga0207649_10000111 3300025920 Bacteria 68568
208 Ga0207650_10000418 3300025925 Bacteria 37720
209 Ga0207650_10005379 3300025925 Bacteria 8730
210 Ga0207690_10045688 3300025932 Bacteria 2895
211 Ga0207706_10003731 3300025933 Bacteria 14529
212 Ga0207709_10000982 3300025935 Bacteria 21301
213 Ga0207709_10004470 3300025935 Bacteria 8074
214 Ga0207709_10021519 3300025935 Bacteria 3651
215 Ga0207679_10000036 3300025945 Bacteria 133834
216 Ga0207679_10000105 3300025945 Bacteria 68561
217 Ga0207679_10138463 3300025945 Bacteria 1964
218 Ga0207640_10000154 3300025981 Bacteria 49637
219 Ga0207678_10000106 3300026067 Bacteria 68474
220 Ga0207702_10000135 3300026078 Bacteria 88092
221 Ga0207648_10137021 3300026089 Bacteria 2156
222 Ga0207674_10002847 3300026116 Bacteria 21514
223 Ga0207698_10091909 3300026142 Bacteria 2486
224 Ga0209281_1000379 3300027111 Bacteria 70495
225 Ga0209281_1004003 3300027111 Bacteria 4567
226 Ga0209371_1000004 3300027312 Bacteria 1098197
227 Ga0209282_1000043 3300027666 Bacteria 119260
228 Ga0268266_10000335 3300028379 Bacteria 73645
229 Ga0268266_10126077 3300028379 Bacteria 2285
230 Ga0265338_10001178 3300028800 Bacteria 43156
231 Ga0268256_1000005 3300030500 Bacteria 1082342
232 Ga0307511_10061742 3300030521 Bacteria 2852
233 Ga0265340_10079217 3300031247 Bacteria 1549
234 Ga0307509_10097343 3300031507 Bacteria 2991
235 Ga0307408_100000028 3300031548 Bacteria 233440
236 Ga0307408_100000074 3300031548 Bacteria 111955
237 Ga0307405_10001861 3300031731 Bacteria 9057
238 Ga0307405_10064245 3300031731 Bacteria 2332
239 Ga0307518_10013348 3300031838 Bacteria 5874
240 Ga0307406_10068905 3300031901 Bacteria 2311
241 Ga0307412_10001662 3300031911 Bacteria 12283
242 Ga0307412_10016685 3300031911 Bacteria 4379
243 Ga0307414_10098460 3300032004 Bacteria 2194
244 Ga0307414_10273285 3300032004 Bacteria 1416
245 Ga0307414_10499323 3300032004 Bacteria 1076
246 Ga0395899_0078640 3300037312 Bacteria 2404
247 Ga0395899_0085802 3300037312 Bacteria 2287
248 Ga0395899_0104362 3300037312 Bacteria 2043
249 Ga0395899_0112424 3300037312 Bacteria 1956
250 Ga0395900_0000162 3300037418 Bacteria 109616
251 Ga0395900_0005262 3300037418 Bacteria 13569
252 Ga0395900_0007334 3300037418 Bacteria 11410
253 Ga0395900_0009391 3300037418 Bacteria 10027
254 Ga0395900_0041333 3300037418 Bacteria 4753
255 Ga0395900_0107327 3300037418 Bacteria 2868
256 Ga0395900_0148447 3300037418 Bacteria 2396
257 Ga0395900_0177587 3300037418 Bacteria 2165
258 Ga0395900_0259394 3300037418 Bacteria 1736
259 Ga0395900_0334831 3300037418 Bacteria 1490
260 Ga0395900_0354717 3300037418 Bacteria 1439
261 Ga0395900_0378589 3300037418 Bacteria 1384
262 Ga0395898_0002086 3300037466 Bacteria 24861
263 Ga0395898_0023727 3300037466 Bacteria 6192
264 Ga0395898_0046474 3300037466 Bacteria 4264
265 Ga0395898_0050881 3300037466 Bacteria 4053
266 Ga0395898_0134242 3300037466 Bacteria 2370
267 Ga0395898_0279590 3300037466 Bacteria 1592
268 Ga0395905_0032388 3300037471 Bacteria 4916
269 Ga0395905_0039045 3300037471 Bacteria 4454
270 Ga0395905_0066292 3300037471 Bacteria 3381
271 Ga0395905_0300853 3300037471 Bacteria 1491
272 Ga0395905_0528993 3300037471 Bacteria 1079
273 Ga0395901_0000009 3300038443 Bacteria 479396
274 Ga0395901_0000042 3300038443 Bacteria 201819
275 Ga0395901_0000091 3300038443 Bacteria 123334
276 Ga0395901_0023936 3300038443 Bacteria 6264
277 Ga0395901_0061038 3300038443 Bacteria 3923
278 Ga0395901_0123431 3300038443 Bacteria 2721
279 Ga0395901_0168631 3300038443 Bacteria 2297
280 Ga0395901_0283097 3300038443 Bacteria 1722
281 Ga0395901_0525495 3300038443 Bacteria 1202
282 Ga0439436_0000095 3300041404 Bacteria 20869
283 Ga0439438_000160 3300041405 Bacteria 30706
284 Ga0439438_000190 3300041405 Bacteria 27711
285 Ga0439438_000503 3300041405 Bacteria 17737
286 Ga0439466_0000574 3300041411 Bacteria 13819
287 Ga0439466_0008236 3300041411 Bacteria 3930
288 Ga0439466_0032146 3300041411 Bacteria 1791
289 Ga0439448_0069504 3300042005 Bacteria 1172
290 Ga0439432_005030 3300042006 Bacteria 4780
291 Ga0439432_006082 3300042006 Bacteria 4324
292 Ga0439432_021723 3300042006 Bacteria 2125
293 Ga0450906_012235 3300042145 Bacteria 1592
294 Ga0439464_0000813 3300042439 Bacteria 6861
295 Ga0439464_0005146 3300042439 Bacteria 3368
296 Ga0439464_0018199 3300042439 Bacteria 1910
297 Ga0466972_0002472 3300044658 Bacteria 9144
298 Ga0466972_0003769 3300044658 Bacteria 7542
299 Ga0466972_0054889 3300044658 Bacteria 1917
300 Ga0466982_0000040 3300044672 Bacteria 41234
301 Ga0466965_0001680 3300044683 Bacteria 9081
302 Ga0466966_0031469 3300044684 Bacteria 3440
303 Ga0466966_0270642 3300044684 Bacteria 1022
304 Ga0466961_0142054 3300044693 Bacteria 1502
305 Ga0466971_0137107 3300044719 Bacteria 1138
306 Ga0466968_0006840 3300044735 Bacteria 4315
307 Ga0466970_0007069 3300044765 Bacteria 5614
308 Ga0466970_0099987 3300044765 Bacteria 1579
309 Ga0466958_0108722 3300045836 Bacteria 1730
310 Ga0466967_0746344 3300045976 Bacteria 971
311 Ga0495617_000002 3300046452 Bacteria 710121
312 Ga0495617_000020 3300046452 Bacteria 230257
313 Ga0495617_000443 3300046452 Bacteria 22346
314 Ga0495617_002156 3300046452 Bacteria 8073
315 Ga0495627_000005 3300046453 Bacteria 630805
316 Ga0495627_000058 3300046453 Bacteria 143802
317 Ga0495627_000207 3300046453 Bacteria 63763
318 Ga0495627_001366 3300046453 Bacteria 14571
319 Ga0495627_027126 3300046453 Bacteria 1840
320 Ga0495627_033386 3300046453 Bacteria 1614
321 Ga0495603_0028731 3300046455 Bacteria 3355
322 Ga0495603_0038059 3300046455 Bacteria 2885
323 Ga0495603_0040631 3300046455 Bacteria 2783
324 Ga0495590_0000025 3300046457 Bacteria 165221
325 Ga0495590_0013996 3300046457 Bacteria 2938
326 Ga0495590_0038493 3300046457 Bacteria 1668
327 Ga0495591_000081 3300046458 Bacteria 107738
328 Ga0495591_000246 3300046458 Bacteria 52198
329 Ga0495591_002486 3300046458 Bacteria 10221
330 Ga0495591_012754 3300046458 Bacteria 3111
331 Ga0495591_016756 3300046458 Bacteria 2538
332 Ga0495629_0080053 3300046459 Bacteria 2281
333 Ga0495638_0007776 3300046460 Bacteria 7656
334 Ga0495638_0011767 3300046460 Bacteria 6024
335 Ga0495638_0029677 3300046460 Bacteria 3526
336 Ga0495638_0061000 3300046460 Bacteria 2331
337 Ga0495638_0070430 3300046460 Bacteria 2141
338 Ga0495638_0192279 3300046460 Bacteria 1157
339 Ga0495653_0000082 3300046463 Bacteria 80285
340 Ga0495653_0015657 3300046463 Bacteria 6181
341 Ga0495653_0019749 3300046463 Bacteria 5463
342 Ga0495653_0033932 3300046463 Bacteria 4039
343 Ga0495653_0049210 3300046463 Bacteria 3248
344 Ga0495650_0000001 3300046471 Bacteria 1085492
345 Ga0495650_0000085 3300046471 Bacteria 235655
346 Ga0495650_0000462 3300046471 Bacteria 63149
347 Ga0495650_0001171 3300046471 Bacteria 28029
348 Ga0495650_0001182 3300046471 Bacteria 27749
349 Ga0495650_0053169 3300046471 Bacteria 1660
350 Ga0495582_0111521 3300046473 Bacteria 1536
351 Ga0495605_0000018 3300046474 Bacteria 270187
352 Ga0495605_0000051 3300046474 Bacteria 163067
353 Ga0495605_0000293 3300046474 Bacteria 55067
354 Ga0495605_0011697 3300046474 Bacteria 4884
355 Ga0495605_0019095 3300046474 Bacteria 3667
356 Ga0495605_0027590 3300046474 Bacteria 2941
357 Ga0495605_0029040 3300046474 Bacteria 2850
358 Ga0495605_0035726 3300046474 Bacteria 2510
359 Ga0495605_0057595 3300046474 Bacteria 1869
360 Ga0495605_0063262 3300046474 Bacteria 1765
361 Ga0495605_0108008 3300046474 Bacteria 1272
362 Ga0495605_0109559 3300046474 Bacteria 1261
363 Ga0495584_0000003 3300046491 Bacteria 323768
364 Ga0495584_0000058 3300046491 Bacteria 81148
365 Ga0495584_0000070 3300046491 Bacteria 73237
366 Ga0495584_0029859 3300046491 Bacteria 2762
367 Ga0495584_0062431 3300046491 Bacteria 1873
368 Ga0495584_0079441 3300046491 Bacteria 1650
369 Ga0495584_0083705 3300046491 Bacteria 1606
370 Ga0495584_0116125 3300046491 Bacteria 1355
371 Ga0495585_0000183 3300046492 Bacteria 66586
372 Ga0495585_0000424 3300046492 Bacteria 40738
373 Ga0495585_0000814 3300046492 Bacteria 27169
374 Ga0495585_0005398 3300046492 Bacteria 8061
375 Ga0495585_0006004 3300046492 Bacteria 7599
376 Ga0495585_0010489 3300046492 Bacteria 5510
377 Ga0495585_0017021 3300046492 Bacteria 4207
378 Ga0495585_0017297 3300046492 Bacteria 4168
379 Ga0495585_0030772 3300046492 Bacteria 3051
380 Ga0495585_0043023 3300046492 Bacteria 2527
381 Ga0495585_0043787 3300046492 Bacteria 2502
382 Ga0495585_0050006 3300046492 Bacteria 2319
383 Ga0495585_0088414 3300046492 Bacteria 1671
384 Ga0495585_0093826 3300046492 Bacteria 1613
385 Ga0495594_0000828 3300046499 Bacteria 15980
386 Ga0495594_0002110 3300046499 Bacteria 10356
387 Ga0495594_0054489 3300046499 Bacteria 2204
388 Ga0495594_0242772 3300046499 Bacteria 1026
389 Ga0495596_0000017 3300046500 Bacteria 114761
390 Ga0495596_0000366 3300046500 Bacteria 29053
391 Ga0495596_0000486 3300046500 Bacteria 25196
392 Ga0495596_0000884 3300046500 Bacteria 18072
393 Ga0495596_0000958 3300046500 Bacteria 17231
394 Ga0495596_0002814 3300046500 Bacteria 9109
395 Ga0495596_0002923 3300046500 Bacteria 8877
396 Ga0495596_0010139 3300046500 Bacteria 4117
397 Ga0495596_0010912 3300046500 Bacteria 3937
398 Ga0495596_0011652 3300046500 Bacteria 3784
399 Ga0495596_0012793 3300046500 Bacteria 3579
400 Ga0495596_0014942 3300046500 Bacteria 3262
401 Ga0495596_0016439 3300046500 Bacteria 3073
402 Ga0495596_0020852 3300046500 Bacteria 2679
403 Ga0495596_0024894 3300046500 Bacteria 2421
404 Ga0495596_0087490 3300046500 Bacteria 1209
405 Ga0495607_0000485 3300046501 Bacteria 39753
406 Ga0495607_0001440 3300046501 Bacteria 21201
407 Ga0495607_0001650 3300046501 Bacteria 19320
408 Ga0495607_0004773 3300046501 Bacteria 9907
409 Ga0495607_0004924 3300046501 Bacteria 9709
410 Ga0495607_0006308 3300046501 Bacteria 8357
411 Ga0495607_0009224 3300046501 Bacteria 6702
412 Ga0495607_0015090 3300046501 Bacteria 5016
413 Ga0495607_0019636 3300046501 Bacteria 4288
414 Ga0495607_0063452 3300046501 Bacteria 2090
415 Ga0495583_0000010 3300046506 Bacteria 353523
416 Ga0495583_0000051 3300046506 Bacteria 212400
417 Ga0495583_0000382 3300046506 Bacteria 68388
418 Ga0495583_0001685 3300046506 Bacteria 21387
419 Ga0495583_0003156 3300046506 Bacteria 12993
420 Ga0495583_0004240 3300046506 Bacteria 10401
421 Ga0495583_0005962 3300046506 Bacteria 8086
422 Ga0495583_0006526 3300046506 Bacteria 7609
423 Ga0495583_0021928 3300046506 Bacteria 3273
424 Ga0495583_0030949 3300046506 Bacteria 2600
425 Ga0495583_0036045 3300046506 Bacteria 2356
426 Ga0495583_0039818 3300046506 Bacteria 2211
427 Ga0495583_0055621 3300046506 Bacteria 1787
428 Ga0495583_0098912 3300046506 Bacteria 1247
429 Ga0495606_0000101 3300046507 Bacteria 146752
430 Ga0495606_0000161 3300046507 Bacteria 117607
431 Ga0495606_0000409 3300046507 Bacteria 72543
432 Ga0495606_0001868 3300046507 Bacteria 26409
433 Ga0495606_0003416 3300046507 Bacteria 16866
434 Ga0495606_0010811 3300046507 Bacteria 7521
435 Ga0495606_0017655 3300046507 Bacteria 5384
436 Ga0495606_0027466 3300046507 Bacteria 4035
437 Ga0495606_0089737 3300046507 Bacteria 1893
438 Ga0495610_0000014 3300046512 Bacteria 444708
439 Ga0495610_0000020 3300046512 Bacteria 344007
440 Ga0495610_0000229 3300046512 Bacteria 59730
441 Ga0495610_0000293 3300046512 Bacteria 52547
442 Ga0495610_0001226 3300046512 Bacteria 23065
443 Ga0495610_0019426 3300046512 Bacteria 3802
444 Ga0495610_0024547 3300046512 Bacteria 3250
445 Ga0495610_0069845 3300046512 Bacteria 1642
446 Ga0495616_0000207 3300046513 Bacteria 48768
447 Ga0495616_0000446 3300046513 Bacteria 31542
448 Ga0495616_0000492 3300046513 Bacteria 30078
449 Ga0495616_0000493 3300046513 Bacteria 30071
450 Ga0495616_0002335 3300046513 Bacteria 12668
451 Ga0495616_0008047 3300046513 Bacteria 6279
452 Ga0495616_0008671 3300046513 Bacteria 5999
453 Ga0495616_0011794 3300046513 Bacteria 4987
454 Ga0495616_0017240 3300046513 Bacteria 3984
455 Ga0495616_0019015 3300046513 Bacteria 3755
456 Ga0495616_0020945 3300046513 Bacteria 3550
457 Ga0495616_0025138 3300046513 Bacteria 3185
458 Ga0495616_0029934 3300046513 Bacteria 2867
459 Ga0495616_0034155 3300046513 Bacteria 2643
460 Ga0495616_0034287 3300046513 Bacteria 2637
461 Ga0495616_0073500 3300046513 Bacteria 1649
462 Ga0495616_0115044 3300046513 Bacteria 1246
463 Ga0495616_0172039 3300046513 Bacteria 968
464 Ga0495620_0004244 3300046515 Bacteria 8100
465 Ga0495620_0005093 3300046515 Bacteria 7359
466 Ga0495620_0034269 3300046515 Bacteria 2296
467 Ga0495620_0053036 3300046515 Bacteria 1719
468 Ga0495630_0034925 3300046517 Bacteria 3756
469 Ga0495631_0000791 3300046518 Bacteria 20226
470 Ga0495631_0002616 3300046518 Bacteria 10050
471 Ga0495631_0003789 3300046518 Bacteria 8228
472 Ga0495631_0004387 3300046518 Bacteria 7517
473 Ga0495631_0005725 3300046518 Bacteria 6482
474 Ga0495631_0016205 3300046518 Bacteria 3559
475 Ga0495631_0016490 3300046518 Bacteria 3520
476 Ga0495631_0025827 3300046518 Bacteria 2701
477 Ga0495631_0040161 3300046518 Bacteria 2074
478 Ga0495631_0044611 3300046518 Bacteria 1953
479 Ga0495631_0052258 3300046518 Bacteria 1784
480 Ga0495631_0054674 3300046518 Bacteria 1740
481 Ga0495631_0084225 3300046518 Bacteria 1370
482 Ga0495631_0106122 3300046518 Bacteria 1208
483 Ga0495631_0127202 3300046518 Bacteria 1095
484 Ga0495631_0160438 3300046518 Bacteria 965
485 Ga0495632_0000048 3300046519 Bacteria 137883
486 Ga0495632_0000065 3300046519 Bacteria 116086
487 Ga0495632_0000129 3300046519 Bacteria 77134
488 Ga0495632_0000296 3300046519 Bacteria 48157
489 Ga0495632_0000445 3300046519 Bacteria 39318
490 Ga0495632_0002241 3300046519 Bacteria 14914
491 Ga0495632_0013411 3300046519 Bacteria 4678
492 Ga0495632_0013468 3300046519 Bacteria 4667
493 Ga0495632_0014339 3300046519 Bacteria 4487
494 Ga0495632_0018245 3300046519 Bacteria 3854
495 Ga0495632_0023960 3300046519 Bacteria 3250
496 Ga0495632_0025629 3300046519 Bacteria 3117
497 Ga0495637_0000019 3300046520 Bacteria 185953
498 Ga0495637_0000293 3300046520 Bacteria 38928
499 Ga0495637_0003878 3300046520 Bacteria 7849
500 Ga0495637_0015401 3300046520 Bacteria 3585
501 Ga0495637_0023477 3300046520 Bacteria 2802
502 Ga0495637_0025683 3300046520 Bacteria 2652
503 Ga0495637_0031841 3300046520 Bacteria 2329
504 Ga0495637_0046503 3300046520 Bacteria 1835
505 Ga0495637_0047426 3300046520 Bacteria 1813
506 Ga0495643_0000030 3300046522 Bacteria 260229
507 Ga0495643_0000081 3300046522 Bacteria 160004
508 Ga0495643_0000234 3300046522 Bacteria 84022
509 Ga0495643_0000259 3300046522 Bacteria 77609
510 Ga0495643_0000391 3300046522 Bacteria 57750
511 Ga0495643_0003298 3300046522 Bacteria 11926
512 Ga0495643_0005676 3300046522 Bacteria 8363
513 Ga0495643_0038465 3300046522 Bacteria 2620
514 Ga0495643_0039291 3300046522 Bacteria 2589
515 Ga0495643_0045127 3300046522 Bacteria 2393
516 Ga0495643_0110145 3300046522 Bacteria 1401
517 Ga0495643_0114352 3300046522 Bacteria 1369
518 Ga0495643_0135447 3300046522 Bacteria 1233
519 Ga0495644_0005954 3300046523 Bacteria 4753
520 Ga0495644_0013952 3300046523 Bacteria 3080
521 Ga0495644_0022314 3300046523 Bacteria 2412
522 Ga0495644_0026508 3300046523 Bacteria 2198
523 Ga0495644_0039788 3300046523 Bacteria 1772
524 Ga0495644_0082294 3300046523 Bacteria 1213
525 Ga0495648_0000030 3300046524 Bacteria 216178
526 Ga0495648_0001105 3300046524 Bacteria 27423
527 Ga0495648_0002123 3300046524 Bacteria 18676
528 Ga0495648_0002372 3300046524 Bacteria 17491
529 Ga0495648_0003335 3300046524 Bacteria 14162
530 Ga0495648_0006165 3300046524 Bacteria 9831
531 Ga0495648_0016682 3300046524 Bacteria 5286
532 Ga0495648_0020755 3300046524 Bacteria 4570
533 Ga0495648_0024723 3300046524 Bacteria 4081
534 Ga0495663_0000003 3300046525 Bacteria 362694
535 Ga0495663_0017735 3300046525 Bacteria 2022
536 Ga0495663_0056308 3300046525 Bacteria 1228
537 Ga0495663_0077534 3300046525 Bacteria 1066
538 Ga0495666_0001974 3300046526 Bacteria 10124
539 Ga0495666_0071989 3300046526 Bacteria 1642
540 Ga0495666_0120197 3300046526 Bacteria 1231
541 Ga0495642_0000085 3300046528 Bacteria 54372
542 Ga0495642_0000285 3300046528 Bacteria 28471
543 Ga0495642_0002484 3300046528 Bacteria 7496
544 Ga0495642_0004658 3300046528 Bacteria 5312
545 Ga0495642_0032156 3300046528 Bacteria 2104
546 Ga0495642_0055346 3300046528 Bacteria 1637
547 Ga0495642_0064434 3300046528 Bacteria 1524
548 Ga0495642_0092782 3300046528 Bacteria 1279
549 Ga0495652_0033951 3300046529 Bacteria 4449
550 Ga0495654_0000014 3300046530 Bacteria 312126
551 Ga0495654_0002221 3300046530 Bacteria 12587
552 Ga0495654_0032258 3300046530 Bacteria 2656
553 Ga0495654_0041475 3300046530 Bacteria 2289
554 Ga0495654_0053621 3300046530 Bacteria 1959
555 Ga0495654_0054451 3300046530 Bacteria 1940
556 Ga0495665_0000967 3300046531 Bacteria 15211
557 Ga0495665_0002029 3300046531 Bacteria 10962
558 Ga0495665_0230130 3300046531 Bacteria 957
559 Ga0495586_0005932 3300046535 Bacteria 6538
560 Ga0495586_0348831 3300046535 Bacteria 850
561 Ga0495587_0012506 3300046536 Bacteria 5338
562 Ga0495587_0047406 3300046536 Bacteria 2548
563 Ga0495609_0000019 3300046538 Bacteria 297777
564 Ga0495609_0000298 3300046538 Bacteria 45867
565 Ga0495609_0000447 3300046538 Bacteria 33815
566 Ga0495609_0001963 3300046538 Bacteria 13048
567 Ga0495609_0002362 3300046538 Bacteria 11646
568 Ga0495609_0004683 3300046538 Bacteria 7409
569 Ga0495609_0005513 3300046538 Bacteria 6618
570 Ga0495609_0011763 3300046538 Bacteria 4161
571 Ga0495609_0017035 3300046538 Bacteria 3380
572 Ga0495609_0039371 3300046538 Bacteria 2128
573 Ga0495609_0071947 3300046538 Bacteria 1519
574 Ga0495597_0000020 3300046542 Bacteria 161793
575 Ga0495597_0000226 3300046542 Bacteria 51108
576 Ga0495597_0000378 3300046542 Bacteria 38615
577 Ga0495597_0000771 3300046542 Bacteria 25342
578 Ga0495597_0010567 3300046542 Bacteria 4504
579 Ga0495597_0027187 3300046542 Bacteria 2624
580 Ga0495597_0049366 3300046542 Bacteria 1859
581 Ga0495597_0059891 3300046542 Bacteria 1661
582 Ga0495597_0079802 3300046542 Bacteria 1401
583 Ga0495622_0000002 3300046557 Bacteria 321742
584 Ga0495622_0001564 3300046557 Bacteria 11352
585 Ga0495622_0020979 3300046557 Bacteria 3042
586 Ga0495622_0038190 3300046557 Bacteria 2236
587 Ga0495622_0055342 3300046557 Bacteria 1840
588 Ga0495622_0115500 3300046557 Bacteria 1227
589 Ga0495633_0000215 3300046558 Bacteria 72445
590 Ga0495633_0002968 3300046558 Bacteria 11604
591 Ga0495633_0003511 3300046558 Bacteria 10400
592 Ga0495633_0006036 3300046558 Bacteria 7265
593 Ga0495633_0009986 3300046558 Bacteria 5208
594 Ga0495633_0030221 3300046558 Bacteria 2633
595 Ga0495633_0033386 3300046558 Bacteria 2481
596 Ga0495633_0044780 3300046558 Bacteria 2097
597 Ga0495633_0051377 3300046558 Bacteria 1942
598 Ga0495633_0091548 3300046558 Bacteria 1414
599 Ga0495633_0102959 3300046558 Bacteria 1325
600 Ga0495633_0143858 3300046558 Bacteria 1102
601 Ga0495656_0009349 3300046615 Bacteria 3523
602 Ga0495656_0009453 3300046615 Bacteria 3505
603 Ga0495656_0012450 3300046615 Bacteria 3139
604 Ga0495656_0127214 3300046615 Bacteria 1209
605 Ga0495656_0129691 3300046615 Bacteria 1199
606 Ga0495668_0000066 3300046616 Bacteria 178533
607 Ga0495668_0000579 3300046616 Bacteria 44604
608 Ga0495668_0000712 3300046616 Bacteria 40090
609 Ga0495668_0000941 3300046616 Bacteria 32463
610 Ga0495668_0006113 3300046616 Bacteria 7971
611 Ga0495668_0008725 3300046616 Bacteria 6294
612 Ga0495668_0014985 3300046616 Bacteria 4536
613 Ga0495668_0018432 3300046616 Bacteria 4033
614 Ga0495668_0025349 3300046616 Bacteria 3370
615 Ga0495668_0026700 3300046616 Bacteria 3275
616 Ga0495668_0028787 3300046616 Bacteria 3140
617 Ga0495634_0110452 3300046642 Bacteria 1768
618 Ga0495611_0000195 3300046648 Bacteria 42925
619 Ga0495611_0000773 3300046648 Bacteria 17861
620 Ga0495611_0005640 3300046648 Bacteria 5337
621 Ga0495611_0012256 3300046648 Bacteria 3645
622 Ga0495611_0013207 3300046648 Bacteria 3514
623 Ga0495611_0021422 3300046648 Bacteria 2792
624 Ga0495625_0000931 3300046660 Bacteria 39360
625 Ga0495625_0003303 3300046660 Bacteria 16271
626 Ga0495625_0006597 3300046660 Bacteria 10306
627 Ga0495625_0007223 3300046660 Bacteria 9722
628 Ga0495625_0008059 3300046660 Bacteria 9034
629 Ga0495625_0009200 3300046660 Bacteria 8297
630 Ga0495625_0009398 3300046660 Bacteria 8184
631 Ga0495625_0016910 3300046660 Bacteria 5725
632 Ga0495625_0042605 3300046660 Bacteria 3297
633 Ga0495625_0045391 3300046660 Bacteria 3177
634 Ga0495625_0053402 3300046660 Bacteria 2890
635 Ga0495625_0070958 3300046660 Bacteria 2445
636 Ga0495625_0079450 3300046660 Bacteria 2287
637 Ga0495625_0262301 3300046660 Bacteria 1118
638 Ga0495635_0080820 3300046663 Bacteria 2224
639 Ga0495661_0000012 3300046665 Bacteria 276804
640 Ga0495661_0001056 3300046665 Bacteria 24401
641 Ga0495661_0001625 3300046665 Bacteria 18404
642 Ga0495661_0001753 3300046665 Bacteria 17440
643 Ga0495661_0002244 3300046665 Bacteria 14973
644 Ga0495661_0002879 3300046665 Bacteria 13017
645 Ga0495661_0003589 3300046665 Bacteria 11417
646 Ga0495661_0005577 3300046665 Bacteria 8923
647 Ga0495661_0019699 3300046665 Bacteria 4416
648 Ga0495661_0025401 3300046665 Bacteria 3825
649 Ga0495661_0025719 3300046665 Bacteria 3799
650 Ga0495661_0025738 3300046665 Bacteria 3797
651 Ga0495661_0029391 3300046665 Bacteria 3508
652 Ga0495661_0032133 3300046665 Bacteria 3321
653 Ga0495661_0036722 3300046665 Bacteria 3064
654 Ga0495661_0042148 3300046665 Bacteria 2816
655 Ga0495661_0054609 3300046665 Bacteria 2397
656 Ga0495661_0062250 3300046665 Bacteria 2211
657 Ga0495661_0064810 3300046665 Bacteria 2154
658 Ga0495661_0070399 3300046665 Bacteria 2047
659 Ga0495661_0087318 3300046665 Bacteria 1783
660 Ga0495661_0134895 3300046665 Bacteria 1348
661 Ga0495661_0138143 3300046665 Bacteria 1328
662 Ga0495661_0186158 3300046665 Bacteria 1097
663 Ga0495661_0208321 3300046665 Bacteria 1019
664 Ga0495588_0000050 3300046674 Bacteria 335314
665 Ga0495588_0004204 3300046674 Bacteria 6348
666 Ga0495588_0005098 3300046674 Bacteria 5838
667 Ga0495588_0014664 3300046674 Bacteria 3757
668 Ga0495588_0039624 3300046674 Bacteria 2401
669 Ga0495623_0011819 3300046679 Bacteria 5656
670 Ga0495646_0249751 3300046680 Bacteria 951
671 Ga0495669_0000177 3300046684 Bacteria 40130
672 Ga0495669_0001901 3300046684 Bacteria 8561
673 Ga0495669_0002014 3300046684 Bacteria 8331
674 Ga0495669_0004319 3300046684 Bacteria 5865
675 Ga0495669_0004923 3300046684 Bacteria 5543
676 Ga0495669_0006645 3300046684 Bacteria 4837
677 Ga0495669_0017491 3300046684 Bacteria 3077
678 Ga0495669_0025856 3300046684 Bacteria 2563
679 Ga0495669_0136775 3300046684 Bacteria 1155
680 Ga0495613_0021419 3300046689 Bacteria 4819
681 Ga0495613_0127856 3300046689 Bacteria 1821
682 Ga0495624_0012500 3300046690 Bacteria 5799
683 Ga0495670_0000099 3300046691 Bacteria 37893
684 Ga0495670_0000845 3300046691 Bacteria 14804
685 Ga0495670_0002249 3300046691 Bacteria 9520
686 Ga0495670_0004826 3300046691 Bacteria 6621
687 Ga0495670_0014837 3300046691 Bacteria 3835
688 Ga0495670_0015496 3300046691 Bacteria 3745
689 Ga0495670_0015603 3300046691 Bacteria 3732
690 Ga0495670_0073028 3300046691 Bacteria 1738
691 Ga0495670_0124261 3300046691 Bacteria 1342
692 Ga0495670_0155901 3300046691 Bacteria 1198
693 Ga0495671_0000005 3300046692 Bacteria 509397
694 Ga0495671_0000043 3300046692 Bacteria 163036
695 Ga0495671_0000965 3300046692 Bacteria 20129
696 Ga0495671_0001044 3300046692 Bacteria 19266
697 Ga0495671_0002730 3300046692 Bacteria 11054
698 Ga0495671_0003679 3300046692 Bacteria 9336
699 Ga0495671_0009092 3300046692 Bacteria 5567
700 Ga0495671_0013778 3300046692 Bacteria 4366
701 Ga0495671_0020586 3300046692 Bacteria 3475
702 Ga0495671_0027738 3300046692 Bacteria 2921
703 Ga0495671_0055345 3300046692 Bacteria 1965
704 Ga0495649_0000277 3300046694 Bacteria 45216
705 Ga0495649_0000925 3300046694 Bacteria 23262
706 Ga0495649_0001478 3300046694 Bacteria 17648
707 Ga0495649_0002415 3300046694 Bacteria 13178
708 Ga0495649_0007497 3300046694 Bacteria 6640
709 Ga0495649_0009530 3300046694 Bacteria 5761
710 Ga0495649_0013410 3300046694 Bacteria 4728
711 Ga0495649_0021575 3300046694 Bacteria 3608
712 Ga0495649_0024486 3300046694 Bacteria 3365
713 Ga0495649_0033919 3300046694 Bacteria 2809
714 Ga0495649_0037742 3300046694 Bacteria 2651
715 Ga0495649_0123923 3300046694 Bacteria 1365
716 Ga0495589_0000007 3300046794 Bacteria 276444
717 Ga0495589_0000145 3300046794 Bacteria 65639
718 Ga0495589_0002088 3300046794 Bacteria 11298
719 Ga0495589_0008988 3300046794 Bacteria 5198
720 Ga0495589_0017726 3300046794 Bacteria 3654
721 Ga0495589_0022401 3300046794 Bacteria 3223
722 Ga0495589_0038226 3300046794 Bacteria 2403
723 Ga0495589_0047301 3300046794 Bacteria 2132
724 Ga0495589_0052226 3300046794 Bacteria 2020
725 Ga0495589_0059031 3300046794 Bacteria 1886
726 Ga0495589_0062732 3300046794 Bacteria 1823
727 Ga0495589_0103003 3300046794 Bacteria 1380
728 Ga0495589_0126147 3300046794 Bacteria 1231
729 Ga0495660_0000100 3300046810 Bacteria 92354
730 Ga0495660_0000779 3300046810 Bacteria 23870
731 Ga0495660_0002034 3300046810 Bacteria 13147
732 Ga0495660_0002236 3300046810 Bacteria 12458
733 Ga0495660_0004798 3300046810 Bacteria 8157
734 Ga0495660_0006085 3300046810 Bacteria 7165
735 Ga0495660_0007481 3300046810 Bacteria 6413
736 Ga0495660_0011314 3300046810 Bacteria 5181
737 Ga0495660_0011889 3300046810 Bacteria 5050
738 Ga0495660_0013655 3300046810 Bacteria 4709
739 Ga0495660_0015327 3300046810 Bacteria 4428
740 Ga0495660_0059833 3300046810 Bacteria 2048
741 Ga0495660_0114702 3300046810 Bacteria 1370
742 Ga0495581_0013823 3300047315 Bacteria 4678
743 Ga0495581_0069182 3300047315 Bacteria 2041
744 Ga0495604_0017012 3300047317 Bacteria 5815
745 Ga0495604_0062481 3300047317 Bacteria 2844
746 Ga0495604_0323950 3300047317 Bacteria 1029
747 Ga0495636_0010960 3300047318 Bacteria 3589
748 Ga0495672_0000041 3300047320 Bacteria 267545
749 Ga0495672_0000188 3300047320 Bacteria 89538
750 Ga0495672_0000226 3300047320 Bacteria 80307
751 Ga0495672_0000272 3300047320 Bacteria 71551
752 Ga0495672_0007001 3300047320 Bacteria 8570
753 Ga0495672_0011006 3300047320 Bacteria 6410
754 Ga0495672_0020577 3300047320 Bacteria 4318
755 Ga0495672_0072364 3300047320 Bacteria 1947
756 Ga0495672_0077174 3300047320 Bacteria 1868
757 Ga0495672_0197651 3300047320 Bacteria 1007
758 Ga0495676_0000037 3300047321 Bacteria 115856
759 Ga0495676_0043115 3300047321 Bacteria 3696
760 Ga0495676_0127562 3300047321 Bacteria 1841
761 Ga0495680_0005077 3300047322 Bacteria 12424
762 Ga0495680_0021570 3300047322 Bacteria 5390
763 Ga0495683_0000763 3300047323 Bacteria 23208
764 Ga0495683_0001975 3300047323 Bacteria 12798
765 Ga0495683_0009910 3300047323 Bacteria 5060
766 Ga0495683_0011455 3300047323 Bacteria 4667
767 Ga0495683_0023237 3300047323 Bacteria 3188
768 Ga0495683_0051917 3300047323 Bacteria 2048
769 Ga0495683_0075001 3300047323 Bacteria 1657
770 Ga0495683_0115975 3300047323 Bacteria 1275
771 Ga0495683_0156977 3300047323 Bacteria 1054
772 Ga0495687_000003 3300047443 Bacteria 859509
773 Ga0495687_000016 3300047443 Bacteria 359237
774 Ga0495687_000028 3300047443 Bacteria 293356
775 Ga0495687_000417 3300047443 Bacteria 52512
776 Ga0495687_001550 3300047443 Bacteria 20895
777 Ga0495687_046170 3300047443 Bacteria 1882
778 Ga0495675_0101663 3300047444 Bacteria 1798
779 Ga0495677_0000005 3300047445 Bacteria 243336
780 Ga0495677_0000210 3300047445 Bacteria 26828
781 Ga0495677_0000722 3300047445 Bacteria 13347
782 Ga0495677_0002621 3300047445 Bacteria 7038
783 Ga0495677_0003870 3300047445 Bacteria 5785
784 Ga0495677_0005985 3300047445 Bacteria 4604
785 Ga0495677_0011091 3300047445 Bacteria 3299
786 Ga0495677_0017220 3300047445 Bacteria 2620
787 Ga0495677_0020456 3300047445 Bacteria 2399
788 Ga0495677_0125269 3300047445 Bacteria 981
789 Ga0495677_0211802 3300047445 Bacteria 754
790 Ga0495679_002173 3300047446 Bacteria 10289
791 Ga0495679_005976 3300047446 Bacteria 5320
792 Ga0495679_008263 3300047446 Bacteria 4247
793 Ga0495679_022179 3300047446 Bacteria 2177
794 Ga0495679_041848 3300047446 Bacteria 1416
795 Ga0495685_005235 3300047447 Bacteria 4223
796 Ga0495685_019404 3300047447 Bacteria 2336
797 Ga0495685_039044 3300047447 Bacteria 1625
798 Ga0495673_0000008 3300047469 Bacteria 752462
799 Ga0495673_0000012 3300047469 Bacteria 656908
800 Ga0495673_0000702 3300047469 Bacteria 32531
801 Ga0495673_0068437 3300047469 Bacteria 1500
802 Ga0495673_0092700 3300047469 Bacteria 1232
803 Ga0495681_0000123 3300047470 Bacteria 68069
804 Ga0495681_0003758 3300047470 Bacteria 10527
805 Ga0495681_0004627 3300047470 Bacteria 9339
806 Ga0495681_0005829 3300047470 Bacteria 8182
807 Ga0495681_0007875 3300047470 Bacteria 6737
808 Ga0495681_0008039 3300047470 Bacteria 6650
809 Ga0495681_0027026 3300047470 Bacteria 2976
810 Ga0495681_0081491 3300047470 Bacteria 1443
811 Ga0495681_0099096 3300047470 Bacteria 1276
812 Ga0495681_0104627 3300047470 Bacteria 1233
813 Ga0495681_0201059 3300047470 Bacteria 808
814 Ga0495686_0000054 3300047472 Bacteria 259400
815 Ga0495686_0000732 3300047472 Bacteria 43872
816 Ga0495686_0003051 3300047472 Bacteria 14839
817 Ga0495686_0003612 3300047472 Bacteria 13268
818 Ga0495686_0012570 3300047472 Bacteria 5918
819 Ga0495686_0019149 3300047472 Bacteria 4578
820 Ga0495686_0039828 3300047472 Bacteria 2999
821 Ga0495686_0041746 3300047472 Bacteria 2919
822 Ga0495686_0066042 3300047472 Bacteria 2236
823 Ga0495686_0233483 3300047472 Bacteria 1040
824 Ga0495593_0004899 3300047673 Bacteria 7939
825 Ga0495593_0014834 3300047673 Bacteria 4427
826 Ga0495593_0068663 3300047673 Bacteria 1844
827 Ga0495614_0008021 3300048089 Bacteria 4693
828 Ga0495614_0010244 3300048089 Bacteria 4134
829 Ga0495626_0000004 3300048091 Bacteria 356599
830 Ga0495626_0000322 3300048091 Bacteria 50407
831 Ga0495626_0003241 3300048091 Bacteria 10532
832 Ga0495626_0003747 3300048091 Bacteria 9576
833 Ga0495626_0004117 3300048091 Bacteria 9034
834 Ga0495626_0004329 3300048091 Bacteria 8751
835 Ga0495626_0006298 3300048091 Bacteria 6769
836 Ga0495626_0006531 3300048091 Bacteria 6624
837 Ga0495626_0014964 3300048091 Bacteria 3980
838 Ga0495626_0016531 3300048091 Bacteria 3744
839 Ga0495626_0025116 3300048091 Bacteria 2916
840 Ga0495626_0025984 3300048091 Bacteria 2858
841 Ga0495626_0026914 3300048091 Bacteria 2798
842 Ga0495626_0041785 3300048091 Bacteria 2156
843 Ga0495626_0057082 3300048091 Bacteria 1786
844 Ga0495626_0065753 3300048091 Bacteria 1640
845 Ga0496100_0059302 3300048903 Bacteria 2514
846 Ga0496101_0020477 3300048904 Bacteria 4530
847 Ga0496101_0112071 3300048904 Bacteria 2055
848 Ga0496102_0000931 3300048905 Bacteria 27579
849 Ga0496102_0011417 3300048905 Bacteria 7657
850 Ga0496102_0030581 3300048905 Bacteria 4820
851 Ga0496102_0122227 3300048905 Bacteria 2432
852 Ga0496102_0174486 3300048905 Bacteria 2024
853 Ga0496102_0196686 3300048905 Bacteria 1900
854 Ga0496103_0007939 3300048906 Bacteria 6308
855 Ga0496103_0346197 3300048906 Bacteria 956
856 Ga0496106_0012244 3300048909 Bacteria 6332
857 Ga0496107_0017128 3300048910 Bacteria 5096
858 Ga0496107_0049247 3300048910 Bacteria 3036
859 Ga0496109_0115634 3300048912 Bacteria 2496
860 Ga0496109_0229130 3300048912 Bacteria 1748
861 Ga0496109_0231317 3300048912 Bacteria 1739
862 Ga0496109_0439711 3300048912 Bacteria 1232
863 Ga0496110_0001119 3300048913 Bacteria 18923
864 Ga0496111_0060901 3300048914 Bacteria 2736
865 Ga0496113_0007519 3300048916 Bacteria 7021
866 Ga0496113_0353646 3300048916 Bacteria 1179
867 Ga0496114_0075065 3300048917 Bacteria 2847
868 Ga0496115_0101784 3300048918 Bacteria 2356
869 Ga0496116_0000382 3300048919 Bacteria 65862
870 Ga0496116_0015565 3300048919 Bacteria 6007
871 Ga0496117_0000100 3300048920 Bacteria 194307
872 Ga0496117_0000645 3300048920 Bacteria 56167
873 Ga0496117_0001645 3300048920 Bacteria 31400
874 Ga0496117_0003157 3300048920 Bacteria 19622
875 Ga0496117_0010742 3300048920 Bacteria 8277
876 Ga0496117_0035465 3300048920 Bacteria 3743
877 Ga0496117_0130556 3300048920 Bacteria 1523
878 Ga0496118_0000338 3300048921 Bacteria 80086
879 Ga0496118_0002116 3300048921 Bacteria 27830
880 Ga0496118_0004775 3300048921 Bacteria 15842
881 Ga0496118_0008860 3300048921 Bacteria 10291
882 Ga0496118_0038351 3300048921 Bacteria 3842
883 Ga0496119_0006814 3300048922 Bacteria 10473
884 Ga0496119_0037252 3300048922 Bacteria 3162
885 Ga0496120_0004314 3300048923 Bacteria 12040
886 Ga0496120_0014380 3300048923 Bacteria 5277
887 Ga0496121_0000589 3300048924 Bacteria 68077
888 Ga0496121_0026317 3300048924 Bacteria 5486
889 Ga0496121_0040615 3300048924 Bacteria 4078
890 Ga0496121_0059199 3300048924 Bacteria 3160
891 Ga0496121_0070409 3300048924 Bacteria 2817
892 Ga0496121_0147814 3300048924 Bacteria 1734
893 Ga0496121_0258550 3300048924 Bacteria 1203
894 Ga0496122_0000210 3300048925 Bacteria 130178
895 Ga0496122_0000808 3300048925 Bacteria 60057
896 Ga0496122_0005126 3300048925 Bacteria 15811
897 Ga0496122_0009079 3300048925 Bacteria 10545
898 Ga0496122_0019722 3300048925 Bacteria 6144
899 Ga0496122_0034402 3300048925 Bacteria 4146
900 Ga0496122_0055038 3300048925 Bacteria 2981
901 Ga0496122_0106936 3300048925 Bacteria 1850
902 Ga0496122_0168599 3300048925 Bacteria 1323
903 Ga0496123_0000591 3300048926 Bacteria 61801
904 Ga0496123_0000597 3300048926 Bacteria 61302
905 Ga0496123_0001320 3300048926 Bacteria 35029
906 Ga0496123_0003625 3300048926 Bacteria 17092
907 Ga0496123_0005021 3300048926 Bacteria 13544
908 Ga0496123_0023774 3300048926 Bacteria 4681
909 Ga0496123_0066312 3300048926 Bacteria 2287
910 Ga0496123_0085817 3300048926 Bacteria 1891
911 Ga0496123_0128076 3300048926 Bacteria 1413
912 Ga0496123_0143417 3300048926 Bacteria 1301
913 Ga0496123_0161496 3300048926 Bacteria 1194
914 Ga0496124_0000056 3300048927 Bacteria 250907
915 Ga0496124_0000425 3300048927 Bacteria 75572
916 Ga0496124_0001066 3300048927 Bacteria 43350
917 Ga0496124_0004210 3300048927 Bacteria 16937
918 Ga0496124_0010799 3300048927 Bacteria 9202
919 Ga0496124_0022742 3300048927 Bacteria 5740
920 Ga0496124_0023861 3300048927 Bacteria 5572
921 Ga0496124_0035413 3300048927 Bacteria 4368
922 Ga0496124_0037634 3300048927 Bacteria 4206
923 Ga0496124_0054728 3300048927 Bacteria 3376
924 Ga0496124_0069987 3300048927 Bacteria 2911
925 Ga0496124_0114901 3300048927 Bacteria 2161
926 Ga0496124_0129593 3300048927 Bacteria 2005
927 Ga0496124_0324435 3300048927 Bacteria 1101
928 Ga0496125_0000245 3300048928 Bacteria 111310
929 Ga0496125_0000789 3300048928 Bacteria 51669
930 Ga0496125_0003880 3300048928 Bacteria 17674
931 Ga0496125_0004750 3300048928 Bacteria 15481
932 Ga0496125_0023862 3300048928 Bacteria 5637
933 Ga0496125_0042739 3300048928 Bacteria 3855
934 Ga0496125_0077384 3300048928 Bacteria 2564
935 Ga0496125_0078919 3300048928 Bacteria 2527
936 Ga0496125_0145313 3300048928 Bacteria 1640
937 Ga0496125_0222157 3300048928 Bacteria 1216
938 Ga0496125_0350107 3300048928 Bacteria 883
939 Ga0496126_0022618 3300048929 Bacteria 6110
940 Ga0496126_0101114 3300048929 Bacteria 2522
941 Ga0496126_0125425 3300048929 Bacteria 2222
942 Ga0496126_0406116 3300048929 Bacteria 1104
943 Ga0495678_000006 3300049459 Bacteria 463690
944 Ga0495678_000130 3300049459 Bacteria 88909
945 Ga0495678_000233 3300049459 Bacteria 63499
946 Ga0495678_001703 3300049459 Bacteria 16504
947 Ga0495678_001985 3300049459 Bacteria 14727
948 Ga0495678_002123 3300049459 Bacteria 14081
949 Ga0495678_018410 3300049459 Bacteria 3141
950 Ga0495678_020704 3300049459 Bacteria 2906
951 Ga0495682_0000107 3300049460 Bacteria 73486
952 Ga0495682_0001172 3300049460 Bacteria 14944
953 Ga0495682_0011704 3300049460 Bacteria 3371
954 Ga0495682_0030101 3300049460 Bacteria 2009
955 Ga0495682_0068963 3300049460 Bacteria 1273
956 Ga0495682_0085817 3300049460 Bacteria 1131
957 Ga0501032_0189417 3300049569 Bacteria 1345
958 Ga0501034_0166710 3300049571 Bacteria 2171
959 Ga0501034_0191130 3300049571 Bacteria 2009
960 Ga0501034_0339289 3300049571 Bacteria 1433
961 Ga0501034_0505333 3300049571 Bacteria 1122
962 Ga0501047_0235227 3300049581 Bacteria 1684
963 Ga0501227_005034 3300049665 Bacteria 2838
964 Ga0501249_004483 3300049679 Bacteria 2836
965 Ga0501269_000016 3300049766 Bacteria 58863
966 Ga0501269_001654 3300049766 Bacteria 2850
967 Ga0501035_0018733 3300049822 Bacteria 6376
968 Ga0501035_0148309 3300049822 Bacteria 2037
969 Ga0501044_0177987 3300049823 Bacteria 2095
970 Ga0501044_0389883 3300049823 Bacteria 1307
971 nmdc:mga03n38_225856_c1 3300050490 Bacteria 979
972 nmdc:mga00v17_23_c1 3300050491 Bacteria 43132
973 nmdc:mga00v17_33669_c1 3300050491 Bacteria 3037
974 nmdc:mga00v17_62366_c1 3300050491 Bacteria 2293
975 Ga0500643_000362 3300053087 Bacteria 35932
976 Ga0500641_0072413 3300053096 Bacteria 1452
977 Ga0500555_000370 3300053103 Bacteria 19042
978 Ga0500618_000088 3300053125 Bacteria 74892
979 Ga0500618_000519 3300053125 Bacteria 24282
980 Ga0500618_009889 3300053125 Bacteria 2585
981 Ga0500559_0004652 3300053136 Bacteria 6469
982 Ga0500564_178817 3300053138 Bacteria 886
983 Ga0500568_0023303 3300053139 Bacteria 2634
984 Ga0500604_0014012 3300053151 Bacteria 2179
985 Ga0500627_0008381 3300053158 Bacteria 3668
986 Ga0500634_0000386 3300053161 Bacteria 14126
987 Ga0587084_000853 3300059477 Bacteria 2651
988 Ga0587066_001081 3300059490 Bacteria 2609
989 Ga0587070_001403 3300059491 Bacteria 2477
990 Ga0587077_003339 3300059493 Bacteria 2008
991 Ga0587085_005580 3300059506 Bacteria 1488
992 Ga0587090_004877 3300059510 Bacteria 1653
993 Ga0587091_002339 3300059511 Bacteria 2231
994 Ga0587101_001671 3300059623 Bacteria 1965
995 Ga0587109_008309 3300059624 Bacteria 1598
996 Ga0587117_004643 3300059627 Bacteria 1442
997 Ga0587062_002637 3300059639 Bacteria 1732
998 Ga0587067_003478 3300059640 Bacteria 1971
999 Ga0587076_001114 3300059645 Bacteria 2622
1000 Ga0587100_000181 3300059648 Bacteria 2598
1001 Ga0587111_0008704 3300060346 Bacteria 1691

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0197651 Ga0495672_0197651_323_991 215
2 3300041411 Ga0439466_0032146 Ga0439466_0032146_27_698 223
3 3300045836 Ga0466958_0108722 Ga0466958_0108722_24_695 223
4 3300046513 Ga0495616_0172039 Ga0495616_0172039_265_957 223
5 3300047445 Ga0495677_0211802 Ga0495677_0211802_13_684 223
6 3300047470 Ga0495681_0201059 Ga0495681_0201059_26_745 235
7 3300046674 Ga0495588_0039624 Ga0495588_0039624_10_729 239
8 iso_pu_bacteria 2643221588 2643949730 241
9 3300025295 Ga0209564_1001636 Ga0209564_100163613 243
10 3300003781 Ga0055536_1000820 Ga0055536_100082017 244
11 3300003794 Ga0055531_10001146 Ga0055531_1000114617 244
12 3300025292 Ga0209676_1001558 Ga0209676_100155818 244
13 3300025298 Ga0209050_1015681 Ga0209050_10156814 244
14 3300025299 Ga0209256_1000921 Ga0209256_100092120 244
15 3300025304 Ga0209257_1001484 Ga0209257_100148418 244
16 3300003771 Ga0055526_1000116 Ga0055526_100011656 245
17 3300003791 Ga0055530_10000529 Ga0055530_1000052919 245
18 3300003794 Ga0055531_10000165 Ga0055531_100001653 245
19 3300025295 Ga0209564_1000202 Ga0209564_100020216 245
20 3300025298 Ga0209050_1000069 Ga0209050_100006934 245
21 3300025735 Ga0207713_1042527 Ga0207713_10425272 245
22 3300046501 Ga0495607_0001650 Ga0495607_0001650_12_749 245
23 3300046501 Ga0495607_0019636 Ga0495607_0019636_3540_4277 245
24 3300046665 Ga0495661_0019699 Ga0495661_0019699_12_749 245
25 3300046694 Ga0495649_0009530 Ga0495649_0009530_5008_5745 245
26 iso_pu_bacteria 2834028612 2834030082 245
27 iso_pu_bacteria 8056131705 8056134978 246
28 iso_pu_bacteria 2599185167 2599401838 247
29 iso_pu_bacteria 2599185179 2599453971 247
30 iso_pu_bacteria 2599185190 2599515545 247
31 iso_pu_bacteria 2599185191 2599521350 247
32 iso_pu_bacteria 2599185288 2599881171 247
33 iso_pu_bacteria 2599185290 2599894924 247
34 iso_pu_bacteria 2599185303 2599949544 247
35 iso_pu_bacteria 2675903420 2677901038 247
36 iso_pu_bacteria 2738541294 2738810409 247
37 iso_pu_bacteria 2738541309 2738897769 247
38 iso_pu_bacteria 2929189879 2929192820 247
39 iso_pu_bacteria 2931390751 2931394224 247
40 iso_pu_bacteria 2945928738 2945933753 247
41 iso_pu_bacteria 2945961074 2945963935 247
42 iso_pu_bacteria 2946027586 2946031158 247
43 iso_pu_bacteria 2947233263 2947237556 247
44 iso_pu_bacteria 8055817908 8055820576 247
45 iso_pu_bacteria 8056148874 8056154544 247
46 iso_pu_bacteria 8056161164 8056166363 247
47 3300046680 Ga0495646_0249751 Ga0495646_0249751_53_799 248
48 3300005288 Ga0065714_10064654 Ga0065714_1006465423 249
49 3300013100 Ga0157373_10006159 Ga0157373_100061591 249
50 3300013100 Ga0157373_10025897 Ga0157373_100258972 249
51 3300014497 Ga0182008_10003524 Ga0182008_100035241 249
52 3300015262 Ga0182007_10003019 Ga0182007_100030192 249
53 3300030521 Ga0307511_10061742 Ga0307511_100617423 249
54 3300046518 Ga0495631_0127202 Ga0495631_0127202_304_1053 249
55 3300046665 Ga0495661_0002879 Ga0495661_0002879_8460_9209 249
56 3300046694 Ga0495649_0024486 Ga0495649_0024486_1653_2402 249
57 3300047446 Ga0495679_005976 Ga0495679_005976_598_1347 249
58 3300048912 Ga0496109_0439711 Ga0496109_0439711_124_873 249
59 3300048927 Ga0496124_0069987 Ga0496124_0069987_1716_2465 249
60 3300053161 Ga0500634_0000386 Ga0500634_0000386_13177_13926 249
61 iso_pu_bacteria 2808606385 2808978416 249
62 iso_pu_bacteria 2808606388 2808994057 249
63 iso_pu_bacteria 2823421272 2823421295 249
64 iso_pu_bacteria 2852612431 2852617558 249
65 iso_pu_bacteria 2852667396 2852672323 249
66 iso_pu_bacteria 2919476304 2919479716 249
67 iso_pu_bacteria 2946006987 2946010172 249
68 iso_pu_bacteria 8054285046 8054286389 249
69 iso_pu_bacteria 8054503363 8054505932 249
70 3300002737 JGI25162J39368_1000004 JGI25162J39368_100000429 250
71 3300002771 JGI25163J39215_1000047 JGI25163J39215_100004725 250
72 3300002772 JGI25164J39214_1000031 JGI25164J39214_100003129 250
73 3300003214 JGI25165J46597_1000011 JGI25165J46597_100001129 250
74 3300003781 Ga0055536_1000014 Ga0055536_1000014163 250
75 3300003791 Ga0055530_10000126 Ga0055530_1000012646 250
76 3300003792 Ga0055540_1000566 Ga0055540_10005668 250
77 3300005289 Ga0065704_10092201 Ga0065704_100922013 250
78 3300005331 Ga0070670_100000087 Ga0070670_10000008732 250
79 3300009148 Ga0105243_10007675 Ga0105243_100076753 250
80 3300013102 Ga0157371_10004329 Ga0157371_1000432914 250
81 3300014497 Ga0182008_10000261 Ga0182008_100002612 250
82 3300025207 Ga0209760_100032 Ga0209760_100032107 250
83 3300025231 Ga0207427_100003 Ga0207427_10000329 250
84 3300025233 Ga0209437_100002 Ga0209437_100002984 250
85 3300025261 Ga0209233_1000004 Ga0209233_1000004441 250
86 3300025292 Ga0209676_1000003 Ga0209676_1000003742 250
87 3300025298 Ga0209050_1000004 Ga0209050_1000004724 250
88 3300025303 Ga0209051_1000006 Ga0209051_1000006251 250
89 3300025925 Ga0207650_10000418 Ga0207650_1000041810 250
90 3300025935 Ga0207709_10004470 Ga0207709_100044703 250
91 3300041411 Ga0439466_0000574 Ga0439466_0000574_11442_12206 250
92 3300047320 Ga0495672_0007001 Ga0495672_0007001_7319_8083 250
93 3300048919 Ga0496116_0000382 Ga0496116_0000382_7255_8019 250
94 3300048920 Ga0496117_0001645 Ga0496117_0001645_5586_6350 250
95 3300048921 Ga0496118_0004775 Ga0496118_0004775_12095_12859 250
96 3300048924 Ga0496121_0000589 Ga0496121_0000589_59908_60672 250
97 3300048925 Ga0496122_0005126 Ga0496122_0005126_99_863 250
98 3300048926 Ga0496123_0001320 Ga0496123_0001320_27187_27951 250
99 iso_pu_bacteria 2511231006 2511265866 250
100 iso_pu_bacteria 2512047018 2512329148 250
101 iso_pu_bacteria 2554235341 2555670074 250
102 iso_pu_bacteria 2582580891 2583792341 250
103 iso_pu_bacteria 2597489887 2597858049 250
104 iso_pu_bacteria 2597489888 2597863717 250
105 iso_pu_bacteria 2599185160 2599352892 250
106 iso_pu_bacteria 2599185161 2599359237 250
107 iso_pu_bacteria 2599185162 2599365242 250
108 iso_pu_bacteria 2599185163 2599371931 250
109 iso_pu_bacteria 2599185164 2599378000 250
110 iso_pu_bacteria 2599185165 2599384623 250
111 iso_pu_bacteria 2599185166 2599390789 250
112 iso_pu_bacteria 2599185168 2599402974 250
113 iso_pu_bacteria 2599185181 2599459726 250
114 iso_pu_bacteria 2599185182 2599465935 250
115 iso_pu_bacteria 2599185185 2599485082 250
116 iso_pu_bacteria 2599185186 2599488747 250
117 iso_pu_bacteria 2599185189 2599509180 250
118 iso_pu_bacteria 2599185257 2599802695 250
119 iso_pu_bacteria 2599185356 2600212333 250
120 iso_pu_bacteria 2600254931 2600366655 250
121 iso_pu_bacteria 2600255296 2601690471 250
122 iso_pu_bacteria 2600255313 2601772501 250
123 iso_pu_bacteria 2643221571 2643869799 250
124 iso_pu_bacteria 2643221713 2644621043 250
125 iso_pu_bacteria 2667528171 2671095531 250
126 iso_pu_bacteria 2671180172 2671769684 250
127 iso_pu_bacteria 2721755607 2723248999 250
128 iso_pu_bacteria 2740892503 2743737515 250
129 iso_pu_bacteria 2818991464 2819700992 250
130 iso_pu_bacteria 2842826826 2842831616 250
131 iso_pu_bacteria 2842837860 2842840132 250
132 iso_pu_bacteria 2844665904 2844670692 250
133 iso_pu_bacteria 2857564685 2857569760 250
134 iso_pu_bacteria 2917070673 2917073897 250
135 iso_pu_bacteria 2923153595 2923156556 250
136 iso_pu_bacteria 2935353572 2935357048 250
137 iso_pu_bacteria 2984286254 2984289518 250
138 iso_pu_bacteria 3007395558 3007395940 250
139 iso_pu_bacteria 637000220 637320439 250
140 iso_pu_bacteria 8015687852 8015690750 250
141 iso_pu_bacteria 8019769354 8019773250 250
142 iso_pu_bacteria 8054347763 8054348165 250
143 iso_pu_bacteria 8055770955 8055773887 250
144 iso_pu_bacteria 8057798959 8057800578 250
145 3300005290 Ga0065712_10009916 Ga0065712_100099161 251
146 3300005344 Ga0070661_100004776 Ga0070661_1000047763 251
147 3300005353 Ga0070669_100009854 Ga0070669_1000098548 251
148 3300005457 Ga0070662_100005950 Ga0070662_1000059507 251
149 3300005564 Ga0070664_100000044 Ga0070664_10000004452 251
150 3300005834 Ga0068851_10000752 Ga0068851_1000075214 251
151 3300009011 Ga0105251_10003715 Ga0105251_100037153 251
152 3300009011 Ga0105251_10005101 Ga0105251_100051016 251
153 3300009036 Ga0105244_10000134 Ga0105244_1000013450 251
154 3300009036 Ga0105244_10002934 Ga0105244_100029343 251
155 3300009036 Ga0105244_10206415 Ga0105244_102064152 251
156 3300009092 Ga0105250_10000661 Ga0105250_1000066113 251
157 3300009176 Ga0105242_10000661 Ga0105242_1000066116 251
158 3300009545 Ga0105237_10000116 Ga0105237_1000011637 251
159 3300009545 Ga0105237_10359267 Ga0105237_103592672 251
160 3300011119 Ga0105246_10001733 Ga0105246_100017339 251
161 3300011119 Ga0105246_10011605 Ga0105246_100116056 251
162 3300013100 Ga0157373_10011962 Ga0157373_100119627 251
163 3300013104 Ga0157370_10024498 Ga0157370_100244981 251
164 3300013105 Ga0157369_10007043 Ga0157369_100070434 251
165 3300013105 Ga0157369_10007727 Ga0157369_1000772712 251
166 3300013105 Ga0157369_10037652 Ga0157369_100376525 251
167 3300013308 Ga0157375_10003691 Ga0157375_100036917 251
168 3300013308 Ga0157375_10007576 Ga0157375_100075769 251
169 3300013308 Ga0157375_10121243 Ga0157375_101212432 251
170 3300017792 Ga0163161_10011745 Ga0163161_100117452 251
171 3300017792 Ga0163161_10013050 Ga0163161_100130507 251
172 3300017792 Ga0163161_10015040 Ga0163161_100150402 251
173 3300025321 Ga0207656_10000394 Ga0207656_1000039414 251
174 3300025711 Ga0207696_1000041 Ga0207696_100004182 251
175 3300025728 Ga0207655_1000191 Ga0207655_100019123 251
176 3300025728 Ga0207655_1014974 Ga0207655_10149744 251
177 3300025735 Ga0207713_1000682 Ga0207713_10006825 251
178 3300025735 Ga0207713_1008675 Ga0207713_10086752 251
179 3300025914 Ga0207671_10000166 Ga0207671_1000016646 251
180 3300025920 Ga0207649_10000056 Ga0207649_1000005625 251
181 3300025933 Ga0207706_10003731 Ga0207706_100037313 251
182 3300025945 Ga0207679_10000036 Ga0207679_1000003658 251
183 3300031731 Ga0307405_10001861 Ga0307405_1000186110 251
184 3300046512 Ga0495610_0069845 Ga0495610_0069845_434_1189 251
185 3300046794 Ga0495589_0002088 Ga0495589_0002088_2236_2991 251
186 3300048920 Ga0496117_0000100 Ga0496117_0000100_179383_180138 251
187 3300048920 Ga0496117_0035465 Ga0496117_0035465_1137_1892 251
188 3300048920 Ga0496117_0130556 Ga0496117_0130556_321_1076 251
189 3300048921 Ga0496118_0038351 Ga0496118_0038351_3021_3776 251
190 3300048922 Ga0496119_0006814 Ga0496119_0006814_62_817 251
191 3300048922 Ga0496119_0037252 Ga0496119_0037252_1356_2111 251
192 3300048923 Ga0496120_0004314 Ga0496120_0004314_9593_10348 251
193 3300048923 Ga0496120_0014380 Ga0496120_0014380_3207_3962 251
194 3300048924 Ga0496121_0040615 Ga0496121_0040615_1586_2341 251
195 3300048924 Ga0496121_0070409 Ga0496121_0070409_1217_1972 251
196 3300048925 Ga0496122_0168599 Ga0496122_0168599_458_1213 251
197 3300048926 Ga0496123_0143417 Ga0496123_0143417_131_886 251
198 3300048927 Ga0496124_0001066 Ga0496124_0001066_13405_14160 251
199 3300048927 Ga0496124_0035413 Ga0496124_0035413_402_1157 251
200 3300048928 Ga0496125_0000245 Ga0496125_0000245_97181_97936 251
201 3300048928 Ga0496125_0042739 Ga0496125_0042739_2178_2933 251
202 3300048928 Ga0496125_0077384 Ga0496125_0077384_576_1331 251
203 3300048928 Ga0496125_0078919 Ga0496125_0078919_164_919 251
204 3300048929 Ga0496126_0022618 Ga0496126_0022618_4940_5695 251
205 3300048929 Ga0496126_0101114 Ga0496126_0101114_91_846 251
206 iso_pu_bacteria 2501025502 2501081278 251
207 iso_pu_bacteria 2501025504 2501412208 251
208 iso_pu_bacteria 2510917013 2511094266 251
209 iso_pu_bacteria 2510917014 2511101645 251
210 iso_pu_bacteria 2510917021 2511127402 251
211 iso_pu_bacteria 2511231026 2511386320 251
212 iso_pu_bacteria 2512564014 2512641806 251
213 iso_pu_bacteria 2515154189 2516020977 251
214 iso_pu_bacteria 2599185178 2599448427 251
215 iso_pu_bacteria 2600254954 2600446158 251
216 iso_pu_bacteria 2600255389 2602008040 251
217 iso_pu_bacteria 2643221556 2643800573 251
218 iso_pu_bacteria 2643221623 2644133894 251
219 iso_pu_bacteria 2643221638 2644214045 251
220 iso_pu_bacteria 2643221684 2644470690 251
221 iso_pu_bacteria 2738541297 2738826346 251
222 iso_pu_bacteria 2738541357 2739150143 251
223 iso_pu_bacteria 2738543003 2739192062 251
224 iso_pu_bacteria 2738543020 2739288474 251
225 iso_pu_bacteria 2738543021 2739293786 251
226 iso_pu_bacteria 2738543026 2739318539 251
227 iso_pu_bacteria 2738543029 2739336780 251
228 iso_pu_bacteria 2758568016 2758640644 251
229 iso_pu_bacteria 2808606418 2809143300 251
230 iso_pu_bacteria 2821131069 2821134854 251
231 iso_pu_bacteria 2821443989 2821444546 251
232 iso_pu_bacteria 2834641062 2834643344 251
233 iso_pu_bacteria 2842711865 2842715698 251
234 iso_pu_bacteria 2842854478 2842858020 251
235 iso_pu_bacteria 2857357740 2857358052 251
236 iso_pu_bacteria 2857553236 2857553374 251
237 iso_pu_bacteria 2857558681 2857563351 251
238 iso_pu_bacteria 2882806704 2882809192 251
239 iso_pu_bacteria 2883087390 2883089071 251
240 iso_pu_bacteria 2895498888 2895501889 251
241 iso_pu_bacteria 2895511927 2895517554 251
242 iso_pu_bacteria 2895525241 2895526189 251
243 iso_pu_bacteria 2904424332 2904428222 251
244 iso_pu_bacteria 2919046199 2919046776 251
245 iso_pu_bacteria 2919501602 2919502916 251
246 iso_pu_bacteria 2926063275 2926064589 251
247 iso_pu_bacteria 2939631187 2939636014 251
248 iso_pu_bacteria 2987605356 2987607663 251
249 iso_pu_bacteria 2990703756 2990710726 251
250 iso_pu_bacteria 3007252601 3007254912 251
251 iso_pu_bacteria 3007315729 3007316287 251
252 iso_pu_bacteria 8003400568 8003402591 251
253 iso_pu_bacteria 8047673197 8047677569 251
254 iso_pu_bacteria 8056143049 8056146549 251
255 3300009148 Ga0105243_10062782 Ga0105243_100627824 252
256 3300025728 Ga0207655_1000022 Ga0207655_1000022123 252
257 3300025735 Ga0207713_1064545 Ga0207713_10645452 252
258 3300025935 Ga0207709_10021519 Ga0207709_100215193 252
259 3300047320 Ga0495672_0020577 Ga0495672_0020577_3441_4199 252
260 3300053138 Ga0500564_178817 Ga0500564_178817_77_835 252
261 3300005289 Ga0065704_10071150 Ga0065704_1007115013 253
262 3300005331 Ga0070670_100001916 Ga0070670_1000019163 253
263 3300006946 Ga0079104_1006764 Ga0079104_10067644 253
264 3300009011 Ga0105251_10039117 Ga0105251_100391172 253
265 3300009036 Ga0105244_10000014 Ga0105244_1000001457 253
266 3300009092 Ga0105250_10021366 Ga0105250_100213663 253
267 3300013306 Ga0163162_10085005 Ga0163162_100850053 253
268 3300014497 Ga0182008_10001346 Ga0182008_100013467 253
269 3300017792 Ga0163161_10008504 Ga0163161_100085047 253
270 3300025728 Ga0207655_1000002 Ga0207655_1000002372 253
271 3300025728 Ga0207655_1000063 Ga0207655_100006357 253
272 3300025735 Ga0207713_1000004 Ga0207713_100000446 253
273 3300025925 Ga0207650_10005379 Ga0207650_100053793 253
274 3300027111 Ga0209281_1000379 Ga0209281_100037925 253
275 3300027111 Ga0209281_1004003 Ga0209281_10040034 253
276 3300031507 Ga0307509_10097343 Ga0307509_100973433 253
277 3300032004 Ga0307414_10098460 Ga0307414_100984602 253
278 3300041405 Ga0439438_000503 Ga0439438_000503_4412_5191 253
279 3300042439 Ga0439464_0000813 Ga0439464_0000813_4659_5420 253
280 3300046458 Ga0495591_002486 Ga0495591_002486_3323_4102 253
281 3300046506 Ga0495583_0001685 Ga0495583_0001685_7766_8527 253
282 3300046515 Ga0495620_0004244 Ga0495620_0004244_7159_7920 253
283 3300046515 Ga0495620_0034269 Ga0495620_0034269_73_852 253
284 3300046522 Ga0495643_0110145 Ga0495643_0110145_336_1115 253
285 3300046526 Ga0495666_0001974 Ga0495666_0001974_2861_3622 253
286 3300046531 Ga0495665_0000967 Ga0495665_0000967_5684_6445 253
287 3300046557 Ga0495622_0001564 Ga0495622_0001564_6492_7253 253
288 3300046615 Ga0495656_0127214 Ga0495656_0127214_61_822 253
289 3300046690 Ga0495624_0012500 Ga0495624_0012500_1600_2361 253
290 3300046691 Ga0495670_0155901 Ga0495670_0155901_167_928 253
291 3300046694 Ga0495649_0007497 Ga0495649_0007497_597_1376 253
292 3300046694 Ga0495649_0037742 Ga0495649_0037742_1277_2056 253
293 3300046810 Ga0495660_0013655 Ga0495660_0013655_3215_3976 253
294 3300048924 Ga0496121_0147814 Ga0496121_0147814_313_1074 253
295 3300048925 Ga0496122_0009079 Ga0496122_0009079_5984_6745 253
296 3300048925 Ga0496122_0055038 Ga0496122_0055038_1987_2748 253
297 3300048926 Ga0496123_0066312 Ga0496123_0066312_1424_2185 253
298 3300048927 Ga0496124_0000425 Ga0496124_0000425_23795_24571 253
299 3300048927 Ga0496124_0023861 Ga0496124_0023861_92_871 253
300 3300048927 Ga0496124_0129593 Ga0496124_0129593_206_967 253
301 3300048928 Ga0496125_0004750 Ga0496125_0004750_8341_9102 253
302 3300048928 Ga0496125_0350107 Ga0496125_0350107_11_772 253
303 3300053087 Ga0500643_000362 Ga0500643_000362_26784_27551 253
304 iso_pu_bacteria 2547132130 2547501460 253
305 iso_pu_bacteria 2919134579 2919136880 253
306 iso_pu_bacteria 2939607340 2939608774 253
307 iso_pu_bacteria 8054357960 8054359281 253
308 iso_pu_bacteria 8055097453 8055100099 253
309 iso_pu_bacteria 8057304971 8057309339 253
310 3300003751 Ga0055538_1000123 Ga0055538_100012341 254
311 3300003752 Ga0055539_1000167 Ga0055539_100016741 254
312 3300003756 Ga0055533_1000171 Ga0055533_100017141 254
313 3300003758 Ga0055532_1000159 Ga0055532_100015941 254
314 3300003759 Ga0055525_1000232 Ga0055525_100023241 254
315 3300003761 Ga0055535_1006235 Ga0055535_10062354 254
316 3300003841 Ga0055541_1000112 Ga0055541_100011241 254
317 3300005262 Ga0065165_1000286 Ga0065165_100028622 254
318 3300005459 Ga0068867_100283963 Ga0068867_1002839632 254
319 3300005548 Ga0070665_100000335 Ga0070665_10000033523 254
320 3300006051 Ga0075364_10034882 Ga0075364_100348823 254
321 3300009545 Ga0105237_10053888 Ga0105237_100538884 254
322 3300014968 Ga0157379_10186755 Ga0157379_101867552 254
323 3300015261 Ga0182006_1000206 Ga0182006_10002069 254
324 3300015261 Ga0182006_1004672 Ga0182006_10046724 254
325 3300025206 Ga0209435_100840 Ga0209435_1008402 254
326 3300025224 Ga0209784_100058 Ga0209784_10005852 254
327 3300025225 Ga0209566_100045 Ga0209566_10004552 254
328 3300025226 Ga0209674_100096 Ga0209674_10009652 254
329 3300025229 Ga0209147_100056 Ga0209147_10005652 254
330 3300025230 Ga0209563_100064 Ga0209563_10006452 254
331 3300025242 Ga0209258_100243 Ga0209258_10024352 254
332 3300025246 Ga0209646_1000207 Ga0209646_10002079 254
333 3300025253 Ga0209677_100053 Ga0209677_10005352 254
334 3300025256 Ga0209759_1013956 Ga0209759_10139561 254
335 3300025728 Ga0207655_1002838 Ga0207655_10028386 254
336 3300026089 Ga0207648_10137021 Ga0207648_101370212 254
337 3300028379 Ga0268266_10000335 Ga0268266_1000033516 254
338 3300042006 Ga0439432_005030 Ga0439432_005030_846_1616 254
339 3300046453 Ga0495627_027126 Ga0495627_027126_268_1032 254
340 3300046455 Ga0495603_0040631 Ga0495603_0040631_1683_2447 254
341 3300046457 Ga0495590_0000025 Ga0495590_0000025_105332_106096 254
342 3300046458 Ga0495591_000246 Ga0495591_000246_27493_28257 254
343 3300046458 Ga0495591_012754 Ga0495591_012754_1693_2457 254
344 3300046474 Ga0495605_0000018 Ga0495605_0000018_218214_218978 254
345 3300046474 Ga0495605_0019095 Ga0495605_0019095_2641_3405 254
346 3300046491 Ga0495584_0000070 Ga0495584_0000070_24434_25198 254
347 3300046491 Ga0495584_0079441 Ga0495584_0079441_806_1570 254
348 3300046492 Ga0495585_0006004 Ga0495585_0006004_1735_2499 254
349 3300046492 Ga0495585_0010489 Ga0495585_0010489_2905_3669 254
350 3300046492 Ga0495585_0030772 Ga0495585_0030772_945_1709 254
351 3300046492 Ga0495585_0093826 Ga0495585_0093826_588_1352 254
352 3300046500 Ga0495596_0002814 Ga0495596_0002814_3996_4760 254
353 3300046500 Ga0495596_0010139 Ga0495596_0010139_2632_3396 254
354 3300046500 Ga0495596_0010912 Ga0495596_0010912_932_1696 254
355 3300046500 Ga0495596_0011652 Ga0495596_0011652_2068_2832 254
356 3300046500 Ga0495596_0012793 Ga0495596_0012793_947_1711 254
357 3300046500 Ga0495596_0020852 Ga0495596_0020852_527_1291 254
358 3300046500 Ga0495596_0024894 Ga0495596_0024894_1188_1952 254
359 3300046501 Ga0495607_0004773 Ga0495607_0004773_1246_2010 254
360 3300046501 Ga0495607_0015090 Ga0495607_0015090_3175_3939 254
361 3300046506 Ga0495583_0000382 Ga0495583_0000382_23028_23792 254
362 3300046506 Ga0495583_0003156 Ga0495583_0003156_10310_11074 254
363 3300046506 Ga0495583_0004240 Ga0495583_0004240_3894_4658 254
364 3300046506 Ga0495583_0005962 Ga0495583_0005962_4068_4832 254
365 3300046506 Ga0495583_0006526 Ga0495583_0006526_6214_6978 254
366 3300046507 Ga0495606_0001868 Ga0495606_0001868_21420_22184 254
367 3300046507 Ga0495606_0017655 Ga0495606_0017655_268_1032 254
368 3300046507 Ga0495606_0027466 Ga0495606_0027466_603_1367 254
369 3300046512 Ga0495610_0000229 Ga0495610_0000229_28146_28910 254
370 3300046512 Ga0495610_0019426 Ga0495610_0019426_2672_3436 254
371 3300046513 Ga0495616_0000207 Ga0495616_0000207_15966_16730 254
372 3300046513 Ga0495616_0011794 Ga0495616_0011794_1076_1840 254
373 3300046513 Ga0495616_0019015 Ga0495616_0019015_1705_2469 254
374 3300046513 Ga0495616_0020945 Ga0495616_0020945_255_1019 254
375 3300046513 Ga0495616_0029934 Ga0495616_0029934_665_1429 254
376 3300046518 Ga0495631_0002616 Ga0495631_0002616_7250_8014 254
377 3300046518 Ga0495631_0004387 Ga0495631_0004387_4668_5432 254
378 3300046518 Ga0495631_0005725 Ga0495631_0005725_4324_5088 254
379 3300046518 Ga0495631_0025827 Ga0495631_0025827_1902_2666 254
380 3300046518 Ga0495631_0040161 Ga0495631_0040161_74_838 254
381 3300046518 Ga0495631_0044611 Ga0495631_0044611_263_1027 254
382 3300046518 Ga0495631_0054674 Ga0495631_0054674_193_957 254
383 3300046519 Ga0495632_0000129 Ga0495632_0000129_31394_32158 254
384 3300046519 Ga0495632_0000296 Ga0495632_0000296_32743_33507 254
385 3300046519 Ga0495632_0018245 Ga0495632_0018245_2774_3538 254
386 3300046519 Ga0495632_0023960 Ga0495632_0023960_722_1486 254
387 3300046520 Ga0495637_0000019 Ga0495637_0000019_18273_19037 254
388 3300046520 Ga0495637_0023477 Ga0495637_0023477_199_963 254
389 3300046523 Ga0495644_0013952 Ga0495644_0013952_468_1232 254
390 3300046523 Ga0495644_0022314 Ga0495644_0022314_566_1330 254
391 3300046523 Ga0495644_0026508 Ga0495644_0026508_1005_1769 254
392 3300046524 Ga0495648_0024723 Ga0495648_0024723_1480_2244 254
393 3300046525 Ga0495663_0077534 Ga0495663_0077534_109_873 254
394 3300046528 Ga0495642_0000285 Ga0495642_0000285_15047_15811 254
395 3300046528 Ga0495642_0002484 Ga0495642_0002484_3250_4014 254
396 3300046528 Ga0495642_0032156 Ga0495642_0032156_855_1619 254
397 3300046528 Ga0495642_0064434 Ga0495642_0064434_251_1015 254
398 3300046528 Ga0495642_0092782 Ga0495642_0092782_301_1065 254
399 3300046530 Ga0495654_0054451 Ga0495654_0054451_622_1386 254
400 3300046538 Ga0495609_0001963 Ga0495609_0001963_5779_6543 254
401 3300046538 Ga0495609_0005513 Ga0495609_0005513_4589_5353 254
402 3300046538 Ga0495609_0071947 Ga0495609_0071947_656_1420 254
403 3300046542 Ga0495597_0000226 Ga0495597_0000226_24225_24989 254
404 3300046542 Ga0495597_0079802 Ga0495597_0079802_213_977 254
405 3300046557 Ga0495622_0000002 Ga0495622_0000002_213774_214538 254
406 3300046558 Ga0495633_0002968 Ga0495633_0002968_4414_5178 254
407 3300046558 Ga0495633_0030221 Ga0495633_0030221_1463_2227 254
408 3300046616 Ga0495668_0014985 Ga0495668_0014985_2795_3559 254
409 3300046616 Ga0495668_0018432 Ga0495668_0018432_682_1446 254
410 3300046616 Ga0495668_0026700 Ga0495668_0026700_1430_2194 254
411 3300046616 Ga0495668_0028787 Ga0495668_0028787_1657_2421 254
412 3300046648 Ga0495611_0000195 Ga0495611_0000195_24764_25528 254
413 3300046648 Ga0495611_0000773 Ga0495611_0000773_14740_15504 254
414 3300046648 Ga0495611_0012256 Ga0495611_0012256_2861_3625 254
415 3300046660 Ga0495625_0007223 Ga0495625_0007223_4143_4907 254
416 3300046660 Ga0495625_0042605 Ga0495625_0042605_1493_2257 254
417 3300046665 Ga0495661_0003589 Ga0495661_0003589_2603_3367 254
418 3300046665 Ga0495661_0025401 Ga0495661_0025401_1806_2570 254
419 3300046665 Ga0495661_0025738 Ga0495661_0025738_1625_2389 254
420 3300046665 Ga0495661_0036722 Ga0495661_0036722_1735_2499 254
421 3300046665 Ga0495661_0062250 Ga0495661_0062250_1401_2165 254
422 3300046665 Ga0495661_0070399 Ga0495661_0070399_932_1696 254
423 3300046674 Ga0495588_0005098 Ga0495588_0005098_987_1751 254
424 3300046684 Ga0495669_0002014 Ga0495669_0002014_4034_4798 254
425 3300046684 Ga0495669_0004319 Ga0495669_0004319_1587_2351 254
426 3300046684 Ga0495669_0006645 Ga0495669_0006645_2300_3064 254
427 3300046684 Ga0495669_0017491 Ga0495669_0017491_478_1242 254
428 3300046684 Ga0495669_0025856 Ga0495669_0025856_1061_1825 254
429 3300046691 Ga0495670_0014837 Ga0495670_0014837_2555_3319 254
430 3300046691 Ga0495670_0073028 Ga0495670_0073028_411_1175 254
431 3300046691 Ga0495670_0124261 Ga0495670_0124261_540_1304 254
432 3300046692 Ga0495671_0003679 Ga0495671_0003679_2925_3689 254
433 3300046692 Ga0495671_0009092 Ga0495671_0009092_4458_5222 254
434 3300046692 Ga0495671_0020586 Ga0495671_0020586_1803_2567 254
435 3300046692 Ga0495671_0027738 Ga0495671_0027738_1285_2049 254
436 3300046694 Ga0495649_0000277 Ga0495649_0000277_16993_17757 254
437 3300046694 Ga0495649_0013410 Ga0495649_0013410_72_836 254
438 3300046694 Ga0495649_0033919 Ga0495649_0033919_331_1095 254
439 3300046794 Ga0495589_0022401 Ga0495589_0022401_1703_2467 254
440 3300046794 Ga0495589_0047301 Ga0495589_0047301_587_1351 254
441 3300046794 Ga0495589_0059031 Ga0495589_0059031_744_1508 254
442 3300046810 Ga0495660_0007481 Ga0495660_0007481_3787_4551 254
443 3300046810 Ga0495660_0011314 Ga0495660_0011314_1877_2641 254
444 3300046810 Ga0495660_0011889 Ga0495660_0011889_2825_3589 254
445 3300046810 Ga0495660_0015327 Ga0495660_0015327_842_1606 254
446 3300046810 Ga0495660_0059833 Ga0495660_0059833_920_1684 254
447 3300047320 Ga0495672_0000041 Ga0495672_0000041_170520_171284 254
448 3300047323 Ga0495683_0000763 Ga0495683_0000763_13204_13968 254
449 3300047323 Ga0495683_0156977 Ga0495683_0156977_133_897 254
450 3300047443 Ga0495687_001550 Ga0495687_001550_8096_8860 254
451 3300047445 Ga0495677_0000210 Ga0495677_0000210_12757_13521 254
452 3300047445 Ga0495677_0017220 Ga0495677_0017220_1481_2245 254
453 3300047446 Ga0495679_022179 Ga0495679_022179_762_1526 254
454 3300047446 Ga0495679_041848 Ga0495679_041848_119_883 254
455 3300047447 Ga0495685_005235 Ga0495685_005235_3155_3919 254
456 3300047469 Ga0495673_0000012 Ga0495673_0000012_269609_270373 254
457 3300047470 Ga0495681_0005829 Ga0495681_0005829_895_1659 254
458 3300047470 Ga0495681_0008039 Ga0495681_0008039_134_898 254
459 3300047470 Ga0495681_0081491 Ga0495681_0081491_566_1330 254
460 3300047470 Ga0495681_0104627 Ga0495681_0104627_35_799 254
461 3300047472 Ga0495686_0000732 Ga0495686_0000732_11524_12288 254
462 3300047472 Ga0495686_0041746 Ga0495686_0041746_1344_2108 254
463 3300048091 Ga0495626_0000004 Ga0495626_0000004_24479_25243 254
464 3300048091 Ga0495626_0003747 Ga0495626_0003747_7295_8059 254
465 3300048091 Ga0495626_0016531 Ga0495626_0016531_1246_2010 254
466 3300048091 Ga0495626_0025984 Ga0495626_0025984_211_975 254
467 3300048924 Ga0496121_0026317 Ga0496121_0026317_3826_4590 254
468 3300048927 Ga0496124_0000056 Ga0496124_0000056_244180_244944 254
469 3300048927 Ga0496124_0324435 Ga0496124_0324435_315_1079 254
470 3300048929 Ga0496126_0125425 Ga0496126_0125425_848_1612 254
471 3300049459 Ga0495678_000233 Ga0495678_000233_36611_37375 254
472 3300049459 Ga0495678_001703 Ga0495678_001703_12570_13334 254
473 3300049459 Ga0495678_001985 Ga0495678_001985_11707_12471 254
474 3300049459 Ga0495678_020704 Ga0495678_020704_1562_2326 254
475 3300049460 Ga0495682_0000107 Ga0495682_0000107_38059_38823 254
476 3300049460 Ga0495682_0001172 Ga0495682_0001172_8963_9727 254
477 3300049460 Ga0495682_0011704 Ga0495682_0011704_1113_1877 254
478 3300049460 Ga0495682_0030101 Ga0495682_0030101_114_878 254
479 3300050491 nmdc:mga00v17_62366_c1 nmdc:mga00v17_62366_c1_1271_2035 254
480 3300001915 JGI24741J21665_1000149 JGI24741J21665_100014917 255
481 3300001979 JGI24740J21852_10003968 JGI24740J21852_100039685 255
482 3300002705 JGI25156J39149_1011038 JGI25156J39149_10110383 255
483 3300002737 JGI25162J39368_1003457 JGI25162J39368_10034572 255
484 3300002738 JGI25154J39366_1000359 JGI25154J39366_100035918 255
485 3300002987 JGI25159J45721_1000757 JGI25159J45721_100075713 255
486 3300003322 rootL2_10031707 rootL2_100317075 255
487 3300003751 Ga0055538_1004657 Ga0055538_10046571 255
488 3300003752 Ga0055539_1000073 Ga0055539_100007376 255
489 3300003756 Ga0055533_1005112 Ga0055533_10051122 255
490 3300003756 Ga0055533_1005878 Ga0055533_10058781 255
491 3300003758 Ga0055532_1000090 Ga0055532_100009044 255
492 3300003759 Ga0055525_1000383 Ga0055525_100038324 255
493 3300003760 Ga0055527_1000479 Ga0055527_100047917 255
494 3300003761 Ga0055535_1000085 Ga0055535_100008544 255
495 3300003763 Ga0055529_1000134 Ga0055529_100013462 255
496 3300003771 Ga0055526_1000007 Ga0055526_1000007241 255
497 3300003791 Ga0055530_10000182 Ga0055530_1000018238 255
498 3300003841 Ga0055541_1009305 Ga0055541_10093051 255
499 3300003856 Ga0058692_1000002 Ga0058692_1000002437 255
500 3300004625 Ga0055543_1002524 Ga0055543_10025244 255
501 3300005262 Ga0065165_1000005 Ga0065165_1000005185 255
502 3300005289 Ga0065704_10135927 Ga0065704_101359272 255
503 3300005327 Ga0070658_10583537 Ga0070658_105835371 255
504 3300005339 Ga0070660_100511446 Ga0070660_1005114461 255
505 3300005344 Ga0070661_100000141 Ga0070661_10000014135 255
506 3300005455 Ga0070663_100000034 Ga0070663_10000003426 255
507 3300005457 Ga0070662_100203365 Ga0070662_1002033652 255
508 3300005539 Ga0068853_100077825 Ga0068853_1000778253 255
509 3300005564 Ga0070664_100000057 Ga0070664_10000005727 255
510 3300005564 Ga0070664_100051154 Ga0070664_1000511544 255
511 3300005578 Ga0068854_100000937 Ga0068854_10000093718 255
512 3300005614 Ga0068856_100004528 Ga0068856_10000452814 255
513 3300005616 Ga0068852_100115207 Ga0068852_1001152072 255
514 3300005834 Ga0068851_10215765 Ga0068851_102157652 255
515 3300006048 Ga0075363_100130804 Ga0075363_1001308042 255
516 3300006051 Ga0075364_10012986 Ga0075364_100129862 255
517 3300006948 Ga0099826_10000013 Ga0099826_10000013120 255
518 3300009011 Ga0105251_10013329 Ga0105251_100133294 255
519 3300009011 Ga0105251_10055154 Ga0105251_100551542 255
520 3300009036 Ga0105244_10015891 Ga0105244_100158912 255
521 3300009036 Ga0105244_10050756 Ga0105244_100507563 255
522 3300009093 Ga0105240_10031977 Ga0105240_1003197711 255
523 3300009093 Ga0105240_10042292 Ga0105240_100422923 255
524 3300009148 Ga0105243_10014001 Ga0105243_100140012 255
525 3300009174 Ga0105241_10071225 Ga0105241_100712253 255
526 3300009545 Ga0105237_10181195 Ga0105237_101811954 255
527 3300009551 Ga0105238_10217878 Ga0105238_102178782 255
528 3300013100 Ga0157373_10009246 Ga0157373_100092463 255
529 3300013102 Ga0157371_10000323 Ga0157371_1000032319 255
530 3300013104 Ga0157370_10000038 Ga0157370_1000003818 255
531 3300013104 Ga0157370_10018703 Ga0157370_100187036 255
532 3300013105 Ga0157369_10003855 Ga0157369_100038552 255
533 3300013105 Ga0157369_10034990 Ga0157369_100349906 255
534 3300013307 Ga0157372_10000776 Ga0157372_1000077625 255
535 3300013307 Ga0157372_10323738 Ga0157372_103237383 255
536 3300013307 Ga0157372_10604177 Ga0157372_106041772 255
537 3300014969 Ga0157376_10082633 Ga0157376_100826332 255
538 3300015261 Ga0182006_1002616 Ga0182006_10026165 255
539 3300017792 Ga0163161_10007916 Ga0163161_100079164 255
540 3300020069 Ga0197907_11440316 Ga0197907_114403162 255
541 3300020070 Ga0206356_10624618 Ga0206356_106246182 255
542 3300020077 Ga0206351_10978011 Ga0206351_109780112 255
543 3300020077 Ga0206351_10989253 Ga0206351_109892532 255
544 3300020080 Ga0206350_11491042 Ga0206350_114910422 255
545 3300020610 Ga0154015_1552384 Ga0154015_155238421 255
546 3300022467 Ga0224712_10002754 Ga0224712_100027545 255
547 3300025224 Ga0209784_100006 Ga0209784_100006136 255
548 3300025225 Ga0209566_100002 Ga0209566_100002136 255
549 3300025226 Ga0209674_100097 Ga0209674_100097136 255
550 3300025226 Ga0209674_100403 Ga0209674_10040318 255
551 3300025228 Ga0209672_100208 Ga0209672_10020816 255
552 3300025229 Ga0209147_100018 Ga0209147_100018359 255
553 3300025230 Ga0209563_100007 Ga0209563_10000770 255
554 3300025230 Ga0209563_100041 Ga0209563_100041336 255
555 3300025233 Ga0209437_101405 Ga0209437_1014053 255
556 3300025242 Ga0209258_100028 Ga0209258_100028359 255
557 3300025246 Ga0209646_1000007 Ga0209646_1000007408 255
558 3300025253 Ga0209677_100007 Ga0209677_100007136 255
559 3300025254 Ga0209148_1000640 Ga0209148_100064025 255
560 3300025256 Ga0209759_1002850 Ga0209759_10028509 255
561 3300025272 Ga0209455_1000107 Ga0209455_100010759 255
562 3300025284 Ga0209130_1000254 Ga0209130_100025425 255
563 3300025295 Ga0209564_1000010 Ga0209564_1000010434 255
564 3300025298 Ga0209050_1000010 Ga0209050_1000010662 255
565 3300025304 Ga0209257_1000027 Ga0209257_1000027304 255
566 3300025728 Ga0207655_1037820 Ga0207655_10378203 255
567 3300025728 Ga0207655_1111208 Ga0207655_11112082 255
568 3300025909 Ga0207705_10127390 Ga0207705_101273902 255
569 3300025913 Ga0207695_10002492 Ga0207695_1000249225 255
570 3300025917 Ga0207660_10563602 Ga0207660_105636021 255
571 3300025919 Ga0207657_10007356 Ga0207657_100073567 255
572 3300025920 Ga0207649_10000111 Ga0207649_1000011126 255
573 3300025932 Ga0207690_10045688 Ga0207690_100456881 255
574 3300025935 Ga0207709_10000982 Ga0207709_100009823 255
575 3300025945 Ga0207679_10000105 Ga0207679_1000010540 255
576 3300025945 Ga0207679_10138463 Ga0207679_101384632 255
577 3300025981 Ga0207640_10000154 Ga0207640_1000015443 255
578 3300026067 Ga0207678_10000106 Ga0207678_1000010626 255
579 3300026078 Ga0207702_10000135 Ga0207702_1000013548 255
580 3300026116 Ga0207674_10002847 Ga0207674_1000284722 255
581 3300026142 Ga0207698_10091909 Ga0207698_100919092 255
582 3300027312 Ga0209371_1000004 Ga0209371_1000004643 255
583 3300027666 Ga0209282_1000043 Ga0209282_100004329 255
584 3300028379 Ga0268266_10126077 Ga0268266_101260774 255
585 3300028800 Ga0265338_10001178 Ga0265338_100011782 255
586 3300030500 Ga0268256_1000005 Ga0268256_1000005403 255
587 3300031247 Ga0265340_10079217 Ga0265340_100792173 255
588 3300031548 Ga0307408_100000028 Ga0307408_10000002857 255
589 3300031548 Ga0307408_100000074 Ga0307408_10000007495 255
590 3300031731 Ga0307405_10064245 Ga0307405_100642454 255
591 3300031838 Ga0307518_10013348 Ga0307518_100133483 255
592 3300031901 Ga0307406_10068905 Ga0307406_100689054 255
593 3300031911 Ga0307412_10001662 Ga0307412_100016624 255
594 3300031911 Ga0307412_10016685 Ga0307412_100166853 255
595 3300032004 Ga0307414_10273285 Ga0307414_102732852 255
596 3300032004 Ga0307414_10499323 Ga0307414_104993231 255
597 3300037312 Ga0395899_0078640 Ga0395899_0078640_943_1710 255
598 3300037312 Ga0395899_0085802 Ga0395899_0085802_916_1683 255
599 3300037312 Ga0395899_0104362 Ga0395899_0104362_139_906 255
600 3300037312 Ga0395899_0112424 Ga0395899_0112424_212_979 255
601 3300037418 Ga0395900_0000162 Ga0395900_0000162_14722_15489 255
602 3300037418 Ga0395900_0005262 Ga0395900_0005262_8749_9516 255
603 3300037418 Ga0395900_0007334 Ga0395900_0007334_357_1178 255
604 3300037418 Ga0395900_0009391 Ga0395900_0009391_9229_9996 255
605 3300037418 Ga0395900_0041333 Ga0395900_0041333_3794_4561 255
606 3300037418 Ga0395900_0107327 Ga0395900_0107327_212_979 255
607 3300037418 Ga0395900_0148447 Ga0395900_0148447_504_1271 255
608 3300037418 Ga0395900_0177587 Ga0395900_0177587_761_1528 255
609 3300037418 Ga0395900_0259394 Ga0395900_0259394_611_1378 255
610 3300037418 Ga0395900_0334831 Ga0395900_0334831_371_1138 255
611 3300037418 Ga0395900_0354717 Ga0395900_0354717_183_950 255
612 3300037418 Ga0395900_0378589 Ga0395900_0378589_113_880 255
613 3300037466 Ga0395898_0002086 Ga0395898_0002086_4052_4819 255
614 3300037466 Ga0395898_0023727 Ga0395898_0023727_5037_5804 255
615 3300037466 Ga0395898_0046474 Ga0395898_0046474_634_1401 255
616 3300037466 Ga0395898_0050881 Ga0395898_0050881_2805_3572 255
617 3300037466 Ga0395898_0134242 Ga0395898_0134242_577_1374 255
618 3300037466 Ga0395898_0279590 Ga0395898_0279590_288_1055 255
619 3300037471 Ga0395905_0032388 Ga0395905_0032388_3482_4249 255
620 3300037471 Ga0395905_0039045 Ga0395905_0039045_2256_3047 255
621 3300037471 Ga0395905_0066292 Ga0395905_0066292_1414_2211 255
622 3300037471 Ga0395905_0300853 Ga0395905_0300853_471_1238 255
623 3300037471 Ga0395905_0528993 Ga0395905_0528993_121_888 255
624 3300038443 Ga0395901_0000009 Ga0395901_0000009_206251_207018 255
625 3300038443 Ga0395901_0000042 Ga0395901_0000042_161406_162173 255
626 3300038443 Ga0395901_0000091 Ga0395901_0000091_33169_33936 255
627 3300038443 Ga0395901_0023936 Ga0395901_0023936_5468_6235 255
628 3300038443 Ga0395901_0061038 Ga0395901_0061038_646_1413 255
629 3300038443 Ga0395901_0123431 Ga0395901_0123431_603_1370 255
630 3300038443 Ga0395901_0168631 Ga0395901_0168631_252_1019 255
631 3300038443 Ga0395901_0283097 Ga0395901_0283097_65_847 255
632 3300038443 Ga0395901_0525495 Ga0395901_0525495_304_1101 255
633 3300041404 Ga0439436_0000095 Ga0439436_0000095_15001_15768 255
634 3300041405 Ga0439438_000160 Ga0439438_000160_1517_2314 255
635 3300041405 Ga0439438_000190 Ga0439438_000190_1255_2034 255
636 3300041411 Ga0439466_0008236 Ga0439466_0008236_793_1590 255
637 3300042005 Ga0439448_0069504 Ga0439448_0069504_196_963 255
638 3300042006 Ga0439432_006082 Ga0439432_006082_2663_3460 255
639 3300042006 Ga0439432_021723 Ga0439432_021723_727_1497 255
640 3300042145 Ga0450906_012235 Ga0450906_012235_166_963 255
641 3300042439 Ga0439464_0005146 Ga0439464_0005146_1590_2357 255
642 3300042439 Ga0439464_0018199 Ga0439464_0018199_446_1213 255
643 3300044658 Ga0466972_0002472 Ga0466972_0002472_4434_5201 255
644 3300044658 Ga0466972_0003769 Ga0466972_0003769_3227_3994 255
645 3300044658 Ga0466972_0054889 Ga0466972_0054889_855_1622 255
646 3300044672 Ga0466982_0000040 Ga0466982_0000040_35719_36549 255
647 3300044683 Ga0466965_0001680 Ga0466965_0001680_438_1205 255
648 3300044684 Ga0466966_0031469 Ga0466966_0031469_1270_2037 255
649 3300044684 Ga0466966_0270642 Ga0466966_0270642_91_858 255
650 3300044693 Ga0466961_0142054 Ga0466961_0142054_620_1387 255
651 3300044719 Ga0466971_0137107 Ga0466971_0137107_22_789 255
652 3300044735 Ga0466968_0006840 Ga0466968_0006840_276_1043 255
653 3300044765 Ga0466970_0007069 Ga0466970_0007069_3657_4424 255
654 3300044765 Ga0466970_0099987 Ga0466970_0099987_302_1069 255
655 3300045976 Ga0466967_0746344 Ga0466967_0746344_122_889 255
656 3300046452 Ga0495617_000002 Ga0495617_000002_612175_612948 255
657 3300046452 Ga0495617_000020 Ga0495617_000020_211604_212371 255
658 3300046452 Ga0495617_000443 Ga0495617_000443_12515_13288 255
659 3300046452 Ga0495617_002156 Ga0495617_002156_1795_2565 255
660 3300046453 Ga0495627_000005 Ga0495627_000005_544552_545319 255
661 3300046453 Ga0495627_000058 Ga0495627_000058_13700_14491 255
662 3300046453 Ga0495627_000207 Ga0495627_000207_41986_42759 255
663 3300046453 Ga0495627_001366 Ga0495627_001366_107_874 255
664 3300046453 Ga0495627_033386 Ga0495627_033386_481_1248 255
665 3300046455 Ga0495603_0028731 Ga0495603_0028731_2256_3023 255
666 3300046455 Ga0495603_0038059 Ga0495603_0038059_1214_1981 255
667 3300046457 Ga0495590_0013996 Ga0495590_0013996_285_1082 255
668 3300046457 Ga0495590_0038493 Ga0495590_0038493_518_1285 255
669 3300046458 Ga0495591_000081 Ga0495591_000081_21669_22460 255
670 3300046458 Ga0495591_016756 Ga0495591_016756_1495_2262 255
671 3300046459 Ga0495629_0080053 Ga0495629_0080053_1021_1788 255
672 3300046460 Ga0495638_0007776 Ga0495638_0007776_4208_4975 255
673 3300046460 Ga0495638_0011767 Ga0495638_0011767_503_1270 255
674 3300046460 Ga0495638_0029677 Ga0495638_0029677_2527_3315 255
675 3300046460 Ga0495638_0061000 Ga0495638_0061000_971_1741 255
676 3300046460 Ga0495638_0070430 Ga0495638_0070430_419_1186 255
677 3300046460 Ga0495638_0192279 Ga0495638_0192279_207_1004 255
678 3300046463 Ga0495653_0000082 Ga0495653_0000082_64506_65276 255
679 3300046463 Ga0495653_0015657 Ga0495653_0015657_2049_2816 255
680 3300046463 Ga0495653_0019749 Ga0495653_0019749_1538_2305 255
681 3300046463 Ga0495653_0033932 Ga0495653_0033932_195_962 255
682 3300046463 Ga0495653_0049210 Ga0495653_0049210_368_1135 255
683 3300046471 Ga0495650_0000001 Ga0495650_0000001_442737_443504 255
684 3300046471 Ga0495650_0000085 Ga0495650_0000085_55255_56022 255
685 3300046471 Ga0495650_0000462 Ga0495650_0000462_38739_39506 255
686 3300046471 Ga0495650_0001171 Ga0495650_0001171_8247_9035 255
687 3300046471 Ga0495650_0001182 Ga0495650_0001182_24769_25536 255
688 3300046471 Ga0495650_0053169 Ga0495650_0053169_324_1103 255
689 3300046473 Ga0495582_0111521 Ga0495582_0111521_408_1175 255
690 3300046474 Ga0495605_0000051 Ga0495605_0000051_125043_125810 255
691 3300046474 Ga0495605_0000293 Ga0495605_0000293_22202_22975 255
692 3300046474 Ga0495605_0011697 Ga0495605_0011697_1602_2369 255
693 3300046474 Ga0495605_0027590 Ga0495605_0027590_1214_1981 255
694 3300046474 Ga0495605_0029040 Ga0495605_0029040_751_1539 255
695 3300046474 Ga0495605_0035726 Ga0495605_0035726_1599_2375 255
696 3300046474 Ga0495605_0057595 Ga0495605_0057595_735_1502 255
697 3300046474 Ga0495605_0063262 Ga0495605_0063262_819_1586 255
698 3300046474 Ga0495605_0108008 Ga0495605_0108008_72_869 255
699 3300046474 Ga0495605_0109559 Ga0495605_0109559_155_922 255
700 3300046491 Ga0495584_0000003 Ga0495584_0000003_77971_78759 255
701 3300046491 Ga0495584_0000058 Ga0495584_0000058_19223_19990 255
702 3300046491 Ga0495584_0029859 Ga0495584_0029859_569_1336 255
703 3300046491 Ga0495584_0062431 Ga0495584_0062431_296_1063 255
704 3300046491 Ga0495584_0083705 Ga0495584_0083705_743_1510 255
705 3300046491 Ga0495584_0116125 Ga0495584_0116125_544_1311 255
706 3300046492 Ga0495585_0000183 Ga0495585_0000183_9831_10601 255
707 3300046492 Ga0495585_0000424 Ga0495585_0000424_20494_21261 255
708 3300046492 Ga0495585_0000814 Ga0495585_0000814_6515_7303 255
709 3300046492 Ga0495585_0005398 Ga0495585_0005398_6852_7619 255
710 3300046492 Ga0495585_0017021 Ga0495585_0017021_1159_1926 255
711 3300046492 Ga0495585_0017297 Ga0495585_0017297_1652_2449 255
712 3300046492 Ga0495585_0043023 Ga0495585_0043023_1016_1783 255
713 3300046492 Ga0495585_0043787 Ga0495585_0043787_394_1161 255
714 3300046492 Ga0495585_0050006 Ga0495585_0050006_206_1003 255
715 3300046492 Ga0495585_0088414 Ga0495585_0088414_82_849 255
716 3300046499 Ga0495594_0000828 Ga0495594_0000828_6364_7131 255
717 3300046499 Ga0495594_0002110 Ga0495594_0002110_228_995 255
718 3300046499 Ga0495594_0054489 Ga0495594_0054489_1206_1973 255
719 3300046499 Ga0495594_0242772 Ga0495594_0242772_170_937 255
720 3300046500 Ga0495596_0000017 Ga0495596_0000017_89995_90762 255
721 3300046500 Ga0495596_0000366 Ga0495596_0000366_27834_28601 255
722 3300046500 Ga0495596_0000486 Ga0495596_0000486_9326_10114 255
723 3300046500 Ga0495596_0000884 Ga0495596_0000884_4926_5714 255
724 3300046500 Ga0495596_0000958 Ga0495596_0000958_8989_9756 255
725 3300046500 Ga0495596_0002923 Ga0495596_0002923_1951_2718 255
726 3300046500 Ga0495596_0014942 Ga0495596_0014942_1951_2718 255
727 3300046500 Ga0495596_0016439 Ga0495596_0016439_1672_2445 255
728 3300046500 Ga0495596_0087490 Ga0495596_0087490_111_908 255
729 3300046501 Ga0495607_0000485 Ga0495607_0000485_21945_22712 255
730 3300046501 Ga0495607_0001440 Ga0495607_0001440_8837_9604 255
731 3300046501 Ga0495607_0004924 Ga0495607_0004924_7681_8460 255
732 3300046501 Ga0495607_0006308 Ga0495607_0006308_7151_7918 255
733 3300046501 Ga0495607_0009224 Ga0495607_0009224_5301_6074 255
734 3300046501 Ga0495607_0063452 Ga0495607_0063452_39_806 255
735 3300046506 Ga0495583_0000010 Ga0495583_0000010_276681_277469 255
736 3300046506 Ga0495583_0000051 Ga0495583_0000051_81020_81787 255
737 3300046506 Ga0495583_0021928 Ga0495583_0021928_1538_2335 255
738 3300046506 Ga0495583_0030949 Ga0495583_0030949_147_944 255
739 3300046506 Ga0495583_0036045 Ga0495583_0036045_703_1491 255
740 3300046506 Ga0495583_0039818 Ga0495583_0039818_62_850 255
741 3300046506 Ga0495583_0055621 Ga0495583_0055621_936_1703 255
742 3300046506 Ga0495583_0098912 Ga0495583_0098912_135_902 255
743 3300046507 Ga0495606_0000101 Ga0495606_0000101_46768_47547 255
744 3300046507 Ga0495606_0000161 Ga0495606_0000161_91941_92711 255
745 3300046507 Ga0495606_0000409 Ga0495606_0000409_31458_32225 255
746 3300046507 Ga0495606_0003416 Ga0495606_0003416_4295_5062 255
747 3300046507 Ga0495606_0010811 Ga0495606_0010811_188_976 255
748 3300046507 Ga0495606_0089737 Ga0495606_0089737_315_1082 255
749 3300046512 Ga0495610_0000014 Ga0495610_0000014_44401_45168 255
750 3300046512 Ga0495610_0000020 Ga0495610_0000020_579_1367 255
751 3300046512 Ga0495610_0000293 Ga0495610_0000293_4779_5558 255
752 3300046512 Ga0495610_0001226 Ga0495610_0001226_515_1282 255
753 3300046512 Ga0495610_0024547 Ga0495610_0024547_1070_1837 255
754 3300046513 Ga0495616_0000446 Ga0495616_0000446_28059_28826 255
755 3300046513 Ga0495616_0000492 Ga0495616_0000492_9867_10634 255
756 3300046513 Ga0495616_0000493 Ga0495616_0000493_14919_15707 255
757 3300046513 Ga0495616_0002335 Ga0495616_0002335_521_1291 255
758 3300046513 Ga0495616_0008047 Ga0495616_0008047_316_1089 255
759 3300046513 Ga0495616_0008671 Ga0495616_0008671_3988_4755 255
760 3300046513 Ga0495616_0017240 Ga0495616_0017240_1236_2003 255
761 3300046513 Ga0495616_0025138 Ga0495616_0025138_1032_1829 255
762 3300046513 Ga0495616_0034155 Ga0495616_0034155_1086_1853 255
763 3300046513 Ga0495616_0034287 Ga0495616_0034287_277_1044 255
764 3300046513 Ga0495616_0073500 Ga0495616_0073500_287_1054 255
765 3300046513 Ga0495616_0115044 Ga0495616_0115044_244_1011 255
766 3300046515 Ga0495620_0005093 Ga0495620_0005093_429_1217 255
767 3300046515 Ga0495620_0053036 Ga0495620_0053036_406_1194 255
768 3300046517 Ga0495630_0034925 Ga0495630_0034925_997_1764 255
769 3300046518 Ga0495631_0000791 Ga0495631_0000791_4295_5092 255
770 3300046518 Ga0495631_0003789 Ga0495631_0003789_2101_2874 255
771 3300046518 Ga0495631_0016205 Ga0495631_0016205_2650_3417 255
772 3300046518 Ga0495631_0016490 Ga0495631_0016490_1670_2437 255
773 3300046518 Ga0495631_0052258 Ga0495631_0052258_623_1390 255
774 3300046518 Ga0495631_0084225 Ga0495631_0084225_319_1086 255
775 3300046518 Ga0495631_0106122 Ga0495631_0106122_174_941 255
776 3300046518 Ga0495631_0160438 Ga0495631_0160438_154_942 255
777 3300046519 Ga0495632_0000048 Ga0495632_0000048_52876_53649 255
778 3300046519 Ga0495632_0000065 Ga0495632_0000065_86971_87738 255
779 3300046519 Ga0495632_0000445 Ga0495632_0000445_7500_8288 255
780 3300046519 Ga0495632_0002241 Ga0495632_0002241_1566_2333 255
781 3300046519 Ga0495632_0013411 Ga0495632_0013411_2967_3755 255
782 3300046519 Ga0495632_0013468 Ga0495632_0013468_503_1270 255
783 3300046519 Ga0495632_0014339 Ga0495632_0014339_2285_3052 255
784 3300046519 Ga0495632_0025629 Ga0495632_0025629_1536_2333 255
785 3300046520 Ga0495637_0000293 Ga0495637_0000293_37510_38277 255
786 3300046520 Ga0495637_0003878 Ga0495637_0003878_2097_2870 255
787 3300046520 Ga0495637_0015401 Ga0495637_0015401_899_1690 255
788 3300046520 Ga0495637_0025683 Ga0495637_0025683_1532_2305 255
789 3300046520 Ga0495637_0031841 Ga0495637_0031841_1209_1976 255
790 3300046520 Ga0495637_0046503 Ga0495637_0046503_942_1739 255
791 3300046520 Ga0495637_0047426 Ga0495637_0047426_894_1667 255
792 3300046522 Ga0495643_0000030 Ga0495643_0000030_62437_63210 255
793 3300046522 Ga0495643_0000081 Ga0495643_0000081_119756_120541 255
794 3300046522 Ga0495643_0000234 Ga0495643_0000234_40822_41589 255
795 3300046522 Ga0495643_0000259 Ga0495643_0000259_37091_37858 255
796 3300046522 Ga0495643_0000391 Ga0495643_0000391_45305_46072 255
797 3300046522 Ga0495643_0003298 Ga0495643_0003298_7693_8460 255
798 3300046522 Ga0495643_0005676 Ga0495643_0005676_2414_3181 255
799 3300046522 Ga0495643_0038465 Ga0495643_0038465_151_948 255
800 3300046522 Ga0495643_0039291 Ga0495643_0039291_925_1692 255
801 3300046522 Ga0495643_0045127 Ga0495643_0045127_1359_2147 255
802 3300046522 Ga0495643_0114352 Ga0495643_0114352_207_974 255
803 3300046522 Ga0495643_0135447 Ga0495643_0135447_201_989 255
804 3300046523 Ga0495644_0005954 Ga0495644_0005954_629_1402 255
805 3300046523 Ga0495644_0039788 Ga0495644_0039788_63_830 255
806 3300046523 Ga0495644_0082294 Ga0495644_0082294_72_839 255
807 3300046524 Ga0495648_0000030 Ga0495648_0000030_12793_13563 255
808 3300046524 Ga0495648_0001105 Ga0495648_0001105_16075_16848 255
809 3300046524 Ga0495648_0002123 Ga0495648_0002123_7657_8424 255
810 3300046524 Ga0495648_0002372 Ga0495648_0002372_11173_11940 255
811 3300046524 Ga0495648_0003335 Ga0495648_0003335_8583_9350 255
812 3300046524 Ga0495648_0006165 Ga0495648_0006165_5360_6127 255
813 3300046524 Ga0495648_0016682 Ga0495648_0016682_1084_1857 255
814 3300046524 Ga0495648_0020755 Ga0495648_0020755_2417_3214 255
815 3300046525 Ga0495663_0000003 Ga0495663_0000003_235328_236101 255
816 3300046525 Ga0495663_0017735 Ga0495663_0017735_225_992 255
817 3300046525 Ga0495663_0056308 Ga0495663_0056308_195_962 255
818 3300046526 Ga0495666_0071989 Ga0495666_0071989_19_786 255
819 3300046526 Ga0495666_0120197 Ga0495666_0120197_128_895 255
820 3300046528 Ga0495642_0000085 Ga0495642_0000085_31912_32685 255
821 3300046528 Ga0495642_0004658 Ga0495642_0004658_4042_4809 255
822 3300046528 Ga0495642_0055346 Ga0495642_0055346_195_962 255
823 3300046529 Ga0495652_0033951 Ga0495652_0033951_1079_1846 255
824 3300046530 Ga0495654_0000014 Ga0495654_0000014_665_1432 255
825 3300046530 Ga0495654_0002221 Ga0495654_0002221_9698_10465 255
826 3300046530 Ga0495654_0032258 Ga0495654_0032258_1853_2620 255
827 3300046530 Ga0495654_0041475 Ga0495654_0041475_882_1670 255
828 3300046530 Ga0495654_0053621 Ga0495654_0053621_244_1011 255
829 3300046531 Ga0495665_0002029 Ga0495665_0002029_7987_8754 255
830 3300046531 Ga0495665_0230130 Ga0495665_0230130_33_800 255
831 3300046535 Ga0495586_0005932 Ga0495586_0005932_3150_3917 255
832 3300046535 Ga0495586_0348831 Ga0495586_0348831_63_830 255
833 3300046536 Ga0495587_0012506 Ga0495587_0012506_1752_2519 255
834 3300046536 Ga0495587_0047406 Ga0495587_0047406_1400_2167 255
835 3300046538 Ga0495609_0000019 Ga0495609_0000019_198568_199335 255
836 3300046538 Ga0495609_0000298 Ga0495609_0000298_19311_20078 255
837 3300046538 Ga0495609_0000447 Ga0495609_0000447_20955_21722 255
838 3300046538 Ga0495609_0002362 Ga0495609_0002362_10414_11202 255
839 3300046538 Ga0495609_0004683 Ga0495609_0004683_2628_3416 255
840 3300046538 Ga0495609_0011763 Ga0495609_0011763_2694_3461 255
841 3300046538 Ga0495609_0017035 Ga0495609_0017035_996_1769 255
842 3300046538 Ga0495609_0039371 Ga0495609_0039371_784_1581 255
843 3300046542 Ga0495597_0000020 Ga0495597_0000020_20390_21181 255
844 3300046542 Ga0495597_0000378 Ga0495597_0000378_7705_8472 255
845 3300046542 Ga0495597_0000771 Ga0495597_0000771_24555_25331 255
846 3300046542 Ga0495597_0010567 Ga0495597_0010567_2512_3309 255
847 3300046542 Ga0495597_0027187 Ga0495597_0027187_77_865 255
848 3300046542 Ga0495597_0049366 Ga0495597_0049366_536_1303 255
849 3300046542 Ga0495597_0059891 Ga0495597_0059891_680_1447 255
850 3300046557 Ga0495622_0020979 Ga0495622_0020979_2204_2971 255
851 3300046557 Ga0495622_0038190 Ga0495622_0038190_1043_1831 255
852 3300046557 Ga0495622_0055342 Ga0495622_0055342_216_983 255
853 3300046557 Ga0495622_0115500 Ga0495622_0115500_143_910 255
854 3300046558 Ga0495633_0000215 Ga0495633_0000215_33583_34356 255
855 3300046558 Ga0495633_0003511 Ga0495633_0003511_1200_1973 255
856 3300046558 Ga0495633_0006036 Ga0495633_0006036_1480_2268 255
857 3300046558 Ga0495633_0009986 Ga0495633_0009986_3603_4370 255
858 3300046558 Ga0495633_0033386 Ga0495633_0033386_775_1542 255
859 3300046558 Ga0495633_0044780 Ga0495633_0044780_947_1744 255
860 3300046558 Ga0495633_0051377 Ga0495633_0051377_365_1144 255
861 3300046558 Ga0495633_0091548 Ga0495633_0091548_396_1184 255
862 3300046558 Ga0495633_0102959 Ga0495633_0102959_296_1093 255
863 3300046558 Ga0495633_0143858 Ga0495633_0143858_287_1054 255
864 3300046615 Ga0495656_0009349 Ga0495656_0009349_1258_2031 255
865 3300046615 Ga0495656_0009453 Ga0495656_0009453_326_1093 255
866 3300046615 Ga0495656_0012450 Ga0495656_0012450_1856_2623 255
867 3300046615 Ga0495656_0129691 Ga0495656_0129691_410_1189 255
868 3300046616 Ga0495668_0000066 Ga0495668_0000066_69475_70242 255
869 3300046616 Ga0495668_0000579 Ga0495668_0000579_26262_27029 255
870 3300046616 Ga0495668_0000712 Ga0495668_0000712_24399_25178 255
871 3300046616 Ga0495668_0000941 Ga0495668_0000941_16395_17168 255
872 3300046616 Ga0495668_0006113 Ga0495668_0006113_3797_4594 255
873 3300046616 Ga0495668_0008725 Ga0495668_0008725_3209_3976 255
874 3300046616 Ga0495668_0025349 Ga0495668_0025349_1804_2592 255
875 3300046642 Ga0495634_0110452 Ga0495634_0110452_732_1499 255
876 3300046648 Ga0495611_0005640 Ga0495611_0005640_1090_1857 255
877 3300046648 Ga0495611_0013207 Ga0495611_0013207_1142_1930 255
878 3300046648 Ga0495611_0021422 Ga0495611_0021422_1489_2262 255
879 3300046660 Ga0495625_0000931 Ga0495625_0000931_3921_4688 255
880 3300046660 Ga0495625_0003303 Ga0495625_0003303_10881_11651 255
881 3300046660 Ga0495625_0006597 Ga0495625_0006597_5068_5835 255
882 3300046660 Ga0495625_0008059 Ga0495625_0008059_4409_5197 255
883 3300046660 Ga0495625_0009200 Ga0495625_0009200_4224_4994 255
884 3300046660 Ga0495625_0009398 Ga0495625_0009398_2828_3595 255
885 3300046660 Ga0495625_0016910 Ga0495625_0016910_2415_3212 255
886 3300046660 Ga0495625_0045391 Ga0495625_0045391_1834_2601 255
887 3300046660 Ga0495625_0053402 Ga0495625_0053402_795_1580 255
888 3300046660 Ga0495625_0070958 Ga0495625_0070958_394_1161 255
889 3300046660 Ga0495625_0079450 Ga0495625_0079450_116_883 255
890 3300046660 Ga0495625_0262301 Ga0495625_0262301_158_946 255
891 3300046663 Ga0495635_0080820 Ga0495635_0080820_848_1615 255
892 3300046665 Ga0495661_0000012 Ga0495661_0000012_72915_73682 255
893 3300046665 Ga0495661_0001056 Ga0495661_0001056_15461_16228 255
894 3300046665 Ga0495661_0001625 Ga0495661_0001625_12015_12803 255
895 3300046665 Ga0495661_0001753 Ga0495661_0001753_11812_12579 255
896 3300046665 Ga0495661_0002244 Ga0495661_0002244_4472_5245 255
897 3300046665 Ga0495661_0005577 Ga0495661_0005577_5340_6107 255
898 3300046665 Ga0495661_0025719 Ga0495661_0025719_2255_3052 255
899 3300046665 Ga0495661_0029391 Ga0495661_0029391_2319_3086 255
900 3300046665 Ga0495661_0032133 Ga0495661_0032133_483_1250 255
901 3300046665 Ga0495661_0042148 Ga0495661_0042148_276_1043 255
902 3300046665 Ga0495661_0054609 Ga0495661_0054609_1117_1884 255
903 3300046665 Ga0495661_0064810 Ga0495661_0064810_875_1648 255
904 3300046665 Ga0495661_0087318 Ga0495661_0087318_423_1190 255
905 3300046665 Ga0495661_0134895 Ga0495661_0134895_11_808 255
906 3300046665 Ga0495661_0138143 Ga0495661_0138143_275_1042 255
907 3300046665 Ga0495661_0186158 Ga0495661_0186158_270_1058 255
908 3300046665 Ga0495661_0208321 Ga0495661_0208321_48_845 255
909 3300046674 Ga0495588_0000050 Ga0495588_0000050_37075_37842 255
910 3300046674 Ga0495588_0004204 Ga0495588_0004204_1120_1887 255
911 3300046674 Ga0495588_0014664 Ga0495588_0014664_376_1143 255
912 3300046679 Ga0495623_0011819 Ga0495623_0011819_370_1137 255
913 3300046684 Ga0495669_0000177 Ga0495669_0000177_15136_15903 255
914 3300046684 Ga0495669_0001901 Ga0495669_0001901_2981_3754 255
915 3300046684 Ga0495669_0004923 Ga0495669_0004923_2650_3417 255
916 3300046684 Ga0495669_0136775 Ga0495669_0136775_339_1106 255
917 3300046689 Ga0495613_0021419 Ga0495613_0021419_3918_4685 255
918 3300046689 Ga0495613_0127856 Ga0495613_0127856_921_1688 255
919 3300046691 Ga0495670_0000099 Ga0495670_0000099_23127_23924 255
920 3300046691 Ga0495670_0000845 Ga0495670_0000845_1592_2359 255
921 3300046691 Ga0495670_0002249 Ga0495670_0002249_2713_3501 255
922 3300046691 Ga0495670_0004826 Ga0495670_0004826_2519_3286 255
923 3300046691 Ga0495670_0015496 Ga0495670_0015496_2326_3114 255
924 3300046691 Ga0495670_0015603 Ga0495670_0015603_2443_3210 255
925 3300046692 Ga0495671_0000005 Ga0495671_0000005_402672_403439 255
926 3300046692 Ga0495671_0000043 Ga0495671_0000043_62437_63210 255
927 3300046692 Ga0495671_0000965 Ga0495671_0000965_3455_4228 255
928 3300046692 Ga0495671_0001044 Ga0495671_0001044_431_1198 255
929 3300046692 Ga0495671_0002730 Ga0495671_0002730_7854_8639 255
930 3300046692 Ga0495671_0013778 Ga0495671_0013778_2271_3068 255
931 3300046692 Ga0495671_0055345 Ga0495671_0055345_719_1486 255
932 3300046694 Ga0495649_0000925 Ga0495649_0000925_12657_13424 255
933 3300046694 Ga0495649_0001478 Ga0495649_0001478_3675_4442 255
934 3300046694 Ga0495649_0002415 Ga0495649_0002415_956_1723 255
935 3300046694 Ga0495649_0021575 Ga0495649_0021575_737_1516 255
936 3300046694 Ga0495649_0123923 Ga0495649_0123923_39_806 255
937 3300046794 Ga0495589_0000007 Ga0495589_0000007_72555_73322 255
938 3300046794 Ga0495589_0000145 Ga0495589_0000145_5990_6757 255
939 3300046794 Ga0495589_0008988 Ga0495589_0008988_1024_1797 255
940 3300046794 Ga0495589_0017726 Ga0495589_0017726_1511_2278 255
941 3300046794 Ga0495589_0038226 Ga0495589_0038226_408_1175 255
942 3300046794 Ga0495589_0052226 Ga0495589_0052226_639_1406 255
943 3300046794 Ga0495589_0062732 Ga0495589_0062732_971_1738 255
944 3300046794 Ga0495589_0103003 Ga0495589_0103003_543_1310 255
945 3300046794 Ga0495589_0126147 Ga0495589_0126147_281_1069 255
946 3300046810 Ga0495660_0000100 Ga0495660_0000100_37258_38025 255
947 3300046810 Ga0495660_0000779 Ga0495660_0000779_12761_13528 255
948 3300046810 Ga0495660_0002034 Ga0495660_0002034_4004_4774 255
949 3300046810 Ga0495660_0002236 Ga0495660_0002236_4015_4782 255
950 3300046810 Ga0495660_0004798 Ga0495660_0004798_2293_3063 255
951 3300046810 Ga0495660_0006085 Ga0495660_0006085_1800_2567 255
952 3300046810 Ga0495660_0114702 Ga0495660_0114702_149_946 255
953 3300047315 Ga0495581_0013823 Ga0495581_0013823_3533_4300 255
954 3300047315 Ga0495581_0069182 Ga0495581_0069182_398_1165 255
955 3300047317 Ga0495604_0017012 Ga0495604_0017012_3681_4448 255
956 3300047317 Ga0495604_0062481 Ga0495604_0062481_661_1428 255
957 3300047317 Ga0495604_0323950 Ga0495604_0323950_16_783 255
958 3300047318 Ga0495636_0010960 Ga0495636_0010960_1723_2490 255
959 3300047320 Ga0495672_0000188 Ga0495672_0000188_54743_55510 255
960 3300047320 Ga0495672_0000226 Ga0495672_0000226_3410_4177 255
961 3300047320 Ga0495672_0000272 Ga0495672_0000272_28851_29618 255
962 3300047320 Ga0495672_0011006 Ga0495672_0011006_1818_2585 255
963 3300047320 Ga0495672_0072364 Ga0495672_0072364_657_1424 255
964 3300047320 Ga0495672_0077174 Ga0495672_0077174_321_1109 255
965 3300047321 Ga0495676_0000037 Ga0495676_0000037_101262_102029 255
966 3300047321 Ga0495676_0043115 Ga0495676_0043115_1579_2346 255
967 3300047321 Ga0495676_0127562 Ga0495676_0127562_715_1482 255
968 3300047322 Ga0495680_0005077 Ga0495680_0005077_3739_4506 255
969 3300047322 Ga0495680_0021570 Ga0495680_0021570_2376_3143 255
970 3300047323 Ga0495683_0001975 Ga0495683_0001975_1248_2015 255
971 3300047323 Ga0495683_0009910 Ga0495683_0009910_3282_4052 255
972 3300047323 Ga0495683_0011455 Ga0495683_0011455_1326_2093 255
973 3300047323 Ga0495683_0023237 Ga0495683_0023237_96_863 255
974 3300047323 Ga0495683_0051917 Ga0495683_0051917_513_1301 255
975 3300047323 Ga0495683_0075001 Ga0495683_0075001_632_1405 255
976 3300047323 Ga0495683_0115975 Ga0495683_0115975_205_1002 255
977 3300047443 Ga0495687_000003 Ga0495687_000003_198595_199362 255
978 3300047443 Ga0495687_000016 Ga0495687_000016_318258_319025 255
979 3300047443 Ga0495687_000028 Ga0495687_000028_8174_8941 255
980 3300047443 Ga0495687_000417 Ga0495687_000417_7784_8581 255
981 3300047443 Ga0495687_046170 Ga0495687_046170_813_1580 255
982 3300047444 Ga0495675_0101663 Ga0495675_0101663_338_1105 255
983 3300047445 Ga0495677_0000005 Ga0495677_0000005_203345_204112 255
984 3300047445 Ga0495677_0000722 Ga0495677_0000722_4895_5662 255
985 3300047445 Ga0495677_0002621 Ga0495677_0002621_4619_5386 255
986 3300047445 Ga0495677_0003870 Ga0495677_0003870_34_801 255
987 3300047445 Ga0495677_0005985 Ga0495677_0005985_1533_2300 255
988 3300047445 Ga0495677_0011091 Ga0495677_0011091_1988_2761 255
989 3300047445 Ga0495677_0020456 Ga0495677_0020456_1086_1853 255
990 3300047445 Ga0495677_0125269 Ga0495677_0125269_144_911 255
991 3300047446 Ga0495679_002173 Ga0495679_002173_7261_8058 255
992 3300047446 Ga0495679_008263 Ga0495679_008263_3106_3873 255
993 3300047447 Ga0495685_019404 Ga0495685_019404_672_1469 255
994 3300047447 Ga0495685_039044 Ga0495685_039044_142_909 255
995 3300047469 Ga0495673_0000008 Ga0495673_0000008_439497_440264 255
996 3300047469 Ga0495673_0000702 Ga0495673_0000702_12511_13302 255
997 3300047469 Ga0495673_0068437 Ga0495673_0068437_275_1063 255
998 3300047469 Ga0495673_0092700 Ga0495673_0092700_317_1084 255
999 3300047470 Ga0495681_0000123 Ga0495681_0000123_59027_59815 255
1000 3300047470 Ga0495681_0003758 Ga0495681_0003758_1387_2160 255
1001 3300047470 Ga0495681_0004627 Ga0495681_0004627_8445_9215 255
1002 3300047470 Ga0495681_0007875 Ga0495681_0007875_2727_3494 255
1003 3300047470 Ga0495681_0027026 Ga0495681_0027026_825_1592 255
1004 3300047470 Ga0495681_0099096 Ga0495681_0099096_43_810 255
1005 3300047472 Ga0495686_0000054 Ga0495686_0000054_256703_257470 255
1006 3300047472 Ga0495686_0003051 Ga0495686_0003051_6741_7508 255
1007 3300047472 Ga0495686_0003612 Ga0495686_0003612_9688_10458 255
1008 3300047472 Ga0495686_0012570 Ga0495686_0012570_2862_3641 255
1009 3300047472 Ga0495686_0019149 Ga0495686_0019149_904_1677 255
1010 3300047472 Ga0495686_0039828 Ga0495686_0039828_1960_2748 255
1011 3300047472 Ga0495686_0066042 Ga0495686_0066042_1447_2214 255
1012 3300047472 Ga0495686_0233483 Ga0495686_0233483_46_816 255
1013 3300047673 Ga0495593_0004899 Ga0495593_0004899_3079_3846 255
1014 3300047673 Ga0495593_0014834 Ga0495593_0014834_1022_1789 255
1015 3300047673 Ga0495593_0068663 Ga0495593_0068663_875_1642 255
1016 3300048089 Ga0495614_0008021 Ga0495614_0008021_350_1117 255
1017 3300048089 Ga0495614_0010244 Ga0495614_0010244_2631_3398 255
1018 3300048091 Ga0495626_0000322 Ga0495626_0000322_40133_40900 255
1019 3300048091 Ga0495626_0003241 Ga0495626_0003241_2859_3626 255
1020 3300048091 Ga0495626_0004117 Ga0495626_0004117_2529_3296 255
1021 3300048091 Ga0495626_0004329 Ga0495626_0004329_2319_3107 255
1022 3300048091 Ga0495626_0006298 Ga0495626_0006298_4724_5491 255
1023 3300048091 Ga0495626_0006531 Ga0495626_0006531_4150_4917 255
1024 3300048091 Ga0495626_0014964 Ga0495626_0014964_546_1313 255
1025 3300048091 Ga0495626_0025116 Ga0495626_0025116_382_1161 255
1026 3300048091 Ga0495626_0026914 Ga0495626_0026914_556_1344 255
1027 3300048091 Ga0495626_0041785 Ga0495626_0041785_749_1516 255
1028 3300048091 Ga0495626_0057082 Ga0495626_0057082_433_1230 255
1029 3300048091 Ga0495626_0065753 Ga0495626_0065753_416_1183 255
1030 3300048903 Ga0496100_0059302 Ga0496100_0059302_977_1744 255
1031 3300048904 Ga0496101_0020477 Ga0496101_0020477_1537_2304 255
1032 3300048904 Ga0496101_0112071 Ga0496101_0112071_451_1218 255
1033 3300048905 Ga0496102_0000931 Ga0496102_0000931_3738_4511 255
1034 3300048905 Ga0496102_0011417 Ga0496102_0011417_3349_4128 255
1035 3300048905 Ga0496102_0030581 Ga0496102_0030581_215_982 255
1036 3300048905 Ga0496102_0122227 Ga0496102_0122227_1392_2159 255
1037 3300048905 Ga0496102_0174486 Ga0496102_0174486_371_1138 255
1038 3300048905 Ga0496102_0196686 Ga0496102_0196686_165_968 255
1039 3300048906 Ga0496103_0007939 Ga0496103_0007939_3885_4652 255
1040 3300048906 Ga0496103_0346197 Ga0496103_0346197_64_867 255
1041 3300048909 Ga0496106_0012244 Ga0496106_0012244_4760_5527 255
1042 3300048910 Ga0496107_0017128 Ga0496107_0017128_2408_3175 255
1043 3300048910 Ga0496107_0049247 Ga0496107_0049247_1361_2128 255
1044 3300048912 Ga0496109_0115634 Ga0496109_0115634_229_1002 255
1045 3300048912 Ga0496109_0229130 Ga0496109_0229130_403_1200 255
1046 3300048912 Ga0496109_0231317 Ga0496109_0231317_692_1459 255
1047 3300048913 Ga0496110_0001119 Ga0496110_0001119_4254_5051 255
1048 3300048914 Ga0496111_0060901 Ga0496111_0060901_1335_2132 255
1049 3300048916 Ga0496113_0007519 Ga0496113_0007519_4558_5325 255
1050 3300048916 Ga0496113_0353646 Ga0496113_0353646_224_997 255
1051 3300048917 Ga0496114_0075065 Ga0496114_0075065_226_993 255
1052 3300048918 Ga0496115_0101784 Ga0496115_0101784_751_1524 255
1053 3300048919 Ga0496116_0015565 Ga0496116_0015565_4447_5214 255
1054 3300048920 Ga0496117_0000645 Ga0496117_0000645_11437_12204 255
1055 3300048920 Ga0496117_0003157 Ga0496117_0003157_11_778 255
1056 3300048920 Ga0496117_0010742 Ga0496117_0010742_2799_3566 255
1057 3300048921 Ga0496118_0000338 Ga0496118_0000338_11534_12301 255
1058 3300048921 Ga0496118_0002116 Ga0496118_0002116_2267_3034 255
1059 3300048921 Ga0496118_0008860 Ga0496118_0008860_9143_9910 255
1060 3300048924 Ga0496121_0059199 Ga0496121_0059199_2149_2922 255
1061 3300048924 Ga0496121_0258550 Ga0496121_0258550_38_805 255
1062 3300048925 Ga0496122_0000210 Ga0496122_0000210_72865_73632 255
1063 3300048925 Ga0496122_0000808 Ga0496122_0000808_16154_16945 255
1064 3300048925 Ga0496122_0019722 Ga0496122_0019722_2401_3168 255
1065 3300048925 Ga0496122_0034402 Ga0496122_0034402_47_814 255
1066 3300048925 Ga0496122_0106936 Ga0496122_0106936_697_1464 255
1067 3300048926 Ga0496123_0000591 Ga0496123_0000591_3470_4261 255
1068 3300048926 Ga0496123_0000597 Ga0496123_0000597_53704_54471 255
1069 3300048926 Ga0496123_0003625 Ga0496123_0003625_2277_3047 255
1070 3300048926 Ga0496123_0005021 Ga0496123_0005021_2333_3100 255
1071 3300048926 Ga0496123_0023774 Ga0496123_0023774_3578_4345 255
1072 3300048926 Ga0496123_0085817 Ga0496123_0085817_383_1150 255
1073 3300048926 Ga0496123_0128076 Ga0496123_0128076_19_807 255
1074 3300048926 Ga0496123_0161496 Ga0496123_0161496_16_804 255
1075 3300048927 Ga0496124_0004210 Ga0496124_0004210_2450_3217 255
1076 3300048927 Ga0496124_0010799 Ga0496124_0010799_2928_3695 255
1077 3300048927 Ga0496124_0022742 Ga0496124_0022742_4023_4793 255
1078 3300048927 Ga0496124_0037634 Ga0496124_0037634_637_1404 255
1079 3300048927 Ga0496124_0054728 Ga0496124_0054728_1603_2370 255
1080 3300048927 Ga0496124_0114901 Ga0496124_0114901_1019_1792 255
1081 3300048928 Ga0496125_0000789 Ga0496125_0000789_24641_25408 255
1082 3300048928 Ga0496125_0003880 Ga0496125_0003880_1005_1772 255
1083 3300048928 Ga0496125_0023862 Ga0496125_0023862_4389_5156 255
1084 3300048928 Ga0496125_0145313 Ga0496125_0145313_58_849 255
1085 3300048928 Ga0496125_0222157 Ga0496125_0222157_167_934 255
1086 3300048929 Ga0496126_0406116 Ga0496126_0406116_247_1020 255
1087 3300049459 Ga0495678_000006 Ga0495678_000006_208486_209256 255
1088 3300049459 Ga0495678_000130 Ga0495678_000130_23002_23769 255
1089 3300049459 Ga0495678_002123 Ga0495678_002123_7679_8476 255
1090 3300049459 Ga0495678_018410 Ga0495678_018410_1013_1786 255
1091 3300049460 Ga0495682_0068963 Ga0495682_0068963_382_1179 255
1092 3300049460 Ga0495682_0085817 Ga0495682_0085817_325_1113 255
1093 3300049569 Ga0501032_0189417 Ga0501032_0189417_118_885 255
1094 3300049571 Ga0501034_0166710 Ga0501034_0166710_248_1015 255
1095 3300049571 Ga0501034_0191130 Ga0501034_0191130_608_1399 255
1096 3300049571 Ga0501034_0339289 Ga0501034_0339289_114_917 255
1097 3300049571 Ga0501034_0505333 Ga0501034_0505333_262_1029 255
1098 3300049581 Ga0501047_0235227 Ga0501047_0235227_34_801 255
1099 3300049665 Ga0501227_005034 Ga0501227_005034_1986_2762 255
1100 3300049679 Ga0501249_004483 Ga0501249_004483_996_1763 255
1101 3300049766 Ga0501269_000016 Ga0501269_000016_55659_56426 255
1102 3300049766 Ga0501269_001654 Ga0501269_001654_565_1338 255
1103 3300049822 Ga0501035_0018733 Ga0501035_0018733_421_1188 255
1104 3300049822 Ga0501035_0148309 Ga0501035_0148309_565_1332 255
1105 3300049823 Ga0501044_0177987 Ga0501044_0177987_1158_1925 255
1106 3300049823 Ga0501044_0389883 Ga0501044_0389883_474_1241 255
1107 3300050490 nmdc:mga03n38_225856_c1 nmdc:mga03n38_225856_c1_68_835 255
1108 3300050491 nmdc:mga00v17_23_c1 nmdc:mga00v17_23_c1_18263_19039 255
1109 3300050491 nmdc:mga00v17_33669_c1 nmdc:mga00v17_33669_c1_685_1503 255
1110 3300053096 Ga0500641_0072413 Ga0500641_0072413_74_862 255
1111 3300053103 Ga0500555_000370 Ga0500555_000370_2543_3331 255
1112 3300053125 Ga0500618_000088 Ga0500618_000088_69917_70684 255
1113 3300053125 Ga0500618_000519 Ga0500618_000519_13668_14435 255
1114 3300053125 Ga0500618_009889 Ga0500618_009889_961_1728 255
1115 3300053136 Ga0500559_0004652 Ga0500559_0004652_2026_2802 255
1116 3300053139 Ga0500568_0023303 Ga0500568_0023303_1437_2225 255
1117 3300053151 Ga0500604_0014012 Ga0500604_0014012_514_1302 255
1118 3300053158 Ga0500627_0008381 Ga0500627_0008381_2030_2818 255
1119 3300059477 Ga0587084_000853 Ga0587084_000853_1610_2401 255
1120 3300059490 Ga0587066_001081 Ga0587066_001081_1609_2400 255
1121 3300059491 Ga0587070_001403 Ga0587070_001403_1628_2419 255
1122 3300059493 Ga0587077_003339 Ga0587077_003339_680_1471 255
1123 3300059506 Ga0587085_005580 Ga0587085_005580_208_999 255
1124 3300059510 Ga0587090_004877 Ga0587090_004877_371_1162 255
1125 3300059511 Ga0587091_002339 Ga0587091_002339_1200_1991 255
1126 3300059623 Ga0587101_001671 Ga0587101_001671_680_1471 255
1127 3300059624 Ga0587109_008309 Ga0587109_008309_208_999 255
1128 3300059627 Ga0587117_004643 Ga0587117_004643_495_1286 255
1129 3300059639 Ga0587062_002637 Ga0587062_002637_680_1471 255
1130 3300059640 Ga0587067_003478 Ga0587067_003478_619_1386 255
1131 3300059645 Ga0587076_001114 Ga0587076_001114_1592_2383 255
1132 3300059648 Ga0587100_000181 Ga0587100_000181_200_991 255
1133 3300060346 Ga0587111_0008704 Ga0587111_0008704_680_1471 255
1134 iso_pu_bacteria 2690315857 2691331382 255
1135 iso_pu_bacteria 2855730933 2855732292 255
1136 iso_pu_bacteria 2855767633 2855769000 255
1137 iso_pu_bacteria 2919534386 2919534945 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

9

239

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9856 1 252
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9816 1 247
4fuk-assembly1.cif.gz_A aminopeptidase from trypanosoma brucei 0.9764 7 253
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9755 1 246
4a6v-assembly1.cif.gz_A x-ray structures of oxazole hydroxamate ecmetap-mn complexes 0.9751 1 252
ID Description Score Start End Superfamily
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9914 1 252 3.90.230.10
af_I1J6Q1_1_201_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9784 46 247 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9773 1 247 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9755 1 246 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9738 2 247 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A2M8P659-F1-model_v4 Type I methionyl aminopeptidase 1.002 116 233 GO:0005829
GO:0006508
GO:0070006
AF-A0A3B9AWZ8-F1-model_v4 deleted 0.9997 69 251
AF-A0A4Q6F1R4-F1-model_v4 deleted 0.9983 34 247
AF-A0A6G8DHF1-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9982 1 251 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A3C0LYD4-F1-model_v4 deleted 0.9978 108 202

Feature Viewer

pLDDT pTM Quality
97.15 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map