F490376

General Info

Members Datasets Scaffolds Average Seq Length
1119 912 412 398

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_24573_c1|nmdc:mga0yw44_24573_c1_598_1992
Length 464
Sequence VKVNVPFPKSEQLRSDPKPRKGNFNRDIKLRFFEWRRLATLWQAPVANGTLAEQRKGGLVMLRRLEDARILMYSHDTFGLGHLRRCRTIAHSLVEDFRGLNVLIISGATIAGAFDYRARVDFVKIPSIIKLRNGEYTSMERHIDLHETLKMRQSIIRHTAETFQPDIFIVDKEPMGLRGEAEETLSYLKARGTTLILGLREVMDAPKLLDAEWKRNDVMRKIGKLYDMIWVYGPRDFYDPLTGLDVPANVRAKMQFVGFLQRSLSKNEEPDHRPKGDYILVTTGGGGDGADLIHSVIHAYQQDPTLTHRALVVLGPYMPAKKRRKLMSKGAGIPFLEMIEFDNRMEELIAGAKAVVAMGGYNTYCEILSFDKPALIVPRVAPRQEQLIRAQRASELGLIEMLLPEQAENAPRFAAALKALPDRAPPSKSNPNLRMQGLGDISQIVETWFDQRTAHYLSVVDGKL

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
15 2512875024 Mesorhizobium loti R88b Isolate Nodule
16 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
17 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
18 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
19 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
20 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
21 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
22 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
23 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
24 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
25 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
26 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
27 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
28 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
29 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
30 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
31 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
32 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
33 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
34 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
35 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
36 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
37 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
38 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
39 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
40 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
41 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
42 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
43 2516143018 Ensifer sp. BR816 Isolate Nodule
44 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
45 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
46 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
47 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
48 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
49 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
50 2519899620 Rhizobium sp. Pop5 Isolate Nodule
51 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
52 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
53 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
54 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
55 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
56 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
57 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
58 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
59 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
60 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
61 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
62 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
63 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
64 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
65 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
66 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
67 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
68 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
69 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
70 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
71 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
72 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
73 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
74 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
75 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
76 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
77 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
78 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
79 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
80 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
81 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
82 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
83 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
84 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
85 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
86 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
87 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
88 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
89 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
90 2643221557 Ensifer sp. Root558 Isolate Unclassified
91 2643221558 Rhizobium sp. Root149 Isolate Unclassified
92 2643221568 Rhizobium sp. Root564 Isolate Unclassified
93 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
94 2643221599 Rhizobium sp. Root708 Isolate Unclassified
95 2643221607 Rhizobium sp. Root73 Isolate Unclassified
96 2643221610 Ensifer sp. Root74 Isolate Unclassified
97 2643221618 Ensifer sp. Root231 Isolate Unclassified
98 2643221626 Ensifer sp. Root31 Isolate Unclassified
99 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
100 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
101 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
102 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
103 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
104 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
105 2643221655 Ensifer sp. Root1252 Isolate Unclassified
106 2643221659 Ensifer sp. Root127 Isolate Unclassified
107 2643221668 Ensifer sp. Root423 Isolate Unclassified
108 2643221675 Ensifer sp. Root1298 Isolate Unclassified
109 2643221680 Ensifer sp. Root1312 Isolate Unclassified
110 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
111 2643221688 Rhizobium sp. Root482 Isolate Unclassified
112 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
113 2643221693 Rhizobium sp. Root491 Isolate Unclassified
114 2643221712 Ensifer sp. Root258 Isolate Unclassified
115 2643221718 Rhizobium sp. Root268 Isolate Unclassified
116 2643221719 Rhizobium sp. Root274 Isolate Unclassified
117 2643221723 Ensifer sp. Root278 Isolate Unclassified
118 2643221726 Ensifer sp. Root954 Isolate Unclassified
119 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
120 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
121 2718217882 Rhizobium sp. N741 Isolate Nodule
122 2718217927 Rhizobium sp. N324 Isolate Nodule
123 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
124 2718218009 Rhizobium sp. N561 Isolate Nodule
125 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
126 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
127 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
128 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
129 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
130 2718218363 Rhizobium sp. N113 Isolate Nodule
131 2718218365 Rhizobium sp. N731 Isolate Nodule
132 2718218366 Rhizobium sp. N621 Isolate Nodule
133 2718218423 Rhizobium sp. N941 Isolate Nodule
134 2721755514 Rhizobium sp. N6212 Isolate Nodule
135 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
136 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
137 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
138 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
139 2721755809 Rhizobium sp. N541 Isolate Nodule
140 2721755810 Rhizobium sp. N871 Isolate Nodule
141 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
142 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
143 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
144 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
145 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
146 2728369365 Rhizobium sp. N1341 Isolate Nodule
147 2728369397 Rhizobium sp. N1314 Isolate Nodule
148 2738541293 Rhizobium sp. GV031 Isolate Unclassified
149 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
150 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
151 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
152 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
153 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
154 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
155 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
156 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
157 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
158 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
159 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
160 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
161 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
162 2791355256 Rhizobium sp. M10 Isolate Nodule
163 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
164 2791355260 Rhizobium sp. L9 Isolate Nodule
165 2791355261 Rhizobium sp. J15 Isolate Nodule
166 2791355262 Rhizobium sp. M1 Isolate Nodule
167 2791355263 Rhizobium chutanense C5 Isolate Nodule
168 2791355264 Rhizobium sp. S9 Isolate Nodule
169 2791355265 Rhizobium sp. H4 Isolate Nodule
170 2791355266 Rhizobium sp. L43 Isolate Nodule
171 2791355267 Rhizobium sp. L18 Isolate Nodule
172 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
173 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
174 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
175 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
176 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
177 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
178 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
179 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
180 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
181 2802429633 Rhizobium anhuiense J3 Isolate Nodule
182 2802429634 Rhizobium anhuiense S10 Isolate Nodule
183 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
184 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
185 2802429637 Rhizobium anhuiense C15 Isolate Nodule
186 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
187 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
188 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
189 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
190 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
191 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
192 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
193 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
194 2838048938 Rhizobium pisi 27/80 Isolate Nodule
195 2838061910 Rhizobium phaseoli L15 Isolate Nodule
196 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
197 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
198 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
199 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
200 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
201 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
202 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
203 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
204 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
205 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
206 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
207 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
208 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
209 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
210 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
211 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
212 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
213 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
214 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
215 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
216 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
217 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
218 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
219 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
220 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
221 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
222 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
223 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
224 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
225 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
226 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
227 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
228 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
229 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
230 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
231 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
232 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
233 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
234 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
235 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
236 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
237 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
238 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
239 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
240 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
241 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
242 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
243 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
244 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
245 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
246 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
247 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
248 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
249 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
250 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
251 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
252 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
253 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
254 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
255 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
256 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
257 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
258 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
259 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
260 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
261 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
262 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
263 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
264 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
265 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
266 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
267 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
268 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
269 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
270 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
271 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
272 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
273 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
274 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
275 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
276 2844163670 Ensifer sp. 1H6 Isolate Unclassified
277 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
278 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
279 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
280 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
281 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
282 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
283 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
284 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
285 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
286 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
287 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
288 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
289 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
290 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
291 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
292 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
293 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
294 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
295 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
296 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
297 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
298 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
299 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
300 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
301 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
302 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
303 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
304 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
305 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
306 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
307 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
308 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
309 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
310 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
311 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
312 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
313 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
314 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
315 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
316 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
317 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
318 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
319 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
320 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
321 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
322 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
323 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
324 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
325 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
326 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
327 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
328 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
329 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
330 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
331 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
332 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
333 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
334 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
335 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
336 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
337 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
338 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
339 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
340 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
341 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
342 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
343 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
344 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
345 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
346 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
347 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
348 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
349 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
350 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
351 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
352 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
353 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
354 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
355 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
356 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
357 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
358 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
359 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
360 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
361 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
362 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
363 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
364 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
365 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
366 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
367 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
368 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
369 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
370 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
371 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
372 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
373 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
374 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
375 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
376 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
377 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
378 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
379 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
380 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
381 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
382 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
383 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
384 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
385 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
386 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
387 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
388 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
389 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
390 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
391 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
392 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
393 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
394 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
395 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
396 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
397 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
398 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
399 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
400 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
401 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
402 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
403 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
404 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
405 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
406 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
407 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
408 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
409 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
410 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
411 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
412 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
413 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
414 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
415 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
416 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
417 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
418 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
419 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
420 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
421 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
422 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
423 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
424 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
425 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
426 2933599457 Rhizobium phaseoli M3 Isolate Nodule
427 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
428 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
429 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
430 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
431 2936381700 Rhizobium chutanense C16 Isolate Unclassified
432 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
433 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
434 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
435 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
436 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
437 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
438 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
439 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
440 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
441 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
442 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
443 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
444 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
445 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
446 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
447 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
448 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
449 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
450 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
451 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
452 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
453 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
454 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
455 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
456 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
457 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
458 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
459 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
460 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
461 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
462 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
463 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
464 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
465 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
466 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
467 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
468 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
469 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
470 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
471 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
472 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
473 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
474 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
475 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
476 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
477 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
478 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
479 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
480 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
481 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
482 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
483 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
484 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
485 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
486 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
487 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
488 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
489 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
490 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
491 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
492 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
493 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
494 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
495 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
496 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
497 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
498 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
499 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
500 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
501 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
502 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
503 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
504 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
505 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
506 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
507 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
508 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
509 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
510 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
511 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
512 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
513 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
514 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
515 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
516 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
517 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
518 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
519 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
520 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
521 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
522 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
523 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
524 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
525 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
526 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
527 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
528 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
529 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
530 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
531 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
532 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
533 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
534 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
535 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
536 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
537 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
538 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
539 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
540 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
541 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
542 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
543 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
544 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
545 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
546 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
547 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
548 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
549 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
550 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
551 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
552 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
553 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
554 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
555 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
556 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
557 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
558 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
559 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
560 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
561 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
562 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
563 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
564 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
565 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
566 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
567 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
568 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
569 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
570 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
571 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
572 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
573 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
574 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
575 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
576 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
577 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
578 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
579 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
580 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
581 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
582 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
583 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
584 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
585 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
586 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
587 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
588 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
589 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
590 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
591 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
592 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
593 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
594 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
595 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
596 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
597 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
598 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
599 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
600 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
601 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
602 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
603 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
604 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
605 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
606 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
607 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
608 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
609 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
610 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
611 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
612 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
613 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
614 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
615 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
616 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
617 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
618 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
619 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
620 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
621 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
622 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
623 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
624 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
625 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
626 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
627 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
628 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
629 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
630 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
631 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
632 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
633 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
634 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
635 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
636 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
637 2996887358 Rhizobium sp. R711 Isolate Nodule
638 2996893221 Rhizobium sp. R635 Isolate Nodule
639 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
640 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
641 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
642 3004167301 Mesorhizobium loti 582 Isolate Unclassified
643 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
644 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
645 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
646 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
647 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
648 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
649 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
650 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
651 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
652 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
653 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
654 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
655 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
656 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
657 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
658 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
659 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
660 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
661 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
662 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
663 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
664 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
665 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
666 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
667 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
668 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
669 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
670 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
671 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
672 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
673 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
674 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
675 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
676 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
677 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
678 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
679 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
680 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
681 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
682 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
683 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
684 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
685 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
686 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
687 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
688 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
689 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
690 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
691 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
692 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
693 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
694 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
695 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
696 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
697 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
698 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
699 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
700 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
701 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
702 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
703 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
704 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
705 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
706 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
707 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
708 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
709 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
710 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
711 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
712 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
713 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
714 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
715 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
716 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
717 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
718 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
719 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
720 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
721 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
722 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
723 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
724 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
725 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
726 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
727 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
728 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
729 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
730 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
731 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
732 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
733 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
734 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
735 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
736 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
737 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
738 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
739 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
740 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
741 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
742 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
743 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
744 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
745 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
746 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
747 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
748 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
749 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
750 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
751 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
752 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
753 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
754 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
755 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
756 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
757 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
758 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
759 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
760 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
761 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
762 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
763 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
764 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
765 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
766 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
767 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
768 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
769 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
770 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
771 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
772 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
773 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
774 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
775 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
776 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
777 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
778 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
779 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
780 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
781 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
782 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
783 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
784 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
785 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
786 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
787 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
788 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
789 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
790 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
791 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
792 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
793 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
794 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
795 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
796 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
797 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
798 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
799 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
800 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
801 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
802 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
803 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
804 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
805 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
806 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
807 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
808 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
809 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
810 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
811 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
812 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
813 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
814 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
815 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
816 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
817 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
818 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
819 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
820 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
821 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
822 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
823 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
824 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
825 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
826 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
827 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
828 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
829 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
830 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
831 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
832 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
833 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
834 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
835 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
836 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
837 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
838 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
839 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
840 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
841 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
842 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
843 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
844 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
845 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
846 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
847 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
848 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
849 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
850 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
851 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
852 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
853 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
854 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
855 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
856 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
857 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
858 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
859 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
860 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
861 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
862 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
863 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
864 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
865 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
866 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
867 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
868 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
869 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
870 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
871 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
872 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
873 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
874 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
875 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
876 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
877 8005258706 Rhizobium sp. R693 Isolate Nodule
878 8005275841 Rhizobium sp. N4311 Isolate Nodule
879 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
880 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
881 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
882 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
883 8005321885 Rhizobium sp. R72 Isolate Nodule
884 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
885 8005382845 Rhizobium sp. R634 Isolate Nodule
886 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
887 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
888 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
889 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
890 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
891 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
892 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
893 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
894 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
895 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
896 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
897 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
898 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
899 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
900 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
901 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
902 8018176218 Rhizobium sp. N122 Isolate Nodule
903 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
904 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
905 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
906 8024501048 Rhizobium sp. H4 Isolate Nodule
907 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
908 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
909 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
910 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
911 8056382006 Rhizobium croatiense 13T Isolate Nodule
912 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.82
Metatranscriptomes 0
Isolates 63.18

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 15.55
Nodule 51.47
Rhizoplane 1.97
Rhizosphere 15.37
Stem 0
Stem Tuber 0
Unclassified 15.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000443 3300001979 Bacteria 17700
2 JGI25155J39150_1000020 3300002704 Bacteria 152963
3 JGI25156J39149_1000021 3300002705 Bacteria 152968
4 JGI25162J39368_1001310 3300002737 Bacteria 13993
5 JGI25162J39368_1001352 3300002737 Bacteria 13572
6 JGI25162J39368_1001559 3300002737 Bacteria 11743
7 JGI25154J39366_1000039 3300002738 Bacteria 152972
8 JGI25158J39367_1000021 3300002739 Bacteria 39295
9 JGI25158J39367_1003597 3300002739 Bacteria 2378
10 JGI25157J39369_1000019 3300002741 Bacteria 176591
11 JGI25152J39213_1001590 3300002773 Bacteria 9530
12 JGI25152J39213_1002259 3300002773 Bacteria 7440
13 JGI25152J39213_1015384 3300002773 Bacteria 1511
14 JGI25152J39213_1015385 3300002773 Bacteria 1511
15 JGI25150J39212_1000022 3300002774 Bacteria 131963
16 JGI25150J39212_1001979 3300002774 Bacteria 5367
17 JGI25159J45721_1000037 3300002987 Bacteria 76090
18 JGI25159J45721_1000355 3300002987 Bacteria 21217
19 JGI25159J45721_1000423 3300002987 Bacteria 19499
20 JGI25151J46595_10000023 3300003187 Bacteria 221548
21 JGI25151J46595_10000274 3300003187 Bacteria 59318
22 JGI25151J46595_10006048 3300003187 Bacteria 6158
23 JGI25151J46595_10025607 3300003187 Bacteria 2397
24 JGI25151J46595_10040456 3300003187 Bacteria 1706
25 JGI25406J46586_10004119 3300003203 Bacteria 6787
26 JGI25165J46597_1000018 3300003214 Bacteria 374701
27 JGI25165J46597_1000407 3300003214 Bacteria 45582
28 JGI25153J46596_10002677 3300003215 Bacteria 10172
29 JGI25153J46596_10038349 3300003215 Bacteria 1511
30 JGI25153J46596_10038350 3300003215 Bacteria 1511
31 rootH2_10051486 3300003320 Bacteria 8910
32 rootL2_10024477 3300003322 Bacteria 14815
33 rootH1_10019293 3300003323 Bacteria 14409
34 JGI25160J50197_1000014 3300003354 Bacteria 259862
35 JGI25160J50197_1000113 3300003354 Bacteria 76090
36 JGI25160J50197_1003169 3300003354 Bacteria 7467
37 JGI25160J50197_1008334 3300003354 Bacteria 3956
38 JGI25161J50226_1000022 3300003374 Bacteria 158544
39 JGI25161J50226_1000025 3300003374 Bacteria 148471
40 JGI25161J50226_1001063 3300003374 Bacteria 9391
41 JGI25161J50226_1003751 3300003374 Bacteria 3372
42 Ga0055526_1003560 3300003771 Bacteria 9809
43 Ga0055526_1004633 3300003771 Bacteria 8187
44 Ga0055526_1011807 3300003771 Bacteria 3881
45 Ga0055526_1018430 3300003771 Bacteria 2604
46 Ga0055524_1000809 3300003775 Bacteria 20756
47 Ga0055524_1002252 3300003775 Bacteria 10093
48 Ga0055524_1002377 3300003775 Bacteria 9761
49 Ga0055524_1002795 3300003775 Bacteria 8762
50 Ga0055524_1014125 3300003775 Bacteria 2975
51 Ga0055528_1002240 3300003790 Bacteria 10534
52 Ga0055528_1003248 3300003790 Bacteria 8290
53 Ga0055528_1021841 3300003790 Bacteria 2014
54 Ga0055540_1000379 3300003792 Bacteria 37172
55 Ga0055540_1016517 3300003792 Bacteria 2098
56 Ga0058692_1001787 3300003856 Bacteria 7612
57 Ga0055543_1000005 3300004625 Bacteria 223621
58 Ga0055543_1000381 3300004625 Bacteria 28994
59 Ga0055543_1000817 3300004625 Bacteria 15293
60 Ga0065165_1000347 3300005262 Bacteria 75788
61 Ga0065165_1002002 3300005262 Bacteria 19097
62 Ga0065165_1002159 3300005262 Bacteria 17794
63 Ga0065165_1003353 3300005262 Bacteria 11384
64 Ga0065165_1011043 3300005262 Bacteria 3821
65 Ga0065165_1023268 3300005262 Bacteria 2104
66 Ga0070670_100000196 3300005331 Bacteria 56006
67 Ga0070668_100019030 3300005347 Bacteria 5161
68 Ga0070668_100042323 3300005347 Bacteria 3491
69 Ga0070669_100072607 3300005353 Bacteria 2548
70 Ga0070674_100144571 3300005356 Bacteria 1789
71 Ga0070667_100263878 3300005367 Bacteria 1543
72 Ga0070707_100126638 3300005468 Bacteria 2482
73 Ga0070699_100051187 3300005518 Bacteria 3575
74 Ga0070665_100002391 3300005548 Bacteria 20704
75 Ga0070665_100016171 3300005548 Bacteria 7487
76 Ga0070665_100112513 3300005548 Bacteria 2725
77 Ga0070665_100129080 3300005548 Bacteria 2530
78 Ga0070665_100312353 3300005548 Bacteria 1576
79 Ga0068857_100337479 3300005577 Bacteria 1394
80 Ga0068854_100046058 3300005578 Bacteria 3104
81 Ga0068856_100002393 3300005614 Bacteria 19294
82 Ga0081540_1040794 3300005983 Bacteria 2414
83 Ga0081539_10000646 3300005985 Bacteria 70179
84 Ga0075365_10002073 3300006038 Bacteria 9568
85 Ga0075365_10004110 3300006038 Bacteria 7650
86 Ga0075365_10044195 3300006038 Bacteria 2918
87 Ga0075365_10069904 3300006038 Bacteria 2360
88 Ga0075365_10111042 3300006038 Bacteria 1884
89 Ga0075364_10022777 3300006051 Bacteria 3961
90 Ga0075362_10000288 3300006177 Bacteria 14229
91 Ga0075362_10077039 3300006177 Bacteria 1531
92 Ga0075367_10000352 3300006178 Bacteria 16461
93 Ga0075367_10003994 3300006178 Bacteria 7127
94 Ga0075367_10081998 3300006178 Bacteria 1952
95 Ga0075367_10118254 3300006178 Bacteria 1631
96 Ga0075369_10010335 3300006186 Bacteria 3648
97 Ga0075369_10034297 3300006186 Bacteria 2153
98 Ga0075369_10039727 3300006186 Bacteria 2010
99 Ga0075369_10058194 3300006186 Bacteria 1683
100 Ga0075366_10001721 3300006195 Bacteria 10998
101 Ga0075366_10102839 3300006195 Bacteria 1715
102 Ga0075370_10015245 3300006353 Bacteria 4110
103 Ga0075370_10058681 3300006353 Bacteria 2189
104 Ga0075431_100036440 3300006847 Bacteria 5066
105 Ga0075429_100103600 3300006880 Bacteria 2485
106 Ga0079104_1000082 3300006946 Bacteria 137722
107 Ga0105251_10033076 3300009011 Bacteria 2571
108 Ga0105240_10000012 3300009093 Bacteria 496639
109 Ga0114129_10004566 3300009147 Bacteria 19536
110 Ga0114129_10353966 3300009147 Bacteria 1944
111 Ga0105243_10049327 3300009148 Bacteria 3321
112 Ga0105243_10108221 3300009148 Bacteria 2320
113 Ga0105248_10185998 3300009177 Bacteria 2341
114 Ga0105237_10000165 3300009545 Bacteria 93713
115 Ga0105237_10018970 3300009545 Bacteria 7107
116 Ga0105249_10142513 3300009553 Bacteria 2299
117 Ga0123340_1051603 3300009763 Bacteria 1468
118 Ga0123341_1039486 3300009765 Bacteria 3120
119 Ga0123342_1011252 3300009766 Bacteria 9867
120 Ga0105239_10000471 3300010375 Bacteria 58946
121 Ga0157373_10005480 3300013100 Bacteria 9527
122 Ga0157373_10038303 3300013100 Bacteria 3437
123 Ga0157371_10000195 3300013102 Bacteria 89727
124 Ga0157371_10019115 3300013102 Bacteria 5058
125 Ga0157370_10007276 3300013104 Bacteria 12079
126 Ga0157369_10055775 3300013105 Bacteria 4265
127 Ga0171463_1010 3300013249 Bacteria 269975
128 Ga0157374_10135163 3300013296 Bacteria 2390
129 Ga0182007_10001911 3300015262 Bacteria 10817
130 Ga0182005_1004906 3300015265 Bacteria 4243
131 Ga0183363_1207 3300015690 Bacteria 11952
132 Ga0214544_1000419 3300021320 Bacteria 76083
133 Ga0214542_1000027 3300021321 Bacteria 175107
134 Ga0214542_1019286 3300021321 Bacteria 5427
135 Ga0214543_1000005 3300021327 Bacteria 454523
136 Ga0214543_1000047 3300021327 Bacteria 150894
137 Ga0228711_1016254 3300022739 Bacteria 7822
138 Ga0228710_1003061 3300022740 Bacteria 26649
139 Ga0209435_100025 3300025206 Bacteria 198776
140 Ga0209436_100044 3300025208 Bacteria 70547
141 Ga0209436_100745 3300025208 Bacteria 13511
142 Ga0209672_103402 3300025228 Bacteria 3310
143 Ga0209437_100022 3300025233 Bacteria 625694
144 Ga0209437_100040 3300025233 Bacteria 448096
145 Ga0207425_1000038 3300025245 Bacteria 221600
146 Ga0207425_1001594 3300025245 Bacteria 9200
147 Ga0207425_1002210 3300025245 Bacteria 7066
148 Ga0209646_1000083 3300025246 Bacteria 198777
149 Ga0209646_1009483 3300025246 Bacteria 1543
150 Ga0209026_1000078 3300025250 Bacteria 198777
151 Ga0209677_101094 3300025253 Bacteria 12743
152 Ga0209759_1000060 3300025256 Bacteria 198777
153 Ga0209129_1000016 3300025258 Bacteria 485491
154 Ga0209129_1000036 3300025258 Bacteria 328331
155 Ga0209129_1001000 3300025258 Bacteria 16849
156 Ga0209129_1001274 3300025258 Bacteria 14398
157 Ga0209129_1009534 3300025258 Bacteria 2542
158 Ga0209129_1009539 3300025258 Bacteria 2542
159 Ga0209233_1000031 3300025261 Bacteria 624646
160 Ga0209233_1000051 3300025261 Bacteria 447617
161 Ga0209233_1000146 3300025261 Bacteria 187269
162 Ga0209673_1000005 3300025273 Bacteria 692788
163 Ga0209673_1000212 3300025273 Bacteria 116031
164 Ga0209673_1014367 3300025273 Bacteria 3066
165 Ga0209673_1019093 3300025273 Bacteria 2472
166 Ga0209130_1000001 3300025284 Bacteria 831557
167 Ga0209130_1000013 3300025284 Bacteria 412810
168 Ga0209130_1000074 3300025284 Bacteria 173309
169 Ga0209675_1016281 3300025291 Bacteria 2172
170 Ga0209025_1000108 3300025294 Bacteria 221600
171 Ga0209025_1000300 3300025294 Bacteria 110956
172 Ga0209025_1000593 3300025294 Bacteria 65364
173 Ga0209025_1001193 3300025294 Bacteria 36685
174 Ga0209025_1007795 3300025294 Bacteria 7876
175 Ga0209025_1010251 3300025294 Bacteria 6376
176 Ga0209025_1020001 3300025294 Bacteria 3686
177 Ga0209025_1036173 3300025294 Bacteria 2216
178 Ga0209564_1000329 3300025295 Bacteria 92271
179 Ga0209564_1000402 3300025295 Bacteria 76964
180 Ga0209564_1002621 3300025295 Bacteria 13754
181 Ga0209564_1004961 3300025295 Bacteria 7852
182 Ga0209758_1000053 3300025297 Bacteria 337751
183 Ga0209758_1000104 3300025297 Bacteria 221600
184 Ga0209758_1001035 3300025297 Bacteria 36412
185 Ga0209758_1002176 3300025297 Bacteria 20599
186 Ga0209758_1009270 3300025297 Bacteria 6158
187 Ga0209758_1025304 3300025297 Bacteria 2609
188 Ga0209050_1012725 3300025298 Bacteria 3824
189 Ga0209256_1000164 3300025299 Bacteria 135612
190 Ga0209256_1000582 3300025299 Bacteria 51562
191 Ga0209256_1001320 3300025299 Bacteria 26507
192 Ga0209256_1001362 3300025299 Bacteria 25721
193 Ga0209256_1015871 3300025299 Bacteria 2607
194 Ga0207426_1000005 3300025302 Bacteria 1037188
195 Ga0207426_1000022 3300025302 Bacteria 547377
196 Ga0207426_1000035 3300025302 Bacteria 448327
197 Ga0207426_1000165 3300025302 Bacteria 170244
198 Ga0207426_1003594 3300025302 Bacteria 8234
199 Ga0209051_1000249 3300025303 Bacteria 90988
200 Ga0209051_1001577 3300025303 Bacteria 18793
201 Ga0209051_1002800 3300025303 Bacteria 12034
202 Ga0209051_1007255 3300025303 Bacteria 6093
203 Ga0209051_1012514 3300025303 Bacteria 4099
204 Ga0209051_1033815 3300025303 Bacteria 1926
205 Ga0209257_1002528 3300025304 Bacteria 17936
206 Ga0209257_1005406 3300025304 Bacteria 8985
207 Ga0207695_10000120 3300025913 Bacteria 234247
208 Ga0207695_10204920 3300025913 Bacteria 1885
209 Ga0207671_10000513 3300025914 Bacteria 52462
210 Ga0207650_10001547 3300025925 Bacteria 16467
211 Ga0207706_10163371 3300025933 Bacteria 1957
212 Ga0207667_10078680 3300025949 Bacteria 3417
213 Ga0207712_10138573 3300025961 Bacteria 1864
214 Ga0207640_10076312 3300025981 Bacteria 2274
215 Ga0207658_10042524 3300025986 Bacteria 3297
216 Ga0207678_10105108 3300026067 Bacteria 2409
217 Ga0207702_10004200 3300026078 Bacteria 12873
218 Ga0207674_10213513 3300026116 Bacteria 1878
219 Ga0207683_10128631 3300026121 Bacteria 2277
220 Ga0209281_1000043 3300027111 Bacteria 341543
221 Ga0209281_1000087 3300027111 Bacteria 246142
222 Ga0209281_1000226 3300027111 Bacteria 119980
223 Ga0209371_1000037 3300027312 Bacteria 367074
224 Ga0209371_1000687 3300027312 Bacteria 29000
225 Ga0209282_1000008 3300027666 Bacteria 248526
226 Ga0209813_10000676 3300027866 Bacteria 7806
227 Ga0268266_10002894 3300028379 Bacteria 17796
228 Ga0268266_10021611 3300028379 Bacteria 5482
229 Ga0268266_10033187 3300028379 Bacteria 4390
230 Ga0307515_10000017 3300028794 Bacteria 550465
231 Ga0307515_10002600 3300028794 Bacteria 38893
232 Ga0307515_10016021 3300028794 Bacteria 13759
233 Ga0307515_10038197 3300028794 Bacteria 7690
234 Ga0268256_1000039 3300030500 Bacteria 354969
235 Ga0307513_10000717 3300031456 Bacteria 47556
236 Ga0307408_100025562 3300031548 Bacteria 4046
237 Ga0307406_10177699 3300031901 Bacteria 1547
238 Ga0307406_10230622 3300031901 Bacteria 1382
239 Ga0307412_10015715 3300031911 Bacteria 4493
240 Ga0315914_1000305 3300031967 Bacteria 55880
241 Ga0315913_1000064 3300033430 Bacteria 55884
242 Ga0315915_1000009 3300033464 Bacteria 252178
243 Ga0395905_0000328 3300037471 Bacteria 68234
244 Ga0395905_0011883 3300037471 Bacteria 8403
245 Ga0436364_0821647 3300037853 Bacteria 1822
246 Ga0439438_013761 3300041405 Bacteria 2429
247 Ga0439465_0007929 3300041413 Bacteria 3363
248 Ga0439465_0024274 3300041413 Bacteria 1910
249 Ga0439465_0024686 3300041413 Bacteria 1895
250 Ga0439465_0029020 3300041413 Bacteria 1757
251 Ga0439449_0005519 3300042007 Bacteria 4842
252 Ga0450920_002612 3300042122 Bacteria 3076
253 Ga0450910_001377 3300042147 Bacteria 3050
254 Ga0466963_0021163 3300044694 Bacteria 4099
255 Ga0466970_0003638 3300044765 Bacteria 7517
256 Ga0466959_0042555 3300045049 Bacteria 3350
257 Ga0495617_032064 3300046452 Bacteria 1764
258 Ga0495638_0000269 3300046460 Bacteria 70117
259 Ga0495638_0013192 3300046460 Bacteria 5637
260 Ga0495638_0042009 3300046460 Bacteria 2890
261 Ga0495605_0000841 3300046474 Bacteria 21499
262 Ga0495585_0004462 3300046492 Bacteria 9073
263 Ga0495585_0022616 3300046492 Bacteria 3609
264 Ga0495583_0011222 3300046506 Bacteria 5159
265 Ga0495610_0004590 3300046512 Bacteria 10131
266 Ga0495610_0039899 3300046512 Bacteria 2370
267 Ga0495610_0044818 3300046512 Bacteria 2193
268 Ga0495610_0048815 3300046512 Bacteria 2076
269 Ga0495610_0069825 3300046512 Bacteria 1643
270 Ga0495616_0046021 3300046513 Bacteria 2205
271 Ga0495616_0067417 3300046513 Bacteria 1740
272 Ga0495632_0007168 3300046519 Bacteria 7050
273 Ga0495632_0015129 3300046519 Bacteria 4338
274 Ga0495643_0001376 3300046522 Bacteria 22761
275 Ga0495643_0009597 3300046522 Bacteria 6002
276 Ga0495643_0033863 3300046522 Bacteria 2822
277 Ga0495654_0000305 3300046530 Bacteria 43461
278 Ga0495668_0011738 3300046616 Bacteria 5230
279 Ga0495611_0005071 3300046648 Bacteria 5647
280 Ga0495625_0003375 3300046660 Bacteria 16014
281 Ga0495625_0036637 3300046660 Bacteria 3604
282 Ga0495625_0115084 3300046660 Bacteria 1835
283 Ga0495625_0210662 3300046660 Bacteria 1278
284 Ga0495588_0000601 3300046674 Bacteria 16960
285 Ga0495588_0022710 3300046674 Bacteria 3102
286 Ga0495588_0110619 3300046674 Bacteria 1447
287 Ga0495670_0010698 3300046691 Bacteria 4511
288 Ga0495671_0038874 3300046692 Bacteria 2404
289 Ga0495600_0006330 3300046809 Bacteria 7197
290 Ga0495660_0035613 3300046810 Bacteria 2780
291 Ga0495672_0025631 3300047320 Bacteria 3769
292 Ga0495687_016218 3300047443 Bacteria 3752
293 Ga0495687_026215 3300047443 Bacteria 2748
294 Ga0495686_0033103 3300047472 Bacteria 3340
295 Ga0495686_0047552 3300047472 Bacteria 2708
296 Ga0495686_0052416 3300047472 Bacteria 2558
297 Ga0495686_0124392 3300047472 Bacteria 1534
298 Ga0496100_0095042 3300048903 Bacteria 2042
299 Ga0496102_0075309 3300048905 Bacteria 3103
300 Ga0496102_0111255 3300048905 Bacteria 2553
301 Ga0496103_0052532 3300048906 Bacteria 2524
302 Ga0496106_0000269 3300048909 Bacteria 36744
303 Ga0496106_0093331 3300048909 Bacteria 2326
304 Ga0496109_0210223 3300048912 Bacteria 1830
305 Ga0496110_0038763 3300048913 Bacteria 4148
306 Ga0496111_0011505 3300048914 Bacteria 5964
307 Ga0496111_0068754 3300048914 Bacteria 2575
308 Ga0496112_0046773 3300048915 Bacteria 4245
309 Ga0496113_0104794 3300048916 Bacteria 2195
310 Ga0496116_0000380 3300048919 Bacteria 65998
311 Ga0496116_0006551 3300048919 Bacteria 10548
312 Ga0496116_0009943 3300048919 Bacteria 8038
313 Ga0496116_0019646 3300048919 Bacteria 5164
314 Ga0496116_0036476 3300048919 Bacteria 3440
315 Ga0496116_0050617 3300048919 Bacteria 2766
316 Ga0496117_0000031 3300048920 Bacteria 381048
317 Ga0496117_0004480 3300048920 Bacteria 15367
318 Ga0496117_0006651 3300048920 Bacteria 11588
319 Ga0496117_0009144 3300048920 Bacteria 9289
320 Ga0496118_0000976 3300048921 Bacteria 44594
321 Ga0496118_0008203 3300048921 Bacteria 10854
322 Ga0496118_0008775 3300048921 Bacteria 10365
323 Ga0496119_0006855 3300048922 Bacteria 10423
324 Ga0496119_0026207 3300048922 Bacteria 4047
325 Ga0496120_0000583 3300048923 Bacteria 55408
326 Ga0496120_0005272 3300048923 Bacteria 10380
327 Ga0496120_0026171 3300048923 Bacteria 3607
328 Ga0496120_0048346 3300048923 Bacteria 2448
329 Ga0496121_0000034 3300048924 Bacteria 377095
330 Ga0496121_0006426 3300048924 Bacteria 14598
331 Ga0496121_0022949 3300048924 Bacteria 6029
332 Ga0496121_0034063 3300048924 Bacteria 4592
333 Ga0496121_0053008 3300048924 Bacteria 3400
334 Ga0496121_0055453 3300048924 Bacteria 3302
335 Ga0496121_0061575 3300048924 Bacteria 3078
336 Ga0496121_0155287 3300048924 Bacteria 1679
337 Ga0496122_0000009 3300048925 Bacteria 584024
338 Ga0496122_0000023 3300048925 Bacteria 381035
339 Ga0496122_0005813 3300048925 Bacteria 14501
340 Ga0496122_0027288 3300048925 Bacteria 4886
341 Ga0496122_0057834 3300048925 Bacteria 2875
342 Ga0496123_0000020 3300048926 Bacteria 388748
343 Ga0496123_0000447 3300048926 Bacteria 73878
344 Ga0496123_0006666 3300048926 Bacteria 11127
345 Ga0496123_0018123 3300048926 Bacteria 5623
346 Ga0496123_0029539 3300048926 Bacteria 4032
347 Ga0496123_0058464 3300048926 Bacteria 2500
348 Ga0496123_0078430 3300048926 Bacteria 2023
349 Ga0496124_0000130 3300048927 Bacteria 156467
350 Ga0496124_0000153 3300048927 Bacteria 139859
351 Ga0496124_0010057 3300048927 Bacteria 9649
352 Ga0496124_0039158 3300048927 Bacteria 4111
353 Ga0496124_0089052 3300048927 Bacteria 2521
354 Ga0496124_0199999 3300048927 Bacteria 1520
355 Ga0496124_0257388 3300048927 Bacteria 1287
356 Ga0496125_0000030 3300048928 Bacteria 375023
357 Ga0496125_0013088 3300048928 Bacteria 8181
358 Ga0496125_0050072 3300048928 Bacteria 3463
359 Ga0496125_0213046 3300048928 Bacteria 1253
360 Ga0496126_0000293 3300048929 Bacteria 106340
361 Ga0496126_0190505 3300048929 Bacteria 1737
362 Ga0495678_048241 3300049459 Bacteria 1662
363 Ga0501037_0041257 3300049573 Bacteria 3394
364 Ga0501046_0054503 3300049580 Bacteria 3145
365 Ga0501075_0048275 3300049591 Bacteria 3199
366 Ga0501076_0034899 3300049592 Bacteria 3934
367 Ga0501079_0045237 3300049741 Bacteria 3397
368 Ga0501081_0101507 3300049743 Bacteria 2034
369 Ga0501280_002037 3300049776 Bacteria 3504
370 Ga0501044_0056227 3300049823 Bacteria 4039
371 nmdc:mga03683_39394_c1 3300050489 Bacteria 1935
372 nmdc:mga03683_50363_c1 3300050489 Bacteria 1736
373 nmdc:mga00v17_139_c1 3300050491 Bacteria 42380
374 nmdc:mga00v17_16703_c1 3300050491 Bacteria 4140
375 nmdc:mga00v17_182_c1 3300050491 Bacteria 37460
376 nmdc:mga0yw44_24573_c1 3300050492 Bacteria 3412
377 nmdc:mga0yw44_2775_c1 3300050492 Bacteria 7586
378 nmdc:mga0yw44_59038_c1 3300050492 Bacteria 2346
379 nmdc:mga0yw44_6862_c1 3300050492 Bacteria 5542
380 nmdc:mga0yw44_70824_c1 3300050492 Bacteria 2163
381 nmdc:mga0k408_27132_c1 3300050493 Bacteria 3251
382 nmdc:mga06z11_29666_c1 3300050494 Bacteria 2637
383 nmdc:mga06z11_5567_c1 3300050494 Bacteria 5067
384 nmdc:mga04h51_642_c1 3300050495 Bacteria 8181
385 nmdc:mga07m45_6954_c1 3300050496 Bacteria 5753
386 nmdc:mga05p37_12520_c1 3300050507 Bacteria 10127
387 nmdc:mga05p37_31508_c1 3300050507 Bacteria 6476
388 nmdc:mga06r32_41556_c1 3300050510 Bacteria 4370
389 nmdc:mga0n895_48319_c1 3300050512 Bacteria 4164
390 nmdc:mga0sz30_195_c1 3300050516 Bacteria 22607
391 nmdc:mga0sz30_39036_c1 3300050516 Bacteria 1991
392 nmdc:mga0sz30_67939_c1 3300050516 Bacteria 1531
393 nmdc:mga0sz30_6882_c1 3300050516 Bacteria 4245
394 Ga0500644_0001795 3300053088 Bacteria 5546
395 Ga0500560_000096 3300053107 Bacteria 8849
396 Ga0500618_000357 3300053125 Bacteria 31733
397 Ga0500618_000850 3300053125 Bacteria 16412
398 Ga0500618_004421 3300053125 Bacteria 4512
399 Ga0500618_027798 3300053125 Bacteria 1343
400 Ga0500658_0002006 3300053134 Bacteria 7953
401 Ga0500561_0003308 3300053137 Bacteria 2808
402 Ga0500568_0000086 3300053139 Bacteria 90828
403 Ga0500568_0004546 3300053139 Bacteria 7399
404 Ga0500573_0000205 3300053140 Bacteria 24278
405 Ga0500590_005688 3300053148 Bacteria 6014
406 Ga0500604_0030694 3300053151 Bacteria 1573
407 Ga0500616_0001636 3300053153 Bacteria 20744
408 Ga0500620_000216 3300053155 Bacteria 11437
409 Ga0500622_0000375 3300053156 Bacteria 43118
410 Ga0501084_0004530 3300054114 Bacteria 11363
411 Ga0501082_0082484 3300060353 Bacteria 2774
412 Ga0501082_0121497 3300060353 Bacteria 2264

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0155287 Ga0496121_0155287_691_1665 315
2 3300009011 Ga0105251_10033076 Ga0105251_100330762 363
3 3300003856 Ga0058692_1001787 Ga0058692_10017876 364
4 iso_pu_bacteria 2871435913 2871443689 365
5 iso_pu_bacteria 2933016740 2933021346 368
6 3300046674 Ga0495588_0110619 Ga0495588_0110619_14_1156 371
7 3300009147 Ga0114129_10004566 Ga0114129_100045668 372
8 3300050510 nmdc:mga06r32_41556_c1 nmdc:mga06r32_41556_c1_2449_3633 372
9 3300013102 Ga0157371_10019115 Ga0157371_100191153 374
10 3300013105 Ga0157369_10055775 Ga0157369_100557751 374
11 3300048919 Ga0496116_0000380 Ga0496116_0000380_33473_34645 374
12 3300048926 Ga0496123_0029539 Ga0496123_0029539_1497_2669 374
13 3300048929 Ga0496126_0000293 Ga0496126_0000293_21379_22551 374
14 3300009766 Ga0123342_1011252 Ga0123342_10112524 375
15 3300002773 JGI25152J39213_1015385 JGI25152J39213_10153852 376
16 3300002774 JGI25150J39212_1001979 JGI25150J39212_10019794 376
17 3300003187 JGI25151J46595_10025607 JGI25151J46595_100256072 376
18 3300003215 JGI25153J46596_10038350 JGI25153J46596_100383502 376
19 3300025245 Ga0207425_1001594 Ga0207425_10015944 376
20 3300025258 Ga0209129_1009539 Ga0209129_10095392 376
21 3300025297 Ga0209758_1001035 Ga0209758_100103531 376
22 3300053125 Ga0500618_000357 Ga0500618_000357_2903_4237 376
23 iso_pu_bacteria 2508501127 2509144579 378
24 iso_pu_bacteria 2513237164 2514038998 378
25 iso_pu_bacteria 2599185352 2600197714 378
26 iso_pu_bacteria 2643221595 2643987860 378
27 iso_pu_bacteria 2643221618 2644104784 378
28 iso_pu_bacteria 2643221626 2644151215 378
29 iso_pu_bacteria 2643221627 2644154197 378
30 iso_pu_bacteria 2643221655 2644313203 378
31 iso_pu_bacteria 2643221659 2644336289 378
32 iso_pu_bacteria 2643221712 2644612826 378
33 iso_pu_bacteria 2643221723 2644674282 378
34 iso_pu_bacteria 2721755686 2723573922 378
35 iso_pu_bacteria 2791355091 2792619545 378
36 iso_pu_bacteria 2791355092 2792627316 378
37 iso_pu_bacteria 2844163670 2844169665 378
38 iso_pu_bacteria 2856364286 2856367076 378
39 iso_pu_bacteria 2869162929 2869166612 378
40 iso_pu_bacteria 2874168670 2874172246 378
41 iso_pu_bacteria 2876363079 2876364986 378
42 iso_pu_bacteria 2876413966 2876415538 378
43 iso_pu_bacteria 2878760144 2878765810 378
44 iso_pu_bacteria 2878788777 2878793948 378
45 iso_pu_bacteria 2885326080 2885333166 378
46 iso_pu_bacteria 2888350351 2888354964 378
47 iso_pu_bacteria 2889016732 2889018389 378
48 iso_pu_bacteria 2903448605 2903449993 378
49 iso_pu_bacteria 2903521522 2903522279 378
50 iso_pu_bacteria 2903528002 2903528657 378
51 iso_pu_bacteria 2903540706 2903546756 378
52 iso_pu_bacteria 2906354277 2906360644 378
53 iso_pu_bacteria 2922130491 2922131923 378
54 iso_pu_bacteria 2924754689 2924757530 378
55 iso_pu_bacteria 2937813078 2937815127 378
56 iso_pu_bacteria 2937994558 2938000615 378
57 iso_pu_bacteria 2941499720 2941504420 378
58 iso_pu_bacteria 2958100919 2958103255 378
59 iso_pu_bacteria 2958165035 2958170986 378
60 iso_pu_bacteria 2958172287 2958174859 378
61 iso_pu_bacteria 2961163497 2961169430 378
62 iso_pu_bacteria 2963644680 2963646441 378
63 iso_pu_bacteria 2965119406 2965123565 378
64 iso_pu_bacteria 2968083720 2968090759 378
65 iso_pu_bacteria 2968171901 2968177820 378
66 iso_pu_bacteria 2970524798 2970526301 378
67 iso_pu_bacteria 2970554993 2970560666 378
68 iso_pu_bacteria 2977942078 2977945983 378
69 iso_pu_bacteria 2979710463 2979712982 378
70 iso_pu_bacteria 2979742915 2979752143 378
71 iso_pu_bacteria 2987652177 2987656584 378
72 iso_pu_bacteria 2987659509 2987665592 378
73 iso_pu_bacteria 3004188549 3004194618 378
74 iso_pu_bacteria 3004334049 3004338584 378
75 3300048925 Ga0496122_0000009 Ga0496122_0000009_254816_255985 379
76 3300048926 Ga0496123_0000020 Ga0496123_0000020_59268_60437 379
77 3300049776 Ga0501280_002037 Ga0501280_002037_1784_2950 379
78 iso_pu_bacteria 2511231027 2511388380 379
79 3300048920 Ga0496117_0009144 Ga0496117_0009144_4840_6015 380
80 3300048923 Ga0496120_0048346 Ga0496120_0048346_625_1800 380
81 3300048924 Ga0496121_0000034 Ga0496121_0000034_330375_331550 380
82 3300048928 Ga0496125_0000030 Ga0496125_0000030_42974_44149 380
83 3300050491 nmdc:mga00v17_16703_c1 nmdc:mga00v17_16703_c1_2054_3229 380
84 3300053125 Ga0500618_004421 Ga0500618_004421_3260_4432 380
85 3300053125 Ga0500618_027798 Ga0500618_027798_152_1324 380
86 3300002739 JGI25158J39367_1003597 JGI25158J39367_10035972 382
87 3300002987 JGI25159J45721_1000037 JGI25159J45721_100003713 382
88 3300003187 JGI25151J46595_10040456 JGI25151J46595_100404562 382
89 3300003354 JGI25160J50197_1000113 JGI25160J50197_100011313 382
90 3300003374 JGI25161J50226_1001063 JGI25161J50226_10010634 382
91 3300003771 Ga0055526_1004633 Ga0055526_10046332 382
92 3300003775 Ga0055524_1002795 Ga0055524_10027953 382
93 3300004625 Ga0055543_1000381 Ga0055543_100038112 382
94 3300005262 Ga0065165_1000347 Ga0065165_100034713 382
95 3300005577 Ga0068857_100337479 Ga0068857_1003374792 382
96 3300006038 Ga0075365_10069904 Ga0075365_100699042 382
97 3300006177 Ga0075362_10077039 Ga0075362_100770392 382
98 3300006178 Ga0075367_10118254 Ga0075367_101182542 382
99 3300006186 Ga0075369_10010335 Ga0075369_100103353 382
100 3300006847 Ga0075431_100036440 Ga0075431_1000364404 382
101 3300006880 Ga0075429_100103600 Ga0075429_1001036002 382
102 3300009147 Ga0114129_10353966 Ga0114129_103539661 382
103 3300009177 Ga0105248_10185998 Ga0105248_101859981 382
104 3300009545 Ga0105237_10018970 Ga0105237_100189702 382
105 3300009553 Ga0105249_10142513 Ga0105249_101425132 382
106 3300013296 Ga0157374_10135163 Ga0157374_101351633 382
107 3300025913 Ga0207695_10204920 Ga0207695_102049202 382
108 3300026067 Ga0207678_10105108 Ga0207678_101051082 382
109 3300026116 Ga0207674_10213513 Ga0207674_102135132 382
110 3300026121 Ga0207683_10128631 Ga0207683_101286312 382
111 3300042147 Ga0450910_001377 Ga0450910_001377_1859_3034 382
112 3300046512 Ga0495610_0048815 Ga0495610_0048815_517_1698 382
113 3300046513 Ga0495616_0067417 Ga0495616_0067417_544_1719 382
114 3300046522 Ga0495643_0009597 Ga0495643_0009597_4470_5651 382
115 3300046530 Ga0495654_0000305 Ga0495654_0000305_21443_22621 382
116 3300046660 Ga0495625_0210662 Ga0495625_0210662_23_1204 382
117 3300047443 Ga0495687_026215 Ga0495687_026215_1319_2500 382
118 3300047472 Ga0495686_0033103 Ga0495686_0033103_1435_2613 382
119 3300048914 Ga0496111_0068754 Ga0496111_0068754_446_1627 382
120 3300048915 Ga0496112_0046773 Ga0496112_0046773_432_1613 382
121 3300048922 Ga0496119_0006855 Ga0496119_0006855_5378_6559 382
122 3300048923 Ga0496120_0026171 Ga0496120_0026171_1192_2373 382
123 3300048926 Ga0496123_0078430 Ga0496123_0078430_732_1907 382
124 3300048927 Ga0496124_0000130 Ga0496124_0000130_111266_112441 382
125 3300048928 Ga0496125_0213046 Ga0496125_0213046_24_1205 382
126 3300048929 Ga0496126_0190505 Ga0496126_0190505_507_1682 382
127 3300050489 nmdc:mga03683_50363_c1 nmdc:mga03683_50363_c1_441_1622 382
128 3300050492 nmdc:mga0yw44_59038_c1 nmdc:mga0yw44_59038_c1_1093_2274 382
129 3300050492 nmdc:mga0yw44_70824_c1 nmdc:mga0yw44_70824_c1_134_1315 382
130 3300050507 nmdc:mga05p37_12520_c1 nmdc:mga05p37_12520_c1_2725_3939 382
131 3300050507 nmdc:mga05p37_31508_c1 nmdc:mga05p37_31508_c1_4309_5490 382
132 3300050516 nmdc:mga0sz30_39036_c1 nmdc:mga0sz30_39036_c1_302_1483 382
133 3300050516 nmdc:mga0sz30_67939_c1 nmdc:mga0sz30_67939_c1_12_1193 382
134 3300053125 Ga0500618_000850 Ga0500618_000850_8206_9384 382
135 3300053151 Ga0500604_0030694 Ga0500604_0030694_75_1256 382
136 3300053155 Ga0500620_000216 Ga0500620_000216_5050_6231 382
137 iso_pu_bacteria 2958144490 2958151005 383
138 3300006038 Ga0075365_10004110 Ga0075365_100041103 384
139 3300006178 Ga0075367_10000352 Ga0075367_100003525 384
140 3300006186 Ga0075369_10039727 Ga0075369_100397271 384
141 3300009763 Ga0123340_1051603 Ga0123340_10516032 384
142 3300009765 Ga0123341_1039486 Ga0123341_10394863 384
143 3300003775 Ga0055524_1014125 Ga0055524_10141251 385
144 3300003790 Ga0055528_1021841 Ga0055528_10218412 385
145 3300005262 Ga0065165_1002002 Ga0065165_100200210 385
146 3300025258 Ga0209129_1001274 Ga0209129_10012742 385
147 3300025273 Ga0209673_1014367 Ga0209673_10143672 385
148 3300025295 Ga0209564_1004961 Ga0209564_10049615 385
149 3300025299 Ga0209256_1015871 Ga0209256_10158711 385
150 3300025302 Ga0207426_1003594 Ga0207426_10035944 385
151 3300025303 Ga0209051_1001577 Ga0209051_10015772 385
152 3300037853 Ga0436364_0821647 Ga0436364_0821647_88_1419 385
153 3300053148 Ga0500590_005688 Ga0500590_005688_1130_2311 385
154 3300048903 Ga0496100_0095042 Ga0496100_0095042_228_1409 386
155 3300048905 Ga0496102_0111255 Ga0496102_0111255_680_1861 386
156 3300048926 Ga0496123_0058464 Ga0496123_0058464_1055_2236 386
157 3300048928 Ga0496125_0050072 Ga0496125_0050072_1914_3095 386
158 iso_pu_bacteria 2775507049 2776910393 386
159 iso_pu_bacteria 2899803654 2899808701 386
160 iso_pu_bacteria 2643221653 2644298262 387
161 iso_pu_bacteria 2643221719 2644656514 387
162 iso_pu_bacteria 2989776772 2989776780 387
163 iso_pu_bacteria 2509276021 2509385824 388
164 iso_pu_bacteria 2509276033 2509448117 388
165 iso_pu_bacteria 2558860983 2561467963 388
166 iso_pu_bacteria 2643221568 2643854982 388
167 iso_pu_bacteria 2643221637 2644208589 388
168 iso_pu_bacteria 2643221718 2644652119 388
169 iso_pu_bacteria 2718217927 2719388290 388
170 iso_pu_bacteria 2718217997 2719667908 388
171 iso_pu_bacteria 2718218199 2720494671 388
172 iso_pu_bacteria 2718218232 2720611006 388
173 iso_pu_bacteria 2718218233 2720616174 388
174 iso_pu_bacteria 2718218235 2720629255 388
175 iso_pu_bacteria 2718218269 2720771827 388
176 iso_pu_bacteria 2718218423 2721402913 388
177 iso_pu_bacteria 2721755556 2723029230 388
178 iso_pu_bacteria 2721755684 2723562864 388
179 iso_pu_bacteria 2721755685 2723570854 388
180 iso_pu_bacteria 2721755809 2724035270 388
181 iso_pu_bacteria 2721755819 2724086647 388
182 iso_pu_bacteria 2721755822 2724106805 388
183 iso_pu_bacteria 2721755823 2724107605 388
184 iso_pu_bacteria 2728369352 2730105544 388
185 iso_pu_bacteria 2791355259 2793314887 388
186 iso_pu_bacteria 2791355263 2793340285 388
187 iso_pu_bacteria 2791355267 2793366700 388
188 iso_pu_bacteria 2838016132 2838019326 388
189 iso_pu_bacteria 2838042994 2838046476 388
190 iso_pu_bacteria 2838048938 2838050392 388
191 iso_pu_bacteria 2838061910 2838063095 388
192 iso_pu_bacteria 2838068647 2838071662 388
193 iso_pu_bacteria 2841864319 2841869128 388
194 iso_pu_bacteria 2842264693 2842267856 388
195 iso_pu_bacteria 2842311132 2842311939 388
196 iso_pu_bacteria 2842341865 2842343861 388
197 iso_pu_bacteria 2842363717 2842368236 388
198 iso_pu_bacteria 2842395702 2842396727 388
199 iso_pu_bacteria 2842422224 2842425295 388
200 iso_pu_bacteria 2842428310 2842432019 388
201 iso_pu_bacteria 2842434925 2842438131 388
202 iso_pu_bacteria 2842441272 2842443827 388
203 iso_pu_bacteria 2842447887 2842449910 388
204 iso_pu_bacteria 2842462802 2842466117 388
205 iso_pu_bacteria 2842469257 2842472899 388
206 iso_pu_bacteria 2919166419 2919170683 388
207 iso_pu_bacteria 2933599457 2933602458 388
208 iso_pu_bacteria 2936381700 2936385426 388
209 iso_pu_bacteria 2978969890 2978972505 388
210 iso_pu_bacteria 2984587000 2984590759 388
211 iso_pu_bacteria 2996893221 2996896708 388
212 iso_pu_bacteria 8005275841 8005277006 388
213 iso_pu_bacteria 8005282627 8005287980 388
214 iso_pu_bacteria 8005430974 8005431322 388
215 iso_pu_bacteria 8005497431 8005503319 388
216 iso_pu_bacteria 8005619151 8005625460 388
217 iso_pu_bacteria 8005626139 8005630442 388
218 iso_pu_bacteria 8005668836 8005674837 388
219 iso_pu_bacteria 8005695170 8005696911 388
220 iso_pu_bacteria 8018176218 8018182889 388
221 iso_pu_bacteria 8056375014 8056375322 388
222 iso_pu_bacteria 2508501122 2509109918 389
223 iso_pu_bacteria 2509276019 2509377093 389
224 iso_pu_bacteria 2510065019 2510136803 389
225 iso_pu_bacteria 2510065057 2510305873 389
226 iso_pu_bacteria 2510461076 2510899916 389
227 iso_pu_bacteria 2510461076 2510900512 389
228 iso_pu_bacteria 2510917028 2511184181 389
229 iso_pu_bacteria 2510917030 2511198358 389
230 iso_pu_bacteria 2511231052 2511498159 389
231 iso_pu_bacteria 2512047086 2512529316 389
232 iso_pu_bacteria 2512875016 2512932763 389
233 iso_pu_bacteria 2512875024 2512961088 389
234 iso_pu_bacteria 2512875026 2512969471 389
235 iso_pu_bacteria 2513237084 2513569785 389
236 iso_pu_bacteria 2513237085 2513576641 389
237 iso_pu_bacteria 2513237086 2513587795 389
238 iso_pu_bacteria 2513237088 2513595701 389
239 iso_pu_bacteria 2513237089 2513606374 389
240 iso_pu_bacteria 2513237091 2513618171 389
241 iso_pu_bacteria 2513237093 2513631688 389
242 iso_pu_bacteria 2513237103 2513713383 389
243 iso_pu_bacteria 2513237138 2513866436 389
244 iso_pu_bacteria 2513237140 2513885111 389
245 iso_pu_bacteria 2513237143 2513905613 389
246 iso_pu_bacteria 2513237144 2513911640 389
247 iso_pu_bacteria 2513237146 2513927736 389
248 iso_pu_bacteria 2513237156 2513986063 389
249 iso_pu_bacteria 2513237159 2513997453 389
250 iso_pu_bacteria 2513237160 2514008086 389
251 iso_pu_bacteria 2513237162 2514021377 389
252 iso_pu_bacteria 2513237305 2514417244 389
253 iso_pu_bacteria 2513237351 2514592779 389
254 iso_pu_bacteria 2515075009 2515115388 389
255 iso_pu_bacteria 2515154107 2515610713 389
256 iso_pu_bacteria 2515154113 2515636117 389
257 iso_pu_bacteria 2515154114 2515644726 389
258 iso_pu_bacteria 2515154116 2515658022 389
259 iso_pu_bacteria 2515154134 2515742239 389
260 iso_pu_bacteria 2516143018 2516206669 389
261 iso_pu_bacteria 2516653046 2516896197 389
262 iso_pu_bacteria 2516653077 2517041611 389
263 iso_pu_bacteria 2516653085 2517080794 389
264 iso_pu_bacteria 2517093000 2517099079 389
265 iso_pu_bacteria 2517287029 2517410694 389
266 iso_pu_bacteria 2517487022 2517565649 389
267 iso_pu_bacteria 2519899620 2520380653 389
268 iso_pu_bacteria 2524023207 2524449631 389
269 iso_pu_bacteria 2529292951 2530644887 389
270 iso_pu_bacteria 2534681796 2535519947 389
271 iso_pu_bacteria 2551306084 2551674800 389
272 iso_pu_bacteria 2551306085 2551685014 389
273 iso_pu_bacteria 2551306087 2551703038 389
274 iso_pu_bacteria 2551306089 2551710268 389
275 iso_pu_bacteria 2551306090 2551722280 389
276 iso_pu_bacteria 2551306091 2551724249 389
277 iso_pu_bacteria 2551306092 2551731702 389
278 iso_pu_bacteria 2551306093 2551745023 389
279 iso_pu_bacteria 2554235003 2554248754 389
280 iso_pu_bacteria 2558860100 2558862384 389
281 iso_pu_bacteria 2558860242 2559295842 389
282 iso_pu_bacteria 2582581283 2585167692 389
283 iso_pu_bacteria 2582581294 2585202836 389
284 iso_pu_bacteria 2582581298 2585221707 389
285 iso_pu_bacteria 2582581299 2585228115 389
286 iso_pu_bacteria 2582581304 2585255412 389
287 iso_pu_bacteria 2582581306 2585265950 389
288 iso_pu_bacteria 2582581865 2585390141 389
289 iso_pu_bacteria 2582581866 2585395296 389
290 iso_pu_bacteria 2582581867 2585401203 389
291 iso_pu_bacteria 2585427526 2585524474 389
292 iso_pu_bacteria 2585427528 2585539075 389
293 iso_pu_bacteria 2585427529 2585544123 389
294 iso_pu_bacteria 2585427590 2585821648 389
295 iso_pu_bacteria 2585427593 2585837025 389
296 iso_pu_bacteria 2585427594 2585842535 389
297 iso_pu_bacteria 2599185156 2599332177 389
298 iso_pu_bacteria 2599185170 2599416833 389
299 iso_pu_bacteria 2599185301 2599939452 389
300 iso_pu_bacteria 2600254933 2600374954 389
301 iso_pu_bacteria 2600255279 2601610727 389
302 iso_pu_bacteria 2600255308 2601747501 389
303 iso_pu_bacteria 2615840624 2616295071 389
304 iso_pu_bacteria 2643221557 2643809008 389
305 iso_pu_bacteria 2643221558 2643814393 389
306 iso_pu_bacteria 2643221599 2644006772 389
307 iso_pu_bacteria 2643221607 2644052186 389
308 iso_pu_bacteria 2643221610 2644069147 389
309 iso_pu_bacteria 2643221634 2644191681 389
310 iso_pu_bacteria 2643221636 2644204980 389
311 iso_pu_bacteria 2643221643 2644241148 389
312 iso_pu_bacteria 2643221668 2644378601 389
313 iso_pu_bacteria 2643221675 2644420218 389
314 iso_pu_bacteria 2643221680 2644453625 389
315 iso_pu_bacteria 2643221686 2644484929 389
316 iso_pu_bacteria 2643221688 2644494123 389
317 iso_pu_bacteria 2643221689 2644500518 389
318 iso_pu_bacteria 2643221693 2644521420 389
319 iso_pu_bacteria 2643221726 2644692324 389
320 iso_pu_bacteria 2657244999 2657684312 389
321 iso_pu_bacteria 2690316117 2692318591 389
322 iso_pu_bacteria 2718217882 2719183542 389
323 iso_pu_bacteria 2718218009 2719727983 389
324 iso_pu_bacteria 2718218363 2721144844 389
325 iso_pu_bacteria 2718218365 2721155583 389
326 iso_pu_bacteria 2718218366 2721166931 389
327 iso_pu_bacteria 2721755514 2722837909 389
328 iso_pu_bacteria 2721755810 2724042177 389
329 iso_pu_bacteria 2724679232 2725951981 389
330 iso_pu_bacteria 2728369365 2730161682 389
331 iso_pu_bacteria 2728369397 2730300690 389
332 iso_pu_bacteria 2738541293 2738801771 389
333 iso_pu_bacteria 2738541333 2739033533 389
334 iso_pu_bacteria 2751185821 2753463501 389
335 iso_pu_bacteria 2765235942 2766068672 389
336 iso_pu_bacteria 2791355082 2792581076 389
337 iso_pu_bacteria 2791355094 2792639786 389
338 iso_pu_bacteria 2791355123 2792747431 389
339 iso_pu_bacteria 2791355256 2793296579 389
340 iso_pu_bacteria 2791355260 2793321538 389
341 iso_pu_bacteria 2791355261 2793325912 389
342 iso_pu_bacteria 2791355262 2793332919 389
343 iso_pu_bacteria 2791355264 2793346017 389
344 iso_pu_bacteria 2791355266 2793357940 389
345 iso_pu_bacteria 2802428858 2802721307 389
346 iso_pu_bacteria 2802428859 2802728249 389
347 iso_pu_bacteria 2802428860 2802733935 389
348 iso_pu_bacteria 2802428861 2802740671 389
349 iso_pu_bacteria 2802428862 2802746928 389
350 iso_pu_bacteria 2802428863 2802748683 389
351 iso_pu_bacteria 2802429268 2804754718 389
352 iso_pu_bacteria 2802429605 2805927919 389
353 iso_pu_bacteria 2802429606 2805933765 389
354 iso_pu_bacteria 2802429633 2806044970 389
355 iso_pu_bacteria 2802429634 2806053871 389
356 iso_pu_bacteria 2802429635 2806060037 389
357 iso_pu_bacteria 2802429636 2806065909 389
358 iso_pu_bacteria 2802429637 2806075439 389
359 iso_pu_bacteria 2808606387 2808988334 389
360 iso_pu_bacteria 2818991439 2819560852 389
361 iso_pu_bacteria 2818991461 2819684427 389
362 iso_pu_bacteria 2821123053 2821123202 389
363 iso_pu_bacteria 2838022645 2838024862 389
364 iso_pu_bacteria 2838035591 2838036946 389
365 iso_pu_bacteria 2838074704 2838077660 389
366 iso_pu_bacteria 2838661181 2838662016 389
367 iso_pu_bacteria 2838668709 2838673723 389
368 iso_pu_bacteria 2838675328 2838678785 389
369 iso_pu_bacteria 2838680041 2838684250 389
370 iso_pu_bacteria 2838686498 2838692237 389
371 iso_pu_bacteria 2838694306 2838699741 389
372 iso_pu_bacteria 2838701080 2838705243 389
373 iso_pu_bacteria 2838707686 2838711974 389
374 iso_pu_bacteria 2838714209 2838718126 389
375 iso_pu_bacteria 2838719591 2838723082 389
376 iso_pu_bacteria 2838724970 2838728193 389
377 iso_pu_bacteria 2838729681 2838734540 389
378 iso_pu_bacteria 2838742623 2838747722 389
379 iso_pu_bacteria 2841734538 2841735527 389
380 iso_pu_bacteria 2841846520 2841850640 389
381 iso_pu_bacteria 2841851746 2841853487 389
382 iso_pu_bacteria 2841859092 2841863107 389
383 iso_pu_bacteria 2842077413 2842081716 389
384 iso_pu_bacteria 2842110456 2842114585 389
385 iso_pu_bacteria 2842118031 2842122293 389
386 iso_pu_bacteria 2842124991 2842128850 389
387 iso_pu_bacteria 2842130223 2842133677 389
388 iso_pu_bacteria 2842146304 2842150266 389
389 iso_pu_bacteria 2842152218 2842155411 389
390 iso_pu_bacteria 2842156927 2842161430 389
391 iso_pu_bacteria 2842163707 2842167366 389
392 iso_pu_bacteria 2842170452 2842174632 389
393 iso_pu_bacteria 2842175837 2842179291 389
394 iso_pu_bacteria 2842180545 2842186383 389
395 iso_pu_bacteria 2842187318 2842190550 389
396 iso_pu_bacteria 2842192696 2842195087 389
397 iso_pu_bacteria 2842198810 2842201947 389
398 iso_pu_bacteria 2842205361 2842210496 389
399 iso_pu_bacteria 2842211629 2842215126 389
400 iso_pu_bacteria 2842217011 2842223621 389
401 iso_pu_bacteria 2842224351 2842227847 389
402 iso_pu_bacteria 2842229732 2842235293 389
403 iso_pu_bacteria 2842237096 2842241386 389
404 iso_pu_bacteria 2842243621 2842246360 389
405 iso_pu_bacteria 2842250916 2842254952 389
406 iso_pu_bacteria 2842257432 2842260779 389
407 iso_pu_bacteria 2842271015 2842276070 389
408 iso_pu_bacteria 2842278818 2842283950 389
409 iso_pu_bacteria 2842285085 2842289831 389
410 iso_pu_bacteria 2842291075 2842295372 389
411 iso_pu_bacteria 2842304105 2842310570 389
412 iso_pu_bacteria 2842317721 2842319271 389
413 iso_pu_bacteria 2842370503 2842375916 389
414 iso_pu_bacteria 2842377471 2842381852 389
415 iso_pu_bacteria 2842384541 2842388841 389
416 iso_pu_bacteria 2842402390 2842407028 389
417 iso_pu_bacteria 2842409023 2842413921 389
418 iso_pu_bacteria 2842415677 2842420562 389
419 iso_pu_bacteria 2842489311 2842491717 389
420 iso_pu_bacteria 2842495871 2842502063 389
421 iso_pu_bacteria 2842515876 2842520155 389
422 iso_pu_bacteria 2842521101 2842522306 389
423 iso_pu_bacteria 2842922631 2842924533 389
424 iso_pu_bacteria 2844454524 2844461354 389
425 iso_pu_bacteria 2847417321 2847422910 389
426 iso_pu_bacteria 2847670302 2847674753 389
427 iso_pu_bacteria 2847686936 2847691260 389
428 iso_pu_bacteria 2848992105 2848997685 389
429 iso_pu_bacteria 2850079185 2850085231 389
430 iso_pu_bacteria 2855825444 2855828978 389
431 iso_pu_bacteria 2855839649 2855844095 389
432 iso_pu_bacteria 2855872281 2855872592 389
433 iso_pu_bacteria 2856314179 2856317361 389
434 iso_pu_bacteria 2856320880 2856326843 389
435 iso_pu_bacteria 2856342000 2856348154 389
436 iso_pu_bacteria 2856349417 2856350268 389
437 iso_pu_bacteria 2856356410 2856358117 389
438 iso_pu_bacteria 2857349434 2857351363 389
439 iso_pu_bacteria 2857516855 2857522288 389
440 iso_pu_bacteria 2858800743 2858806655 389
441 iso_pu_bacteria 2869256925 2869259288 389
442 iso_pu_bacteria 2869278585 2869283606 389
443 iso_pu_bacteria 2869285874 2869287388 389
444 iso_pu_bacteria 2871429161 2871430480 389
445 iso_pu_bacteria 2871444079 2871450528 389
446 iso_pu_bacteria 2871474448 2871476239 389
447 iso_pu_bacteria 2871488783 2871492438 389
448 iso_pu_bacteria 2871495908 2871501953 389
449 iso_pu_bacteria 2874102143 2874104315 389
450 iso_pu_bacteria 2874123672 2874124725 389
451 iso_pu_bacteria 2874139085 2874143698 389
452 iso_pu_bacteria 2874146452 2874148967 389
453 iso_pu_bacteria 2874155637 2874155972 389
454 iso_pu_bacteria 2876392853 2876393815 389
455 iso_pu_bacteria 2878035449 2878038399 389
456 iso_pu_bacteria 2878730984 2878736631 389
457 iso_pu_bacteria 2878738818 2878738963 389
458 iso_pu_bacteria 2878745973 2878746912 389
459 iso_pu_bacteria 2878753008 2878758319 389
460 iso_pu_bacteria 2878767105 2878772484 389
461 iso_pu_bacteria 2881147464 2881154778 389
462 iso_pu_bacteria 2881155292 2881161558 389
463 iso_pu_bacteria 2881161766 2881163737 389
464 iso_pu_bacteria 2881845957 2881846315 389
465 iso_pu_bacteria 2881853255 2881854654 389
466 iso_pu_bacteria 2881861095 2881868124 389
467 iso_pu_bacteria 2882632389 2882637639 389
468 iso_pu_bacteria 2882912400 2882913825 389
469 iso_pu_bacteria 2885305155 2885306045 389
470 iso_pu_bacteria 2885312484 2885315481 389
471 iso_pu_bacteria 2885318864 2885324581 389
472 iso_pu_bacteria 2885334103 2885338048 389
473 iso_pu_bacteria 2885342637 2885343872 389
474 iso_pu_bacteria 2885350715 2885357779 389
475 iso_pu_bacteria 2888337043 2888338902 389
476 iso_pu_bacteria 2888343758 2888344574 389
477 iso_pu_bacteria 2896384573 2896388731 389
478 iso_pu_bacteria 2899792073 2899795208 389
479 iso_pu_bacteria 2899845264 2899848232 389
480 iso_pu_bacteria 2903492973 2903496831 389
481 iso_pu_bacteria 2903492973 2903504386 389
482 iso_pu_bacteria 2904659560 2904660540 389
483 iso_pu_bacteria 2906308376 2906309930 389
484 iso_pu_bacteria 2906321335 2906322361 389
485 iso_pu_bacteria 2906328253 2906330548 389
486 iso_pu_bacteria 2906414383 2906417426 389
487 iso_pu_bacteria 2913295892 2913296799 389
488 iso_pu_bacteria 2915980308 2915984503 389
489 iso_pu_bacteria 2915986958 2915991394 389
490 iso_pu_bacteria 2915993759 2915998352 389
491 iso_pu_bacteria 2916000859 2916001628 389
492 iso_pu_bacteria 2916007675 2916009785 389
493 iso_pu_bacteria 2916014648 2916016694 389
494 iso_pu_bacteria 2916021584 2916024275 389
495 iso_pu_bacteria 2916028427 2916030382 389
496 iso_pu_bacteria 2916035215 2916039464 389
497 iso_pu_bacteria 2916041962 2916047575 389
498 iso_pu_bacteria 2916048683 2916049706 389
499 iso_pu_bacteria 2916055098 2916060941 389
500 iso_pu_bacteria 2916061851 2916063055 389
501 iso_pu_bacteria 2916068649 2916071780 389
502 iso_pu_bacteria 2916076590 2916081318 389
503 iso_pu_bacteria 2919100787 2919103340 389
504 iso_pu_bacteria 2919114240 2919118617 389
505 iso_pu_bacteria 2920760137 2920765092 389
506 iso_pu_bacteria 2920822456 2920826735 389
507 iso_pu_bacteria 2921201388 2921206965 389
508 iso_pu_bacteria 2921208531 2921213459 389
509 iso_pu_bacteria 2921237296 2921238190 389
510 iso_pu_bacteria 2921244191 2921248854 389
511 iso_pu_bacteria 2921250672 2921254789 389
512 iso_pu_bacteria 2921257292 2921261447 389
513 iso_pu_bacteria 2921263974 2921269044 389
514 iso_pu_bacteria 2921282425 2921288971 389
515 iso_pu_bacteria 2921289301 2921295590 389
516 iso_pu_bacteria 2921296804 2921303513 389
517 iso_pu_bacteria 2922158528 2922159851 389
518 iso_pu_bacteria 2923556063 2923556646 389
519 iso_pu_bacteria 2924144063 2924145089 389
520 iso_pu_bacteria 2924150972 2924156844 389
521 iso_pu_bacteria 2924158325 2924162162 389
522 iso_pu_bacteria 2924165586 2924170015 389
523 iso_pu_bacteria 2924172951 2924173800 389
524 iso_pu_bacteria 2924179722 2924180672 389
525 iso_pu_bacteria 2924186466 2924192281 389
526 iso_pu_bacteria 2924193448 2924196210 389
527 iso_pu_bacteria 2924200457 2924203713 389
528 iso_pu_bacteria 2924207177 2924209614 389
529 iso_pu_bacteria 2924214083 2924214619 389
530 iso_pu_bacteria 2924221636 2924226602 389
531 iso_pu_bacteria 2924228884 2924231301 389
532 iso_pu_bacteria 2924710171 2924716258 389
533 iso_pu_bacteria 2924718760 2924722478 389
534 iso_pu_bacteria 2924726620 2924730370 389
535 iso_pu_bacteria 2924733363 2924739930 389
536 iso_pu_bacteria 2924762789 2924768481 389
537 iso_pu_bacteria 2924776078 2924776325 389
538 iso_pu_bacteria 2924784321 2924784415 389
539 iso_pu_bacteria 2926754445 2926755146 389
540 iso_pu_bacteria 2926760298 2926762306 389
541 iso_pu_bacteria 2929138655 2929141765 389
542 iso_pu_bacteria 2933006813 2933010739 389
543 iso_pu_bacteria 2933011516 2933015585 389
544 iso_pu_bacteria 2933570622 2933577007 389
545 iso_pu_bacteria 2933586486 2933590559 389
546 iso_pu_bacteria 2933594066 2933597673 389
547 iso_pu_bacteria 2935894831 2935898409 389
548 iso_pu_bacteria 2935901341 2935906850 389
549 iso_pu_bacteria 2936367885 2936370494 389
550 iso_pu_bacteria 2936375103 2936378154 389
551 iso_pu_bacteria 2936996657 2937002301 389
552 iso_pu_bacteria 2937002841 2937003597 389
553 iso_pu_bacteria 2937009748 2937012109 389
554 iso_pu_bacteria 2937016420 2937017442 389
555 iso_pu_bacteria 2937023124 2937024951 389
556 iso_pu_bacteria 2937029754 2937033269 389
557 iso_pu_bacteria 2937036028 2937040619 389
558 iso_pu_bacteria 2937042894 2937043611 389
559 iso_pu_bacteria 2937049772 2937050765 389
560 iso_pu_bacteria 2937056579 2937058229 389
561 iso_pu_bacteria 2937063883 2937064711 389
562 iso_pu_bacteria 2937071275 2937074336 389
563 iso_pu_bacteria 2937078374 2937082721 389
564 iso_pu_bacteria 2937084907 2937086696 389
565 iso_pu_bacteria 2937091812 2937097569 389
566 iso_pu_bacteria 2937098957 2937102433 389
567 iso_pu_bacteria 2937106411 2937111070 389
568 iso_pu_bacteria 2937113482 2937114784 389
569 iso_pu_bacteria 2937119839 2937122897 389
570 iso_pu_bacteria 2937126314 2937126924 389
571 iso_pu_bacteria 2937822353 2937823465 389
572 iso_pu_bacteria 2937836603 2937842341 389
573 iso_pu_bacteria 2937848649 2937851111 389
574 iso_pu_bacteria 2937877337 2937884217 389
575 iso_pu_bacteria 2937891427 2937896256 389
576 iso_pu_bacteria 2937972304 2937979680 389
577 iso_pu_bacteria 2957375807 2957379165 389
578 iso_pu_bacteria 2957382221 2957383248 389
579 iso_pu_bacteria 2957388812 2957390545 389
580 iso_pu_bacteria 2957395598 2957399410 389
581 iso_pu_bacteria 2957402308 2957403518 389
582 iso_pu_bacteria 2957408893 2957411307 389
583 iso_pu_bacteria 2957415311 2957417777 389
584 iso_pu_bacteria 2957422303 2957422778 389
585 iso_pu_bacteria 2957430029 2957432646 389
586 iso_pu_bacteria 2957437181 2957442899 389
587 iso_pu_bacteria 2957443900 2957445141 389
588 iso_pu_bacteria 2957450854 2957452553 389
589 iso_pu_bacteria 2957457609 2957458817 389
590 iso_pu_bacteria 2957464669 2957466813 389
591 iso_pu_bacteria 2957471148 2957472654 389
592 iso_pu_bacteria 2957478035 2957484204 389
593 iso_pu_bacteria 2957484790 2957490317 389
594 iso_pu_bacteria 2957491536 2957495500 389
595 iso_pu_bacteria 2957498199 2957500815 389
596 iso_pu_bacteria 2957505466 2957508498 389
597 iso_pu_bacteria 2958034702 2958040118 389
598 iso_pu_bacteria 2958041894 2958054462 389
599 iso_pu_bacteria 2958071322 2958075476 389
600 iso_pu_bacteria 2958084443 2958091528 389
601 iso_pu_bacteria 2958092219 2958093616 389
602 iso_pu_bacteria 2958115193 2958115648 389
603 iso_pu_bacteria 2958130278 2958131673 389
604 iso_pu_bacteria 2958179912 2958180745 389
605 iso_pu_bacteria 2960584000 2960585065 389
606 iso_pu_bacteria 2960591022 2960595018 389
607 iso_pu_bacteria 2960597568 2960602422 389
608 iso_pu_bacteria 2960603979 2960608930 389
609 iso_pu_bacteria 2960610863 2960613069 389
610 iso_pu_bacteria 2960617483 2960619871 389
611 iso_pu_bacteria 2960624210 2960630302 389
612 iso_pu_bacteria 2960631154 2960633076 389
613 iso_pu_bacteria 2960637947 2960638314 389
614 iso_pu_bacteria 2960645483 2960647830 389
615 iso_pu_bacteria 2960652885 2960658846 389
616 iso_pu_bacteria 2960660292 2960661832 389
617 iso_pu_bacteria 2960667422 2960668628 389
618 iso_pu_bacteria 2960674078 2960679820 389
619 iso_pu_bacteria 2960680706 2960684365 389
620 iso_pu_bacteria 2960687367 2960688422 389
621 iso_pu_bacteria 2960693952 2960700438 389
622 iso_pu_bacteria 2961077736 2961078582 389
623 iso_pu_bacteria 2961114664 2961120861 389
624 iso_pu_bacteria 2961127735 2961128447 389
625 iso_pu_bacteria 2961170736 2961173490 389
626 iso_pu_bacteria 2964607997 2964609887 389
627 iso_pu_bacteria 2964615318 2964618486 389
628 iso_pu_bacteria 2964621998 2964623372 389
629 iso_pu_bacteria 2964628898 2964629206 389
630 iso_pu_bacteria 2964636051 2964640863 389
631 iso_pu_bacteria 2964643177 2964646514 389
632 iso_pu_bacteria 2964649959 2964654258 389
633 iso_pu_bacteria 2964656573 2964661471 389
634 iso_pu_bacteria 2964663802 2964665479 389
635 iso_pu_bacteria 2964670856 2964675684 389
636 iso_pu_bacteria 2964678106 2964681888 389
637 iso_pu_bacteria 2964685014 2964688893 389
638 iso_pu_bacteria 2964691889 2964696469 389
639 iso_pu_bacteria 2964698721 2964699604 389
640 iso_pu_bacteria 2964705432 2964706651 389
641 iso_pu_bacteria 2964712639 2964715560 389
642 iso_pu_bacteria 2964719344 2964720265 389
643 iso_pu_bacteria 2965018300 2965023682 389
644 iso_pu_bacteria 2965062239 2965069565 389
645 iso_pu_bacteria 2967664464 2967671138 389
646 iso_pu_bacteria 2967671571 2967676191 389
647 iso_pu_bacteria 2967678726 2967684685 389
648 iso_pu_bacteria 2967686174 2967689197 389
649 iso_pu_bacteria 2967693043 2967694322 389
650 iso_pu_bacteria 2967699805 2967705940 389
651 iso_pu_bacteria 2967706974 2967708816 389
652 iso_pu_bacteria 2967714385 2967716186 389
653 iso_pu_bacteria 2967721400 2967724310 389
654 iso_pu_bacteria 2967728569 2967732091 389
655 iso_pu_bacteria 2967735183 2967736645 389
656 iso_pu_bacteria 2967742019 2967743471 389
657 iso_pu_bacteria 2967748971 2967752018 389
658 iso_pu_bacteria 2967755722 2967758532 389
659 iso_pu_bacteria 2967762386 2967765570 389
660 iso_pu_bacteria 2967769361 2967772534 389
661 iso_pu_bacteria 2967775926 2967777249 389
662 iso_pu_bacteria 2968003550 2968005916 389
663 iso_pu_bacteria 2968016561 2968018959 389
664 iso_pu_bacteria 2968091066 2968094905 389
665 iso_pu_bacteria 2968097103 2968098415 389
666 iso_pu_bacteria 2968110612 2968111598 389
667 iso_pu_bacteria 2968128360 2968130465 389
668 iso_pu_bacteria 2968138860 2968141055 389
669 iso_pu_bacteria 2970019648 2970024486 389
670 iso_pu_bacteria 2970026789 2970031531 389
671 iso_pu_bacteria 2970033650 2970035435 389
672 iso_pu_bacteria 2970040964 2970047025 389
673 iso_pu_bacteria 2970047711 2970048646 389
674 iso_pu_bacteria 2970054988 2970057325 389
675 iso_pu_bacteria 2970061556 2970065856 389
676 iso_pu_bacteria 2970068827 2970071754 389
677 iso_pu_bacteria 2970076120 2970078669 389
678 iso_pu_bacteria 2970082768 2970087147 389
679 iso_pu_bacteria 2970088815 2970090693 389
680 iso_pu_bacteria 2970095765 2970097175 389
681 iso_pu_bacteria 2970102677 2970105259 389
682 iso_pu_bacteria 2970109326 2970110090 389
683 iso_pu_bacteria 2970116247 2970119740 389
684 iso_pu_bacteria 2970122695 2970127315 389
685 iso_pu_bacteria 2970129317 2970135658 389
686 iso_pu_bacteria 2970136068 2970136616 389
687 iso_pu_bacteria 2970143518 2970146777 389
688 iso_pu_bacteria 2970149975 2970154260 389
689 iso_pu_bacteria 2970156795 2970161437 389
690 iso_pu_bacteria 2970164137 2970166660 389
691 iso_pu_bacteria 2970170962 2970173171 389
692 iso_pu_bacteria 2970177841 2970180901 389
693 iso_pu_bacteria 2970184632 2970187517 389
694 iso_pu_bacteria 2970191845 2970194820 389
695 iso_pu_bacteria 2970469710 2970470868 389
696 iso_pu_bacteria 2970489779 2970490703 389
697 iso_pu_bacteria 2970503327 2970506082 389
698 iso_pu_bacteria 2970593180 2970597969 389
699 iso_pu_bacteria 2977516862 2977521846 389
700 iso_pu_bacteria 2977523885 2977525401 389
701 iso_pu_bacteria 2977530762 2977534718 389
702 iso_pu_bacteria 2977537788 2977539171 389
703 iso_pu_bacteria 2977544691 2977547506 389
704 iso_pu_bacteria 2977551784 2977555497 389
705 iso_pu_bacteria 2977558990 2977563926 389
706 iso_pu_bacteria 2977565890 2977568530 389
707 iso_pu_bacteria 2977572785 2977575227 389
708 iso_pu_bacteria 2977579622 2977581121 389
709 iso_pu_bacteria 2977821940 2977826851 389
710 iso_pu_bacteria 2977828996 2977829154 389
711 iso_pu_bacteria 2977843712 2977845728 389
712 iso_pu_bacteria 2977858184 2977864653 389
713 iso_pu_bacteria 2977864932 2977865999 389
714 iso_pu_bacteria 2977898635 2977905656 389
715 iso_pu_bacteria 2977922695 2977923447 389
716 iso_pu_bacteria 2977971508 2977973563 389
717 iso_pu_bacteria 2979089926 2979092424 389
718 iso_pu_bacteria 2979095461 2979100185 389
719 iso_pu_bacteria 2979100975 2979104395 389
720 iso_pu_bacteria 2979779861 2979784136 389
721 iso_pu_bacteria 2979808191 2979810804 389
722 iso_pu_bacteria 2984509177 2984513811 389
723 iso_pu_bacteria 2984518228 2984522612 389
724 iso_pu_bacteria 2984537506 2984541918 389
725 iso_pu_bacteria 2984601300 2984601349 389
726 iso_pu_bacteria 2987636660 2987638547 389
727 iso_pu_bacteria 2987666974 2987670068 389
728 iso_pu_bacteria 2989771324 2989771894 389
729 iso_pu_bacteria 2996310559 2996316160 389
730 iso_pu_bacteria 2996341866 2996346320 389
731 iso_pu_bacteria 2996348954 2996356596 389
732 iso_pu_bacteria 2996386984 2996391047 389
733 iso_pu_bacteria 2996887358 2996891391 389
734 iso_pu_bacteria 3000135777 3000140887 389
735 iso_pu_bacteria 3003930520 3003931457 389
736 iso_pu_bacteria 3004167301 3004171803 389
737 iso_pu_bacteria 3004203850 3004205210 389
738 iso_pu_bacteria 3004211236 3004212754 389
739 iso_pu_bacteria 3004218560 3004221444 389
740 iso_pu_bacteria 3004268573 3004268622 389
741 iso_pu_bacteria 3004275668 3004282899 389
742 iso_pu_bacteria 3004289098 3004291034 389
743 iso_pu_bacteria 3005445848 3005451548 389
744 iso_pu_bacteria 637000159 637075847 389
745 iso_pu_bacteria 639633055 639651398 389
746 iso_pu_bacteria 643692032 643823094 389
747 iso_pu_bacteria 648276728 648738723 389
748 iso_pu_bacteria 650716007 650741055 389
749 iso_pu_bacteria 8003992118 8003996675 389
750 iso_pu_bacteria 8003999396 8004004130 389
751 iso_pu_bacteria 8004312739 8004319660 389
752 iso_pu_bacteria 8004374579 8004379833 389
753 iso_pu_bacteria 8004387939 8004389369 389
754 iso_pu_bacteria 8004395343 8004403788 389
755 iso_pu_bacteria 8004445564 8004446994 389
756 iso_pu_bacteria 8004633249 8004639372 389
757 iso_pu_bacteria 8004703790 8004711920 389
758 iso_pu_bacteria 8004714634 8004716076 389
759 iso_pu_bacteria 8005258706 8005263938 389
760 iso_pu_bacteria 8005289223 8005289470 389
761 iso_pu_bacteria 8005301065 8005305197 389
762 iso_pu_bacteria 8005307578 8005313307 389
763 iso_pu_bacteria 8005321885 8005325918 389
764 iso_pu_bacteria 8005376324 8005382164 389
765 iso_pu_bacteria 8005382845 8005388591 389
766 iso_pu_bacteria 8005460587 8005466613 389
767 iso_pu_bacteria 8005542996 8005547673 389
768 iso_pu_bacteria 8005556819 8005561980 389
769 iso_pu_bacteria 8005563573 8005567280 389
770 iso_pu_bacteria 8005570704 8005576169 389
771 iso_pu_bacteria 8005658619 8005661644 389
772 iso_pu_bacteria 8005688590 8005689219 389
773 iso_pu_bacteria 8018127388 8018127736 389
774 iso_pu_bacteria 8018150411 8018154812 389
775 iso_pu_bacteria 8018163183 8018165769 389
776 iso_pu_bacteria 8023680758 8023688373 389
777 iso_pu_bacteria 8024479707 8024484010 389
778 iso_pu_bacteria 8024501048 8024503954 389
779 iso_pu_bacteria 8049293176 8049298464 389
780 iso_pu_bacteria 8054558443 8054563370 389
781 iso_pu_bacteria 8055617313 8055618089 389
782 iso_pu_bacteria 8057874678 8057880777 389
783 3300003792 Ga0055540_1000379 Ga0055540_100037924 390
784 3300025303 Ga0209051_1000249 Ga0209051_100024912 390
785 3300025304 Ga0209257_1005406 Ga0209257_10054062 390
786 3300047472 Ga0495686_0052416 Ga0495686_0052416_814_2022 390
787 3300060353 Ga0501082_0121497 Ga0501082_0121497_579_1787 390
788 iso_pu_bacteria 2765235802 2765466951 390
789 iso_pu_bacteria 2767802442 2770197147 390
790 iso_pu_bacteria 2775506902 2776267649 390
791 iso_pu_bacteria 2791355253 2793283411 390
792 iso_pu_bacteria 2839993093 2839997204 390
793 iso_pu_bacteria 2840764183 2840764568 390
794 iso_pu_bacteria 2842871566 2842875512 390
795 iso_pu_bacteria 2904578770 2904583501 390
796 iso_pu_bacteria 2919119836 2919124578 390
797 iso_pu_bacteria 2928521798 2928525898 390
798 iso_pu_bacteria 2954011201 2954012016 390
799 3300002737 JGI25162J39368_1001559 JGI25162J39368_10015593 391
800 3300002739 JGI25158J39367_1000021 JGI25158J39367_100002119 391
801 3300002773 JGI25152J39213_1002259 JGI25152J39213_10022593 391
802 3300002773 JGI25152J39213_1015384 JGI25152J39213_10153842 391
803 3300002987 JGI25159J45721_1000423 JGI25159J45721_100042313 391
804 3300003214 JGI25165J46597_1000407 JGI25165J46597_100040714 391
805 3300003215 JGI25153J46596_10002677 JGI25153J46596_100026775 391
806 3300003215 JGI25153J46596_10038349 JGI25153J46596_100383492 391
807 3300003354 JGI25160J50197_1008334 JGI25160J50197_10083343 391
808 3300003374 JGI25161J50226_1000025 JGI25161J50226_100002550 391
809 3300003771 Ga0055526_1003560 Ga0055526_10035604 391
810 3300003775 Ga0055524_1002252 Ga0055524_10022524 391
811 3300003790 Ga0055528_1002240 Ga0055528_10022404 391
812 3300003792 Ga0055540_1016517 Ga0055540_10165172 391
813 3300005262 Ga0065165_1003353 Ga0065165_10033532 391
814 3300006051 Ga0075364_10022777 Ga0075364_100227773 391
815 3300025208 Ga0209436_100044 Ga0209436_1000443 391
816 3300025233 Ga0209437_100040 Ga0209437_100040325 391
817 3300025258 Ga0209129_1009534 Ga0209129_10095342 391
818 3300025261 Ga0209233_1000051 Ga0209233_1000051326 391
819 3300025273 Ga0209673_1019093 Ga0209673_10190931 391
820 3300025284 Ga0209130_1000001 Ga0209130_1000001123 391
821 3300025294 Ga0209025_1010251 Ga0209025_10102512 391
822 3300025295 Ga0209564_1002621 Ga0209564_10026214 391
823 3300025297 Ga0209758_1009270 Ga0209758_10092702 391
824 3300025297 Ga0209758_1025304 Ga0209758_10253042 391
825 3300025302 Ga0207426_1000005 Ga0207426_1000005728 391
826 3300025303 Ga0209051_1033815 Ga0209051_10338152 391
827 3300041413 Ga0439465_0024274 Ga0439465_0024274_657_1892 391
828 3300041413 Ga0439465_0024686 Ga0439465_0024686_211_1419 391
829 3300046512 Ga0495610_0044818 Ga0495610_0044818_77_1285 391
830 3300048909 Ga0496106_0000269 Ga0496106_0000269_26604_27812 391
831 3300048919 Ga0496116_0009943 Ga0496116_0009943_663_1871 391
832 3300048924 Ga0496121_0022949 Ga0496121_0022949_2281_3489 391
833 3300048926 Ga0496123_0018123 Ga0496123_0018123_329_1537 391
834 3300053139 Ga0500568_0004546 Ga0500568_0004546_3429_4637 391
835 iso_pu_bacteria 3002141150 3002146464 391
836 3300003187 JGI25151J46595_10000274 JGI25151J46595_1000027427 392
837 3300003187 JGI25151J46595_10006048 JGI25151J46595_100060483 392
838 3300003354 JGI25160J50197_1003169 JGI25160J50197_10031694 392
839 3300003374 JGI25161J50226_1003751 JGI25161J50226_10037512 392
840 3300003771 Ga0055526_1011807 Ga0055526_10118073 392
841 3300003775 Ga0055524_1000809 Ga0055524_100080915 392
842 3300003790 Ga0055528_1003248 Ga0055528_10032485 392
843 3300004625 Ga0055543_1000817 Ga0055543_10008178 392
844 3300005262 Ga0065165_1011043 Ga0065165_10110433 392
845 3300005262 Ga0065165_1023268 Ga0065165_10232682 392
846 3300005347 Ga0070668_100019030 Ga0070668_1000190302 392
847 3300005367 Ga0070667_100263878 Ga0070667_1002638781 392
848 3300005468 Ga0070707_100126638 Ga0070707_1001266382 392
849 3300005518 Ga0070699_100051187 Ga0070699_1000511872 392
850 3300005548 Ga0070665_100112513 Ga0070665_1001125132 392
851 3300006038 Ga0075365_10002073 Ga0075365_100020734 392
852 3300006186 Ga0075369_10034297 Ga0075369_100342972 392
853 3300006195 Ga0075366_10102839 Ga0075366_101028392 392
854 3300009148 Ga0105243_10108221 Ga0105243_101082212 392
855 3300013100 Ga0157373_10038303 Ga0157373_100383032 392
856 3300025245 Ga0207425_1002210 Ga0207425_10022104 392
857 3300025258 Ga0209129_1000016 Ga0209129_1000016198 392
858 3300025258 Ga0209129_1001000 Ga0209129_100100013 392
859 3300025273 Ga0209673_1000212 Ga0209673_100021253 392
860 3300025291 Ga0209675_1016281 Ga0209675_10162812 392
861 3300025294 Ga0209025_1000300 Ga0209025_100030052 392
862 3300025294 Ga0209025_1001193 Ga0209025_100119328 392
863 3300025295 Ga0209564_1000402 Ga0209564_100040252 392
864 3300025297 Ga0209758_1000053 Ga0209758_1000053280 392
865 3300025299 Ga0209256_1001320 Ga0209256_10013207 392
866 3300025302 Ga0207426_1000035 Ga0207426_1000035369 392
867 3300025303 Ga0209051_1007255 Ga0209051_10072553 392
868 3300025961 Ga0207712_10138573 Ga0207712_101385732 392
869 3300025986 Ga0207658_10042524 Ga0207658_100425242 392
870 3300027312 Ga0209371_1000037 Ga0209371_100003735 392
871 3300028794 Ga0307515_10000017 Ga0307515_10000017350 392
872 3300030500 Ga0268256_1000039 Ga0268256_1000039274 392
873 3300031456 Ga0307513_10000717 Ga0307513_1000071738 392
874 3300031901 Ga0307406_10177699 Ga0307406_101776992 392
875 3300041413 Ga0439465_0007929 Ga0439465_0007929_181_1416 392
876 3300048905 Ga0496102_0075309 Ga0496102_0075309_64_1275 392
877 3300048909 Ga0496106_0093331 Ga0496106_0093331_205_1416 392
878 3300048912 Ga0496109_0210223 Ga0496109_0210223_274_1485 392
879 3300048913 Ga0496110_0038763 Ga0496110_0038763_472_1680 392
880 3300048914 Ga0496111_0011505 Ga0496111_0011505_2314_3567 392
881 3300048925 Ga0496122_0027288 Ga0496122_0027288_1578_2786 392
882 3300048926 Ga0496123_0006666 Ga0496123_0006666_664_1872 392
883 3300048927 Ga0496124_0257388 Ga0496124_0257388_49_1254 392
884 3300050493 nmdc:mga0k408_27132_c1 nmdc:mga0k408_27132_c1_667_1902 392
885 3300050512 nmdc:mga0n895_48319_c1 nmdc:mga0n895_48319_c1_2035_3246 392
886 3300050516 nmdc:mga0sz30_6882_c1 nmdc:mga0sz30_6882_c1_1795_3030 392
887 iso_pu_bacteria 2599185236 2599718649 392
888 iso_pu_bacteria 8024486573 8024491245 392
889 3300002773 JGI25152J39213_1001590 JGI25152J39213_10015903 393
890 3300002774 JGI25150J39212_1000022 JGI25150J39212_100002266 393
891 3300003187 JGI25151J46595_10000023 JGI25151J46595_1000002377 393
892 3300003203 JGI25406J46586_10004119 JGI25406J46586_100041196 393
893 3300003771 Ga0055526_1018430 Ga0055526_10184302 393
894 3300003775 Ga0055524_1002377 Ga0055524_10023774 393
895 3300005347 Ga0070668_100042323 Ga0070668_1000423232 393
896 3300005353 Ga0070669_100072607 Ga0070669_1000726072 393
897 3300005356 Ga0070674_100144571 Ga0070674_1001445712 393
898 3300005548 Ga0070665_100002391 Ga0070665_1000023916 393
899 3300005548 Ga0070665_100129080 Ga0070665_1001290802 393
900 3300005548 Ga0070665_100312353 Ga0070665_1003123532 393
901 3300005983 Ga0081540_1040794 Ga0081540_10407942 393
902 3300005985 Ga0081539_10000646 Ga0081539_1000064615 393
903 3300006038 Ga0075365_10044195 Ga0075365_100441952 393
904 3300006038 Ga0075365_10111042 Ga0075365_101110421 393
905 3300006177 Ga0075362_10000288 Ga0075362_100002889 393
906 3300006178 Ga0075367_10003994 Ga0075367_100039943 393
907 3300006178 Ga0075367_10081998 Ga0075367_100819981 393
908 3300006186 Ga0075369_10058194 Ga0075369_100581941 393
909 3300006195 Ga0075366_10001721 Ga0075366_100017216 393
910 3300006353 Ga0075370_10015245 Ga0075370_100152452 393
911 3300006353 Ga0075370_10058681 Ga0075370_100586811 393
912 3300006946 Ga0079104_1000082 Ga0079104_100008267 393
913 3300013100 Ga0157373_10005480 Ga0157373_100054801 393
914 3300013102 Ga0157371_10000195 Ga0157371_1000019541 393
915 3300013104 Ga0157370_10007276 Ga0157370_100072767 393
916 3300013249 Ga0171463_1010 Ga0171463_101054 393
917 3300015690 Ga0183363_1207 Ga0183363_12075 393
918 3300021320 Ga0214544_1000419 Ga0214544_100041946 393
919 3300021321 Ga0214542_1000027 Ga0214542_100002790 393
920 3300021321 Ga0214542_1019286 Ga0214542_10192863 393
921 3300021327 Ga0214543_1000005 Ga0214543_1000005399 393
922 3300021327 Ga0214543_1000047 Ga0214543_100004764 393
923 3300022739 Ga0228711_1016254 Ga0228711_10162544 393
924 3300022740 Ga0228710_1003061 Ga0228710_100306114 393
925 3300025208 Ga0209436_100745 Ga0209436_10074511 393
926 3300025245 Ga0207425_1000038 Ga0207425_1000038151 393
927 3300025258 Ga0209129_1000036 Ga0209129_1000036151 393
928 3300025273 Ga0209673_1000005 Ga0209673_1000005356 393
929 3300025284 Ga0209130_1000074 Ga0209130_100007452 393
930 3300025294 Ga0209025_1000108 Ga0209025_1000108151 393
931 3300025294 Ga0209025_1000593 Ga0209025_10005932 393
932 3300025294 Ga0209025_1007795 Ga0209025_10077954 393
933 3300025294 Ga0209025_1020001 Ga0209025_10200012 393
934 3300025294 Ga0209025_1036173 Ga0209025_10361732 393
935 3300025295 Ga0209564_1000329 Ga0209564_100032956 393
936 3300025297 Ga0209758_1000104 Ga0209758_100010476 393
937 3300025297 Ga0209758_1002176 Ga0209758_10021766 393
938 3300025298 Ga0209050_1012725 Ga0209050_10127253 393
939 3300025299 Ga0209256_1000164 Ga0209256_100016467 393
940 3300025299 Ga0209256_1000582 Ga0209256_100058240 393
941 3300025299 Ga0209256_1001362 Ga0209256_100136210 393
942 3300025302 Ga0207426_1000165 Ga0207426_100016552 393
943 3300025303 Ga0209051_1002800 Ga0209051_100280011 393
944 3300025303 Ga0209051_1012514 Ga0209051_10125142 393
945 3300025304 Ga0209257_1002528 Ga0209257_100252813 393
946 3300025933 Ga0207706_10163371 Ga0207706_101633712 393
947 3300027111 Ga0209281_1000043 Ga0209281_100004364 393
948 3300027111 Ga0209281_1000087 Ga0209281_1000087178 393
949 3300027111 Ga0209281_1000226 Ga0209281_100022633 393
950 3300027312 Ga0209371_1000687 Ga0209371_10006876 393
951 3300027666 Ga0209282_1000008 Ga0209282_1000008180 393
952 3300027866 Ga0209813_10000676 Ga0209813_100006764 393
953 3300028379 Ga0268266_10002894 Ga0268266_100028946 393
954 3300028379 Ga0268266_10021611 Ga0268266_100216114 393
955 3300028794 Ga0307515_10016021 Ga0307515_100160216 393
956 3300028794 Ga0307515_10038197 Ga0307515_100381974 393
957 3300031548 Ga0307408_100025562 Ga0307408_1000255623 393
958 3300031901 Ga0307406_10230622 Ga0307406_102306222 393
959 3300031911 Ga0307412_10015715 Ga0307412_100157154 393
960 3300031967 Ga0315914_1000305 Ga0315914_10003057 393
961 3300033430 Ga0315913_1000064 Ga0315913_10000647 393
962 3300033464 Ga0315915_1000009 Ga0315915_100000937 393
963 3300041405 Ga0439438_013761 Ga0439438_013761_290_1498 393
964 3300042007 Ga0439449_0005519 Ga0439449_0005519_887_2101 393
965 3300042122 Ga0450920_002612 Ga0450920_002612_1645_2853 393
966 3300046452 Ga0495617_032064 Ga0495617_032064_321_1529 393
967 3300046460 Ga0495638_0000269 Ga0495638_0000269_51670_52878 393
968 3300046474 Ga0495605_0000841 Ga0495605_0000841_17954_19162 393
969 3300046492 Ga0495585_0004462 Ga0495585_0004462_2573_3805 393
970 3300046492 Ga0495585_0022616 Ga0495585_0022616_1857_3065 393
971 3300046506 Ga0495583_0011222 Ga0495583_0011222_1275_2507 393
972 3300046512 Ga0495610_0004590 Ga0495610_0004590_5645_6880 393
973 3300046512 Ga0495610_0039899 Ga0495610_0039899_363_1598 393
974 3300046512 Ga0495610_0069825 Ga0495610_0069825_17_1249 393
975 3300046513 Ga0495616_0046021 Ga0495616_0046021_214_1449 393
976 3300046519 Ga0495632_0007168 Ga0495632_0007168_2450_3658 393
977 3300046519 Ga0495632_0015129 Ga0495632_0015129_1558_2793 393
978 3300046522 Ga0495643_0001376 Ga0495643_0001376_15753_16988 393
979 3300046522 Ga0495643_0033863 Ga0495643_0033863_507_1742 393
980 3300046616 Ga0495668_0011738 Ga0495668_0011738_2494_3702 393
981 3300046648 Ga0495611_0005071 Ga0495611_0005071_2333_3541 393
982 3300046660 Ga0495625_0003375 Ga0495625_0003375_6984_8192 393
983 3300046660 Ga0495625_0036637 Ga0495625_0036637_1098_2306 393
984 3300046660 Ga0495625_0115084 Ga0495625_0115084_20_1255 393
985 3300046674 Ga0495588_0000601 Ga0495588_0000601_11431_12639 393
986 3300046691 Ga0495670_0010698 Ga0495670_0010698_2876_4084 393
987 3300046692 Ga0495671_0038874 Ga0495671_0038874_704_1912 393
988 3300046810 Ga0495660_0035613 Ga0495660_0035613_17_1252 393
989 3300047320 Ga0495672_0025631 Ga0495672_0025631_2352_3560 393
990 3300047443 Ga0495687_016218 Ga0495687_016218_1364_2599 393
991 3300047472 Ga0495686_0047552 Ga0495686_0047552_756_1991 393
992 3300047472 Ga0495686_0124392 Ga0495686_0124392_215_1450 393
993 3300048916 Ga0496113_0104794 Ga0496113_0104794_344_1552 393
994 3300048919 Ga0496116_0006551 Ga0496116_0006551_1638_2852 393
995 3300048919 Ga0496116_0019646 Ga0496116_0019646_1473_2687 393
996 3300048919 Ga0496116_0036476 Ga0496116_0036476_476_1684 393
997 3300048920 Ga0496117_0000031 Ga0496117_0000031_48187_49395 393
998 3300048920 Ga0496117_0004480 Ga0496117_0004480_4566_5780 393
999 3300048921 Ga0496118_0000976 Ga0496118_0000976_349_1557 393
1000 3300048921 Ga0496118_0008775 Ga0496118_0008775_1629_2843 393
1001 3300048922 Ga0496119_0026207 Ga0496119_0026207_2596_3810 393
1002 3300048923 Ga0496120_0000583 Ga0496120_0000583_48505_49713 393
1003 3300048924 Ga0496121_0006426 Ga0496121_0006426_960_2216 393
1004 3300048924 Ga0496121_0053008 Ga0496121_0053008_388_1623 393
1005 3300048924 Ga0496121_0055453 Ga0496121_0055453_397_1626 393
1006 3300048924 Ga0496121_0061575 Ga0496121_0061575_1611_2819 393
1007 3300048925 Ga0496122_0000023 Ga0496122_0000023_48187_49395 393
1008 3300048925 Ga0496122_0005813 Ga0496122_0005813_5605_6819 393
1009 3300048926 Ga0496123_0000447 Ga0496123_0000447_24484_25692 393
1010 3300048927 Ga0496124_0000153 Ga0496124_0000153_109880_111094 393
1011 3300048927 Ga0496124_0039158 Ga0496124_0039158_2496_3704 393
1012 3300048927 Ga0496124_0089052 Ga0496124_0089052_194_1408 393
1013 3300048927 Ga0496124_0199999 Ga0496124_0199999_42_1256 393
1014 3300049459 Ga0495678_048241 Ga0495678_048241_77_1285 393
1015 3300049573 Ga0501037_0041257 Ga0501037_0041257_345_1559 393
1016 3300049580 Ga0501046_0054503 Ga0501046_0054503_1829_3043 393
1017 3300049591 Ga0501075_0048275 Ga0501075_0048275_1684_2898 393
1018 3300049592 Ga0501076_0034899 Ga0501076_0034899_2441_3655 393
1019 3300049741 Ga0501079_0045237 Ga0501079_0045237_1838_3052 393
1020 3300049743 Ga0501081_0101507 Ga0501081_0101507_519_1733 393
1021 3300049823 Ga0501044_0056227 Ga0501044_0056227_964_2178 393
1022 3300050489 nmdc:mga03683_39394_c1 nmdc:mga03683_39394_c1_322_1530 393
1023 3300050491 nmdc:mga00v17_139_c1 nmdc:mga00v17_139_c1_2622_3830 393
1024 3300050491 nmdc:mga00v17_182_c1 nmdc:mga00v17_182_c1_24947_26155 393
1025 3300050492 nmdc:mga0yw44_24573_c1 nmdc:mga0yw44_24573_c1_598_1992 393
1026 3300050492 nmdc:mga0yw44_2775_c1 nmdc:mga0yw44_2775_c1_5660_6880 393
1027 3300050492 nmdc:mga0yw44_6862_c1 nmdc:mga0yw44_6862_c1_2133_3341 393
1028 3300050494 nmdc:mga06z11_29666_c1 nmdc:mga06z11_29666_c1_59_1294 393
1029 3300050494 nmdc:mga06z11_5567_c1 nmdc:mga06z11_5567_c1_2808_4016 393
1030 3300050495 nmdc:mga04h51_642_c1 nmdc:mga04h51_642_c1_4339_5547 393
1031 3300050496 nmdc:mga07m45_6954_c1 nmdc:mga07m45_6954_c1_3002_4237 393
1032 3300050516 nmdc:mga0sz30_195_c1 nmdc:mga0sz30_195_c1_18592_19800 393
1033 3300053107 Ga0500560_000096 Ga0500560_000096_6744_7952 393
1034 3300053134 Ga0500658_0002006 Ga0500658_0002006_3224_4459 393
1035 3300053137 Ga0500561_0003308 Ga0500561_0003308_815_2023 393
1036 3300053139 Ga0500568_0000086 Ga0500568_0000086_19067_20278 393
1037 3300053153 Ga0500616_0001636 Ga0500616_0001636_12312_13520 393
1038 3300054114 Ga0501084_0004530 Ga0501084_0004530_4321_5535 393
1039 3300060353 Ga0501082_0082484 Ga0501082_0082484_1549_2763 393
1040 iso_pu_bacteria 2791355265 2793355240 393
1041 iso_pu_bacteria 2838736955 2838739775 393
1042 iso_pu_bacteria 2841840854 2841844101 393
1043 iso_pu_bacteria 2842140634 2842143822 393
1044 iso_pu_bacteria 2844009547 2844016186 393
1045 iso_pu_bacteria 2857531043 2857533846 393
1046 iso_pu_bacteria 2869234852 2869235792 393
1047 iso_pu_bacteria 2874109183 2874112981 393
1048 iso_pu_bacteria 3004232784 3004239072 393
1049 iso_pu_bacteria 3005409236 3005413738 393
1050 iso_pu_bacteria 3005452660 3005458140 393
1051 iso_pu_bacteria 8056382006 8056383145 393
1052 3300002987 JGI25159J45721_1000355 JGI25159J45721_10003554 394
1053 3300003354 JGI25160J50197_1000014 JGI25160J50197_1000014151 394
1054 3300003374 JGI25161J50226_1000022 JGI25161J50226_100002251 394
1055 3300004625 Ga0055543_1000005 Ga0055543_100000582 394
1056 3300005262 Ga0065165_1002159 Ga0065165_10021596 394
1057 3300025284 Ga0209130_1000013 Ga0209130_1000013299 394
1058 3300025302 Ga0207426_1000022 Ga0207426_100002282 394
1059 3300028794 Ga0307515_10002600 Ga0307515_1000260024 394
1060 3300037471 Ga0395905_0000328 Ga0395905_0000328_54560_55771 394
1061 3300037471 Ga0395905_0011883 Ga0395905_0011883_6215_7426 394
1062 3300041413 Ga0439465_0029020 Ga0439465_0029020_265_1476 394
1063 3300046460 Ga0495638_0013192 Ga0495638_0013192_3369_4580 394
1064 3300046460 Ga0495638_0042009 Ga0495638_0042009_319_1530 394
1065 3300053088 Ga0500644_0001795 Ga0500644_0001795_1348_2583 394
1066 3300053140 Ga0500573_0000205 Ga0500573_0000205_18524_19735 394
1067 3300053156 Ga0500622_0000375 Ga0500622_0000375_24306_25541 394
1068 3300005331 Ga0070670_100000196 Ga0070670_1000001962 396
1069 3300025925 Ga0207650_10001547 Ga0207650_100015477 396
1070 3300046674 Ga0495588_0022710 Ga0495588_0022710_1529_2743 396
1071 3300046809 Ga0495600_0006330 Ga0495600_0006330_5926_7140 396
1072 3300001979 JGI24740J21852_10000443 JGI24740J21852_1000044314 397
1073 3300002704 JGI25155J39150_1000020 JGI25155J39150_1000020134 397
1074 3300002705 JGI25156J39149_1000021 JGI25156J39149_100002115 397
1075 3300002737 JGI25162J39368_1001310 JGI25162J39368_100131010 397
1076 3300002737 JGI25162J39368_1001352 JGI25162J39368_10013527 397
1077 3300002738 JGI25154J39366_1000039 JGI25154J39366_1000039134 397
1078 3300002741 JGI25157J39369_1000019 JGI25157J39369_100001915 397
1079 3300003214 JGI25165J46597_1000018 JGI25165J46597_1000018274 397
1080 3300003320 rootH2_10051486 rootH2_100514864 397
1081 3300003322 rootL2_10024477 rootL2_1002447711 397
1082 3300003323 rootH1_10019293 rootH1_100192935 397
1083 3300005548 Ga0070665_100016171 Ga0070665_1000161713 397
1084 3300005578 Ga0068854_100046058 Ga0068854_1000460582 397
1085 3300005614 Ga0068856_100002393 Ga0068856_10000239310 397
1086 3300009093 Ga0105240_10000012 Ga0105240_1000001255 397
1087 3300009148 Ga0105243_10049327 Ga0105243_100493271 397
1088 3300009545 Ga0105237_10000165 Ga0105237_1000016566 397
1089 3300010375 Ga0105239_10000471 Ga0105239_1000047149 397
1090 3300015262 Ga0182007_10001911 Ga0182007_100019115 397
1091 3300015265 Ga0182005_1004906 Ga0182005_10049063 397
1092 3300025206 Ga0209435_100025 Ga0209435_100025154 397
1093 3300025228 Ga0209672_103402 Ga0209672_1034022 397
1094 3300025233 Ga0209437_100022 Ga0209437_100022335 397
1095 3300025246 Ga0209646_1000083 Ga0209646_1000083154 397
1096 3300025246 Ga0209646_1009483 Ga0209646_10094831 397
1097 3300025250 Ga0209026_1000078 Ga0209026_1000078154 397
1098 3300025253 Ga0209677_101094 Ga0209677_1010945 397
1099 3300025256 Ga0209759_1000060 Ga0209759_1000060154 397
1100 3300025261 Ga0209233_1000031 Ga0209233_1000031335 397
1101 3300025261 Ga0209233_1000146 Ga0209233_1000146157 397
1102 3300025913 Ga0207695_10000120 Ga0207695_10000120159 397
1103 3300025914 Ga0207671_10000513 Ga0207671_1000051317 397
1104 3300025949 Ga0207667_10078680 Ga0207667_100786803 397
1105 3300025981 Ga0207640_10076312 Ga0207640_100763122 397
1106 3300026078 Ga0207702_10004200 Ga0207702_100042009 397
1107 3300028379 Ga0268266_10033187 Ga0268266_100331873 397
1108 3300044694 Ga0466963_0021163 Ga0466963_0021163_1530_2744 397
1109 3300044765 Ga0466970_0003638 Ga0466970_0003638_1426_2640 397
1110 3300045049 Ga0466959_0042555 Ga0466959_0042555_251_1465 397
1111 3300048906 Ga0496103_0052532 Ga0496103_0052532_1285_2499 397
1112 3300048919 Ga0496116_0050617 Ga0496116_0050617_1511_2725 397
1113 3300048920 Ga0496117_0006651 Ga0496117_0006651_9156_10370 397
1114 3300048921 Ga0496118_0008203 Ga0496118_0008203_3030_4244 397
1115 3300048923 Ga0496120_0005272 Ga0496120_0005272_1557_2771 397
1116 3300048924 Ga0496121_0034063 Ga0496121_0034063_232_1446 397
1117 3300048925 Ga0496122_0057834 Ga0496122_0057834_672_1886 397
1118 3300048927 Ga0496124_0010057 Ga0496124_0010057_1351_2565 397
1119 3300048928 Ga0496125_0013088 Ga0496125_0013088_3630_4844 397

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04101

Glyco_tran_28_C

Glycosyltransferase family 28 C-terminal domain

278

432

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kqx-assembly1.cif.gz_A crystal structure of yijc from b. subtilis in complex with udp 0.7089 8 382
6kqx-assembly1.cif.gz_A crystal structure of yijc from b. subtilis in complex with udp 0.7032 8 382
1v4v-assembly1.cif.gz_B crystal structure of udp-n-acetylglucosamine 2-epimerase from thermus thermophilus hb8 0.6954 8 382
6kqw-assembly1.cif.gz_A crystal structure of yijc from b. subtilis 0.6865 9 383
8h5d-assembly1.cif.gz_A crystal structure of yojk mutant in complex with udp 0.679 8 386
ID Description Score Start End Superfamily
af_A0A0R0EAS2_219_318_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8014 245 330 3.40.50.2000
af_K7L509_198_322_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7413 247 377 3.40.50.2000
af_A0A2R8QIE5_80_195_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7375 284 375 3.40.50.2000
af_Q9NP73_1_149_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7317 217 337 3.40.50.2000
2iyaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.73 215 379 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A3C0MCC4-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.9824 9 129
AF-A0A530H7J9-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.9687 1 368 GO:0016758
AF-A0A060CAV2-F1-model_v4 CAZy families GT1 protein 0.9664 3 144
AF-A0A537QKW0-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.9648 34 384 GO:0016758
AF-A0A522S9P9-F1-model_v4 Glycosyl transferase 0.9636 12 149

Feature Viewer

pLDDT pTM Quality
87.55 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map