F490308

General Info

Members Datasets Scaffolds Average Seq Length
1116 505 861 316

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10018217|Ga0316575_100182173
Length 303
Sequence VLFAGTPEFALPALQTLIGSACDIVAVLTQPDRPAGRGKQLRASPVKQLALENGLEVLQPESLKDTGWQEKLAALRPDLMVVVAYGLMIPSWLLDLPPHGCWNIHASLLPRWRGAAPIQRAIEAGDAQTGVCIMQIEPKLDTGPVYQCLATPIEPDDTAGSLHDRLSGLGARALRNCLDMLAANTLPAPVAQDDSRAVYAAKLSKAEAQLDWNLPAAVLERRVRAFNPWPVAWCEMNGERVRIWKAGVADDAGDCKPGELYAGRRLLLVGTADKALKILELQRPGGQRMTAEQYLNALHSQAS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231008 Pseudomonas sp. GM21 Isolate Nodule
10 2511231010 Pseudomonas sp. GM25 Isolate Nodule
11 2511231011 Pseudomonas sp. GM30 Isolate Nodule
12 2511231012 Pseudomonas sp. GM33 Isolate Nodule
13 2511231014 Pseudomonas sp. GM48 Isolate Nodule
14 2511231015 Pseudomonas sp. GM49 Isolate Nodule
15 2511231016 Pseudomonas sp. GM50 Isolate Nodule
16 2511231017 Pseudomonas sp. GM55 Isolate Nodule
17 2511231018 Pseudomonas sp. GM60 Isolate Nodule
18 2511231019 Pseudomonas sp. GM67 Isolate Nodule
19 2511231020 Pseudomonas sp. GM74 Isolate Nodule
20 2511231021 Pseudomonas sp. GM78 Isolate Nodule
21 2511231022 Pseudomonas sp. GM79 Isolate Nodule
22 2511231023 Pseudomonas sp. GM80 Isolate Nodule
23 2511231024 Pseudomonas sp. GM84 Isolate Nodule
24 2511231031 Pseudomonas sp. GM16 Isolate Nodule
25 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
26 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
27 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
28 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
29 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
30 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
31 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
32 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
33 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
34 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
35 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
36 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
37 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
38 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
39 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
40 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
41 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
42 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
43 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
44 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
45 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
46 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
47 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
48 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
49 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
50 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
51 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
52 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
53 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
54 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
55 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
56 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
57 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
58 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
59 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
60 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
61 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
62 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
63 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
64 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
65 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
66 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
67 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
68 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
69 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
70 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
71 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
72 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
73 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
74 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
75 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
76 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
77 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
78 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
79 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
80 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
81 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
82 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
83 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
84 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
85 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
86 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
87 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
88 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
89 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
90 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
91 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
92 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
93 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
94 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
95 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
96 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
97 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
98 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
99 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
100 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
101 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
102 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
103 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
104 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
105 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
106 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
107 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
108 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
109 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
110 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
111 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
112 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
113 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
114 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
115 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
116 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
117 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
118 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
119 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
120 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
121 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
122 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
123 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
124 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
125 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
126 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
127 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
128 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
129 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
130 2765235841 Pseudomonas putida AA7 Isolate Unclassified
131 2773857670 Pseudomonas sp. 478 Isolate Unclassified
132 2784132063 Pseudomonas sp. 424 Isolate Unclassified
133 2784132072 Pseudomonas sp. 460 Isolate Unclassified
134 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
135 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
136 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
137 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
138 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
139 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
140 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
141 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
142 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
143 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
144 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
145 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
146 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
147 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
148 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
149 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
150 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
151 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
152 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
153 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
154 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
155 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
156 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
157 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
158 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
159 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
160 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
161 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
162 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
163 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
164 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
165 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
166 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
167 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
168 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
169 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
170 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
171 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
172 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
173 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
174 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
175 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
176 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
177 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
178 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
179 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
180 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
181 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
182 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
183 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
184 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
185 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
186 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
187 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
188 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
189 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
190 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
191 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
192 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
193 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
194 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
195 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
196 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
197 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
198 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
199 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
200 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
201 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
202 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
203 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
204 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
205 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
206 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
207 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
208 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
209 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
210 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
211 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
212 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
213 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
214 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
215 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
216 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
217 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
218 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
219 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
220 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
221 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
222 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
223 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
224 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
225 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
226 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
227 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
228 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
229 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
230 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
231 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
232 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
233 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
234 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
235 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
236 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
237 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
238 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
239 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
240 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
241 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
242 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
243 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
244 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
245 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
246 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
247 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
248 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
249 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
250 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
251 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
252 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
253 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
254 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
255 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
256 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
257 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
258 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
259 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
260 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
261 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
262 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
263 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
264 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
265 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
266 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
267 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
268 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
269 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
270 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
271 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
272 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
273 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
274 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
275 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
276 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
277 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
278 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
279 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
280 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
281 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
282 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
288 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
289 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
291 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
293 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
294 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
314 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
315 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
322 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
324 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
325 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
326 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
327 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
328 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
329 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
330 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
331 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
332 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
333 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
334 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
335 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
336 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
337 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
338 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
339 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
340 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
341 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
342 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
343 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
344 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
345 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
346 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
347 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
348 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
349 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
350 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
351 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
352 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
353 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
354 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
355 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
356 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
357 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
358 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
359 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
360 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
361 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
362 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
363 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
364 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
365 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
366 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
367 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
368 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
369 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
370 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
371 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
372 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
373 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
374 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
375 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
376 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
377 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
378 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
379 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
380 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
381 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
382 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
383 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
384 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
385 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
386 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
387 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
388 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
389 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
390 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
391 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
392 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
393 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
394 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
395 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
396 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
397 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
398 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
399 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
400 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
401 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
402 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
403 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
404 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
405 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
406 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
407 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
408 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
409 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
410 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
411 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
412 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
413 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
414 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
415 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
416 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
417 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
418 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
419 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
420 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
421 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
422 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
423 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
424 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
425 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
426 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
427 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
428 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
429 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
430 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
431 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
432 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
433 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
434 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
435 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
436 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
437 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
438 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
439 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
440 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
441 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
442 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
443 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
444 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
445 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
446 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
447 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
448 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
449 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
450 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
451 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
452 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
453 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
454 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
455 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
456 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
457 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
458 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
459 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
460 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
461 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
462 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
463 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
464 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
465 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
466 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
470 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
471 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
472 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
473 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
474 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
475 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
476 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
477 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
478 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
479 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
480 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
481 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
482 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
483 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
484 8052494512 Pseudomonas putida LD6 Isolate Unclassified
485 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
486 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
487 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
488 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
489 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
490 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
491 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
492 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
493 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
494 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
495 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
496 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
497 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
498 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
499 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
500 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
501 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
502 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
503 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
504 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
505 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.15
Metatranscriptomes 0
Isolates 22.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 5.38
Nodule 2.51
Rhizoplane 6.81
Rhizosphere 71.51
Stem 0
Stem Tuber 0
Unclassified 13.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_61 2124908027 Bacteria 51169
2 SwRhRL2b_contig_2749780 2162886007 Bacteria 1665
3 JGI24741J21665_1002934 3300001915 Bacteria 4262
4 JGI25164J39214_1000175 3300002772 Bacteria 59290
5 JGI25164J39214_1000357 3300002772 Bacteria 28322
6 JGI25165J46597_1000175 3300003214 Bacteria 100117
7 JGI25165J46597_1000193 3300003214 Bacteria 91069
8 Ga0055538_1000012 3300003751 Bacteria 353826
9 Ga0055539_1000017 3300003752 Bacteria 353873
10 Ga0055533_1000021 3300003756 Bacteria 353826
11 Ga0055532_1000020 3300003758 Bacteria 270853
12 Ga0055525_1000117 3300003759 Bacteria 120690
13 Ga0055536_1000547 3300003781 Bacteria 25802
14 Ga0055536_1000593 3300003781 Bacteria 24687
15 Ga0055536_1005739 3300003781 Bacteria 5980
16 Ga0055536_1020865 3300003781 Bacteria 2008
17 Ga0055530_10000081 3300003791 Bacteria 82192
18 Ga0055530_10000159 3300003791 Bacteria 61131
19 Ga0055530_10003552 3300003791 Bacteria 8783
20 Ga0055540_1000121 3300003792 Bacteria 82192
21 Ga0055540_1000242 3300003792 Bacteria 49989
22 Ga0055540_1001117 3300003792 Bacteria 16893
23 Ga0055531_10001857 3300003794 Bacteria 14840
24 Ga0055541_1000012 3300003841 Bacteria 353826
25 Ga0058692_1003282 3300003856 Bacteria 5054
26 Ga0065714_10002471 3300005288 Bacteria 16560
27 Ga0065714_10066068 3300005288 Bacteria 7696
28 Ga0065714_10066935 3300005288 Bacteria 6080
29 Ga0065714_10067254 3300005288 Bacteria 5732
30 Ga0065714_10067959 3300005288 Bacteria 5074
31 Ga0065714_10074006 3300005288 Bacteria 3095
32 Ga0065714_10086380 3300005288 Bacteria 2101
33 Ga0065712_10000160 3300005290 Bacteria 33313
34 Ga0065712_10002851 3300005290 Bacteria 5047
35 Ga0065712_10071587 3300005290 Bacteria 5170
36 Ga0065715_10008286 3300005293 Bacteria 3239
37 Ga0070670_100017009 3300005331 Bacteria 6241
38 Ga0070670_100046495 3300005331 Bacteria 3732
39 Ga0070661_100002052 3300005344 Bacteria 13882
40 Ga0070661_100066694 3300005344 Bacteria 2644
41 Ga0070669_100000153 3300005353 Bacteria 62355
42 Ga0070669_100000158 3300005353 Bacteria 61318
43 Ga0070662_100000562 3300005457 Bacteria 22575
44 Ga0068853_100000040 3300005539 Bacteria 105702
45 Ga0070665_100106751 3300005548 Bacteria 2802
46 Ga0070665_100189889 3300005548 Bacteria 2055
47 Ga0070665_100320364 3300005548 Bacteria 1554
48 Ga0070664_100000049 3300005564 Bacteria 71805
49 Ga0070664_100014744 3300005564 Bacteria 6382
50 Ga0068854_100002019 3300005578 Bacteria 12425
51 Ga0068851_10000018 3300005834 Bacteria 137425
52 Ga0075364_10037035 3300006051 Bacteria 3156
53 Ga0075364_10074915 3300006051 Bacteria 2232
54 Ga0075364_10083028 3300006051 Bacteria 2120
55 Ga0075432_10008138 3300006058 Bacteria 3576
56 Ga0075432_10036464 3300006058 Bacteria 1709
57 Ga0099823_1001433 3300006944 Bacteria 19711
58 Ga0099823_1017745 3300006944 Bacteria 6911
59 Ga0079104_1000291 3300006946 Bacteria 63569
60 Ga0079104_1000306 3300006946 Bacteria 62131
61 Ga0079104_1011461 3300006946 Bacteria 2849
62 Ga0105251_10000033 3300009011 Bacteria 118905
63 Ga0105251_10000995 3300009011 Bacteria 24850
64 Ga0105251_10002417 3300009011 Bacteria 14720
65 Ga0105251_10008537 3300009011 Bacteria 6147
66 Ga0105251_10019139 3300009011 Bacteria 3624
67 Ga0105251_10034316 3300009011 Bacteria 2512
68 Ga0105251_10060428 3300009011 Bacteria 1784
69 Ga0105244_10000186 3300009036 Bacteria 63278
70 Ga0105244_10001163 3300009036 Bacteria 21788
71 Ga0105244_10006161 3300009036 Bacteria 7824
72 Ga0105244_10010196 3300009036 Bacteria 5707
73 Ga0105244_10011507 3300009036 Bacteria 5298
74 Ga0105244_10012125 3300009036 Bacteria 5117
75 Ga0105244_10023068 3300009036 Bacteria 3419
76 Ga0105244_10029512 3300009036 Bacteria 2930
77 Ga0105244_10061702 3300009036 Bacteria 1886
78 Ga0105244_10074675 3300009036 Bacteria 1686
79 Ga0105244_10077413 3300009036 Bacteria 1650
80 Ga0105244_10094355 3300009036 Bacteria 1469
81 Ga0105250_10000203 3300009092 Bacteria 50306
82 Ga0105250_10000550 3300009092 Bacteria 25618
83 Ga0105250_10005762 3300009092 Bacteria 5513
84 Ga0105250_10016036 3300009092 Bacteria 3058
85 Ga0105250_10018938 3300009092 Bacteria 2784
86 Ga0105243_10000075 3300009148 Bacteria 112098
87 Ga0105243_10006258 3300009148 Bacteria 9197
88 Ga0105243_10008082 3300009148 Bacteria 8075
89 Ga0105243_10012797 3300009148 Bacteria 6337
90 Ga0105243_10012953 3300009148 Bacteria 6301
91 Ga0105243_10016614 3300009148 Bacteria 5565
92 Ga0105243_10024895 3300009148 Bacteria 4569
93 Ga0105243_10027788 3300009148 Bacteria 4338
94 Ga0105241_10293162 3300009174 Bacteria 1393
95 Ga0105242_10003444 3300009176 Bacteria 12294
96 Ga0105237_10015442 3300009545 Bacteria 7948
97 Ga0105246_10000322 3300011119 Bacteria 25369
98 Ga0105246_10002463 3300011119 Bacteria 11182
99 Ga0105246_10027386 3300011119 Bacteria 3733
100 Ga0157336_1000242 3300012477 Bacteria 2406
101 Ga0157337_1000089 3300012483 Bacteria 3954
102 Ga0157345_1000342 3300012498 Bacteria 5507
103 Ga0157373_10006572 3300013100 Bacteria 8672
104 Ga0157373_10011243 3300013100 Bacteria 6586
105 Ga0157373_10015430 3300013100 Bacteria 5585
106 Ga0157373_10015802 3300013100 Bacteria 5510
107 Ga0157371_10000226 3300013102 Bacteria 82385
108 Ga0157371_10012722 3300013102 Bacteria 6415
109 Ga0157371_10014325 3300013102 Bacteria 5989
110 Ga0157370_10003131 3300013104 Bacteria 19584
111 Ga0157370_10023845 3300013104 Bacteria 6069
112 Ga0157370_10068026 3300013104 Bacteria 3366
113 Ga0157370_10094400 3300013104 Bacteria 2806
114 Ga0157370_10133309 3300013104 Bacteria 2317
115 Ga0157369_10033496 3300013105 Bacteria 5645
116 Ga0157369_10114866 3300013105 Bacteria 2859
117 Ga0157369_10154159 3300013105 Bacteria 2427
118 Ga0163162_10001329 3300013306 Bacteria 23079
119 Ga0157372_10018101 3300013307 Bacteria 7572
120 Ga0157372_10028093 3300013307 Bacteria 6136
121 Ga0157375_10024624 3300013308 Bacteria 5574
122 Ga0182008_10000938 3300014497 Bacteria 20315
123 Ga0182008_10003949 3300014497 Bacteria 8773
124 Ga0182008_10008674 3300014497 Bacteria 5532
125 Ga0182008_10013327 3300014497 Bacteria 4323
126 Ga0182008_10018729 3300014497 Bacteria 3583
127 Ga0182008_10022978 3300014497 Bacteria 3190
128 Ga0182008_10038337 3300014497 Bacteria 2396
129 Ga0182008_10086859 3300014497 Bacteria 1540
130 Ga0182008_10103811 3300014497 Bacteria 1406
131 Ga0182006_1004750 3300015261 Bacteria 6633
132 Ga0182006_1005425 3300015261 Bacteria 6085
133 Ga0182006_1005564 3300015261 Bacteria 5988
134 Ga0182006_1009327 3300015261 Bacteria 4401
135 Ga0182006_1049907 3300015261 Bacteria 1614
136 Ga0182006_1062526 3300015261 Bacteria 1400
137 Ga0182007_10004678 3300015262 Bacteria 6174
138 Ga0182005_1002872 3300015265 Bacteria 5995
139 Ga0182005_1010661 3300015265 Bacteria 2638
140 Ga0182005_1013258 3300015265 Bacteria 2319
141 Ga0163161_10134235 3300017792 Bacteria 1869
142 Ga0163161_10146361 3300017792 Bacteria 1792
143 Ga0163161_10211279 3300017792 Bacteria 1499
144 Ga0163161_10277264 3300017792 Bacteria 1314
145 Ga0209435_101310 3300025206 Bacteria 3245
146 Ga0209760_100020 3300025207 Bacteria 169879
147 Ga0209760_100169 3300025207 Bacteria 37738
148 Ga0209784_100007 3300025224 Bacteria 747715
149 Ga0209566_100009 3300025225 Bacteria 554018
150 Ga0209674_100021 3300025226 Bacteria 629811
151 Ga0209147_100009 3300025229 Bacteria 747409
152 Ga0209563_100018 3300025230 Bacteria 747850
153 Ga0207427_100005 3300025231 Bacteria 797999
154 Ga0207427_100006 3300025231 Bacteria 785415
155 Ga0209437_100013 3300025233 Bacteria 785457
156 Ga0209437_100018 3300025233 Bacteria 694400
157 Ga0209258_100237 3300025242 Bacteria 102220
158 Ga0209646_1000234 3300025246 Bacteria 57682
159 Ga0209677_100012 3300025253 Bacteria 554018
160 Ga0209233_1000021 3300025261 Bacteria 798078
161 Ga0209233_1000022 3300025261 Bacteria 785415
162 Ga0209675_1005173 3300025291 Bacteria 5542
163 Ga0209676_1000015 3300025292 Bacteria 784458
164 Ga0209676_1000157 3300025292 Bacteria 163094
165 Ga0209676_1000222 3300025292 Bacteria 124695
166 Ga0209676_1000242 3300025292 Bacteria 117224
167 Ga0209676_1000583 3300025292 Bacteria 54696
168 Ga0209676_1002004 3300025292 Bacteria 16080
169 Ga0209050_1000030 3300025298 Bacteria 463381
170 Ga0209050_1000061 3300025298 Bacteria 321435
171 Ga0209050_1000296 3300025298 Bacteria 104732
172 Ga0209050_1005565 3300025298 Bacteria 7840
173 Ga0209051_1000088 3300025303 Bacteria 180480
174 Ga0209051_1000143 3300025303 Bacteria 135182
175 Ga0209051_1000487 3300025303 Bacteria 51194
176 Ga0209051_1006284 3300025303 Bacteria 6732
177 Ga0209257_1000143 3300025304 Bacteria 199975
178 Ga0209257_1027342 3300025304 Bacteria 1901
179 Ga0207656_10000009 3300025321 Bacteria 245637
180 Ga0207696_1000055 3300025711 Bacteria 258289
181 Ga0207696_1000127 3300025711 Bacteria 135531
182 Ga0207696_1000151 3300025711 Bacteria 120171
183 Ga0207696_1000165 3300025711 Bacteria 104683
184 Ga0207696_1001549 3300025711 Bacteria 12278
185 Ga0207696_1003732 3300025711 Bacteria 6810
186 Ga0207696_1004751 3300025711 Bacteria 5781
187 Ga0207696_1013295 3300025711 Bacteria 2875
188 Ga0207696_1017423 3300025711 Bacteria 2380
189 Ga0207696_1021743 3300025711 Bacteria 2050
190 Ga0207655_1000135 3300025728 Bacteria 143597
191 Ga0207655_1000348 3300025728 Bacteria 67077
192 Ga0207655_1000603 3300025728 Bacteria 43527
193 Ga0207655_1000652 3300025728 Bacteria 41403
194 Ga0207655_1000662 3300025728 Bacteria 40724
195 Ga0207655_1001765 3300025728 Bacteria 18889
196 Ga0207655_1006522 3300025728 Bacteria 7715
197 Ga0207655_1007418 3300025728 Bacteria 7113
198 Ga0207655_1010161 3300025728 Bacteria 5745
199 Ga0207655_1045398 3300025728 Bacteria 1835
200 Ga0207655_1049995 3300025728 Bacteria 1702
201 Ga0207713_1000103 3300025735 Bacteria 138415
202 Ga0207713_1000126 3300025735 Bacteria 118913
203 Ga0207713_1000692 3300025735 Bacteria 31614
204 Ga0207713_1000735 3300025735 Bacteria 30569
205 Ga0207713_1002220 3300025735 Bacteria 14390
206 Ga0207713_1002937 3300025735 Bacteria 11920
207 Ga0207713_1003840 3300025735 Bacteria 10043
208 Ga0207713_1003859 3300025735 Bacteria 9999
209 Ga0207713_1003907 3300025735 Bacteria 9920
210 Ga0207713_1009074 3300025735 Bacteria 5649
211 Ga0207713_1009075 3300025735 Bacteria 5649
212 Ga0207713_1011679 3300025735 Bacteria 4753
213 Ga0207713_1012398 3300025735 Bacteria 4563
214 Ga0207713_1015569 3300025735 Bacteria 3896
215 Ga0207713_1019564 3300025735 Bacteria 3306
216 Ga0207713_1025943 3300025735 Bacteria 2695
217 Ga0207713_1030420 3300025735 Bacteria 2404
218 Ga0207713_1088745 3300025735 Bacteria 1092
219 Ga0207671_10000027 3300025914 Bacteria 264907
220 Ga0207649_10000007 3300025920 Bacteria 334217
221 Ga0207681_10000488 3300025923 Bacteria 27801
222 Ga0207681_10001509 3300025923 Bacteria 15021
223 Ga0207650_10000178 3300025925 Bacteria 74821
224 Ga0207650_10000210 3300025925 Bacteria 66574
225 Ga0207706_10000050 3300025933 Bacteria 116811
226 Ga0207706_10001275 3300025933 Bacteria 25420
227 Ga0207686_10010242 3300025934 Bacteria 5100
228 Ga0207709_10000107 3300025935 Bacteria 129240
229 Ga0207709_10000269 3300025935 Bacteria 61223
230 Ga0207709_10002112 3300025935 Bacteria 12786
231 Ga0207709_10051282 3300025935 Bacteria 2529
232 Ga0207709_10055190 3300025935 Bacteria 2453
233 Ga0207709_10074275 3300025935 Bacteria 2169
234 Ga0207709_10129988 3300025935 Bacteria 1715
235 Ga0207679_10000013 3300025945 Bacteria 334197
236 Ga0207712_10007685 3300025961 Bacteria 6817
237 Ga0207640_10009942 3300025981 Bacteria 5343
238 Ga0207639_10001234 3300026041 Bacteria 17314
239 Ga0209281_1000091 3300027111 Bacteria 242588
240 Ga0209281_1000237 3300027111 Bacteria 112688
241 Ga0209389_1000065 3300027296 Bacteria 102064
242 Ga0209371_1000231 3300027312 Bacteria 71359
243 Ga0209371_1000445 3300027312 Bacteria 41588
244 Ga0209969_1003756 3300027360 Bacteria 2105
245 Ga0209981_1003805 3300027378 Bacteria 1965
246 Ga0209996_1004309 3300027395 Bacteria 1808
247 Ga0209999_1005748 3300027543 Bacteria 2232
248 Ga0209982_1004394 3300027552 Bacteria 2017
249 Ga0207428_10042158 3300027907 Bacteria 3692
250 Ga0207428_10043727 3300027907 Bacteria 3616
251 Ga0268266_10003207 3300028379 Bacteria 16549
252 Ga0268266_10157208 3300028379 Bacteria 2054
253 Ga0268266_10572784 3300028379 Bacteria 1083
254 Ga0307517_10032796 3300028786 Bacteria 5989
255 Ga0268256_1000192 3300030500 Bacteria 71359
256 Ga0268256_1000402 3300030500 Bacteria 39342
257 Ga0307511_10024751 3300030521 Bacteria 5553
258 Ga0307511_10068194 3300030521 Bacteria 2630
259 Ga0316177_1089383 3300030731 Bacteria 2008
260 Ga0316179_1069431 3300030734 Bacteria 1932
261 Ga0316178_1080449 3300030735 Bacteria 31707
262 Ga0316183_1089988 3300030742 Bacteria 1768
263 Ga0316183_1121923 3300030742 Bacteria 2900
264 Ga0316183_1199248 3300030742 Bacteria 1594
265 Ga0316181_1110545 3300030744 Bacteria 2151
266 Ga0307513_10010765 3300031456 Bacteria 11429
267 Ga0307509_10066245 3300031507 Bacteria 3790
268 Ga0307408_100014056 3300031548 Bacteria 5318
269 Ga0307408_100055360 3300031548 Bacteria 2872
270 Ga0307408_100087097 3300031548 Bacteria 2349
271 Ga0307408_100274335 3300031548 Bacteria 1401
272 Ga0316575_10018217 3300031665 Bacteria 2675
273 Ga0307405_10025032 3300031731 Bacteria 3420
274 Ga0307405_10049058 3300031731 Bacteria 2607
275 Ga0307413_10014349 3300031824 Bacteria 4020
276 Ga0307407_10124207 3300031903 Bacteria 1641
277 Ga0307412_10059225 3300031911 Bacteria 2565
278 Ga0307412_10455015 3300031911 Bacteria 1055
279 Ga0307409_100008613 3300031995 Bacteria 6203
280 Ga0307409_100010758 3300031995 Bacteria 5715
281 Ga0307416_100248799 3300032002 Bacteria 1728
282 Ga0307416_100477053 3300032002 Bacteria 1306
283 Ga0307414_10170457 3300032004 Bacteria 1739
284 Ga0307411_10255064 3300032005 Bacteria 1381
285 Ga0307510_10033908 3300033180 Bacteria 5725
286 Ga0316584_0083827 3300036712 Bacteria 2387
287 Ga0316584_0084182 3300036712 Bacteria 2382
288 Ga0439436_0005819 3300041404 Bacteria 3778
289 Ga0439438_000296 3300041405 Bacteria 22341
290 Ga0439438_000440 3300041405 Bacteria 18928
291 Ga0439438_001725 3300041405 Bacteria 9624
292 Ga0439438_003887 3300041405 Bacteria 5885
293 Ga0439438_008515 3300041405 Bacteria 3393
294 Ga0439438_009972 3300041405 Bacteria 3040
295 Ga0439438_011123 3300041405 Bacteria 2817
296 Ga0439438_015415 3300041405 Bacteria 2249
297 Ga0439447_000380 3300041407 Bacteria 16186
298 Ga0439447_000690 3300041407 Bacteria 12516
299 Ga0439447_001108 3300041407 Bacteria 9772
300 Ga0439447_003266 3300041407 Bacteria 5765
301 Ga0439447_004722 3300041407 Bacteria 4643
302 Ga0439447_038304 3300041407 Bacteria 1178
303 Ga0439466_0000240 3300041411 Bacteria 21440
304 Ga0439466_0002174 3300041411 Bacteria 7689
305 Ga0439466_0002581 3300041411 Bacteria 7093
306 Ga0439466_0002774 3300041411 Bacteria 6854
307 Ga0439466_0003780 3300041411 Bacteria 5848
308 Ga0439466_0003898 3300041411 Bacteria 5758
309 Ga0439466_0004111 3300041411 Bacteria 5620
310 Ga0439466_0008138 3300041411 Bacteria 3952
311 Ga0439466_0011670 3300041411 Bacteria 3247
312 Ga0439431_0008263 3300041997 Bacteria 2336
313 Ga0439437_005172 3300042000 Bacteria 1433
314 Ga0439432_001415 3300042006 Bacteria 9031
315 Ga0439432_003836 3300042006 Bacteria 5543
316 Ga0439432_004227 3300042006 Bacteria 5251
317 Ga0439432_007970 3300042006 Bacteria 3735
318 Ga0439432_008448 3300042006 Bacteria 3615
319 Ga0439432_014077 3300042006 Bacteria 2710
320 Ga0439432_029655 3300042006 Bacteria 1777
321 Ga0439432_032063 3300042006 Bacteria 1696
322 Ga0439432_054155 3300042006 Bacteria 1246
323 Ga0439452_000190 3300042010 Bacteria 45505
324 Ga0439452_001782 3300042010 Bacteria 8392
325 Ga0439452_002240 3300042010 Bacteria 7252
326 Ga0439452_002643 3300042010 Bacteria 6526
327 Ga0439452_002983 3300042010 Bacteria 6016
328 Ga0439452_003229 3300042010 Bacteria 5766
329 Ga0439452_007923 3300042010 Bacteria 3219
330 Ga0439452_010851 3300042010 Bacteria 2635
331 Ga0439455_0004409 3300042012 Bacteria 2787
332 Ga0439456_000021 3300042013 Bacteria 60440
333 Ga0439456_001799 3300042013 Bacteria 4325
334 Ga0439456_009110 3300042013 Bacteria 2051
335 Ga0439456_009135 3300042013 Bacteria 2047
336 Ga0439456_017369 3300042013 Bacteria 1508
337 Ga0439456_030367 3300042013 Bacteria 1156
338 Ga0439463_000264 3300042016 Bacteria 14461
339 Ga0439463_000940 3300042016 Bacteria 8001
340 Ga0439463_007878 3300042016 Bacteria 2630
341 Ga0439463_013062 3300042016 Bacteria 2042
342 Ga0450911_000055 3300042115 Bacteria 47324
343 Ga0450911_000211 3300042115 Bacteria 22807
344 Ga0450911_002007 3300042115 Bacteria 4225
345 Ga0450911_003352 3300042115 Bacteria 2847
346 Ga0450919_000953 3300042121 Bacteria 3746
347 Ga0450922_001398 3300042124 Bacteria 2374
348 Ga0450900_002909 3300042136 Bacteria 1860
349 Ga0450900_006123 3300042136 Bacteria 1446
350 Ga0450902_002249 3300042137 Bacteria 2727
351 Ga0450902_006853 3300042137 Bacteria 1752
352 Ga0450903_002798 3300042138 Bacteria 3067
353 Ga0450903_005738 3300042138 Bacteria 2071
354 Ga0450903_009946 3300042138 Bacteria 1544
355 Ga0450904_000367 3300042139 Bacteria 9499
356 Ga0450905_000365 3300042142 Bacteria 5422
357 Ga0450906_000309 3300042145 Bacteria 9838
358 Ga0450906_004691 3300042145 Bacteria 2849
359 Ga0450907_000110 3300042146 Bacteria 31083
360 Ga0450907_004724 3300042146 Bacteria 2334
361 Ga0450910_000275 3300042147 Bacteria 5968
362 Ga0439446_0000079 3300042156 Bacteria 15851
363 Ga0439446_0006348 3300042156 Bacteria 3079
364 Ga0450908_002350 3300042184 Bacteria 3706
365 Ga0450909_001360 3300042185 Bacteria 3398
366 Ga0450909_008876 3300042185 Bacteria 1464
367 Ga0450909_016365 3300042185 Bacteria 1095
368 Ga0439434_0000244 3300042435 Bacteria 15200
369 Ga0439434_0007094 3300042435 Bacteria 3275
370 Ga0439464_0007532 3300042439 Bacteria 2847
371 Ga0439460_0005294 3300042461 Bacteria 3162
372 Ga0439460_0008161 3300042461 Bacteria 2640
373 Ga0450916_002327 3300042530 Bacteria 2009
374 Ga0450901_001714 3300042533 Bacteria 2472
375 Ga0439440_0002407 3300042993 Bacteria 3537
376 Ga0495617_001971 3300046452 Bacteria 8591
377 Ga0495617_004003 3300046452 Bacteria 5415
378 Ga0495617_021959 3300046452 Bacteria 2156
379 Ga0495627_000296 3300046453 Bacteria 49348
380 Ga0495627_000701 3300046453 Bacteria 25541
381 Ga0495627_001391 3300046453 Bacteria 14329
382 Ga0495627_005214 3300046453 Bacteria 5279
383 Ga0495627_012109 3300046453 Bacteria 3070
384 Ga0495627_016909 3300046453 Bacteria 2489
385 Ga0495603_0005896 3300046455 Bacteria 7322
386 Ga0495590_0003265 3300046457 Bacteria 6632
387 Ga0495590_0013086 3300046457 Bacteria 3059
388 Ga0495590_0020549 3300046457 Bacteria 2345
389 Ga0495590_0020958 3300046457 Bacteria 2319
390 Ga0495591_000164 3300046458 Bacteria 70760
391 Ga0495591_000898 3300046458 Bacteria 20804
392 Ga0495591_001277 3300046458 Bacteria 16078
393 Ga0495591_002623 3300046458 Bacteria 9854
394 Ga0495591_004987 3300046458 Bacteria 6277
395 Ga0495591_006161 3300046458 Bacteria 5370
396 Ga0495591_014256 3300046458 Bacteria 2867
397 Ga0495591_016129 3300046458 Bacteria 2614
398 Ga0495591_016982 3300046458 Bacteria 2512
399 Ga0495591_040625 3300046458 Bacteria 1324
400 Ga0495591_042448 3300046458 Bacteria 1285
401 Ga0495638_0010051 3300046460 Bacteria 6596
402 Ga0495638_0015178 3300046460 Bacteria 5179
403 Ga0495638_0017020 3300046460 Bacteria 4858
404 Ga0495638_0028413 3300046460 Bacteria 3612
405 Ga0495638_0037963 3300046460 Bacteria 3063
406 Ga0495638_0109997 3300046460 Bacteria 1637
407 Ga0495638_0134084 3300046460 Bacteria 1452
408 Ga0495638_0142909 3300046460 Bacteria 1394
409 Ga0495638_0151761 3300046460 Bacteria 1343
410 Ga0495653_0003789 3300046463 Bacteria 12234
411 Ga0495653_0003842 3300046463 Bacteria 12145
412 Ga0495653_0014723 3300046463 Bacteria 6379
413 Ga0495653_0038452 3300046463 Bacteria 3756
414 Ga0495653_0045733 3300046463 Bacteria 3393
415 Ga0495653_0061155 3300046463 Bacteria 2850
416 Ga0495650_0000402 3300046471 Bacteria 72128
417 Ga0495650_0006953 3300046471 Bacteria 6920
418 Ga0495650_0011360 3300046471 Bacteria 4886
419 Ga0495650_0025552 3300046471 Bacteria 2765
420 Ga0495650_0026977 3300046471 Bacteria 2661
421 Ga0495650_0038625 3300046471 Bacteria 2066
422 Ga0495650_0042643 3300046471 Bacteria 1930
423 Ga0495582_0007342 3300046473 Bacteria 6106
424 Ga0495605_0000101 3300046474 Bacteria 107469
425 Ga0495605_0000302 3300046474 Bacteria 53003
426 Ga0495605_0000971 3300046474 Bacteria 19484
427 Ga0495605_0002433 3300046474 Bacteria 11508
428 Ga0495605_0003182 3300046474 Bacteria 9859
429 Ga0495605_0003918 3300046474 Bacteria 8806
430 Ga0495605_0008090 3300046474 Bacteria 5949
431 Ga0495605_0095896 3300046474 Bacteria 1369
432 Ga0495639_0004372 3300046475 Bacteria 6056
433 Ga0495584_0001255 3300046491 Bacteria 15494
434 Ga0495584_0002779 3300046491 Bacteria 9779
435 Ga0495584_0005430 3300046491 Bacteria 6753
436 Ga0495584_0017033 3300046491 Bacteria 3703
437 Ga0495584_0021615 3300046491 Bacteria 3267
438 Ga0495584_0056697 3300046491 Bacteria 1972
439 Ga0495584_0092270 3300046491 Bacteria 1527
440 Ga0495585_0001285 3300046492 Bacteria 20022
441 Ga0495585_0002528 3300046492 Bacteria 13000
442 Ga0495585_0004778 3300046492 Bacteria 8716
443 Ga0495585_0014098 3300046492 Bacteria 4667
444 Ga0495585_0047442 3300046492 Bacteria 2392
445 Ga0495585_0049065 3300046492 Bacteria 2346
446 Ga0495585_0053795 3300046492 Bacteria 2227
447 Ga0495585_0145721 3300046492 Bacteria 1237
448 Ga0495594_0035244 3300046499 Bacteria 2725
449 Ga0495596_0000175 3300046500 Bacteria 44764
450 Ga0495596_0066402 3300046500 Bacteria 1403
451 Ga0495607_0000268 3300046501 Bacteria 55932
452 Ga0495607_0000365 3300046501 Bacteria 46525
453 Ga0495607_0005597 3300046501 Bacteria 8960
454 Ga0495607_0005788 3300046501 Bacteria 8793
455 Ga0495607_0007200 3300046501 Bacteria 7724
456 Ga0495607_0010681 3300046501 Bacteria 6154
457 Ga0495607_0011810 3300046501 Bacteria 5791
458 Ga0495607_0013345 3300046501 Bacteria 5386
459 Ga0495607_0013669 3300046501 Bacteria 5309
460 Ga0495607_0030494 3300046501 Bacteria 3310
461 Ga0495607_0044080 3300046501 Bacteria 2632
462 Ga0495607_0125063 3300046501 Bacteria 1345
463 Ga0495607_0171712 3300046501 Bacteria 1094
464 Ga0495583_0000300 3300046506 Bacteria 78677
465 Ga0495583_0001652 3300046506 Bacteria 21664
466 Ga0495583_0002663 3300046506 Bacteria 14865
467 Ga0495583_0003013 3300046506 Bacteria 13456
468 Ga0495583_0006176 3300046506 Bacteria 7886
469 Ga0495583_0027546 3300046506 Bacteria 2804
470 Ga0495583_0050015 3300046506 Bacteria 1911
471 Ga0495583_0070558 3300046506 Bacteria 1536
472 Ga0495606_0000115 3300046507 Bacteria 135589
473 Ga0495606_0000285 3300046507 Bacteria 87775
474 Ga0495606_0000964 3300046507 Bacteria 42126
475 Ga0495606_0006355 3300046507 Bacteria 10924
476 Ga0495606_0007604 3300046507 Bacteria 9637
477 Ga0495606_0014817 3300046507 Bacteria 6056
478 Ga0495606_0025115 3300046507 Bacteria 4276
479 Ga0495606_0056155 3300046507 Bacteria 2542
480 Ga0495606_0060785 3300046507 Bacteria 2419
481 Ga0495606_0062836 3300046507 Bacteria 2368
482 Ga0495610_0002956 3300046512 Bacteria 13703
483 Ga0495610_0003937 3300046512 Bacteria 11243
484 Ga0495610_0006042 3300046512 Bacteria 8452
485 Ga0495610_0006114 3300046512 Bacteria 8395
486 Ga0495610_0010481 3300046512 Bacteria 5755
487 Ga0495610_0010736 3300046512 Bacteria 5665
488 Ga0495610_0011500 3300046512 Bacteria 5409
489 Ga0495610_0012730 3300046512 Bacteria 5039
490 Ga0495610_0013954 3300046512 Bacteria 4747
491 Ga0495610_0023432 3300046512 Bacteria 3356
492 Ga0495610_0051382 3300046512 Bacteria 2007
493 Ga0495616_0011579 3300046513 Bacteria 5047
494 Ga0495616_0033194 3300046513 Bacteria 2691
495 Ga0495616_0033805 3300046513 Bacteria 2660
496 Ga0495616_0041203 3300046513 Bacteria 2356
497 Ga0495616_0056611 3300046513 Bacteria 1936
498 Ga0495616_0058624 3300046513 Bacteria 1895
499 Ga0495620_0000023 3300046515 Bacteria 131512
500 Ga0495620_0000040 3300046515 Bacteria 112660
501 Ga0495620_0000376 3300046515 Bacteria 30597
502 Ga0495620_0004033 3300046515 Bacteria 8341
503 Ga0495620_0007287 3300046515 Bacteria 6024
504 Ga0495620_0008993 3300046515 Bacteria 5334
505 Ga0495620_0010021 3300046515 Bacteria 5012
506 Ga0495620_0012309 3300046515 Bacteria 4428
507 Ga0495620_0028528 3300046515 Bacteria 2594
508 Ga0495631_0000807 3300046518 Bacteria 20009
509 Ga0495631_0002636 3300046518 Bacteria 10012
510 Ga0495631_0003660 3300046518 Bacteria 8393
511 Ga0495631_0011556 3300046518 Bacteria 4339
512 Ga0495631_0021897 3300046518 Bacteria 2974
513 Ga0495631_0037171 3300046518 Bacteria 2170
514 Ga0495632_0000353 3300046519 Bacteria 43688
515 Ga0495632_0001535 3300046519 Bacteria 19069
516 Ga0495632_0001892 3300046519 Bacteria 16771
517 Ga0495632_0006047 3300046519 Bacteria 7857
518 Ga0495632_0009605 3300046519 Bacteria 5814
519 Ga0495632_0009696 3300046519 Bacteria 5780
520 Ga0495632_0013177 3300046519 Bacteria 4730
521 Ga0495632_0014458 3300046519 Bacteria 4463
522 Ga0495632_0014787 3300046519 Bacteria 4402
523 Ga0495632_0017847 3300046519 Bacteria 3905
524 Ga0495632_0064465 3300046519 Bacteria 1771
525 Ga0495632_0152339 3300046519 Bacteria 1068
526 Ga0495632_0156301 3300046519 Bacteria 1052
527 Ga0495637_0000054 3300046520 Bacteria 99531
528 Ga0495637_0000194 3300046520 Bacteria 47572
529 Ga0495637_0001359 3300046520 Bacteria 14692
530 Ga0495637_0001467 3300046520 Bacteria 13872
531 Ga0495637_0002835 3300046520 Bacteria 9400
532 Ga0495637_0005571 3300046520 Bacteria 6392
533 Ga0495637_0006074 3300046520 Bacteria 6098
534 Ga0495637_0006097 3300046520 Bacteria 6070
535 Ga0495637_0007743 3300046520 Bacteria 5312
536 Ga0495637_0056099 3300046520 Bacteria 1631
537 Ga0495637_0061985 3300046520 Bacteria 1532
538 Ga0495637_0070823 3300046520 Bacteria 1407
539 Ga0495643_0000280 3300046522 Bacteria 72628
540 Ga0495643_0000460 3300046522 Bacteria 51847
541 Ga0495643_0001333 3300046522 Bacteria 23352
542 Ga0495643_0003285 3300046522 Bacteria 11942
543 Ga0495643_0008958 3300046522 Bacteria 6287
544 Ga0495643_0028711 3300046522 Bacteria 3115
545 Ga0495643_0036074 3300046522 Bacteria 2718
546 Ga0495643_0044905 3300046522 Bacteria 2400
547 Ga0495643_0074277 3300046522 Bacteria 1781
548 Ga0495643_0100321 3300046522 Bacteria 1484
549 Ga0495644_0001093 3300046523 Bacteria 11203
550 Ga0495644_0008585 3300046523 Bacteria 3933
551 Ga0495644_0063253 3300046523 Bacteria 1391
552 Ga0495644_0073552 3300046523 Bacteria 1285
553 Ga0495648_0001218 3300046524 Bacteria 25789
554 Ga0495648_0002215 3300046524 Bacteria 18204
555 Ga0495648_0002926 3300046524 Bacteria 15343
556 Ga0495648_0006423 3300046524 Bacteria 9598
557 Ga0495648_0007250 3300046524 Bacteria 8901
558 Ga0495648_0014356 3300046524 Bacteria 5802
559 Ga0495648_0015979 3300046524 Bacteria 5422
560 Ga0495648_0017577 3300046524 Bacteria 5105
561 Ga0495648_0018458 3300046524 Bacteria 4936
562 Ga0495648_0039218 3300046524 Bacteria 3016
563 Ga0495648_0044656 3300046524 Bacteria 2764
564 Ga0495666_0007271 3300046526 Bacteria 5555
565 Ga0495666_0030808 3300046526 Bacteria 2630
566 Ga0495642_0000530 3300046528 Bacteria 19384
567 Ga0495642_0003931 3300046528 Bacteria 5813
568 Ga0495642_0011373 3300046528 Bacteria 3418
569 Ga0495654_0001074 3300046530 Bacteria 19916
570 Ga0495654_0001863 3300046530 Bacteria 14044
571 Ga0495654_0004272 3300046530 Bacteria 8532
572 Ga0495654_0004926 3300046530 Bacteria 7854
573 Ga0495654_0007882 3300046530 Bacteria 5922
574 Ga0495654_0008140 3300046530 Bacteria 5807
575 Ga0495654_0018594 3300046530 Bacteria 3639
576 Ga0495654_0032698 3300046530 Bacteria 2635
577 Ga0495654_0052389 3300046530 Bacteria 1987
578 Ga0495654_0119126 3300046530 Bacteria 1196
579 Ga0495654_0140575 3300046530 Bacteria 1076
580 Ga0495586_0039845 3300046535 Bacteria 2526
581 Ga0495587_0003815 3300046536 Bacteria 9997
582 Ga0495587_0115538 3300046536 Bacteria 1539
583 Ga0495609_0000061 3300046538 Bacteria 139848
584 Ga0495609_0000100 3300046538 Bacteria 100831
585 Ga0495609_0000178 3300046538 Bacteria 64164
586 Ga0495609_0025169 3300046538 Bacteria 2729
587 Ga0495609_0030557 3300046538 Bacteria 2452
588 Ga0495609_0033362 3300046538 Bacteria 2337
589 Ga0495609_0057505 3300046538 Bacteria 1721
590 Ga0495597_0000121 3300046542 Bacteria 70801
591 Ga0495597_0023133 3300046542 Bacteria 2876
592 Ga0495597_0030573 3300046542 Bacteria 2454
593 Ga0495597_0032404 3300046542 Bacteria 2372
594 Ga0495597_0067047 3300046542 Bacteria 1554
595 Ga0495597_0090955 3300046542 Bacteria 1295
596 Ga0495645_0147243 3300046543 Bacteria 1639
597 Ga0495622_0008643 3300046557 Bacteria 4718
598 Ga0495622_0017305 3300046557 Bacteria 3355
599 Ga0495622_0058951 3300046557 Bacteria 1777
600 Ga0495633_0000191 3300046558 Bacteria 78838
601 Ga0495633_0030976 3300046558 Bacteria 2596
602 Ga0495668_0008556 3300046616 Bacteria 6370
603 Ga0495668_0009359 3300046616 Bacteria 6023
604 Ga0495668_0025629 3300046616 Bacteria 3349
605 Ga0495668_0033263 3300046616 Bacteria 2897
606 Ga0495668_0036664 3300046616 Bacteria 2747
607 Ga0495634_0012719 3300046642 Bacteria 6091
608 Ga0495634_0090380 3300046642 Bacteria 1989
609 Ga0495611_0000539 3300046648 Bacteria 22207
610 Ga0495611_0001529 3300046648 Bacteria 11385
611 Ga0495611_0059730 3300046648 Bacteria 1731
612 Ga0495625_0000147 3300046660 Bacteria 107983
613 Ga0495625_0023415 3300046660 Bacteria 4718
614 Ga0495625_0034672 3300046660 Bacteria 3723
615 Ga0495625_0059005 3300046660 Bacteria 2724
616 Ga0495625_0107502 3300046660 Bacteria 1909
617 Ga0495635_0000604 3300046663 Bacteria 23105
618 Ga0495659_0002389 3300046664 Bacteria 6063
619 Ga0495659_0004322 3300046664 Bacteria 4474
620 Ga0495661_0000165 3300046665 Bacteria 78666
621 Ga0495661_0000282 3300046665 Bacteria 57833
622 Ga0495661_0000315 3300046665 Bacteria 54229
623 Ga0495661_0000463 3300046665 Bacteria 43094
624 Ga0495661_0002401 3300046665 Bacteria 14454
625 Ga0495661_0014406 3300046665 Bacteria 5298
626 Ga0495661_0025512 3300046665 Bacteria 3816
627 Ga0495661_0036084 3300046665 Bacteria 3097
628 Ga0495661_0111889 3300046665 Bacteria 1520
629 Ga0495661_0144908 3300046665 Bacteria 1288
630 Ga0495588_0076149 3300046674 Bacteria 1748
631 Ga0495623_0026764 3300046679 Bacteria 3711
632 Ga0495646_0031537 3300046680 Bacteria 3301
633 Ga0495646_0142047 3300046680 Bacteria 1341
634 Ga0495669_0010487 3300046684 Bacteria 3917
635 Ga0495613_0027732 3300046689 Bacteria 4215
636 Ga0495613_0303292 3300046689 Bacteria 1105
637 Ga0495624_0034097 3300046690 Bacteria 3295
638 Ga0495670_0004276 3300046691 Bacteria 6992
639 Ga0495670_0005838 3300046691 Bacteria 6031
640 Ga0495670_0031544 3300046691 Bacteria 2634
641 Ga0495670_0065003 3300046691 Bacteria 1838
642 Ga0495671_0000442 3300046692 Bacteria 32850
643 Ga0495671_0000471 3300046692 Bacteria 31523
644 Ga0495671_0004890 3300046692 Bacteria 7924
645 Ga0495671_0012137 3300046692 Bacteria 4709
646 Ga0495671_0015315 3300046692 Bacteria 4111
647 Ga0495671_0030969 3300046692 Bacteria 2737
648 Ga0495671_0047897 3300046692 Bacteria 2133
649 Ga0495671_0122815 3300046692 Bacteria 1266
650 Ga0495649_0001612 3300046694 Bacteria 16811
651 Ga0495649_0008675 3300046694 Bacteria 6103
652 Ga0495649_0009370 3300046694 Bacteria 5825
653 Ga0495649_0011587 3300046694 Bacteria 5166
654 Ga0495649_0024453 3300046694 Bacteria 3368
655 Ga0495649_0024463 3300046694 Bacteria 3367
656 Ga0495649_0024819 3300046694 Bacteria 3342
657 Ga0495649_0026853 3300046694 Bacteria 3197
658 Ga0495649_0041235 3300046694 Bacteria 2525
659 Ga0495649_0042328 3300046694 Bacteria 2488
660 Ga0495649_0086350 3300046694 Bacteria 1674
661 Ga0495649_0161274 3300046694 Bacteria 1175
662 Ga0495589_0009577 3300046794 Bacteria 5037
663 Ga0495589_0018147 3300046794 Bacteria 3609
664 Ga0495589_0035008 3300046794 Bacteria 2519
665 Ga0495589_0036685 3300046794 Bacteria 2456
666 Ga0495589_0050308 3300046794 Bacteria 2061
667 Ga0495589_0073111 3300046794 Bacteria 1673
668 Ga0495589_0089115 3300046794 Bacteria 1498
669 Ga0495660_0002249 3300046810 Bacteria 12425
670 Ga0495660_0002584 3300046810 Bacteria 11503
671 Ga0495660_0003663 3300046810 Bacteria 9456
672 Ga0495660_0013969 3300046810 Bacteria 4655
673 Ga0495660_0024180 3300046810 Bacteria 3461
674 Ga0495660_0024950 3300046810 Bacteria 3399
675 Ga0495660_0031961 3300046810 Bacteria 2957
676 Ga0495660_0044275 3300046810 Bacteria 2449
677 Ga0495660_0048195 3300046810 Bacteria 2330
678 Ga0495660_0053515 3300046810 Bacteria 2190
679 Ga0495660_0057105 3300046810 Bacteria 2106
680 Ga0495604_0017122 3300047317 Bacteria 5797
681 Ga0495604_0060498 3300047317 Bacteria 2900
682 Ga0495604_0080944 3300047317 Bacteria 2432
683 Ga0495674_0032307 3300047319 Bacteria 4748
684 Ga0495672_0002590 3300047320 Bacteria 16392
685 Ga0495672_0003292 3300047320 Bacteria 13971
686 Ga0495672_0004877 3300047320 Bacteria 10791
687 Ga0495672_0012275 3300047320 Bacteria 5991
688 Ga0495672_0014189 3300047320 Bacteria 5466
689 Ga0495672_0017754 3300047320 Bacteria 4748
690 Ga0495672_0031184 3300047320 Bacteria 3330
691 Ga0495672_0031509 3300047320 Bacteria 3310
692 Ga0495672_0037053 3300047320 Bacteria 2988
693 Ga0495672_0040170 3300047320 Bacteria 2839
694 Ga0495672_0052547 3300047320 Bacteria 2392
695 Ga0495672_0060902 3300047320 Bacteria 2177
696 Ga0495672_0061247 3300047320 Bacteria 2169
697 Ga0495672_0081398 3300047320 Bacteria 1803
698 Ga0495672_0111035 3300047320 Bacteria 1471
699 Ga0495672_0132380 3300047320 Bacteria 1310
700 Ga0495676_0000027 3300047321 Bacteria 141955
701 Ga0495676_0017905 3300047321 Bacteria 6253
702 Ga0495676_0024131 3300047321 Bacteria 5268
703 Ga0495680_0002978 3300047322 Bacteria 16922
704 Ga0495680_0064621 3300047322 Bacteria 2805
705 Ga0495680_0088326 3300047322 Bacteria 2329
706 Ga0495683_0000127 3300047323 Bacteria 75779
707 Ga0495683_0001020 3300047323 Bacteria 19493
708 Ga0495683_0001698 3300047323 Bacteria 13995
709 Ga0495683_0006921 3300047323 Bacteria 6160
710 Ga0495683_0013630 3300047323 Bacteria 4247
711 Ga0495683_0036955 3300047323 Bacteria 2478
712 Ga0495683_0066536 3300047323 Bacteria 1775
713 Ga0495683_0121746 3300047323 Bacteria 1237
714 Ga0495687_008752 3300047443 Bacteria 5749
715 Ga0495687_019335 3300047443 Bacteria 3346
716 Ga0495675_0072084 3300047444 Bacteria 2179
717 Ga0495677_0003730 3300047445 Bacteria 5895
718 Ga0495679_000096 3300047446 Bacteria 80131
719 Ga0495679_001683 3300047446 Bacteria 12269
720 Ga0495679_005660 3300047446 Bacteria 5510
721 Ga0495679_018601 3300047446 Bacteria 2462
722 Ga0495673_0001299 3300047469 Bacteria 20334
723 Ga0495673_0001329 3300047469 Bacteria 20068
724 Ga0495673_0001337 3300047469 Bacteria 20018
725 Ga0495673_0004104 3300047469 Bacteria 9245
726 Ga0495673_0005473 3300047469 Bacteria 7667
727 Ga0495673_0005824 3300047469 Bacteria 7372
728 Ga0495673_0014201 3300047469 Bacteria 4147
729 Ga0495673_0017126 3300047469 Bacteria 3687
730 Ga0495673_0030946 3300047469 Bacteria 2509
731 Ga0495673_0044348 3300047469 Bacteria 1983
732 Ga0495673_0062745 3300047469 Bacteria 1586
733 Ga0495673_0095788 3300047469 Bacteria 1206
734 Ga0495681_0008700 3300047470 Bacteria 6335
735 Ga0495681_0009013 3300047470 Bacteria 6192
736 Ga0495681_0011503 3300047470 Bacteria 5264
737 Ga0495681_0019355 3300047470 Bacteria 3720
738 Ga0495681_0023579 3300047470 Bacteria 3265
739 Ga0495681_0055149 3300047470 Bacteria 1854
740 Ga0495681_0066586 3300047470 Bacteria 1643
741 Ga0495681_0075792 3300047470 Bacteria 1513
742 Ga0495681_0088152 3300047470 Bacteria 1374
743 Ga0495686_0016571 3300047472 Bacteria 4995
744 Ga0495686_0037419 3300047472 Bacteria 3108
745 Ga0495686_0061776 3300047472 Bacteria 2326
746 Ga0495686_0134454 3300047472 Bacteria 1463
747 Ga0495593_0028813 3300047673 Bacteria 3048
748 Ga0495593_0105229 3300047673 Bacteria 1444
749 Ga0495602_0091614 3300048088 Bacteria 2520
750 Ga0495626_0000067 3300048091 Bacteria 139969
751 Ga0495626_0000507 3300048091 Bacteria 38997
752 Ga0495626_0000684 3300048091 Bacteria 32479
753 Ga0495626_0002907 3300048091 Bacteria 11407
754 Ga0495626_0007520 3300048091 Bacteria 6052
755 Ga0495626_0010124 3300048091 Bacteria 5058
756 Ga0495626_0017435 3300048091 Bacteria 3625
757 Ga0495626_0018889 3300048091 Bacteria 3452
758 Ga0495626_0040640 3300048091 Bacteria 2195
759 Ga0495626_0097113 3300048091 Bacteria 1288
760 Ga0496102_0017650 3300048905 Bacteria 6253
761 Ga0496102_0124175 3300048905 Bacteria 2412
762 Ga0496102_0208387 3300048905 Bacteria 1843
763 Ga0496103_0009954 3300048906 Bacteria 5622
764 Ga0496104_0397920 3300048907 Bacteria 1290
765 Ga0496110_0173561 3300048913 Bacteria 1956
766 Ga0496110_0306598 3300048913 Bacteria 1446
767 Ga0496111_0040892 3300048914 Bacteria 3326
768 Ga0496114_0054349 3300048917 Bacteria 3339
769 Ga0496116_0000242 3300048919 Bacteria 99455
770 Ga0496116_0002441 3300048919 Bacteria 19563
771 Ga0496116_0015602 3300048919 Bacteria 5997
772 Ga0496116_0016890 3300048919 Bacteria 5691
773 Ga0496116_0143991 3300048919 Bacteria 1335
774 Ga0496117_0000270 3300048920 Bacteria 97077
775 Ga0496117_0001400 3300048920 Bacteria 35026
776 Ga0496117_0008847 3300048920 Bacteria 9501
777 Ga0496117_0009764 3300048920 Bacteria 8853
778 Ga0496117_0011796 3300048920 Bacteria 7783
779 Ga0496117_0020455 3300048920 Bacteria 5394
780 Ga0496117_0084105 3300048920 Bacteria 2077
781 Ga0496117_0114029 3300048920 Bacteria 1676
782 Ga0496118_0000635 3300048921 Bacteria 57514
783 Ga0496118_0001057 3300048921 Bacteria 42974
784 Ga0496118_0007753 3300048921 Bacteria 11269
785 Ga0496118_0016858 3300048921 Bacteria 6676
786 Ga0496118_0024056 3300048921 Bacteria 5269
787 Ga0496118_0030353 3300048921 Bacteria 4513
788 Ga0496118_0068469 3300048921 Bacteria 2577
789 Ga0496118_0103282 3300048921 Bacteria 1917
790 Ga0496118_0119699 3300048921 Bacteria 1720
791 Ga0496118_0206938 3300048921 Bacteria 1155
792 Ga0496119_0000927 3300048922 Bacteria 37935
793 Ga0496119_0106180 3300048922 Bacteria 1567
794 Ga0496120_0001153 3300048923 Bacteria 33865
795 Ga0496120_0006057 3300048923 Bacteria 9395
796 Ga0496121_0000318 3300048924 Bacteria 100833
797 Ga0496121_0001431 3300048924 Bacteria 40302
798 Ga0496121_0003532 3300048924 Bacteria 22182
799 Ga0496121_0090791 3300048924 Bacteria 2387
800 Ga0496121_0102831 3300048924 Bacteria 2199
801 Ga0496121_0129648 3300048924 Bacteria 1890
802 Ga0496122_0002044 3300048925 Bacteria 29954
803 Ga0496122_0002319 3300048925 Bacteria 27466
804 Ga0496122_0037098 3300048925 Bacteria 3929
805 Ga0496122_0072746 3300048925 Bacteria 2442
806 Ga0496122_0171749 3300048925 Bacteria 1305
807 Ga0496123_0000243 3300048926 Bacteria 109767
808 Ga0496123_0002575 3300048926 Bacteria 22073
809 Ga0496123_0003264 3300048926 Bacteria 18397
810 Ga0496123_0020385 3300048926 Bacteria 5187
811 Ga0496123_0045948 3300048926 Bacteria 2967
812 Ga0496123_0064851 3300048926 Bacteria 2325
813 Ga0496123_0066692 3300048926 Bacteria 2278
814 Ga0496123_0066933 3300048926 Bacteria 2272
815 Ga0496124_0000751 3300048927 Bacteria 53223
816 Ga0496124_0004281 3300048927 Bacteria 16771
817 Ga0496124_0004505 3300048927 Bacteria 16250
818 Ga0496124_0007674 3300048927 Bacteria 11414
819 Ga0496124_0009354 3300048927 Bacteria 10097
820 Ga0496124_0011231 3300048927 Bacteria 8975
821 Ga0496124_0012961 3300048927 Bacteria 8174
822 Ga0496124_0016449 3300048927 Bacteria 7029
823 Ga0496124_0019159 3300048927 Bacteria 6384
824 Ga0496124_0026911 3300048927 Bacteria 5177
825 Ga0496124_0028798 3300048927 Bacteria 4961
826 Ga0496124_0044655 3300048927 Bacteria 3800
827 Ga0496124_0115377 3300048927 Bacteria 2155
828 Ga0496124_0143382 3300048927 Bacteria 1882
829 Ga0496124_0147283 3300048927 Bacteria 1851
830 Ga0496124_0265737 3300048927 Bacteria 1259
831 Ga0496124_0372013 3300048927 Bacteria 1002
832 Ga0496125_0000659 3300048928 Bacteria 57535
833 Ga0496125_0009328 3300048928 Bacteria 10115
834 Ga0496125_0033305 3300048928 Bacteria 4561
835 Ga0496125_0059322 3300048928 Bacteria 3084
836 Ga0496125_0073867 3300048928 Bacteria 2648
837 Ga0496125_0093947 3300048928 Bacteria 2236
838 Ga0496125_0108688 3300048928 Bacteria 2016
839 Ga0496126_0049489 3300048929 Bacteria 3837
840 Ga0495678_000093 3300049459 Bacteria 113086
841 Ga0495678_001871 3300049459 Bacteria 15324
842 Ga0495678_005859 3300049459 Bacteria 6655
843 Ga0495678_007267 3300049459 Bacteria 5765
844 Ga0495678_015613 3300049459 Bacteria 3490
845 Ga0495678_022409 3300049459 Bacteria 2761
846 Ga0495678_025410 3300049459 Bacteria 2543
847 Ga0495678_027770 3300049459 Bacteria 2396
848 Ga0495678_028913 3300049459 Bacteria 2332
849 Ga0495678_045152 3300049459 Bacteria 1739
850 Ga0495682_0000413 3300049460 Bacteria 30397
851 Ga0495682_0012344 3300049460 Bacteria 3275
852 Ga0495682_0024734 3300049460 Bacteria 2237
853 Ga0501032_0039091 3300049569 Bacteria 3228
854 Ga0501034_0000164 3300049571 Bacteria 125152
855 Ga0501039_0225027 3300049575 Bacteria 1475
856 Ga0501241_004287 3300049758 Bacteria 2679
857 Ga0501226_000008 3300049853 Bacteria 199119
858 nmdc:mga03683_104331_c1 3300050489 Bacteria 1248
859 Ga0500618_003287 3300053125 Bacteria 5612
860 Ga0500659_0003689 3300053135 Bacteria 8914
861 Ga0500573_0003716 3300053140 Bacteria 7941

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046453 Ga0495627_000296 Ga0495627_000296_9766_10710 291
2 3300053140 Ga0500573_0003716 Ga0500573_0003716_1671_2615 291
3 3300046474 Ga0495605_0003918 Ga0495605_0003918_4543_5502 298
4 3300031665 Ga0316575_10018217 Ga0316575_100182173 300
5 3300036712 Ga0316584_0083827 Ga0316584_0083827_163_1101 300
6 3300047320 Ga0495672_0003292 Ga0495672_0003292_3388_4347 300
7 3300046458 Ga0495591_000164 Ga0495591_000164_32456_33415 301
8 3300046501 Ga0495607_0000268 Ga0495607_0000268_17891_18850 301
9 3300046501 Ga0495607_0007200 Ga0495607_0007200_4610_5569 301
10 3300046542 Ga0495597_0000121 Ga0495597_0000121_32476_33435 301
11 3300046660 Ga0495625_0034672 Ga0495625_0034672_587_1546 301
12 3300046810 Ga0495660_0013969 Ga0495660_0013969_3469_4428 301
13 3300047320 Ga0495672_0040170 Ga0495672_0040170_1373_2332 301
14 3300047320 Ga0495672_0081398 Ga0495672_0081398_623_1582 301
15 iso_pu_bacteria 2511231024 2511376298 306
16 iso_pu_bacteria 2554235231 2555245246 306
17 iso_pu_bacteria 2728369097 2729146374 306
18 iso_pu_bacteria 2765235841 2765581228 306
19 iso_pu_bacteria 2806310737 2807405807 306
20 iso_pu_bacteria 2806310745 2807454142 306
21 iso_pu_bacteria 2808606373 2808905920 306
22 iso_pu_bacteria 2823421272 2823426054 306
23 iso_pu_bacteria 2912963787 2912963809 306
24 iso_pu_bacteria 2919155634 2919156119 306
25 iso_pu_bacteria 2939651529 2939654410 306
26 iso_pu_bacteria 3007803356 3007804231 306
27 iso_pu_bacteria 3007872151 3007876303 306
28 iso_pu_bacteria 8052494512 8052494609 306
29 iso_pu_bacteria 8054929484 8054929654 306
30 iso_pu_bacteria 8055878733 8055881637 306
31 iso_pu_bacteria 8056115690 8056116307 306
32 iso_pu_bacteria 8056120720 8056120740 306
33 iso_pu_bacteria 8056137416 8056137436 306
34 3300049575 Ga0501039_0225027 Ga0501039_0225027_430_1362 307
35 3300031824 Ga0307413_10014349 Ga0307413_100143493 308
36 3300031995 Ga0307409_100008613 Ga0307409_1000086135 308
37 3300041997 Ga0439431_0008263 Ga0439431_0008263_1178_2107 309
38 3300042000 Ga0439437_005172 Ga0439437_005172_171_1100 309
39 3300042012 Ga0439455_0004409 Ga0439455_0004409_1537_2466 309
40 3300042115 Ga0450911_000055 Ga0450911_000055_28217_29146 309
41 3300042136 Ga0450900_002909 Ga0450900_002909_186_1115 309
42 3300042530 Ga0450916_002327 Ga0450916_002327_488_1417 309
43 iso_pu_bacteria 2808606379 2808940355 309
44 iso_pu_bacteria 3007252601 3007254967 309
45 iso_pu_bacteria 3007315729 3007316239 309
46 3300003781 Ga0055536_1020865 Ga0055536_10208652 310
47 3300003856 Ga0058692_1003282 Ga0058692_10032823 310
48 3300006944 Ga0099823_1001433 Ga0099823_100143318 310
49 3300006944 Ga0099823_1017745 Ga0099823_10177456 310
50 3300009011 Ga0105251_10008537 Ga0105251_100085372 310
51 3300009011 Ga0105251_10034316 Ga0105251_100343162 310
52 3300009011 Ga0105251_10060428 Ga0105251_100604281 310
53 3300009036 Ga0105244_10010196 Ga0105244_100101967 310
54 3300009036 Ga0105244_10012125 Ga0105244_100121255 310
55 3300009036 Ga0105244_10077413 Ga0105244_100774132 310
56 3300009036 Ga0105244_10094355 Ga0105244_100943552 310
57 3300009092 Ga0105250_10016036 Ga0105250_100160362 310
58 3300009148 Ga0105243_10006258 Ga0105243_100062585 310
59 3300009148 Ga0105243_10012953 Ga0105243_100129535 310
60 3300013102 Ga0157371_10000226 Ga0157371_1000022629 310
61 3300013307 Ga0157372_10018101 Ga0157372_100181015 310
62 3300025292 Ga0209676_1000242 Ga0209676_100024237 310
63 3300025711 Ga0207696_1000055 Ga0207696_1000055140 310
64 3300025711 Ga0207696_1004751 Ga0207696_10047514 310
65 3300025728 Ga0207655_1000348 Ga0207655_100034822 310
66 3300025728 Ga0207655_1000662 Ga0207655_100066222 310
67 3300025728 Ga0207655_1045398 Ga0207655_10453981 310
68 3300025728 Ga0207655_1049995 Ga0207655_10499952 310
69 3300025735 Ga0207713_1011679 Ga0207713_10116791 310
70 3300025735 Ga0207713_1015569 Ga0207713_10155691 310
71 3300025735 Ga0207713_1019564 Ga0207713_10195643 310
72 3300025935 Ga0207709_10055190 Ga0207709_100551901 310
73 3300027296 Ga0209389_1000065 Ga0209389_10000657 310
74 3300027312 Ga0209371_1000445 Ga0209371_10004455 310
75 3300028379 Ga0268266_10572784 Ga0268266_105727841 310
76 3300030500 Ga0268256_1000402 Ga0268256_10004025 310
77 3300031456 Ga0307513_10010765 Ga0307513_100107655 310
78 3300031548 Ga0307408_100087097 Ga0307408_1000870972 310
79 3300042006 Ga0439432_001415 Ga0439432_001415_4801_5733 310
80 3300042136 Ga0450900_006123 Ga0450900_006123_107_1039 310
81 3300042137 Ga0450902_002249 Ga0450902_002249_406_1338 310
82 3300042139 Ga0450904_000367 Ga0450904_000367_1826_2758 310
83 3300042142 Ga0450905_000365 Ga0450905_000365_2511_3443 310
84 3300042533 Ga0450901_001714 Ga0450901_001714_54_986 310
85 3300046453 Ga0495627_000701 Ga0495627_000701_6762_7694 310
86 3300046492 Ga0495585_0002528 Ga0495585_0002528_3207_4139 310
87 3300046501 Ga0495607_0005597 Ga0495607_0005597_2407_3339 310
88 3300046515 Ga0495620_0000023 Ga0495620_0000023_93812_94744 310
89 3300046518 Ga0495631_0002636 Ga0495631_0002636_6888_7820 310
90 3300046519 Ga0495632_0000353 Ga0495632_0000353_19666_20598 310
91 3300046519 Ga0495632_0014458 Ga0495632_0014458_754_1686 310
92 3300046519 Ga0495632_0014787 Ga0495632_0014787_2778_3710 310
93 3300046520 Ga0495637_0061985 Ga0495637_0061985_452_1384 310
94 3300046522 Ga0495643_0000280 Ga0495643_0000280_50562_51494 310
95 3300046522 Ga0495643_0001333 Ga0495643_0001333_4715_5647 310
96 3300046524 Ga0495648_0007250 Ga0495648_0007250_5255_6187 310
97 3300046530 Ga0495654_0001863 Ga0495654_0001863_8390_9322 310
98 3300046665 Ga0495661_0000463 Ga0495661_0000463_20248_21180 310
99 3300046692 Ga0495671_0012137 Ga0495671_0012137_2084_3016 310
100 3300046694 Ga0495649_0001612 Ga0495649_0001612_13123_14055 310
101 3300046810 Ga0495660_0031961 Ga0495660_0031961_499_1431 310
102 3300047320 Ga0495672_0002590 Ga0495672_0002590_8407_9339 310
103 3300047321 Ga0495676_0017905 Ga0495676_0017905_1281_2213 310
104 3300048917 Ga0496114_0054349 Ga0496114_0054349_161_1093 310
105 3300048920 Ga0496117_0001400 Ga0496117_0001400_29386_30318 310
106 3300048920 Ga0496117_0008847 Ga0496117_0008847_4674_5606 310
107 3300048920 Ga0496117_0011796 Ga0496117_0011796_2286_3218 310
108 3300048921 Ga0496118_0000635 Ga0496118_0000635_4682_5614 310
109 3300048921 Ga0496118_0001057 Ga0496118_0001057_4709_5641 310
110 3300048922 Ga0496119_0000927 Ga0496119_0000927_10041_10973 310
111 3300048922 Ga0496119_0106180 Ga0496119_0106180_332_1264 310
112 3300048923 Ga0496120_0001153 Ga0496120_0001153_20900_21832 310
113 3300048924 Ga0496121_0129648 Ga0496121_0129648_655_1587 310
114 3300048925 Ga0496122_0002319 Ga0496122_0002319_4309_5241 310
115 3300048925 Ga0496122_0171749 Ga0496122_0171749_319_1251 310
116 3300048926 Ga0496123_0002575 Ga0496123_0002575_2820_3752 310
117 3300048926 Ga0496123_0066692 Ga0496123_0066692_1312_2244 310
118 3300048926 Ga0496123_0066933 Ga0496123_0066933_94_1026 310
119 3300048927 Ga0496124_0004505 Ga0496124_0004505_4334_5266 310
120 3300048927 Ga0496124_0012961 Ga0496124_0012961_2558_3490 310
121 3300048927 Ga0496124_0044655 Ga0496124_0044655_2017_2949 310
122 3300048927 Ga0496124_0115377 Ga0496124_0115377_325_1257 310
123 3300048928 Ga0496125_0000659 Ga0496125_0000659_4682_5614 310
124 3300048928 Ga0496125_0033305 Ga0496125_0033305_1076_2008 310
125 3300048928 Ga0496125_0059322 Ga0496125_0059322_1688_2620 310
126 3300048929 Ga0496126_0049489 Ga0496126_0049489_2570_3502 310
127 3300049571 Ga0501034_0000164 Ga0501034_0000164_31495_32427 310
128 3300049853 Ga0501226_000008 Ga0501226_000008_27510_28442 310
129 3300053125 Ga0500618_003287 Ga0500618_003287_3143_4075 310
130 3300053135 Ga0500659_0003689 Ga0500659_0003689_4899_5831 310
131 iso_pu_bacteria 2510065053 2510282754 310
132 iso_pu_bacteria 2510065055 2510295410 310
133 iso_pu_bacteria 2510065058 2510310966 310
134 iso_pu_bacteria 2554235132 2554812357 310
135 iso_pu_bacteria 2599185155 2599327809 310
136 iso_pu_bacteria 2606217733 2608384377 310
137 iso_pu_bacteria 2811994881 2812369751 310
138 iso_pu_bacteria 2826581358 2826581737 310
139 iso_pu_bacteria 2842815866 2842817079 310
140 iso_pu_bacteria 2842849001 2842852041 310
141 iso_pu_bacteria 2919125081 2919126099 310
142 iso_pu_bacteria 2923519811 2923523838 310
143 iso_pu_bacteria 2926063275 2926064472 310
144 iso_pu_bacteria 2984499530 2984500126 310
145 iso_pu_bacteria 2984504281 2984506490 310
146 iso_pu_bacteria 2990196909 2990197880 310
147 iso_pu_bacteria 3007419365 3007419597 310
148 iso_pu_bacteria 640427133 640485976 310
149 iso_pu_bacteria 651053060 651173889 310
150 iso_pu_bacteria 8011350971 8011356179 310
151 iso_pu_bacteria 8016728285 8016731501 310
152 iso_pu_bacteria 8019769354 8019769458 310
153 iso_pu_bacteria 8057798959 8057802253 310
154 3300009011 Ga0105251_10000033 Ga0105251_1000003320 312
155 3300009092 Ga0105250_10000203 Ga0105250_1000020351 312
156 3300025711 Ga0207696_1000127 Ga0207696_100012799 312
157 3300025711 Ga0207696_1021743 Ga0207696_10217432 312
158 3300025735 Ga0207713_1000126 Ga0207713_100012699 312
159 3300027360 Ga0209969_1003756 Ga0209969_10037562 312
160 3300027378 Ga0209981_1003805 Ga0209981_10038052 312
161 3300027395 Ga0209996_1004309 Ga0209996_10043091 312
162 3300027543 Ga0209999_1005748 Ga0209999_10057482 312
163 3300027552 Ga0209982_1004394 Ga0209982_10043942 312
164 3300046512 Ga0495610_0006114 Ga0495610_0006114_4780_5739 312
165 iso_pu_bacteria 2599185167 2599401098 312
166 iso_pu_bacteria 2599185179 2599449569 312
167 iso_pu_bacteria 2599185190 2599511641 312
168 iso_pu_bacteria 2599185191 2599516615 312
169 iso_pu_bacteria 2599185290 2599893144 312
170 iso_pu_bacteria 2738543020 2739285961 312
171 iso_pu_bacteria 2738543021 2739291274 312
172 iso_pu_bacteria 2842805378 2842807544 312
173 iso_pu_bacteria 2931390751 2931390955 312
174 3300027312 Ga0209371_1000231 Ga0209371_10002316 313
175 3300030500 Ga0268256_1000192 Ga0268256_100019264 313
176 3300041411 Ga0439466_0004111 Ga0439466_0004111_1490_2431 313
177 3300042006 Ga0439432_029655 Ga0439432_029655_573_1514 313
178 3300042010 Ga0439452_010851 Ga0439452_010851_1654_2595 313
179 3300042156 Ga0439446_0000079 Ga0439446_0000079_2104_3045 313
180 iso_pu_bacteria 2597489888 2597861211 313
181 iso_pu_bacteria 2597489889 2597866958 313
182 iso_pu_bacteria 2599185189 2599506038 313
183 iso_pu_bacteria 2599185288 2599879332 313
184 iso_pu_bacteria 2599185303 2599948722 313
185 iso_pu_bacteria 2600255296 2601693285 313
186 iso_pu_bacteria 2619619299 2621296534 313
187 iso_pu_bacteria 2643221571 2643873501 313
188 iso_pu_bacteria 2643221713 2644624482 313
189 iso_pu_bacteria 2675903420 2677900458 313
190 iso_pu_bacteria 2721755607 2723246115 313
191 iso_pu_bacteria 2738541265 2738673480 313
192 iso_pu_bacteria 2738541282 2738751873 313
193 iso_pu_bacteria 2738541294 2738807555 313
194 iso_pu_bacteria 2738541303 2738860914 313
195 iso_pu_bacteria 2738541309 2738894915 313
196 iso_pu_bacteria 2808606385 2808980133 313
197 iso_pu_bacteria 2808606388 2808995853 313
198 iso_pu_bacteria 2816332298 2817487987 313
199 iso_pu_bacteria 2834028612 2834031244 313
200 iso_pu_bacteria 2842826826 2842828461 313
201 iso_pu_bacteria 2842837860 2842838218 313
202 iso_pu_bacteria 2852612431 2852616643 313
203 iso_pu_bacteria 2852667396 2852671611 313
204 iso_pu_bacteria 2860867994 2860868010 313
205 iso_pu_bacteria 2908446538 2908446589 313
206 iso_pu_bacteria 2929189879 2929189894 313
207 iso_pu_bacteria 2945928738 2945930590 313
208 iso_pu_bacteria 2946006987 2946012937 313
209 iso_pu_bacteria 2946027586 2946028199 313
210 iso_pu_bacteria 2947233263 2947234720 313
211 iso_pu_bacteria 8054285046 8054290000 313
212 iso_pu_bacteria 8054347763 8054349297 313
213 iso_pu_bacteria 8054503363 8054503562 313
214 iso_pu_bacteria 8055817908 8055817924 313
215 iso_pu_bacteria 8056131705 8056131895 313
216 iso_pu_bacteria 8056148874 8056151207 313
217 iso_pu_bacteria 8056161164 8056163920 313
218 3300005290 Ga0065712_10000160 Ga0065712_1000016029 314
219 3300009011 Ga0105251_10000995 Ga0105251_100009957 314
220 3300009036 Ga0105244_10000186 Ga0105244_1000018633 314
221 3300009036 Ga0105244_10023068 Ga0105244_100230682 314
222 3300009148 Ga0105243_10016614 Ga0105243_100166142 314
223 3300009148 Ga0105243_10027788 Ga0105243_100277882 314
224 3300025728 Ga0207655_1000135 Ga0207655_100013541 314
225 3300025728 Ga0207655_1006522 Ga0207655_10065223 314
226 3300025735 Ga0207713_1000735 Ga0207713_100073521 314
227 3300025735 Ga0207713_1003840 Ga0207713_10038405 314
228 3300025935 Ga0207709_10074275 Ga0207709_100742752 314
229 3300025935 Ga0207709_10129988 Ga0207709_101299882 314
230 3300041404 Ga0439436_0005819 Ga0439436_0005819_592_1536 314
231 3300041405 Ga0439438_000296 Ga0439438_000296_2816_3811 314
232 3300041405 Ga0439438_000440 Ga0439438_000440_4168_5112 314
233 3300041407 Ga0439447_000690 Ga0439447_000690_9026_9970 314
234 3300041411 Ga0439466_0002174 Ga0439466_0002174_6578_7522 314
235 3300041411 Ga0439466_0003898 Ga0439466_0003898_498_1442 314
236 3300042006 Ga0439432_008448 Ga0439432_008448_224_1168 314
237 3300042010 Ga0439452_001782 Ga0439452_001782_2054_2998 314
238 3300042013 Ga0439456_000021 Ga0439456_000021_37733_38704 314
239 3300042156 Ga0439446_0006348 Ga0439446_0006348_451_1395 314
240 3300042185 Ga0450909_001360 Ga0450909_001360_1687_2631 314
241 3300042435 Ga0439434_0000244 Ga0439434_0000244_12123_13067 314
242 3300046463 Ga0495653_0003842 Ga0495653_0003842_8995_9963 314
243 3300046507 Ga0495606_0000964 Ga0495606_0000964_22647_23615 314
244 3300048927 Ga0496124_0011231 Ga0496124_0011231_1440_2384 314
245 3300048927 Ga0496124_0026911 Ga0496124_0026911_2505_3488 314
246 3300049569 Ga0501032_0039091 Ga0501032_0039091_242_1186 314
247 3300006051 Ga0075364_10037035 Ga0075364_100370353 315
248 3300046460 Ga0495638_0028413 Ga0495638_0028413_390_1337 315
249 3300046474 Ga0495605_0000101 Ga0495605_0000101_73318_74265 315
250 3300046506 Ga0495583_0000300 Ga0495583_0000300_4554_5501 315
251 3300046512 Ga0495610_0002956 Ga0495610_0002956_2099_3046 315
252 3300046515 Ga0495620_0000040 Ga0495620_0000040_73026_73973 315
253 3300046518 Ga0495631_0011556 Ga0495631_0011556_85_1032 315
254 3300046520 Ga0495637_0005571 Ga0495637_0005571_770_1717 315
255 3300046524 Ga0495648_0001218 Ga0495648_0001218_20315_21262 315
256 3300046524 Ga0495648_0006423 Ga0495648_0006423_6837_7784 315
257 3300046530 Ga0495654_0004926 Ga0495654_0004926_4546_5493 315
258 3300046538 Ga0495609_0000178 Ga0495609_0000178_3951_4898 315
259 3300046558 Ga0495633_0000191 Ga0495633_0000191_4573_5520 315
260 3300046665 Ga0495661_0000165 Ga0495661_0000165_73202_74149 315
261 3300046691 Ga0495670_0005838 Ga0495670_0005838_4550_5497 315
262 3300046794 Ga0495589_0035008 Ga0495589_0035008_119_1066 315
263 3300046810 Ga0495660_0002584 Ga0495660_0002584_1555_2502 315
264 3300047323 Ga0495683_0000127 Ga0495683_0000127_1480_2427 315
265 3300047446 Ga0495679_001683 Ga0495679_001683_8993_9940 315
266 3300047469 Ga0495673_0014201 Ga0495673_0014201_143_1090 315
267 3300047470 Ga0495681_0055149 Ga0495681_0055149_658_1605 315
268 3300048925 Ga0496122_0037098 Ga0496122_0037098_2349_3296 315
269 3300048926 Ga0496123_0020385 Ga0496123_0020385_2514_3461 315
270 3300048927 Ga0496124_0019159 Ga0496124_0019159_5404_6351 315
271 3300049459 Ga0495678_000093 Ga0495678_000093_38928_39875 315
272 iso_pu_bacteria 2511231004 2511256297 315
273 iso_pu_bacteria 2511231006 2511265776 315
274 iso_pu_bacteria 2511231007 2511274338 315
275 iso_pu_bacteria 2511231008 2511279850 315
276 iso_pu_bacteria 2511231010 2511289702 315
277 iso_pu_bacteria 2511231011 2511293293 315
278 iso_pu_bacteria 2511231012 2511298935 315
279 iso_pu_bacteria 2511231014 2511313087 315
280 iso_pu_bacteria 2511231015 2511322249 315
281 iso_pu_bacteria 2511231016 2511325238 315
282 iso_pu_bacteria 2511231017 2511332222 315
283 iso_pu_bacteria 2511231018 2511337658 315
284 iso_pu_bacteria 2511231019 2511345504 315
285 iso_pu_bacteria 2511231020 2511347996 315
286 iso_pu_bacteria 2511231021 2511359140 315
287 iso_pu_bacteria 2511231022 2511366140 315
288 iso_pu_bacteria 2511231023 2511370506 315
289 iso_pu_bacteria 2511231031 2511412458 315
290 iso_pu_bacteria 2511231156 2511822048 315
291 iso_pu_bacteria 2512047018 2512325299 315
292 iso_pu_bacteria 2554235341 2555666961 315
293 iso_pu_bacteria 2582580891 2583795396 315
294 iso_pu_bacteria 2597489887 2597855211 315
295 iso_pu_bacteria 2599185160 2599355634 315
296 iso_pu_bacteria 2599185161 2599362964 315
297 iso_pu_bacteria 2599185162 2599368730 315
298 iso_pu_bacteria 2599185163 2599376073 315
299 iso_pu_bacteria 2599185164 2599380740 315
300 iso_pu_bacteria 2599185165 2599387744 315
301 iso_pu_bacteria 2599185166 2599394931 315
302 iso_pu_bacteria 2599185168 2599406696 315
303 iso_pu_bacteria 2599185181 2599462468 315
304 iso_pu_bacteria 2599185182 2599468110 315
305 iso_pu_bacteria 2599185185 2599487337 315
306 iso_pu_bacteria 2599185186 2599491485 315
307 iso_pu_bacteria 2599185188 2599503831 315
308 iso_pu_bacteria 2599185212 2599617068 315
309 iso_pu_bacteria 2599185248 2599767776 315
310 iso_pu_bacteria 2599185257 2599804307 315
311 iso_pu_bacteria 2599185289 2599887907 315
312 iso_pu_bacteria 2599185291 2599899402 315
313 iso_pu_bacteria 2599185300 2599933261 315
314 iso_pu_bacteria 2599185302 2599941989 315
315 iso_pu_bacteria 2599185304 2599954970 315
316 iso_pu_bacteria 2599185305 2599963575 315
317 iso_pu_bacteria 2599185306 2599969562 315
318 iso_pu_bacteria 2599185307 2599972681 315
319 iso_pu_bacteria 2599185308 2599981048 315
320 iso_pu_bacteria 2599185309 2599986277 315
321 iso_pu_bacteria 2599185310 2599991330 315
322 iso_pu_bacteria 2599185311 2599997211 315
323 iso_pu_bacteria 2599185312 2600000841 315
324 iso_pu_bacteria 2599185313 2600007459 315
325 iso_pu_bacteria 2599185314 2600014895 315
326 iso_pu_bacteria 2599185315 2600020200 315
327 iso_pu_bacteria 2599185316 2600027152 315
328 iso_pu_bacteria 2599185317 2600033186 315
329 iso_pu_bacteria 2599185318 2600039397 315
330 iso_pu_bacteria 2599185319 2600044279 315
331 iso_pu_bacteria 2599185320 2600050061 315
332 iso_pu_bacteria 2599185321 2600054691 315
333 iso_pu_bacteria 2599185322 2600062874 315
334 iso_pu_bacteria 2599185323 2600065293 315
335 iso_pu_bacteria 2599185324 2600073234 315
336 iso_pu_bacteria 2599185325 2600078999 315
337 iso_pu_bacteria 2599185356 2600215090 315
338 iso_pu_bacteria 2600254930 2600358761 315
339 iso_pu_bacteria 2600254931 2600363179 315
340 iso_pu_bacteria 2600255283 2601627703 315
341 iso_pu_bacteria 2600255313 2601775256 315
342 iso_pu_bacteria 2600255318 2601798205 315
343 iso_pu_bacteria 2603880185 2606077093 315
344 iso_pu_bacteria 2603880199 2606129661 315
345 iso_pu_bacteria 2623620443 2624477790 315
346 iso_pu_bacteria 2623620446 2624489374 315
347 iso_pu_bacteria 2643221565 2643843180 315
348 iso_pu_bacteria 2643221589 2643956049 315
349 iso_pu_bacteria 2643221602 2644020171 315
350 iso_pu_bacteria 2643221633 2644184183 315
351 iso_pu_bacteria 2643221650 2644282847 315
352 iso_pu_bacteria 2651869719 2652546997 315
353 iso_pu_bacteria 2667528170 2671091906 315
354 iso_pu_bacteria 2667528171 2671099605 315
355 iso_pu_bacteria 2667528176 2671129610 315
356 iso_pu_bacteria 2671180172 2671771316 315
357 iso_pu_bacteria 2675903515 2678266521 315
358 iso_pu_bacteria 2713897148 2715749526 315
359 iso_pu_bacteria 2713897149 2715754527 315
360 iso_pu_bacteria 2738541271 2738690600 315
361 iso_pu_bacteria 2738543004 2739200966 315
362 iso_pu_bacteria 2738543015 2739261803 315
363 iso_pu_bacteria 2738543016 2739266374 315
364 iso_pu_bacteria 2738543025 2739312177 315
365 iso_pu_bacteria 2740892503 2743740782 315
366 iso_pu_bacteria 2744054620 2745007751 315
367 iso_pu_bacteria 2773857670 2774118049 315
368 iso_pu_bacteria 2784132063 2784261491 315
369 iso_pu_bacteria 2784132072 2784316536 315
370 iso_pu_bacteria 2791355520 2794593619 315
371 iso_pu_bacteria 2808606361 2808858641 315
372 iso_pu_bacteria 2808606376 2808923926 315
373 iso_pu_bacteria 2808606377 2808928131 315
374 iso_pu_bacteria 2808606378 2808938601 315
375 iso_pu_bacteria 2808606380 2808946219 315
376 iso_pu_bacteria 2808606381 2808950687 315
377 iso_pu_bacteria 2808606382 2808960658 315
378 iso_pu_bacteria 2808606383 2808967146 315
379 iso_pu_bacteria 2808606389 2809001956 315
380 iso_pu_bacteria 2808606445 2809217547 315
381 iso_pu_bacteria 2818991456 2819655450 315
382 iso_pu_bacteria 2818991464 2819704752 315
383 iso_pu_bacteria 2825651385 2825654691 315
384 iso_pu_bacteria 2842832357 2842833764 315
385 iso_pu_bacteria 2842843487 2842845997 315
386 iso_pu_bacteria 2842854478 2842855983 315
387 iso_pu_bacteria 2844665904 2844667446 315
388 iso_pu_bacteria 2852657418 2852662596 315
389 iso_pu_bacteria 2860339153 2860345234 315
390 iso_pu_bacteria 2878029506 2878029733 315
391 iso_pu_bacteria 2880230671 2880230687 315
392 iso_pu_bacteria 2904518522 2904518632 315
393 iso_pu_bacteria 2904550169 2904553425 315
394 iso_pu_bacteria 2913036834 2913036909 315
395 iso_pu_bacteria 2917070673 2917070695 315
396 iso_pu_bacteria 2919063839 2919068013 315
397 iso_pu_bacteria 2919385768 2919388852 315
398 iso_pu_bacteria 2919456309 2919457889 315
399 iso_pu_bacteria 2919481497 2919487028 315
400 iso_pu_bacteria 2919487758 2919487816 315
401 iso_pu_bacteria 2919697872 2919702421 315
402 iso_pu_bacteria 2923153595 2923153614 315
403 iso_pu_bacteria 2923586266 2923589339 315
404 iso_pu_bacteria 2929144301 2929144379 315
405 iso_pu_bacteria 2931369376 2931372294 315
406 iso_pu_bacteria 2931396565 2931398433 315
407 iso_pu_bacteria 2935353572 2935357970 315
408 iso_pu_bacteria 2939636861 2939640539 315
409 iso_pu_bacteria 2945961074 2945967164 315
410 iso_pu_bacteria 2969304461 2969304489 315
411 iso_pu_bacteria 2974289157 2974293759 315
412 iso_pu_bacteria 2984286254 2984292501 315
413 iso_pu_bacteria 2988728565 2988731841 315
414 iso_pu_bacteria 2998139840 2998140057 315
415 iso_pu_bacteria 3007395558 3007399061 315
416 iso_pu_bacteria 3007511990 3007517476 315
417 iso_pu_bacteria 3007614139 3007616470 315
418 iso_pu_bacteria 3007619802 3007622585 315
419 iso_pu_bacteria 3007718800 3007722045 315
420 iso_pu_bacteria 3007855910 3007859502 315
421 iso_pu_bacteria 3007861166 3007864769 315
422 iso_pu_bacteria 3007866637 3007871903 315
423 iso_pu_bacteria 637000220 637317364 315
424 iso_pu_bacteria 8015687852 8015687871 315
425 iso_pu_bacteria 8019775933 8019779644 315
426 iso_pu_bacteria 8029995093 8029995193 315
427 iso_pu_bacteria 8055770955 8055770974 315
428 iso_pu_bacteria 8056125926 8056126077 315
429 iso_pu_bacteria 8056143049 8056143317 315
430 iso_pu_bacteria 8056155041 8056160055 315
431 iso_pu_bacteria 8056166840 8056170989 315
432 iso_pu_bacteria 8056172158 8056177121 315
433 iso_pu_bacteria 8056177738 8056182213 315
434 iso_pu_bacteria 8056569372 8056570788 315
435 3300001915 JGI24741J21665_1002934 JGI24741J21665_10029342 316
436 3300005288 Ga0065714_10067959 Ga0065714_100679592 316
437 3300005344 Ga0070661_100066694 Ga0070661_1000666942 316
438 3300005353 Ga0070669_100000153 Ga0070669_1000001536 316
439 3300005457 Ga0070662_100000562 Ga0070662_1000005626 316
440 3300005539 Ga0068853_100000040 Ga0068853_1000000407 316
441 3300005564 Ga0070664_100014744 Ga0070664_1000147446 316
442 3300005578 Ga0068854_100002019 Ga0068854_1000020195 316
443 3300005834 Ga0068851_10000018 Ga0068851_10000018100 316
444 3300009011 Ga0105251_10002417 Ga0105251_1000241711 316
445 3300009036 Ga0105244_10011507 Ga0105244_100115072 316
446 3300013100 Ga0157373_10015430 Ga0157373_100154306 316
447 3300013104 Ga0157370_10003131 Ga0157370_100031312 316
448 3300013105 Ga0157369_10114866 Ga0157369_101148663 316
449 3300014497 Ga0182008_10022978 Ga0182008_100229781 316
450 3300015261 Ga0182006_1004750 Ga0182006_10047503 316
451 3300017792 Ga0163161_10134235 Ga0163161_101342352 316
452 3300025321 Ga0207656_10000009 Ga0207656_10000009100 316
453 3300025728 Ga0207655_1000652 Ga0207655_100065238 316
454 3300025735 Ga0207713_1000692 Ga0207713_100069231 316
455 3300025923 Ga0207681_10000488 Ga0207681_1000048818 316
456 3300025933 Ga0207706_10000050 Ga0207706_10000050100 316
457 3300025981 Ga0207640_10009942 Ga0207640_100099422 316
458 3300026041 Ga0207639_10001234 Ga0207639_1000123416 316
459 3300031507 Ga0307509_10066245 Ga0307509_100662453 316
460 3300046522 Ga0495643_0000460 Ga0495643_0000460_21850_22800 316
461 3300046522 Ga0495643_0003285 Ga0495643_0003285_7320_8270 316
462 3300046692 Ga0495671_0000442 Ga0495671_0000442_5431_6381 316
463 3300046694 Ga0495649_0024819 Ga0495649_0024819_648_1646 316
464 3300046694 Ga0495649_0042328 Ga0495649_0042328_592_1542 316
465 3300046810 Ga0495660_0024180 Ga0495660_0024180_2025_2975 316
466 3300047470 Ga0495681_0075792 Ga0495681_0075792_72_1022 316
467 2162886007 SwRhRL2b_contig_2749780 SwRhRL2b_0870.00000080 317
468 3300003751 Ga0055538_1000012 Ga0055538_100001298 317
469 3300003752 Ga0055539_1000017 Ga0055539_100001798 317
470 3300003756 Ga0055533_1000021 Ga0055533_100002198 317
471 3300003758 Ga0055532_1000020 Ga0055532_1000020144 317
472 3300003759 Ga0055525_1000117 Ga0055525_100011718 317
473 3300003841 Ga0055541_1000012 Ga0055541_100001298 317
474 3300005288 Ga0065714_10067254 Ga0065714_100672546 317
475 3300005290 Ga0065712_10071587 Ga0065712_100715873 317
476 3300005331 Ga0070670_100017009 Ga0070670_1000170092 317
477 3300005331 Ga0070670_100046495 Ga0070670_1000464952 317
478 3300005344 Ga0070661_100002052 Ga0070661_10000205211 317
479 3300005548 Ga0070665_100189889 Ga0070665_1001898892 317
480 3300005548 Ga0070665_100320364 Ga0070665_1003203642 317
481 3300005564 Ga0070664_100000049 Ga0070664_10000004974 317
482 3300009011 Ga0105251_10019139 Ga0105251_100191393 317
483 3300009036 Ga0105244_10006161 Ga0105244_100061614 317
484 3300009092 Ga0105250_10000550 Ga0105250_100005506 317
485 3300009148 Ga0105243_10008082 Ga0105243_100080825 317
486 3300009174 Ga0105241_10293162 Ga0105241_102931622 317
487 3300009176 Ga0105242_10003444 Ga0105242_100034445 317
488 3300009545 Ga0105237_10015442 Ga0105237_100154426 317
489 3300011119 Ga0105246_10000322 Ga0105246_1000032219 317
490 3300011119 Ga0105246_10027386 Ga0105246_100273862 317
491 3300013100 Ga0157373_10015802 Ga0157373_100158021 317
492 3300013104 Ga0157370_10068026 Ga0157370_100680262 317
493 3300013105 Ga0157369_10033496 Ga0157369_100334962 317
494 3300013308 Ga0157375_10024624 Ga0157375_100246246 317
495 3300014497 Ga0182008_10008674 Ga0182008_100086746 317
496 3300015261 Ga0182006_1005564 Ga0182006_10055646 317
497 3300025206 Ga0209435_101310 Ga0209435_1013102 317
498 3300025224 Ga0209784_100007 Ga0209784_10000798 317
499 3300025225 Ga0209566_100009 Ga0209566_10000998 317
500 3300025226 Ga0209674_100021 Ga0209674_10002198 317
501 3300025229 Ga0209147_100009 Ga0209147_10000998 317
502 3300025230 Ga0209563_100018 Ga0209563_10001898 317
503 3300025242 Ga0209258_100237 Ga0209258_10023798 317
504 3300025246 Ga0209646_1000234 Ga0209646_100023415 317
505 3300025253 Ga0209677_100012 Ga0209677_10001298 317
506 3300025711 Ga0207696_1000165 Ga0207696_1000165101 317
507 3300025728 Ga0207655_1000603 Ga0207655_100060326 317
508 3300025735 Ga0207713_1012398 Ga0207713_10123984 317
509 3300025914 Ga0207671_10000027 Ga0207671_1000002711 317
510 3300025920 Ga0207649_10000007 Ga0207649_10000007188 317
511 3300025925 Ga0207650_10000178 Ga0207650_1000017863 317
512 3300025925 Ga0207650_10000210 Ga0207650_1000021014 317
513 3300025934 Ga0207686_10010242 Ga0207686_100102423 317
514 3300025935 Ga0207709_10002112 Ga0207709_1000211210 317
515 3300025945 Ga0207679_10000013 Ga0207679_10000013116 317
516 3300028379 Ga0268266_10157208 Ga0268266_101572082 317
517 3300030742 Ga0316183_1199248 Ga0316183_11992482 317
518 3300042006 Ga0439432_003836 Ga0439432_003836_4533_5486 317
519 3300046512 Ga0495610_0010481 Ga0495610_0010481_516_1469 317
520 3300046530 Ga0495654_0007882 Ga0495654_0007882_269_1222 317
521 3300046530 Ga0495654_0052389 Ga0495654_0052389_536_1489 317
522 3300048927 Ga0496124_0372013 Ga0496124_0372013_38_991 317
523 3300048928 Ga0496125_0108688 Ga0496125_0108688_388_1341 317
524 3300036712 Ga0316584_0084182 Ga0316584_0084182_228_1223 318
525 2124908027 MRS2a_Contig_61 MRS2a_00478430 319
526 3300002772 JGI25164J39214_1000175 JGI25164J39214_100017560 319
527 3300002772 JGI25164J39214_1000357 JGI25164J39214_100035727 319
528 3300003214 JGI25165J46597_1000175 JGI25165J46597_100017596 319
529 3300003214 JGI25165J46597_1000193 JGI25165J46597_100019390 319
530 3300003781 Ga0055536_1000547 Ga0055536_10005472 319
531 3300003781 Ga0055536_1000593 Ga0055536_10005936 319
532 3300003781 Ga0055536_1005739 Ga0055536_10057392 319
533 3300003791 Ga0055530_10000081 Ga0055530_1000008136 319
534 3300003791 Ga0055530_10000159 Ga0055530_1000015960 319
535 3300003791 Ga0055530_10003552 Ga0055530_100035525 319
536 3300003792 Ga0055540_1000121 Ga0055540_100012136 319
537 3300003792 Ga0055540_1000242 Ga0055540_100024244 319
538 3300003792 Ga0055540_1001117 Ga0055540_10011177 319
539 3300003794 Ga0055531_10001857 Ga0055531_1000185711 319
540 3300005288 Ga0065714_10002471 Ga0065714_100024713 319
541 3300005288 Ga0065714_10066068 Ga0065714_100660682 319
542 3300005288 Ga0065714_10066935 Ga0065714_100669356 319
543 3300005288 Ga0065714_10074006 Ga0065714_100740063 319
544 3300005288 Ga0065714_10086380 Ga0065714_100863802 319
545 3300005290 Ga0065712_10002851 Ga0065712_100028514 319
546 3300005293 Ga0065715_10008286 Ga0065715_100082863 319
547 3300005353 Ga0070669_100000158 Ga0070669_10000015856 319
548 3300005548 Ga0070665_100106751 Ga0070665_1001067512 319
549 3300006051 Ga0075364_10074915 Ga0075364_100749152 319
550 3300006051 Ga0075364_10083028 Ga0075364_100830282 319
551 3300006058 Ga0075432_10008138 Ga0075432_100081383 319
552 3300006058 Ga0075432_10036464 Ga0075432_100364641 319
553 3300006946 Ga0079104_1000291 Ga0079104_100029159 319
554 3300006946 Ga0079104_1000306 Ga0079104_100030633 319
555 3300006946 Ga0079104_1011461 Ga0079104_10114612 319
556 3300009036 Ga0105244_10001163 Ga0105244_1000116319 319
557 3300009036 Ga0105244_10029512 Ga0105244_100295123 319
558 3300009036 Ga0105244_10061702 Ga0105244_100617022 319
559 3300009036 Ga0105244_10074675 Ga0105244_100746752 319
560 3300009092 Ga0105250_10005762 Ga0105250_100057626 319
561 3300009092 Ga0105250_10018938 Ga0105250_100189382 319
562 3300009148 Ga0105243_10000075 Ga0105243_1000007520 319
563 3300009148 Ga0105243_10012797 Ga0105243_100127977 319
564 3300009148 Ga0105243_10024895 Ga0105243_100248954 319
565 3300011119 Ga0105246_10002463 Ga0105246_100024636 319
566 3300012477 Ga0157336_1000242 Ga0157336_10002422 319
567 3300012483 Ga0157337_1000089 Ga0157337_10000894 319
568 3300012498 Ga0157345_1000342 Ga0157345_10003422 319
569 3300013100 Ga0157373_10006572 Ga0157373_100065722 319
570 3300013100 Ga0157373_10011243 Ga0157373_100112437 319
571 3300013102 Ga0157371_10012722 Ga0157371_100127227 319
572 3300013102 Ga0157371_10014325 Ga0157371_100143253 319
573 3300013104 Ga0157370_10023845 Ga0157370_100238451 319
574 3300013104 Ga0157370_10094400 Ga0157370_100944002 319
575 3300013104 Ga0157370_10133309 Ga0157370_101333092 319
576 3300013105 Ga0157369_10154159 Ga0157369_101541591 319
577 3300013306 Ga0163162_10001329 Ga0163162_100013297 319
578 3300013307 Ga0157372_10028093 Ga0157372_100280932 319
579 3300014497 Ga0182008_10000938 Ga0182008_100009383 319
580 3300014497 Ga0182008_10003949 Ga0182008_100039492 319
581 3300014497 Ga0182008_10013327 Ga0182008_100133274 319
582 3300014497 Ga0182008_10018729 Ga0182008_100187293 319
583 3300014497 Ga0182008_10038337 Ga0182008_100383371 319
584 3300014497 Ga0182008_10086859 Ga0182008_100868592 319
585 3300014497 Ga0182008_10103811 Ga0182008_101038111 319
586 3300015261 Ga0182006_1005425 Ga0182006_10054252 319
587 3300015261 Ga0182006_1009327 Ga0182006_10093272 319
588 3300015261 Ga0182006_1049907 Ga0182006_10499072 319
589 3300015261 Ga0182006_1062526 Ga0182006_10625262 319
590 3300015262 Ga0182007_10004678 Ga0182007_100046782 319
591 3300015265 Ga0182005_1002872 Ga0182005_10028724 319
592 3300015265 Ga0182005_1010661 Ga0182005_10106613 319
593 3300015265 Ga0182005_1013258 Ga0182005_10132582 319
594 3300017792 Ga0163161_10146361 Ga0163161_101463612 319
595 3300017792 Ga0163161_10211279 Ga0163161_102112792 319
596 3300017792 Ga0163161_10277264 Ga0163161_102772641 319
597 3300025207 Ga0209760_100020 Ga0209760_10002046 319
598 3300025207 Ga0209760_100169 Ga0209760_10016923 319
599 3300025231 Ga0207427_100005 Ga0207427_100005652 319
600 3300025231 Ga0207427_100006 Ga0207427_10000694 319
601 3300025233 Ga0209437_100013 Ga0209437_10001394 319
602 3300025233 Ga0209437_100018 Ga0209437_100018562 319
603 3300025261 Ga0209233_1000021 Ga0209233_1000021652 319
604 3300025261 Ga0209233_1000022 Ga0209233_100002294 319
605 3300025291 Ga0209675_1005173 Ga0209675_10051733 319
606 3300025292 Ga0209676_1000015 Ga0209676_1000015105 319
607 3300025292 Ga0209676_1000157 Ga0209676_1000157107 319
608 3300025292 Ga0209676_1000222 Ga0209676_1000222100 319
609 3300025292 Ga0209676_1000583 Ga0209676_100058318 319
610 3300025292 Ga0209676_1002004 Ga0209676_100200415 319
611 3300025298 Ga0209050_1000030 Ga0209050_1000030333 319
612 3300025298 Ga0209050_1000061 Ga0209050_1000061117 319
613 3300025298 Ga0209050_1000296 Ga0209050_1000296100 319
614 3300025298 Ga0209050_1005565 Ga0209050_10055657 319
615 3300025303 Ga0209051_1000088 Ga0209051_100008871 319
616 3300025303 Ga0209051_1000143 Ga0209051_1000143105 319
617 3300025303 Ga0209051_1000487 Ga0209051_100048722 319
618 3300025303 Ga0209051_1006284 Ga0209051_10062843 319
619 3300025304 Ga0209257_1000143 Ga0209257_100014323 319
620 3300025304 Ga0209257_1027342 Ga0209257_10273422 319
621 3300025711 Ga0207696_1000151 Ga0207696_100015118 319
622 3300025711 Ga0207696_1001549 Ga0207696_10015492 319
623 3300025711 Ga0207696_1003732 Ga0207696_10037324 319
624 3300025711 Ga0207696_1013295 Ga0207696_10132954 319
625 3300025711 Ga0207696_1017423 Ga0207696_10174231 319
626 3300025728 Ga0207655_1001765 Ga0207655_10017656 319
627 3300025728 Ga0207655_1007418 Ga0207655_10074182 319
628 3300025728 Ga0207655_1010161 Ga0207655_10101616 319
629 3300025735 Ga0207713_1000103 Ga0207713_100010339 319
630 3300025735 Ga0207713_1002220 Ga0207713_100222011 319
631 3300025735 Ga0207713_1002937 Ga0207713_10029379 319
632 3300025735 Ga0207713_1003859 Ga0207713_10038597 319
633 3300025735 Ga0207713_1003907 Ga0207713_10039076 319
634 3300025735 Ga0207713_1009074 Ga0207713_10090741 319
635 3300025735 Ga0207713_1009075 Ga0207713_10090751 319
636 3300025735 Ga0207713_1025943 Ga0207713_10259432 319
637 3300025735 Ga0207713_1030420 Ga0207713_10304201 319
638 3300025735 Ga0207713_1088745 Ga0207713_10887451 319
639 3300025923 Ga0207681_10001509 Ga0207681_100015098 319
640 3300025933 Ga0207706_10001275 Ga0207706_1000127512 319
641 3300025935 Ga0207709_10000107 Ga0207709_1000010727 319
642 3300025935 Ga0207709_10000269 Ga0207709_1000026923 319
643 3300025935 Ga0207709_10051282 Ga0207709_100512822 319
644 3300025961 Ga0207712_10007685 Ga0207712_100076853 319
645 3300027111 Ga0209281_1000091 Ga0209281_1000091130 319
646 3300027111 Ga0209281_1000237 Ga0209281_100023722 319
647 3300027907 Ga0207428_10042158 Ga0207428_100421581 319
648 3300027907 Ga0207428_10043727 Ga0207428_100437273 319
649 3300028379 Ga0268266_10003207 Ga0268266_100032073 319
650 3300028786 Ga0307517_10032796 Ga0307517_100327966 319
651 3300030521 Ga0307511_10024751 Ga0307511_100247512 319
652 3300030521 Ga0307511_10068194 Ga0307511_100681942 319
653 3300030731 Ga0316177_1089383 Ga0316177_10893832 319
654 3300030734 Ga0316179_1069431 Ga0316179_10694312 319
655 3300030735 Ga0316178_1080449 Ga0316178_108044913 319
656 3300030742 Ga0316183_1089988 Ga0316183_10899881 319
657 3300030742 Ga0316183_1121923 Ga0316183_11219232 319
658 3300030744 Ga0316181_1110545 Ga0316181_11105452 319
659 3300031548 Ga0307408_100014056 Ga0307408_1000140564 319
660 3300031548 Ga0307408_100055360 Ga0307408_1000553602 319
661 3300031548 Ga0307408_100274335 Ga0307408_1002743351 319
662 3300031731 Ga0307405_10025032 Ga0307405_100250323 319
663 3300031731 Ga0307405_10049058 Ga0307405_100490581 319
664 3300031903 Ga0307407_10124207 Ga0307407_101242072 319
665 3300031911 Ga0307412_10059225 Ga0307412_100592252 319
666 3300031911 Ga0307412_10455015 Ga0307412_104550151 319
667 3300031995 Ga0307409_100010758 Ga0307409_1000107586 319
668 3300032002 Ga0307416_100248799 Ga0307416_1002487991 319
669 3300032002 Ga0307416_100477053 Ga0307416_1004770531 319
670 3300032004 Ga0307414_10170457 Ga0307414_101704572 319
671 3300032005 Ga0307411_10255064 Ga0307411_102550642 319
672 3300033180 Ga0307510_10033908 Ga0307510_100339082 319
673 3300041405 Ga0439438_001725 Ga0439438_001725_8468_9427 319
674 3300041405 Ga0439438_003887 Ga0439438_003887_4451_5410 319
675 3300041405 Ga0439438_008515 Ga0439438_008515_72_1031 319
676 3300041405 Ga0439438_009972 Ga0439438_009972_1767_2726 319
677 3300041405 Ga0439438_011123 Ga0439438_011123_120_1079 319
678 3300041405 Ga0439438_015415 Ga0439438_015415_894_1853 319
679 3300041407 Ga0439447_000380 Ga0439447_000380_2315_3274 319
680 3300041407 Ga0439447_001108 Ga0439447_001108_2287_3246 319
681 3300041407 Ga0439447_003266 Ga0439447_003266_374_1372 319
682 3300041407 Ga0439447_004722 Ga0439447_004722_3294_4292 319
683 3300041407 Ga0439447_038304 Ga0439447_038304_65_1024 319
684 3300041411 Ga0439466_0000240 Ga0439466_0000240_5384_6343 319
685 3300041411 Ga0439466_0002581 Ga0439466_0002581_2584_3543 319
686 3300041411 Ga0439466_0002774 Ga0439466_0002774_4136_5095 319
687 3300041411 Ga0439466_0003780 Ga0439466_0003780_436_1395 319
688 3300041411 Ga0439466_0008138 Ga0439466_0008138_454_1413 319
689 3300041411 Ga0439466_0011670 Ga0439466_0011670_2158_3117 319
690 3300042006 Ga0439432_004227 Ga0439432_004227_4150_5109 319
691 3300042006 Ga0439432_007970 Ga0439432_007970_2292_3251 319
692 3300042006 Ga0439432_014077 Ga0439432_014077_48_1007 319
693 3300042006 Ga0439432_032063 Ga0439432_032063_422_1381 319
694 3300042006 Ga0439432_054155 Ga0439432_054155_96_1055 319
695 3300042010 Ga0439452_000190 Ga0439452_000190_4987_5946 319
696 3300042010 Ga0439452_002240 Ga0439452_002240_5616_6575 319
697 3300042010 Ga0439452_002643 Ga0439452_002643_2355_3314 319
698 3300042010 Ga0439452_002983 Ga0439452_002983_4654_5613 319
699 3300042010 Ga0439452_003229 Ga0439452_003229_4676_5635 319
700 3300042010 Ga0439452_007923 Ga0439452_007923_359_1357 319
701 3300042013 Ga0439456_001799 Ga0439456_001799_758_1717 319
702 3300042013 Ga0439456_009110 Ga0439456_009110_373_1332 319
703 3300042013 Ga0439456_009135 Ga0439456_009135_201_1160 319
704 3300042013 Ga0439456_017369 Ga0439456_017369_461_1420 319
705 3300042013 Ga0439456_030367 Ga0439456_030367_141_1100 319
706 3300042016 Ga0439463_000264 Ga0439463_000264_4872_5831 319
707 3300042016 Ga0439463_000940 Ga0439463_000940_5322_6281 319
708 3300042016 Ga0439463_007878 Ga0439463_007878_1346_2305 319
709 3300042016 Ga0439463_013062 Ga0439463_013062_646_1605 319
710 3300042115 Ga0450911_000211 Ga0450911_000211_4649_5608 319
711 3300042115 Ga0450911_002007 Ga0450911_002007_2048_3007 319
712 3300042115 Ga0450911_003352 Ga0450911_003352_1713_2672 319
713 3300042121 Ga0450919_000953 Ga0450919_000953_1980_2939 319
714 3300042124 Ga0450922_001398 Ga0450922_001398_591_1550 319
715 3300042137 Ga0450902_006853 Ga0450902_006853_379_1377 319
716 3300042138 Ga0450903_002798 Ga0450903_002798_1635_2594 319
717 3300042138 Ga0450903_005738 Ga0450903_005738_709_1668 319
718 3300042138 Ga0450903_009946 Ga0450903_009946_162_1121 319
719 3300042145 Ga0450906_000309 Ga0450906_000309_2314_3273 319
720 3300042145 Ga0450906_004691 Ga0450906_004691_123_1082 319
721 3300042146 Ga0450907_000110 Ga0450907_000110_25474_26433 319
722 3300042146 Ga0450907_004724 Ga0450907_004724_1295_2254 319
723 3300042147 Ga0450910_000275 Ga0450910_000275_3789_4748 319
724 3300042184 Ga0450908_002350 Ga0450908_002350_427_1386 319
725 3300042185 Ga0450909_008876 Ga0450909_008876_212_1171 319
726 3300042185 Ga0450909_016365 Ga0450909_016365_49_1008 319
727 3300042435 Ga0439434_0007094 Ga0439434_0007094_390_1349 319
728 3300042439 Ga0439464_0007532 Ga0439464_0007532_125_1084 319
729 3300042461 Ga0439460_0005294 Ga0439460_0005294_2155_3114 319
730 3300042461 Ga0439460_0008161 Ga0439460_0008161_1369_2328 319
731 3300042993 Ga0439440_0002407 Ga0439440_0002407_2179_3138 319
732 3300046452 Ga0495617_001971 Ga0495617_001971_2335_3294 319
733 3300046452 Ga0495617_004003 Ga0495617_004003_4202_5161 319
734 3300046452 Ga0495617_021959 Ga0495617_021959_809_1768 319
735 3300046453 Ga0495627_001391 Ga0495627_001391_4524_5483 319
736 3300046453 Ga0495627_005214 Ga0495627_005214_4273_5232 319
737 3300046453 Ga0495627_012109 Ga0495627_012109_2096_3055 319
738 3300046453 Ga0495627_016909 Ga0495627_016909_297_1256 319
739 3300046455 Ga0495603_0005896 Ga0495603_0005896_4832_5830 319
740 3300046457 Ga0495590_0003265 Ga0495590_0003265_1608_2567 319
741 3300046457 Ga0495590_0013086 Ga0495590_0013086_385_1344 319
742 3300046457 Ga0495590_0020549 Ga0495590_0020549_1057_2025 319
743 3300046457 Ga0495590_0020958 Ga0495590_0020958_356_1315 319
744 3300046458 Ga0495591_000898 Ga0495591_000898_4690_5649 319
745 3300046458 Ga0495591_001277 Ga0495591_001277_10846_11805 319
746 3300046458 Ga0495591_002623 Ga0495591_002623_4221_5180 319
747 3300046458 Ga0495591_004987 Ga0495591_004987_4960_5919 319
748 3300046458 Ga0495591_006161 Ga0495591_006161_4277_5236 319
749 3300046458 Ga0495591_014256 Ga0495591_014256_469_1428 319
750 3300046458 Ga0495591_016129 Ga0495591_016129_1573_2532 319
751 3300046458 Ga0495591_016982 Ga0495591_016982_1257_2216 319
752 3300046458 Ga0495591_040625 Ga0495591_040625_121_1080 319
753 3300046458 Ga0495591_042448 Ga0495591_042448_274_1233 319
754 3300046460 Ga0495638_0010051 Ga0495638_0010051_3385_4344 319
755 3300046460 Ga0495638_0015178 Ga0495638_0015178_4040_4999 319
756 3300046460 Ga0495638_0017020 Ga0495638_0017020_135_1094 319
757 3300046460 Ga0495638_0037963 Ga0495638_0037963_130_1089 319
758 3300046460 Ga0495638_0109997 Ga0495638_0109997_396_1355 319
759 3300046460 Ga0495638_0134084 Ga0495638_0134084_114_1073 319
760 3300046460 Ga0495638_0142909 Ga0495638_0142909_20_979 319
761 3300046460 Ga0495638_0151761 Ga0495638_0151761_265_1224 319
762 3300046463 Ga0495653_0003789 Ga0495653_0003789_4972_5931 319
763 3300046463 Ga0495653_0014723 Ga0495653_0014723_373_1332 319
764 3300046463 Ga0495653_0038452 Ga0495653_0038452_604_1563 319
765 3300046463 Ga0495653_0045733 Ga0495653_0045733_363_1322 319
766 3300046463 Ga0495653_0061155 Ga0495653_0061155_1576_2535 319
767 3300046471 Ga0495650_0000402 Ga0495650_0000402_54307_55266 319
768 3300046471 Ga0495650_0006953 Ga0495650_0006953_2031_2990 319
769 3300046471 Ga0495650_0011360 Ga0495650_0011360_3728_4687 319
770 3300046471 Ga0495650_0025552 Ga0495650_0025552_1614_2573 319
771 3300046471 Ga0495650_0026977 Ga0495650_0026977_1566_2525 319
772 3300046471 Ga0495650_0038625 Ga0495650_0038625_809_1777 319
773 3300046471 Ga0495650_0042643 Ga0495650_0042643_920_1879 319
774 3300046473 Ga0495582_0007342 Ga0495582_0007342_4832_5791 319
775 3300046474 Ga0495605_0000302 Ga0495605_0000302_30436_31395 319
776 3300046474 Ga0495605_0000971 Ga0495605_0000971_4747_5706 319
777 3300046474 Ga0495605_0002433 Ga0495605_0002433_8454_9413 319
778 3300046474 Ga0495605_0003182 Ga0495605_0003182_5119_6078 319
779 3300046474 Ga0495605_0008090 Ga0495605_0008090_4621_5580 319
780 3300046474 Ga0495605_0095896 Ga0495605_0095896_62_1021 319
781 3300046475 Ga0495639_0004372 Ga0495639_0004372_418_1377 319
782 3300046491 Ga0495584_0001255 Ga0495584_0001255_4298_5257 319
783 3300046491 Ga0495584_0002779 Ga0495584_0002779_2207_3166 319
784 3300046491 Ga0495584_0005430 Ga0495584_0005430_3997_4956 319
785 3300046491 Ga0495584_0017033 Ga0495584_0017033_2347_3306 319
786 3300046491 Ga0495584_0021615 Ga0495584_0021615_315_1274 319
787 3300046491 Ga0495584_0056697 Ga0495584_0056697_381_1340 319
788 3300046491 Ga0495584_0092270 Ga0495584_0092270_186_1145 319
789 3300046492 Ga0495585_0001285 Ga0495585_0001285_14139_15137 319
790 3300046492 Ga0495585_0004778 Ga0495585_0004778_5390_6349 319
791 3300046492 Ga0495585_0014098 Ga0495585_0014098_705_1664 319
792 3300046492 Ga0495585_0047442 Ga0495585_0047442_1338_2297 319
793 3300046492 Ga0495585_0049065 Ga0495585_0049065_1239_2198 319
794 3300046492 Ga0495585_0053795 Ga0495585_0053795_1218_2177 319
795 3300046492 Ga0495585_0145721 Ga0495585_0145721_38_997 319
796 3300046499 Ga0495594_0035244 Ga0495594_0035244_187_1146 319
797 3300046500 Ga0495596_0000175 Ga0495596_0000175_4716_5675 319
798 3300046500 Ga0495596_0066402 Ga0495596_0066402_65_1024 319
799 3300046501 Ga0495607_0000365 Ga0495607_0000365_40457_41416 319
800 3300046501 Ga0495607_0005788 Ga0495607_0005788_4960_5919 319
801 3300046501 Ga0495607_0010681 Ga0495607_0010681_4829_5788 319
802 3300046501 Ga0495607_0011810 Ga0495607_0011810_439_1407 319
803 3300046501 Ga0495607_0013345 Ga0495607_0013345_4393_5352 319
804 3300046501 Ga0495607_0013669 Ga0495607_0013669_3953_4912 319
805 3300046501 Ga0495607_0030494 Ga0495607_0030494_2215_3174 319
806 3300046501 Ga0495607_0044080 Ga0495607_0044080_1612_2571 319
807 3300046501 Ga0495607_0125063 Ga0495607_0125063_55_1014 319
808 3300046501 Ga0495607_0171712 Ga0495607_0171712_49_1008 319
809 3300046506 Ga0495583_0001652 Ga0495583_0001652_15851_16810 319
810 3300046506 Ga0495583_0002663 Ga0495583_0002663_9084_10043 319
811 3300046506 Ga0495583_0003013 Ga0495583_0003013_10141_11100 319
812 3300046506 Ga0495583_0006176 Ga0495583_0006176_4589_5548 319
813 3300046506 Ga0495583_0027546 Ga0495583_0027546_95_1054 319
814 3300046506 Ga0495583_0050015 Ga0495583_0050015_568_1527 319
815 3300046506 Ga0495583_0070558 Ga0495583_0070558_190_1149 319
816 3300046507 Ga0495606_0000115 Ga0495606_0000115_90740_91699 319
817 3300046507 Ga0495606_0000285 Ga0495606_0000285_43925_44884 319
818 3300046507 Ga0495606_0006355 Ga0495606_0006355_4098_5057 319
819 3300046507 Ga0495606_0007604 Ga0495606_0007604_4614_5573 319
820 3300046507 Ga0495606_0014817 Ga0495606_0014817_129_1088 319
821 3300046507 Ga0495606_0025115 Ga0495606_0025115_258_1217 319
822 3300046507 Ga0495606_0056155 Ga0495606_0056155_137_1096 319
823 3300046507 Ga0495606_0060785 Ga0495606_0060785_180_1139 319
824 3300046507 Ga0495606_0062836 Ga0495606_0062836_180_1139 319
825 3300046512 Ga0495610_0003937 Ga0495610_0003937_4964_5923 319
826 3300046512 Ga0495610_0006042 Ga0495610_0006042_7019_7978 319
827 3300046512 Ga0495610_0010736 Ga0495610_0010736_2215_3174 319
828 3300046512 Ga0495610_0011500 Ga0495610_0011500_390_1349 319
829 3300046512 Ga0495610_0012730 Ga0495610_0012730_84_1043 319
830 3300046512 Ga0495610_0013954 Ga0495610_0013954_3454_4413 319
831 3300046512 Ga0495610_0023432 Ga0495610_0023432_2249_3208 319
832 3300046512 Ga0495610_0051382 Ga0495610_0051382_681_1640 319
833 3300046513 Ga0495616_0011579 Ga0495616_0011579_1402_2361 319
834 3300046513 Ga0495616_0033194 Ga0495616_0033194_1539_2498 319
835 3300046513 Ga0495616_0033805 Ga0495616_0033805_310_1269 319
836 3300046513 Ga0495616_0041203 Ga0495616_0041203_1317_2276 319
837 3300046513 Ga0495616_0056611 Ga0495616_0056611_586_1545 319
838 3300046513 Ga0495616_0058624 Ga0495616_0058624_48_1007 319
839 3300046515 Ga0495620_0000376 Ga0495620_0000376_819_1778 319
840 3300046515 Ga0495620_0004033 Ga0495620_0004033_3228_4187 319
841 3300046515 Ga0495620_0007287 Ga0495620_0007287_4927_5886 319
842 3300046515 Ga0495620_0008993 Ga0495620_0008993_3966_4925 319
843 3300046515 Ga0495620_0010021 Ga0495620_0010021_182_1141 319
844 3300046515 Ga0495620_0012309 Ga0495620_0012309_840_1799 319
845 3300046515 Ga0495620_0028528 Ga0495620_0028528_1253_2212 319
846 3300046518 Ga0495631_0000807 Ga0495631_0000807_14020_14979 319
847 3300046518 Ga0495631_0003660 Ga0495631_0003660_6182_7141 319
848 3300046518 Ga0495631_0021897 Ga0495631_0021897_1773_2732 319
849 3300046518 Ga0495631_0037171 Ga0495631_0037171_27_986 319
850 3300046519 Ga0495632_0001535 Ga0495632_0001535_5132_6091 319
851 3300046519 Ga0495632_0001892 Ga0495632_0001892_4687_5646 319
852 3300046519 Ga0495632_0006047 Ga0495632_0006047_4594_5553 319
853 3300046519 Ga0495632_0009605 Ga0495632_0009605_4660_5619 319
854 3300046519 Ga0495632_0009696 Ga0495632_0009696_4475_5434 319
855 3300046519 Ga0495632_0013177 Ga0495632_0013177_3382_4341 319
856 3300046519 Ga0495632_0017847 Ga0495632_0017847_1345_2304 319
857 3300046519 Ga0495632_0064465 Ga0495632_0064465_129_1088 319
858 3300046519 Ga0495632_0152339 Ga0495632_0152339_89_1048 319
859 3300046519 Ga0495632_0156301 Ga0495632_0156301_36_995 319
860 3300046520 Ga0495637_0000054 Ga0495637_0000054_4882_5841 319
861 3300046520 Ga0495637_0000194 Ga0495637_0000194_41749_42708 319
862 3300046520 Ga0495637_0001359 Ga0495637_0001359_4975_5934 319
863 3300046520 Ga0495637_0001467 Ga0495637_0001467_114_1073 319
864 3300046520 Ga0495637_0002835 Ga0495637_0002835_4340_5299 319
865 3300046520 Ga0495637_0006074 Ga0495637_0006074_2238_3197 319
866 3300046520 Ga0495637_0006097 Ga0495637_0006097_2250_3209 319
867 3300046520 Ga0495637_0007743 Ga0495637_0007743_385_1344 319
868 3300046520 Ga0495637_0056099 Ga0495637_0056099_531_1490 319
869 3300046520 Ga0495637_0070823 Ga0495637_0070823_21_980 319
870 3300046522 Ga0495643_0008958 Ga0495643_0008958_3152_4111 319
871 3300046522 Ga0495643_0028711 Ga0495643_0028711_75_1034 319
872 3300046522 Ga0495643_0036074 Ga0495643_0036074_368_1327 319
873 3300046522 Ga0495643_0044905 Ga0495643_0044905_384_1343 319
874 3300046522 Ga0495643_0074277 Ga0495643_0074277_334_1293 319
875 3300046522 Ga0495643_0100321 Ga0495643_0100321_34_993 319
876 3300046523 Ga0495644_0001093 Ga0495644_0001093_1497_2456 319
877 3300046523 Ga0495644_0008585 Ga0495644_0008585_181_1140 319
878 3300046523 Ga0495644_0063253 Ga0495644_0063253_92_1051 319
879 3300046523 Ga0495644_0073552 Ga0495644_0073552_79_1038 319
880 3300046524 Ga0495648_0002215 Ga0495648_0002215_3773_4732 319
881 3300046524 Ga0495648_0002926 Ga0495648_0002926_9465_10424 319
882 3300046524 Ga0495648_0014356 Ga0495648_0014356_3464_4423 319
883 3300046524 Ga0495648_0015979 Ga0495648_0015979_4089_5048 319
884 3300046524 Ga0495648_0017577 Ga0495648_0017577_176_1135 319
885 3300046524 Ga0495648_0018458 Ga0495648_0018458_3619_4578 319
886 3300046524 Ga0495648_0039218 Ga0495648_0039218_283_1242 319
887 3300046524 Ga0495648_0044656 Ga0495648_0044656_1767_2726 319
888 3300046526 Ga0495666_0007271 Ga0495666_0007271_387_1346 319
889 3300046526 Ga0495666_0030808 Ga0495666_0030808_26_985 319
890 3300046528 Ga0495642_0000530 Ga0495642_0000530_4661_5620 319
891 3300046528 Ga0495642_0003931 Ga0495642_0003931_347_1306 319
892 3300046528 Ga0495642_0011373 Ga0495642_0011373_2304_3263 319
893 3300046530 Ga0495654_0001074 Ga0495654_0001074_11156_12115 319
894 3300046530 Ga0495654_0004272 Ga0495654_0004272_2615_3574 319
895 3300046530 Ga0495654_0008140 Ga0495654_0008140_178_1137 319
896 3300046530 Ga0495654_0018594 Ga0495654_0018594_2333_3292 319
897 3300046530 Ga0495654_0032698 Ga0495654_0032698_1310_2269 319
898 3300046530 Ga0495654_0119126 Ga0495654_0119126_74_1033 319
899 3300046530 Ga0495654_0140575 Ga0495654_0140575_24_983 319
900 3300046535 Ga0495586_0039845 Ga0495586_0039845_194_1153 319
901 3300046536 Ga0495587_0003815 Ga0495587_0003815_4543_5502 319
902 3300046536 Ga0495587_0115538 Ga0495587_0115538_382_1341 319
903 3300046538 Ga0495609_0000061 Ga0495609_0000061_95138_96097 319
904 3300046538 Ga0495609_0000100 Ga0495609_0000100_32000_32959 319
905 3300046538 Ga0495609_0025169 Ga0495609_0025169_363_1322 319
906 3300046538 Ga0495609_0030557 Ga0495609_0030557_368_1327 319
907 3300046538 Ga0495609_0033362 Ga0495609_0033362_1331_2290 319
908 3300046538 Ga0495609_0057505 Ga0495609_0057505_48_1010 319
909 3300046542 Ga0495597_0023133 Ga0495597_0023133_1587_2546 319
910 3300046542 Ga0495597_0030573 Ga0495597_0030573_1126_2085 319
911 3300046542 Ga0495597_0032404 Ga0495597_0032404_1093_2052 319
912 3300046542 Ga0495597_0067047 Ga0495597_0067047_131_1090 319
913 3300046542 Ga0495597_0090955 Ga0495597_0090955_127_1086 319
914 3300046543 Ga0495645_0147243 Ga0495645_0147243_29_988 319
915 3300046557 Ga0495622_0008643 Ga0495622_0008643_2398_3357 319
916 3300046557 Ga0495622_0017305 Ga0495622_0017305_349_1308 319
917 3300046557 Ga0495622_0058951 Ga0495622_0058951_394_1353 319
918 3300046558 Ga0495633_0030976 Ga0495633_0030976_1306_2265 319
919 3300046616 Ga0495668_0008556 Ga0495668_0008556_2929_3888 319
920 3300046616 Ga0495668_0009359 Ga0495668_0009359_4681_5640 319
921 3300046616 Ga0495668_0025629 Ga0495668_0025629_215_1174 319
922 3300046616 Ga0495668_0033263 Ga0495668_0033263_1737_2696 319
923 3300046616 Ga0495668_0036664 Ga0495668_0036664_395_1354 319
924 3300046642 Ga0495634_0012719 Ga0495634_0012719_384_1343 319
925 3300046642 Ga0495634_0090380 Ga0495634_0090380_120_1079 319
926 3300046648 Ga0495611_0000539 Ga0495611_0000539_20142_21101 319
927 3300046648 Ga0495611_0001529 Ga0495611_0001529_4024_4983 319
928 3300046648 Ga0495611_0059730 Ga0495611_0059730_432_1391 319
929 3300046660 Ga0495625_0000147 Ga0495625_0000147_95289_96248 319
930 3300046660 Ga0495625_0023415 Ga0495625_0023415_3370_4329 319
931 3300046660 Ga0495625_0059005 Ga0495625_0059005_1373_2332 319
932 3300046660 Ga0495625_0107502 Ga0495625_0107502_135_1094 319
933 3300046663 Ga0495635_0000604 Ga0495635_0000604_18615_19574 319
934 3300046664 Ga0495659_0002389 Ga0495659_0002389_4692_5651 319
935 3300046664 Ga0495659_0004322 Ga0495659_0004322_346_1305 319
936 3300046665 Ga0495661_0000282 Ga0495661_0000282_43941_44900 319
937 3300046665 Ga0495661_0000315 Ga0495661_0000315_30376_31335 319
938 3300046665 Ga0495661_0002401 Ga0495661_0002401_8970_9929 319
939 3300046665 Ga0495661_0014406 Ga0495661_0014406_3900_4859 319
940 3300046665 Ga0495661_0025512 Ga0495661_0025512_458_1417 319
941 3300046665 Ga0495661_0036084 Ga0495661_0036084_586_1545 319
942 3300046665 Ga0495661_0111889 Ga0495661_0111889_440_1399 319
943 3300046665 Ga0495661_0144908 Ga0495661_0144908_244_1203 319
944 3300046674 Ga0495588_0076149 Ga0495588_0076149_365_1324 319
945 3300046679 Ga0495623_0026764 Ga0495623_0026764_2270_3229 319
946 3300046680 Ga0495646_0031537 Ga0495646_0031537_1669_2628 319
947 3300046680 Ga0495646_0142047 Ga0495646_0142047_187_1146 319
948 3300046684 Ga0495669_0010487 Ga0495669_0010487_2610_3569 319
949 3300046689 Ga0495613_0027732 Ga0495613_0027732_1154_2113 319
950 3300046689 Ga0495613_0303292 Ga0495613_0303292_128_1087 319
951 3300046690 Ga0495624_0034097 Ga0495624_0034097_378_1337 319
952 3300046691 Ga0495670_0004276 Ga0495670_0004276_2075_3034 319
953 3300046691 Ga0495670_0031544 Ga0495670_0031544_1283_2242 319
954 3300046691 Ga0495670_0065003 Ga0495670_0065003_462_1421 319
955 3300046692 Ga0495671_0000471 Ga0495671_0000471_2348_3307 319
956 3300046692 Ga0495671_0004890 Ga0495671_0004890_3693_4652 319
957 3300046692 Ga0495671_0015315 Ga0495671_0015315_2134_3141 319
958 3300046692 Ga0495671_0030969 Ga0495671_0030969_389_1348 319
959 3300046692 Ga0495671_0047897 Ga0495671_0047897_1032_1991 319
960 3300046692 Ga0495671_0122815 Ga0495671_0122815_218_1177 319
961 3300046694 Ga0495649_0008675 Ga0495649_0008675_370_1329 319
962 3300046694 Ga0495649_0009370 Ga0495649_0009370_630_1589 319
963 3300046694 Ga0495649_0011587 Ga0495649_0011587_4151_5110 319
964 3300046694 Ga0495649_0024453 Ga0495649_0024453_2254_3213 319
965 3300046694 Ga0495649_0024463 Ga0495649_0024463_128_1087 319
966 3300046694 Ga0495649_0026853 Ga0495649_0026853_67_1026 319
967 3300046694 Ga0495649_0041235 Ga0495649_0041235_907_1866 319
968 3300046694 Ga0495649_0086350 Ga0495649_0086350_136_1095 319
969 3300046694 Ga0495649_0161274 Ga0495649_0161274_81_1040 319
970 3300046794 Ga0495589_0009577 Ga0495589_0009577_350_1309 319
971 3300046794 Ga0495589_0018147 Ga0495589_0018147_2283_3242 319
972 3300046794 Ga0495589_0036685 Ga0495589_0036685_105_1121 319
973 3300046794 Ga0495589_0050308 Ga0495589_0050308_87_1067 319
974 3300046794 Ga0495589_0073111 Ga0495589_0073111_330_1289 319
975 3300046794 Ga0495589_0089115 Ga0495589_0089115_359_1318 319
976 3300046810 Ga0495660_0002249 Ga0495660_0002249_4733_5692 319
977 3300046810 Ga0495660_0003663 Ga0495660_0003663_1842_2801 319
978 3300046810 Ga0495660_0024950 Ga0495660_0024950_59_1018 319
979 3300046810 Ga0495660_0044275 Ga0495660_0044275_1233_2192 319
980 3300046810 Ga0495660_0048195 Ga0495660_0048195_1236_2195 319
981 3300046810 Ga0495660_0053515 Ga0495660_0053515_313_1272 319
982 3300046810 Ga0495660_0057105 Ga0495660_0057105_941_1927 319
983 3300047317 Ga0495604_0017122 Ga0495604_0017122_2698_3657 319
984 3300047317 Ga0495604_0060498 Ga0495604_0060498_384_1343 319
985 3300047317 Ga0495604_0080944 Ga0495604_0080944_1337_2296 319
986 3300047319 Ga0495674_0032307 Ga0495674_0032307_3667_4626 319
987 3300047320 Ga0495672_0004877 Ga0495672_0004877_1397_2356 319
988 3300047320 Ga0495672_0012275 Ga0495672_0012275_412_1371 319
989 3300047320 Ga0495672_0014189 Ga0495672_0014189_4175_5134 319
990 3300047320 Ga0495672_0017754 Ga0495672_0017754_3700_4659 319
991 3300047320 Ga0495672_0031184 Ga0495672_0031184_2006_2965 319
992 3300047320 Ga0495672_0031509 Ga0495672_0031509_1990_2949 319
993 3300047320 Ga0495672_0037053 Ga0495672_0037053_63_1022 319
994 3300047320 Ga0495672_0052547 Ga0495672_0052547_800_1759 319
995 3300047320 Ga0495672_0060902 Ga0495672_0060902_154_1113 319
996 3300047320 Ga0495672_0061247 Ga0495672_0061247_793_1752 319
997 3300047320 Ga0495672_0111035 Ga0495672_0111035_170_1156 319
998 3300047320 Ga0495672_0132380 Ga0495672_0132380_289_1248 319
999 3300047321 Ga0495676_0000027 Ga0495676_0000027_45566_46525 319
1000 3300047321 Ga0495676_0024131 Ga0495676_0024131_4183_5142 319
1001 3300047322 Ga0495680_0002978 Ga0495680_0002978_5036_5995 319
1002 3300047322 Ga0495680_0064621 Ga0495680_0064621_1709_2668 319
1003 3300047322 Ga0495680_0088326 Ga0495680_0088326_137_1096 319
1004 3300047323 Ga0495683_0001020 Ga0495683_0001020_4632_5591 319
1005 3300047323 Ga0495683_0001698 Ga0495683_0001698_8031_8990 319
1006 3300047323 Ga0495683_0006921 Ga0495683_0006921_3698_4657 319
1007 3300047323 Ga0495683_0013630 Ga0495683_0013630_327_1286 319
1008 3300047323 Ga0495683_0036955 Ga0495683_0036955_1173_2132 319
1009 3300047323 Ga0495683_0066536 Ga0495683_0066536_727_1686 319
1010 3300047323 Ga0495683_0121746 Ga0495683_0121746_81_1040 319
1011 3300047443 Ga0495687_008752 Ga0495687_008752_4010_4969 319
1012 3300047443 Ga0495687_019335 Ga0495687_019335_365_1324 319
1013 3300047444 Ga0495675_0072084 Ga0495675_0072084_48_1007 319
1014 3300047445 Ga0495677_0003730 Ga0495677_0003730_344_1303 319
1015 3300047446 Ga0495679_000096 Ga0495679_000096_28961_29920 319
1016 3300047446 Ga0495679_005660 Ga0495679_005660_251_1231 319
1017 3300047446 Ga0495679_018601 Ga0495679_018601_1122_2081 319
1018 3300047469 Ga0495673_0001299 Ga0495673_0001299_17679_18638 319
1019 3300047469 Ga0495673_0001329 Ga0495673_0001329_5025_5984 319
1020 3300047469 Ga0495673_0001337 Ga0495673_0001337_5015_5974 319
1021 3300047469 Ga0495673_0004104 Ga0495673_0004104_3132_4091 319
1022 3300047469 Ga0495673_0005473 Ga0495673_0005473_1859_2818 319
1023 3300047469 Ga0495673_0005824 Ga0495673_0005824_81_1055 319
1024 3300047469 Ga0495673_0017126 Ga0495673_0017126_364_1323 319
1025 3300047469 Ga0495673_0030946 Ga0495673_0030946_1103_2089 319
1026 3300047469 Ga0495673_0044348 Ga0495673_0044348_977_1936 319
1027 3300047469 Ga0495673_0062745 Ga0495673_0062745_47_1006 319
1028 3300047469 Ga0495673_0095788 Ga0495673_0095788_180_1139 319
1029 3300047470 Ga0495681_0008700 Ga0495681_0008700_4972_5931 319
1030 3300047470 Ga0495681_0009013 Ga0495681_0009013_4918_5877 319
1031 3300047470 Ga0495681_0011503 Ga0495681_0011503_333_1292 319
1032 3300047470 Ga0495681_0019355 Ga0495681_0019355_2672_3631 319
1033 3300047470 Ga0495681_0023579 Ga0495681_0023579_1232_2191 319
1034 3300047470 Ga0495681_0066586 Ga0495681_0066586_327_1286 319
1035 3300047470 Ga0495681_0088152 Ga0495681_0088152_390_1349 319
1036 3300047472 Ga0495686_0016571 Ga0495686_0016571_3175_4134 319
1037 3300047472 Ga0495686_0037419 Ga0495686_0037419_418_1377 319
1038 3300047472 Ga0495686_0061776 Ga0495686_0061776_25_984 319
1039 3300047472 Ga0495686_0134454 Ga0495686_0134454_149_1108 319
1040 3300047673 Ga0495593_0028813 Ga0495593_0028813_366_1325 319
1041 3300047673 Ga0495593_0105229 Ga0495593_0105229_114_1073 319
1042 3300048088 Ga0495602_0091614 Ga0495602_0091614_274_1233 319
1043 3300048091 Ga0495626_0000067 Ga0495626_0000067_43920_44879 319
1044 3300048091 Ga0495626_0000507 Ga0495626_0000507_4433_5392 319
1045 3300048091 Ga0495626_0000684 Ga0495626_0000684_4676_5635 319
1046 3300048091 Ga0495626_0002907 Ga0495626_0002907_5242_6201 319
1047 3300048091 Ga0495626_0007520 Ga0495626_0007520_408_1367 319
1048 3300048091 Ga0495626_0010124 Ga0495626_0010124_81_1040 319
1049 3300048091 Ga0495626_0017435 Ga0495626_0017435_2491_3450 319
1050 3300048091 Ga0495626_0018889 Ga0495626_0018889_1663_2622 319
1051 3300048091 Ga0495626_0040640 Ga0495626_0040640_1094_2053 319
1052 3300048091 Ga0495626_0097113 Ga0495626_0097113_139_1125 319
1053 3300048905 Ga0496102_0017650 Ga0496102_0017650_321_1280 319
1054 3300048905 Ga0496102_0124175 Ga0496102_0124175_880_1839 319
1055 3300048905 Ga0496102_0208387 Ga0496102_0208387_77_1036 319
1056 3300048906 Ga0496103_0009954 Ga0496103_0009954_158_1117 319
1057 3300048907 Ga0496104_0397920 Ga0496104_0397920_163_1122 319
1058 3300048913 Ga0496110_0173561 Ga0496110_0173561_681_1640 319
1059 3300048913 Ga0496110_0306598 Ga0496110_0306598_83_1042 319
1060 3300048914 Ga0496111_0040892 Ga0496111_0040892_967_1926 319
1061 3300048919 Ga0496116_0000242 Ga0496116_0000242_93190_94149 319
1062 3300048919 Ga0496116_0002441 Ga0496116_0002441_14280_15239 319
1063 3300048919 Ga0496116_0015602 Ga0496116_0015602_3991_4950 319
1064 3300048919 Ga0496116_0016890 Ga0496116_0016890_4375_5334 319
1065 3300048919 Ga0496116_0143991 Ga0496116_0143991_135_1094 319
1066 3300048920 Ga0496117_0000270 Ga0496117_0000270_93179_94138 319
1067 3300048920 Ga0496117_0009764 Ga0496117_0009764_3308_4267 319
1068 3300048920 Ga0496117_0020455 Ga0496117_0020455_4274_5233 319
1069 3300048920 Ga0496117_0084105 Ga0496117_0084105_982_1941 319
1070 3300048920 Ga0496117_0114029 Ga0496117_0114029_328_1287 319
1071 3300048921 Ga0496118_0007753 Ga0496118_0007753_1588_2547 319
1072 3300048921 Ga0496118_0016858 Ga0496118_0016858_1351_2310 319
1073 3300048921 Ga0496118_0024056 Ga0496118_0024056_374_1333 319
1074 3300048921 Ga0496118_0030353 Ga0496118_0030353_1808_2767 319
1075 3300048921 Ga0496118_0068469 Ga0496118_0068469_604_1563 319
1076 3300048921 Ga0496118_0103282 Ga0496118_0103282_437_1396 319
1077 3300048921 Ga0496118_0119699 Ga0496118_0119699_623_1582 319
1078 3300048921 Ga0496118_0206938 Ga0496118_0206938_73_1032 319
1079 3300048923 Ga0496120_0006057 Ga0496120_0006057_3992_4951 319
1080 3300048924 Ga0496121_0000318 Ga0496121_0000318_5240_6199 319
1081 3300048924 Ga0496121_0001431 Ga0496121_0001431_23500_24459 319
1082 3300048924 Ga0496121_0003532 Ga0496121_0003532_8477_9436 319
1083 3300048924 Ga0496121_0090791 Ga0496121_0090791_139_1098 319
1084 3300048924 Ga0496121_0102831 Ga0496121_0102831_859_1818 319
1085 3300048925 Ga0496122_0002044 Ga0496122_0002044_15705_16664 319
1086 3300048925 Ga0496122_0072746 Ga0496122_0072746_566_1525 319
1087 3300048926 Ga0496123_0000243 Ga0496123_0000243_93143_94102 319
1088 3300048926 Ga0496123_0003264 Ga0496123_0003264_2124_3083 319
1089 3300048926 Ga0496123_0045948 Ga0496123_0045948_1769_2728 319
1090 3300048926 Ga0496123_0064851 Ga0496123_0064851_1028_1987 319
1091 3300048927 Ga0496124_0000751 Ga0496124_0000751_22091_23050 319
1092 3300048927 Ga0496124_0004281 Ga0496124_0004281_2322_3281 319
1093 3300048927 Ga0496124_0007674 Ga0496124_0007674_4794_5753 319
1094 3300048927 Ga0496124_0009354 Ga0496124_0009354_4516_5475 319
1095 3300048927 Ga0496124_0016449 Ga0496124_0016449_921_1880 319
1096 3300048927 Ga0496124_0028798 Ga0496124_0028798_3321_4280 319
1097 3300048927 Ga0496124_0143382 Ga0496124_0143382_644_1603 319
1098 3300048927 Ga0496124_0147283 Ga0496124_0147283_150_1109 319
1099 3300048927 Ga0496124_0265737 Ga0496124_0265737_138_1097 319
1100 3300048928 Ga0496125_0009328 Ga0496125_0009328_4554_5513 319
1101 3300048928 Ga0496125_0073867 Ga0496125_0073867_1571_2530 319
1102 3300048928 Ga0496125_0093947 Ga0496125_0093947_357_1316 319
1103 3300049459 Ga0495678_001871 Ga0495678_001871_7588_8547 319
1104 3300049459 Ga0495678_005859 Ga0495678_005859_2625_3584 319
1105 3300049459 Ga0495678_007267 Ga0495678_007267_4083_5042 319
1106 3300049459 Ga0495678_015613 Ga0495678_015613_2341_3300 319
1107 3300049459 Ga0495678_022409 Ga0495678_022409_28_987 319
1108 3300049459 Ga0495678_025410 Ga0495678_025410_1471_2430 319
1109 3300049459 Ga0495678_027770 Ga0495678_027770_511_1470 319
1110 3300049459 Ga0495678_028913 Ga0495678_028913_1194_2153 319
1111 3300049459 Ga0495678_045152 Ga0495678_045152_436_1395 319
1112 3300049460 Ga0495682_0000413 Ga0495682_0000413_5357_6316 319
1113 3300049460 Ga0495682_0012344 Ga0495682_0012344_77_1036 319
1114 3300049460 Ga0495682_0024734 Ga0495682_0024734_332_1300 319
1115 3300049758 Ga0501241_004287 Ga0501241_004287_1011_1970 319
1116 3300050489 nmdc:mga03683_104331_c1 nmdc:mga03683_104331_c1_244_1203 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

202

299

0.96

PF00551

Formyl_trans_N

Formyl transferase

1

178

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9709 5 313
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9647 5 313
3q0i-assembly1.cif.gz_A methionyl-trna formyltransferase from vibrio cholerae 0.963 5 312
3q0i-assembly1.cif.gz_A methionyl-trna formyltransferase from vibrio cholerae 0.9536 5 312
3r8x-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from yersinia pestis complexed with l-methionine 0.9462 1 311
ID Description Score Start End Superfamily
5uaiB02 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.9937 211 311 3.10.25.10
5uaiB02 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.9651 211 311 3.10.25.10
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9517 5 209 3.40.50.170
af_Q2FZ68_206_310_3.10.25.10 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.9423 211 311 3.10.25.10
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9422 5 209 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A3C1MXF4-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9664 152 314 GO:0004479
GO:0005829
AF-A0A449IHQ0-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9662 1 315 GO:0004479
GO:0005829
AF-A0A1J4VFA6-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9623 108 312 GO:0004479
GO:0005829
AF-A0A447KN32-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9588 103 311 GO:0004479
GO:0005829
AF-A0A7R8ZV97-F1-model_v4 Methionyl-tRNA formyltransferase, mitochondrial (EC 2.1.2.9) 0.9586 11 282 GO:0004479
GO:0005829
GO:0006629
GO:0008962

Feature Viewer

pLDDT pTM Quality
92.91 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map