F490275

General Info

Members Datasets Scaffolds Average Seq Length
1114 342 952 162

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10090210|Ga0105244_100902103
Length 187
Sequence MPLINLYTANSNHIKIMVYLTQMEIVVMAIPAYLWLKDDGGADIKGSVDVQDREGSIEIHSFAHGLHLPTDNMTGKITGTRVHSALTFEKEFDSSSPYLYKAVAKGQTLKSAEFKWYRINDAGQEVEYFNMLLEGVKVVSVCPLMHNCKNAGTEKHNHLEAVSLRYEKITWKHCDGNIMFSDAWNER

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
7 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
8 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
9 2547132181 Kosakonia sacchari SP1 Isolate Stem
10 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
11 2561511199 Enterobacter sp. R4-368 Isolate Nodule
12 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
13 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
14 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
15 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
16 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
17 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
18 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
19 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
20 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
21 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
22 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
23 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
24 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
25 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
26 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
27 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
28 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
29 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
30 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
31 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
32 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
33 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
34 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
35 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
36 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
37 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
38 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
39 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
40 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
41 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
42 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
43 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
44 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
45 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
46 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
47 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
48 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
49 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
50 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
51 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
52 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
53 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
54 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
55 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
56 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
57 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
58 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
59 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
60 2636415599 Klebsiella variicola DX120E Isolate Unclassified
61 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
62 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
63 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
64 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
65 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
66 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
67 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
68 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
69 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
70 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
71 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
72 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
73 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
74 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
75 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
76 2775507074 Klebsiella sp. D5A Isolate Unclassified
77 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
78 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
79 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
80 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
81 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
82 2821118458 Enterobacter asburiae 609 Isolate Unclassified
83 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
84 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
85 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
86 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
87 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
88 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
89 2847085930 Erwinia persicina B64 Isolate Bulb
90 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
91 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
92 2865014394 Pantoea sp. R-71966 Isolate Unclassified
93 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
94 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
95 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
96 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
97 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
98 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
99 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
100 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
101 2919150387 Rahnella aceris 1817 Isolate Unclassified
102 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
103 2927143783 Rahnella sp. 2050 Isolate Unclassified
104 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
105 2928058823 Ralstonia sp. 1138 Isolate Unclassified
106 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
107 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
108 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
109 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
110 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
111 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
112 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
113 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
114 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
115 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
116 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
117 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
118 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
119 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
120 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
121 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
122 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
123 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
124 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
125 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
126 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
127 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
128 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
129 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
130 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
131 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
132 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
133 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
134 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
135 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
136 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
137 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
138 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
139 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
140 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
141 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
142 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
143 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
144 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
145 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
146 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
147 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
148 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
149 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
150 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
151 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
152 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
153 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
154 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
155 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
156 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
157 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
158 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
159 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
160 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
161 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
162 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
163 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
164 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
165 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
166 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
167 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
168 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
169 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
170 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
171 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
172 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
173 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
174 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
175 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
176 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
177 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
178 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
179 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
180 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
190 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
193 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
206 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
211 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
212 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
213 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
221 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
222 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
225 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
226 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
227 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
228 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
229 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
230 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
231 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
232 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
235 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
236 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
237 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
243 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
244 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
245 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
256 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
257 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
260 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
261 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
264 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
265 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
268 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
274 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
289 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
297 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
298 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
318 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
319 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
326 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
327 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
328 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
333 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
334 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
335 640753048 Serratia proteamaculans 568 Isolate Endosphere
336 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
337 8018221730 Enterobacter sp. CM29 Isolate Unclassified
338 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
339 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
340 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
341 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
342 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.27
Metatranscriptomes 0
Isolates 13.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0.09
Endosphere 4.67
Nodule 3.14
Rhizoplane 6.46
Rhizosphere 59.34
Stem 0.09
Stem Tuber 0
Unclassified 26.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1116176 2162886007 Bacteria 4276
2 SwRhRL2b_contig_1388857 2162886007 Bacteria 3290
3 SwRhRL2b_contig_1984934 2162886007 Bacteria 2940
4 SwRhRL2b_contig_288352 2162886007 Bacteria 3762
5 JGI24739J22299_10026342 3300001989 Bacteria 2041
6 JGI24737J22298_10033958 3300001990 Bacteria 1583
7 JGI24735J21928_10015425 3300002067 Bacteria 2384
8 JGI25162J39368_1000010 3300002737 Bacteria 389629
9 JGI25162J39368_1000067 3300002737 Bacteria 129813
10 JGI25163J39215_1000115 3300002771 Bacteria 33567
11 JGI25163J39215_1000122 3300002771 Bacteria 32438
12 JGI25164J39214_1000003 3300002772 Bacteria 389390
13 JGI25164J39214_1000039 3300002772 Bacteria 129437
14 JGI25165J46597_1024405 3300003214 Bacteria 785
15 rootH1_10159771 3300003316 Bacteria 1062
16 rootH2_10021910 3300003320 Bacteria 6657
17 rootH2_10030435 3300003320 Bacteria 31171
18 rootH2_10045982 3300003320 Bacteria 32690
19 rootH2_10068894 3300003320 Bacteria 17138
20 rootH2_10315290 3300003320 Bacteria 2059
21 rootL2_10084213 3300003322 Bacteria 17016
22 rootH1_10054216 3300003323 Bacteria 1217
23 JGI25160J50197_1043116 3300003354 Bacteria 1019
24 Ga0055538_1000009 3300003751 Bacteria 389629
25 Ga0055538_1000052 3300003751 Bacteria 129813
26 Ga0055539_1000013 3300003752 Bacteria 389629
27 Ga0055539_1000077 3300003752 Bacteria 129445
28 Ga0055533_1000017 3300003756 Bacteria 389629
29 Ga0055533_1000083 3300003756 Bacteria 129813
30 Ga0055525_1000019 3300003759 Bacteria 389629
31 Ga0055525_1000110 3300003759 Bacteria 129813
32 Ga0055541_1000010 3300003841 Bacteria 389629
33 Ga0055541_1000054 3300003841 Bacteria 129813
34 Ga0058692_1000025 3300003856 Bacteria 217356
35 Ga0058692_1000251 3300003856 Bacteria 29580
36 Ga0058692_1000408 3300003856 Bacteria 20288
37 Ga0058692_1000529 3300003856 Bacteria 16557
38 Ga0058692_1000592 3300003856 Bacteria 15301
39 Ga0058692_1000690 3300003856 Bacteria 13901
40 Ga0058692_1000706 3300003856 Bacteria 13672
41 Ga0058692_1004649 3300003856 Bacteria 4041
42 Ga0058692_1007215 3300003856 Bacteria 2973
43 Ga0058692_1012090 3300003856 Bacteria 2058
44 Ga0058692_1026105 3300003856 Bacteria 1152
45 Ga0058692_1054332 3300003856 Bacteria 652
46 Ga0065703_1024204 3300005272 Bacteria 624
47 Ga0065714_10002884 3300005288 Bacteria 10102
48 Ga0065704_10000269 3300005289 Bacteria 43603
49 Ga0065704_10000544 3300005289 Bacteria 16923
50 Ga0065704_10000975 3300005289 Bacteria 18294
51 Ga0065704_10070896 3300005289 Bacteria 14909
52 Ga0065704_10071533 3300005289 Bacteria 10786
53 Ga0065704_10072828 3300005289 Bacteria 7952
54 Ga0065704_10074914 3300005289 Bacteria 5917
55 Ga0065704_10091184 3300005289 Bacteria 2735
56 Ga0065704_10115508 3300005289 Bacteria 1871
57 Ga0065704_10128739 3300005289 Bacteria 1658
58 Ga0065704_10227335 3300005289 Bacteria 1031
59 Ga0070658_10278579 3300005327 Bacteria 1423
60 Ga0070683_101693265 3300005329 Bacteria 608
61 Ga0070668_100007218 3300005347 Bacteria 8238
62 Ga0070668_100382211 3300005347 Bacteria 1198
63 Ga0070662_100033295 3300005457 Bacteria 3627
64 Ga0070665_100001598 3300005548 Bacteria 26073
65 Ga0070665_101005822 3300005548 Bacteria 846
66 Ga0068855_100145036 3300005563 Bacteria 2703
67 Ga0068857_100000540 3300005577 Bacteria 27448
68 Ga0075364_10004772 3300006051 Bacteria 7837
69 Ga0075364_10041139 3300006051 Bacteria 3000
70 Ga0075364_10102496 3300006051 Bacteria 1906
71 Ga0075364_10186918 3300006051 Bacteria 1403
72 Ga0075432_10000001 3300006058 Bacteria 64068
73 Ga0075432_10000449 3300006058 Bacteria 12141
74 Ga0075432_10005035 3300006058 Bacteria 4499
75 Ga0075366_10076526 3300006195 Bacteria 1997
76 Ga0075436_100022387 3300006914 Bacteria 4341
77 Ga0075436_100064656 3300006914 Bacteria 2529
78 Ga0075436_100814169 3300006914 Bacteria 696
79 Ga0079104_1000083 3300006946 Bacteria 137254
80 Ga0079104_1000555 3300006946 Bacteria 38528
81 Ga0079104_1000618 3300006946 Bacteria 34829
82 Ga0079104_1000852 3300006946 Bacteria 25363
83 Ga0079104_1000860 3300006946 Bacteria 25164
84 Ga0079104_1000946 3300006946 Bacteria 23075
85 Ga0079104_1000973 3300006946 Bacteria 22420
86 Ga0079104_1001090 3300006946 Bacteria 20273
87 Ga0079104_1001793 3300006946 Bacteria 13334
88 Ga0079104_1003138 3300006946 Bacteria 8026
89 Ga0079104_1004302 3300006946 Bacteria 6165
90 Ga0079104_1005874 3300006946 Bacteria 4782
91 Ga0105251_10001214 3300009011 Bacteria 22276
92 Ga0105251_10001984 3300009011 Bacteria 16652
93 Ga0105251_10002863 3300009011 Bacteria 13020
94 Ga0105251_10007168 3300009011 Bacteria 6930
95 Ga0105251_10007520 3300009011 Bacteria 6698
96 Ga0105251_10012397 3300009011 Bacteria 4822
97 Ga0105251_10013976 3300009011 Bacteria 4460
98 Ga0105251_10014550 3300009011 Bacteria 4341
99 Ga0105251_10017003 3300009011 Bacteria 3909
100 Ga0105251_10028718 3300009011 Bacteria 2807
101 Ga0105251_10030945 3300009011 Bacteria 2682
102 Ga0105251_10052349 3300009011 Bacteria 1944
103 Ga0105251_10074189 3300009011 Bacteria 1580
104 Ga0105251_10111049 3300009011 Bacteria 1249
105 Ga0105251_10113560 3300009011 Bacteria 1233
106 Ga0105251_10170810 3300009011 Bacteria 980
107 Ga0105251_10215431 3300009011 Bacteria 864
108 Ga0105251_10267265 3300009011 Bacteria 772
109 Ga0105251_10357144 3300009011 Bacteria 667
110 Ga0105251_10363571 3300009011 Bacteria 661
111 Ga0105244_10000298 3300009036 Bacteria 48389
112 Ga0105244_10000883 3300009036 Bacteria 25403
113 Ga0105244_10000972 3300009036 Bacteria 24082
114 Ga0105244_10001219 3300009036 Bacteria 21079
115 Ga0105244_10001509 3300009036 Bacteria 18595
116 Ga0105244_10001550 3300009036 Bacteria 18280
117 Ga0105244_10002018 3300009036 Bacteria 15653
118 Ga0105244_10008637 3300009036 Bacteria 6344
119 Ga0105244_10012009 3300009036 Bacteria 5150
120 Ga0105244_10014891 3300009036 Bacteria 4478
121 Ga0105244_10020695 3300009036 Bacteria 3651
122 Ga0105244_10048080 3300009036 Bacteria 2185
123 Ga0105244_10053421 3300009036 Bacteria 2053
124 Ga0105244_10054801 3300009036 Bacteria 2022
125 Ga0105244_10083790 3300009036 Bacteria 1575
126 Ga0105244_10090210 3300009036 Bacteria 1508
127 Ga0105244_10111139 3300009036 Bacteria 1333
128 Ga0105244_10112571 3300009036 Bacteria 1323
129 Ga0105244_10149869 3300009036 Bacteria 1118
130 Ga0105250_10000018 3300009092 Bacteria 246692
131 Ga0105250_10000378 3300009092 Bacteria 33263
132 Ga0105250_10000819 3300009092 Bacteria 18526
133 Ga0105250_10000991 3300009092 Bacteria 16500
134 Ga0105250_10001129 3300009092 Bacteria 15032
135 Ga0105250_10001311 3300009092 Bacteria 13623
136 Ga0105250_10002074 3300009092 Bacteria 10285
137 Ga0105250_10039027 3300009092 Bacteria 1904
138 Ga0105250_10100191 3300009092 Bacteria 1182
139 Ga0105250_10100426 3300009092 Bacteria 1180
140 Ga0105250_10366513 3300009092 Bacteria 633
141 Ga0105240_10011917 3300009093 Bacteria 12060
142 Ga0105240_10391989 3300009093 Bacteria 1566
143 Ga0105240_10471427 3300009093 Bacteria 1401
144 Ga0105247_10156540 3300009101 Bacteria 1505
145 Ga0105243_10789025 3300009148 Bacteria 935
146 Ga0105241_10695778 3300009174 Bacteria 927
147 Ga0105248_10974370 3300009177 Bacteria 958
148 Ga0105237_10074910 3300009545 Bacteria 3376
149 Ga0105237_11000517 3300009545 Bacteria 843
150 Ga0105238_10763569 3300009551 Bacteria 981
151 Ga0105239_10438403 3300010375 Bacteria 1481
152 Ga0105246_10004178 3300011119 Bacteria 8776
153 Ga0105246_10189198 3300011119 Bacteria 1592
154 Ga0157373_10002693 3300013100 Bacteria 13464
155 Ga0157373_10007838 3300013100 Bacteria 7942
156 Ga0157373_10020473 3300013100 Bacteria 4808
157 Ga0157373_10037932 3300013100 Bacteria 3452
158 Ga0157373_10111713 3300013100 Bacteria 1921
159 Ga0157373_10126488 3300013100 Bacteria 1797
160 Ga0157373_11007862 3300013100 Bacteria 622
161 Ga0157373_11024891 3300013100 Bacteria 617
162 Ga0157371_10000020 3300013102 Bacteria 304987
163 Ga0157371_10000098 3300013102 Bacteria 134017
164 Ga0157371_10000152 3300013102 Bacteria 101330
165 Ga0157371_10000317 3300013102 Bacteria 62655
166 Ga0157371_10000331 3300013102 Bacteria 60985
167 Ga0157371_10002597 3300013102 Bacteria 17141
168 Ga0157371_10003635 3300013102 Bacteria 13884
169 Ga0157371_10004175 3300013102 Bacteria 12729
170 Ga0157371_10007066 3300013102 Bacteria 9134
171 Ga0157371_10523210 3300013102 Bacteria 877
172 Ga0157371_10681118 3300013102 Bacteria 769
173 Ga0157371_10801238 3300013102 Bacteria 710
174 Ga0157370_10001138 3300013104 Bacteria 33224
175 Ga0157370_10004938 3300013104 Bacteria 15098
176 Ga0157370_10007201 3300013104 Bacteria 12140
177 Ga0157369_10041502 3300013105 Bacteria 5022
178 Ga0157369_10180925 3300013105 Bacteria 2218
179 Ga0157369_10437709 3300013105 Bacteria 1355
180 Ga0157369_10942676 3300013105 Bacteria 885
181 Ga0157374_10379990 3300013296 Bacteria 1407
182 Ga0163162_10056578 3300013306 Bacteria 3950
183 Ga0163162_10110638 3300013306 Bacteria 2844
184 Ga0163162_11493981 3300013306 Bacteria 770
185 Ga0157372_10012980 3300013307 Bacteria 8887
186 Ga0157372_10013473 3300013307 Bacteria 8738
187 Ga0157372_10017023 3300013307 Bacteria 7802
188 Ga0157372_10017921 3300013307 Bacteria 7610
189 Ga0157372_10039418 3300013307 Bacteria 5214
190 Ga0157372_10040522 3300013307 Bacteria 5145
191 Ga0157372_10045838 3300013307 Bacteria 4852
192 Ga0157372_10125027 3300013307 Bacteria 2957
193 Ga0157372_11743741 3300013307 Bacteria 716
194 Ga0182008_10022523 3300014497 Bacteria 3226
195 Ga0182006_1000009 3300015261 Bacteria 438243
196 Ga0182006_1000071 3300015261 Bacteria 135189
197 Ga0182006_1043697 3300015261 Bacteria 1751
198 Ga0182007_10013779 3300015262 Bacteria 3072
199 Ga0183366_1001 3300015679 Bacteria 2743932
200 Ga0183366_1002 3300015679 Bacteria 791639
201 Ga0183370_1001 3300015680 Bacteria 2743932
202 Ga0183370_1002 3300015680 Bacteria 791639
203 Ga0183369_1001 3300015685 Bacteria 2743932
204 Ga0183369_1002 3300015685 Bacteria 791621
205 Ga0183368_1001 3300015687 Bacteria 2743932
206 Ga0183368_1005 3300015687 Bacteria 791621
207 Ga0183360_10050 3300015689 Bacteria 1786
208 Ga0183361_11658 3300016635 Bacteria 1155
209 Ga0163161_10000417 3300017792 Bacteria 35758
210 Ga0163161_10000535 3300017792 Bacteria 31016
211 Ga0163161_10003557 3300017792 Bacteria 10910
212 Ga0163161_10034132 3300017792 Bacteria 3638
213 Ga0163161_10096099 3300017792 Bacteria 2199
214 Ga0163161_10114291 3300017792 Bacteria 2022
215 Ga0213876_10000214 3300021384 Bacteria 58407
216 Ga0209760_100067 3300025207 Bacteria 87264
217 Ga0209760_100070 3300025207 Bacteria 83162
218 Ga0209784_100012 3300025224 Bacteria 535823
219 Ga0209566_100010 3300025225 Bacteria 535823
220 Ga0209674_100023 3300025226 Bacteria 535823
221 Ga0209563_100027 3300025230 Bacteria 535823
222 Ga0207427_100017 3300025231 Bacteria 535823
223 Ga0209437_100029 3300025233 Bacteria 535823
224 Ga0209677_100014 3300025253 Bacteria 535823
225 Ga0209148_1025937 3300025254 Bacteria 914
226 Ga0209233_1000953 3300025261 Bacteria 12515
227 Ga0209233_1001138 3300025261 Bacteria 10847
228 Ga0209676_1042156 3300025292 Bacteria 1269
229 Ga0209564_1021915 3300025295 Bacteria 2277
230 Ga0207426_1001593 3300025302 Bacteria 18131
231 Ga0207696_1000013 3300025711 Bacteria 524881
232 Ga0207696_1000066 3300025711 Bacteria 231203
233 Ga0207696_1000397 3300025711 Bacteria 40737
234 Ga0207696_1000529 3300025711 Bacteria 31502
235 Ga0207696_1000672 3300025711 Bacteria 24051
236 Ga0207696_1000799 3300025711 Bacteria 20385
237 Ga0207696_1000900 3300025711 Bacteria 18421
238 Ga0207696_1001086 3300025711 Bacteria 16023
239 Ga0207696_1002012 3300025711 Bacteria 10285
240 Ga0207696_1020801 3300025711 Bacteria 2109
241 Ga0207696_1026348 3300025711 Bacteria 1800
242 Ga0207696_1065924 3300025711 Bacteria 1012
243 Ga0207655_1000002 3300025728 Bacteria 1148694
244 Ga0207655_1000042 3300025728 Bacteria 333039
245 Ga0207655_1000047 3300025728 Bacteria 302548
246 Ga0207655_1000050 3300025728 Bacteria 294923
247 Ga0207655_1000075 3300025728 Bacteria 226658
248 Ga0207655_1000144 3300025728 Bacteria 136801
249 Ga0207655_1000314 3300025728 Bacteria 72243
250 Ga0207655_1000439 3300025728 Bacteria 55457
251 Ga0207655_1000676 3300025728 Bacteria 39882
252 Ga0207655_1000838 3300025728 Bacteria 33088
253 Ga0207655_1001127 3300025728 Bacteria 26100
254 Ga0207655_1006615 3300025728 Bacteria 7644
255 Ga0207655_1007471 3300025728 Bacteria 7087
256 Ga0207655_1014959 3300025728 Bacteria 4345
257 Ga0207655_1020274 3300025728 Bacteria 3424
258 Ga0207655_1076620 3300025728 Bacteria 1222
259 Ga0207655_1078197 3300025728 Bacteria 1203
260 Ga0207655_1202188 3300025728 Bacteria 592
261 Ga0207713_1000019 3300025735 Bacteria 361225
262 Ga0207713_1000029 3300025735 Bacteria 285054
263 Ga0207713_1000035 3300025735 Bacteria 263228
264 Ga0207713_1000478 3300025735 Bacteria 41433
265 Ga0207713_1000766 3300025735 Bacteria 29687
266 Ga0207713_1001154 3300025735 Bacteria 22311
267 Ga0207713_1004180 3300025735 Bacteria 9471
268 Ga0207713_1006604 3300025735 Bacteria 7041
269 Ga0207713_1009765 3300025735 Bacteria 5376
270 Ga0207713_1015715 3300025735 Bacteria 3870
271 Ga0207713_1018388 3300025735 Bacteria 3463
272 Ga0207713_1019238 3300025735 Bacteria 3349
273 Ga0207713_1027370 3300025735 Bacteria 2591
274 Ga0207713_1044361 3300025735 Bacteria 1827
275 Ga0207713_1045414 3300025735 Bacteria 1794
276 Ga0207713_1047995 3300025735 Bacteria 1723
277 Ga0207713_1061172 3300025735 Bacteria 1434
278 Ga0207713_1072732 3300025735 Bacteria 1264
279 Ga0207713_1082468 3300025735 Bacteria 1152
280 Ga0207713_1092294 3300025735 Bacteria 1061
281 Ga0207710_10461487 3300025900 Bacteria 657
282 Ga0207647_10099486 3300025904 Bacteria 1727
283 Ga0207705_10810475 3300025909 Bacteria 726
284 Ga0207695_10078883 3300025913 Bacteria 3339
285 Ga0207695_10270573 3300025913 Bacteria 1595
286 Ga0207695_10598145 3300025913 Bacteria 984
287 Ga0207671_10142957 3300025914 Bacteria 1844
288 Ga0207671_10581116 3300025914 Bacteria 893
289 Ga0207671_10594199 3300025914 Bacteria 882
290 Ga0207706_10027897 3300025933 Bacteria 5047
291 Ga0207667_10320960 3300025949 Bacteria 1582
292 Ga0207668_10048968 3300025972 Bacteria 2902
293 Ga0207674_10000214 3300026116 Bacteria 71833
294 Ga0209281_1000109 3300027111 Bacteria 216504
295 Ga0209281_1000130 3300027111 Bacteria 191756
296 Ga0209281_1000143 3300027111 Bacteria 174070
297 Ga0209281_1000239 3300027111 Bacteria 111505
298 Ga0209281_1000284 3300027111 Bacteria 95457
299 Ga0209281_1000340 3300027111 Bacteria 79749
300 Ga0209281_1000352 3300027111 Bacteria 75822
301 Ga0209281_1000378 3300027111 Bacteria 70786
302 Ga0209281_1000419 3300027111 Bacteria 63849
303 Ga0209281_1000443 3300027111 Bacteria 59526
304 Ga0209281_1000613 3300027111 Bacteria 40172
305 Ga0209281_1000872 3300027111 Bacteria 26193
306 Ga0209281_1001207 3300027111 Bacteria 17535
307 Ga0209281_1001215 3300027111 Bacteria 17396
308 Ga0209281_1001700 3300027111 Bacteria 11449
309 Ga0209281_1002328 3300027111 Bacteria 7892
310 Ga0209281_1008168 3300027111 Bacteria 2566
311 Ga0209371_1000001 3300027312 Bacteria 2771503
312 Ga0209371_1000036 3300027312 Bacteria 367250
313 Ga0209371_1000108 3300027312 Bacteria 141822
314 Ga0209371_1000249 3300027312 Bacteria 66713
315 Ga0209371_1000278 3300027312 Bacteria 59137
316 Ga0209371_1000528 3300027312 Bacteria 36453
317 Ga0209371_1000532 3300027312 Bacteria 36173
318 Ga0209371_1000664 3300027312 Bacteria 30015
319 Ga0209371_1001264 3300027312 Bacteria 17946
320 Ga0209371_1001551 3300027312 Bacteria 15166
321 Ga0209371_1001883 3300027312 Bacteria 12871
322 Ga0209371_1002589 3300027312 Bacteria 9945
323 Ga0209371_1002877 3300027312 Bacteria 9053
324 Ga0209371_1003068 3300027312 Bacteria 8566
325 Ga0209371_1003547 3300027312 Bacteria 7491
326 Ga0209371_1003942 3300027312 Bacteria 6807
327 Ga0209371_1005282 3300027312 Bacteria 5204
328 Ga0209371_1005651 3300027312 Bacteria 4895
329 Ga0209371_1007490 3300027312 Bacteria 3790
330 Ga0207428_10000155 3300027907 Bacteria 93472
331 Ga0207428_10029760 3300027907 Bacteria 4520
332 Ga0268266_10001140 3300028379 Bacteria 32988
333 Ga0268266_10384723 3300028379 Bacteria 1324
334 Ga0268266_10981552 3300028379 Bacteria 817
335 Ga0265338_10016048 3300028800 Bacteria 8179
336 Ga0237817_13135 3300030083 Bacteria 680
337 Ga0268256_1000001 3300030500 Bacteria 2771065
338 Ga0268256_1000040 3300030500 Bacteria 348002
339 Ga0268256_1000076 3300030500 Bacteria 178295
340 Ga0268256_1000231 3300030500 Bacteria 59137
341 Ga0268256_1000256 3300030500 Bacteria 56357
342 Ga0268256_1000493 3300030500 Bacteria 33610
343 Ga0268256_1000563 3300030500 Bacteria 30009
344 Ga0268256_1001062 3300030500 Bacteria 18284
345 Ga0268256_1001325 3300030500 Bacteria 15166
346 Ga0268256_1001456 3300030500 Bacteria 14211
347 Ga0268256_1001620 3300030500 Bacteria 13032
348 Ga0268256_1001717 3300030500 Bacteria 12457
349 Ga0268256_1002282 3300030500 Bacteria 9948
350 Ga0268256_1002754 3300030500 Bacteria 8566
351 Ga0268256_1003246 3300030500 Bacteria 7491
352 Ga0268256_1005130 3300030500 Bacteria 5214
353 Ga0268256_1005267 3300030500 Bacteria 5130
354 Ga0268256_1005414 3300030500 Bacteria 5011
355 Ga0268256_1007724 3300030500 Bacteria 3790
356 Ga0268256_1011535 3300030500 Bacteria 2789
357 Ga0268256_1055530 3300030500 Bacteria 815
358 Ga0307511_10351545 3300030521 Bacteria 633
359 Ga0265316_10229264 3300031344 Bacteria 1368
360 Ga0265316_10943168 3300031344 Bacteria 602
361 Ga0307408_100002112 3300031548 Bacteria 14288
362 Ga0307413_10052041 3300031824 Bacteria 2471
363 Ga0307412_10001707 3300031911 Bacteria 12149
364 Ga0307412_10004085 3300031911 Bacteria 8132
365 Ga0307510_10046032 3300033180 Bacteria 4698
366 Ga0436365_1279401 3300039437 Bacteria 294819
367 Ga0436361_0927016 3300039447 Bacteria 1132
368 Ga0439436_0000421 3300041404 Bacteria 10692
369 Ga0439438_000001 3300041405 Bacteria 1263568
370 Ga0439438_000182 3300041405 Bacteria 28081
371 Ga0439438_001009 3300041405 Bacteria 12585
372 Ga0439438_003553 3300041405 Bacteria 6261
373 Ga0439438_005546 3300041405 Bacteria 4618
374 Ga0439438_005716 3300041405 Bacteria 4526
375 Ga0439438_008341 3300041405 Bacteria 3444
376 Ga0439438_065487 3300041405 Bacteria 904
377 Ga0439447_000630 3300041407 Bacteria 13135
378 Ga0439447_001263 3300041407 Bacteria 9209
379 Ga0439447_003288 3300041407 Bacteria 5749
380 Ga0439447_023613 3300041407 Bacteria 1600
381 Ga0439466_0001819 3300041411 Bacteria 8357
382 Ga0439466_0007318 3300041411 Bacteria 4181
383 Ga0439466_0062443 3300041411 Bacteria 1197
384 Ga0439466_0066067 3300041411 Bacteria 1158
385 Ga0451807_2567597 3300041486 Bacteria 1184
386 Ga0451851_0824615 3300041507 Bacteria 1796
387 Ga0439432_005097 3300042006 Bacteria 4751
388 Ga0439432_005935 3300042006 Bacteria 4386
389 Ga0439432_011378 3300042006 Bacteria 3067
390 Ga0439432_026013 3300042006 Bacteria 1916
391 Ga0439432_026964 3300042006 Bacteria 1879
392 Ga0439432_027437 3300042006 Bacteria 1859
393 Ga0439432_041917 3300042006 Bacteria 1448
394 Ga0439452_000109 3300042010 Bacteria 67189
395 Ga0439452_000132 3300042010 Bacteria 56901
396 Ga0439452_000144 3300042010 Bacteria 53542
397 Ga0439452_000593 3300042010 Bacteria 18631
398 Ga0439452_001307 3300042010 Bacteria 10486
399 Ga0439452_003083 3300042010 Bacteria 5913
400 Ga0439452_008008 3300042010 Bacteria 3199
401 Ga0439452_012964 3300042010 Bacteria 2352
402 Ga0439452_076049 3300042010 Bacteria 735
403 Ga0439452_088376 3300042010 Bacteria 671
404 Ga0439456_010605 3300042013 Bacteria 1904
405 Ga0439463_018878 3300042016 Bacteria 1717
406 Ga0450923_010535 3300042125 Bacteria 1643
407 Ga0450902_005088 3300042137 Bacteria 1977
408 Ga0450902_012726 3300042137 Bacteria 1349
409 Ga0450903_002554 3300042138 Bacteria 3229
410 Ga0439446_0011832 3300042156 Bacteria 2375
411 Ga0439434_0000782 3300042435 Bacteria 9162
412 Ga0450893_0092904 3300042532 Bacteria 607
413 Ga0466969_0082280 3300044656 Bacteria 1534
414 Ga0466981_0000004 3300044669 Bacteria 171461
415 Ga0466981_0305472 3300044669 Bacteria 997
416 Ga0466966_0002832 3300044684 Bacteria 11415
417 Ga0466961_0052627 3300044693 Bacteria 2598
418 Ga0466957_0040905 3300044842 Bacteria 2801
419 Ga0466959_0023933 3300045049 Bacteria 4521
420 Ga0495617_004643 3300046452 Bacteria 4968
421 Ga0495617_009951 3300046452 Bacteria 3260
422 Ga0495617_043595 3300046452 Bacteria 1498
423 Ga0495627_000023 3300046453 Bacteria 251113
424 Ga0495627_001183 3300046453 Bacteria 16537
425 Ga0495627_017740 3300046453 Bacteria 2412
426 Ga0495627_041229 3300046453 Bacteria 1418
427 Ga0495627_042386 3300046453 Bacteria 1395
428 Ga0495590_0012563 3300046457 Bacteria 3140
429 Ga0495591_000017 3300046458 Bacteria 238400
430 Ga0495591_000558 3300046458 Bacteria 28646
431 Ga0495591_000768 3300046458 Bacteria 23178
432 Ga0495591_001381 3300046458 Bacteria 15197
433 Ga0495591_001484 3300046458 Bacteria 14513
434 Ga0495591_001642 3300046458 Bacteria 13488
435 Ga0495591_002873 3300046458 Bacteria 9250
436 Ga0495591_004272 3300046458 Bacteria 7064
437 Ga0495591_005120 3300046458 Bacteria 6153
438 Ga0495591_007139 3300046458 Bacteria 4796
439 Ga0495591_012859 3300046458 Bacteria 3092
440 Ga0495591_014904 3300046458 Bacteria 2769
441 Ga0495591_018517 3300046458 Bacteria 2360
442 Ga0495591_019914 3300046458 Bacteria 2232
443 Ga0495591_023403 3300046458 Bacteria 1979
444 Ga0495638_0002143 3300046460 Bacteria 16584
445 Ga0495638_0006559 3300046460 Bacteria 8469
446 Ga0495638_0006966 3300046460 Bacteria 8162
447 Ga0495638_0008397 3300046460 Bacteria 7324
448 Ga0495638_0024674 3300046460 Bacteria 3915
449 Ga0495638_0087533 3300046460 Bacteria 1881
450 Ga0495653_0026007 3300046463 Bacteria 4697
451 Ga0495650_0000088 3300046471 Bacteria 234769
452 Ga0495650_0000102 3300046471 Bacteria 211007
453 Ga0495650_0000692 3300046471 Bacteria 43528
454 Ga0495650_0003618 3300046471 Bacteria 11135
455 Ga0495650_0004230 3300046471 Bacteria 9939
456 Ga0495650_0009928 3300046471 Bacteria 5361
457 Ga0495650_0012743 3300046471 Bacteria 4503
458 Ga0495650_0044859 3300046471 Bacteria 1865
459 Ga0495580_0011532 3300046472 Bacteria 6837
460 Ga0495605_0000026 3300046474 Bacteria 221832
461 Ga0495605_0000067 3300046474 Bacteria 138871
462 Ga0495605_0000355 3300046474 Bacteria 44115
463 Ga0495605_0011659 3300046474 Bacteria 4891
464 Ga0495605_0012558 3300046474 Bacteria 4693
465 Ga0495605_0022807 3300046474 Bacteria 3300
466 Ga0495605_0046002 3300046474 Bacteria 2147
467 Ga0495605_0048887 3300046474 Bacteria 2068
468 Ga0495605_0109132 3300046474 Bacteria 1264
469 Ga0495664_0360353 3300046477 Bacteria 875
470 Ga0495584_0003419 3300046491 Bacteria 8742
471 Ga0495584_0007923 3300046491 Bacteria 5524
472 Ga0495584_0011381 3300046491 Bacteria 4556
473 Ga0495585_0003783 3300046492 Bacteria 10095
474 Ga0495585_0029471 3300046492 Bacteria 3123
475 Ga0495585_0144886 3300046492 Bacteria 1242
476 Ga0495594_0015797 3300046499 Bacteria 3970
477 Ga0495596_0000128 3300046500 Bacteria 52409
478 Ga0495596_0078039 3300046500 Bacteria 1285
479 Ga0495607_0004348 3300046501 Bacteria 10449
480 Ga0495607_0010162 3300046501 Bacteria 6333
481 Ga0495607_0010576 3300046501 Bacteria 6194
482 Ga0495607_0013109 3300046501 Bacteria 5442
483 Ga0495607_0036031 3300046501 Bacteria 2986
484 Ga0495607_0101794 3300046501 Bacteria 1537
485 Ga0495583_0000043 3300046506 Bacteria 230804
486 Ga0495583_0000334 3300046506 Bacteria 74547
487 Ga0495583_0000457 3300046506 Bacteria 60714
488 Ga0495583_0003126 3300046506 Bacteria 13077
489 Ga0495583_0046723 3300046506 Bacteria 1995
490 Ga0495606_0000032 3300046507 Bacteria 248690
491 Ga0495606_0000314 3300046507 Bacteria 83573
492 Ga0495606_0001287 3300046507 Bacteria 34737
493 Ga0495606_0007406 3300046507 Bacteria 9839
494 Ga0495606_0016109 3300046507 Bacteria 5720
495 Ga0495606_0019087 3300046507 Bacteria 5115
496 Ga0495610_0001881 3300046512 Bacteria 18115
497 Ga0495610_0003940 3300046512 Bacteria 11242
498 Ga0495610_0006268 3300046512 Bacteria 8240
499 Ga0495610_0044985 3300046512 Bacteria 2187
500 Ga0495610_0056149 3300046512 Bacteria 1894
501 Ga0495616_0013698 3300046513 Bacteria 4566
502 Ga0495616_0016246 3300046513 Bacteria 4123
503 Ga0495616_0072832 3300046513 Bacteria 1658
504 Ga0495620_0000114 3300046515 Bacteria 64421
505 Ga0495620_0000656 3300046515 Bacteria 21332
506 Ga0495620_0002257 3300046515 Bacteria 11154
507 Ga0495620_0005229 3300046515 Bacteria 7263
508 Ga0495620_0022126 3300046515 Bacteria 3070
509 Ga0495620_0054735 3300046515 Bacteria 1684
510 Ga0495620_0088305 3300046515 Bacteria 1246
511 Ga0495620_0212659 3300046515 Bacteria 741
512 Ga0495628_0409858 3300046516 Bacteria 989
513 Ga0495631_0000609 3300046518 Bacteria 23559
514 Ga0495631_0002216 3300046518 Bacteria 11184
515 Ga0495631_0025951 3300046518 Bacteria 2694
516 Ga0495632_0003142 3300046519 Bacteria 11934
517 Ga0495632_0012302 3300046519 Bacteria 4939
518 Ga0495632_0012435 3300046519 Bacteria 4911
519 Ga0495632_0037465 3300046519 Bacteria 2460
520 Ga0495637_0000082 3300046520 Bacteria 73771
521 Ga0495637_0006292 3300046520 Bacteria 5975
522 Ga0495637_0010895 3300046520 Bacteria 4382
523 Ga0495637_0014783 3300046520 Bacteria 3677
524 Ga0495637_0082297 3300046520 Bacteria 1282
525 Ga0495637_0099927 3300046520 Bacteria 1135
526 Ga0495637_0281469 3300046520 Bacteria 593
527 Ga0495643_0006000 3300046522 Bacteria 8105
528 Ga0495643_0019424 3300046522 Bacteria 3931
529 Ga0495643_0101770 3300046522 Bacteria 1471
530 Ga0495643_0206637 3300046522 Bacteria 939
531 Ga0495644_0000367 3300046523 Bacteria 20417
532 Ga0495644_0001147 3300046523 Bacteria 10877
533 Ga0495644_0003581 3300046523 Bacteria 6127
534 Ga0495648_0000368 3300046524 Bacteria 49770
535 Ga0495648_0000996 3300046524 Bacteria 29117
536 Ga0495648_0009739 3300046524 Bacteria 7401
537 Ga0495648_0012042 3300046524 Bacteria 6479
538 Ga0495648_0016305 3300046524 Bacteria 5361
539 Ga0495648_0027249 3300046524 Bacteria 3829
540 Ga0495648_0058441 3300046524 Bacteria 2306
541 Ga0495648_0088454 3300046524 Bacteria 1741
542 Ga0495648_0097007 3300046524 Bacteria 1636
543 Ga0495642_0293589 3300046528 Bacteria 712
544 Ga0495652_0077686 3300046529 Bacteria 2751
545 Ga0495654_0000027 3300046530 Bacteria 232420
546 Ga0495654_0000168 3300046530 Bacteria 64288
547 Ga0495654_0000936 3300046530 Bacteria 21636
548 Ga0495654_0002279 3300046530 Bacteria 12415
549 Ga0495654_0003688 3300046530 Bacteria 9298
550 Ga0495654_0003711 3300046530 Bacteria 9268
551 Ga0495654_0008050 3300046530 Bacteria 5849
552 Ga0495654_0009699 3300046530 Bacteria 5270
553 Ga0495654_0015805 3300046530 Bacteria 4002
554 Ga0495654_0022456 3300046530 Bacteria 3276
555 Ga0495654_0029800 3300046530 Bacteria 2781
556 Ga0495654_0049552 3300046530 Bacteria 2057
557 Ga0495654_0061715 3300046530 Bacteria 1798
558 Ga0495654_0063844 3300046530 Bacteria 1762
559 Ga0495654_0095915 3300046530 Bacteria 1371
560 Ga0495654_0209229 3300046530 Bacteria 830
561 Ga0495665_0030222 3300046531 Bacteria 2900
562 Ga0495609_0000036 3300046538 Bacteria 186358
563 Ga0495609_0000043 3300046538 Bacteria 166590
564 Ga0495609_0000118 3300046538 Bacteria 92011
565 Ga0495609_0000353 3300046538 Bacteria 40090
566 Ga0495597_0001293 3300046542 Bacteria 18431
567 Ga0495597_0002746 3300046542 Bacteria 10844
568 Ga0495597_0007423 3300046542 Bacteria 5569
569 Ga0495597_0015252 3300046542 Bacteria 3640
570 Ga0495597_0016111 3300046542 Bacteria 3533
571 Ga0495597_0019756 3300046542 Bacteria 3147
572 Ga0495597_0020269 3300046542 Bacteria 3098
573 Ga0495645_0046855 3300046543 Bacteria 3151
574 Ga0495622_0087277 3300046557 Bacteria 1434
575 Ga0495633_0000229 3300046558 Bacteria 68402
576 Ga0495633_0002494 3300046558 Bacteria 12954
577 Ga0495633_0286607 3300046558 Bacteria 749
578 Ga0495656_0141742 3300046615 Bacteria 1153
579 Ga0495668_0002560 3300046616 Bacteria 14770
580 Ga0495668_0049908 3300046616 Bacteria 2320
581 Ga0495668_0225474 3300046616 Bacteria 1026
582 Ga0495611_0001403 3300046648 Bacteria 12021
583 Ga0495611_0001841 3300046648 Bacteria 10145
584 Ga0495611_0002903 3300046648 Bacteria 7650
585 Ga0495611_0004141 3300046648 Bacteria 6308
586 Ga0495611_0104821 3300046648 Bacteria 1315
587 Ga0495625_0000039 3300046660 Bacteria 209762
588 Ga0495625_0000101 3300046660 Bacteria 139139
589 Ga0495625_0009255 3300046660 Bacteria 8266
590 Ga0495625_0011449 3300046660 Bacteria 7234
591 Ga0495661_0000024 3300046665 Bacteria 188844
592 Ga0495661_0000545 3300046665 Bacteria 38934
593 Ga0495661_0002293 3300046665 Bacteria 14767
594 Ga0495661_0003960 3300046665 Bacteria 10817
595 Ga0495661_0051768 3300046665 Bacteria 2477
596 Ga0495588_0001806 3300046674 Bacteria 9122
597 Ga0495588_0009525 3300046674 Bacteria 4493
598 Ga0495588_0075585 3300046674 Bacteria 1755
599 Ga0495624_0309802 3300046690 Bacteria 951
600 Ga0495670_0001972 3300046691 Bacteria 10078
601 Ga0495670_0004301 3300046691 Bacteria 6975
602 Ga0495670_0033302 3300046691 Bacteria 2563
603 Ga0495671_0000355 3300046692 Bacteria 38082
604 Ga0495671_0001787 3300046692 Bacteria 13908
605 Ga0495671_0006014 3300046692 Bacteria 7051
606 Ga0495671_0016210 3300046692 Bacteria 3983
607 Ga0495671_0029624 3300046692 Bacteria 2809
608 Ga0495671_0049474 3300046692 Bacteria 2095
609 Ga0495649_0000032 3300046694 Bacteria 151121
610 Ga0495649_0000271 3300046694 Bacteria 46152
611 Ga0495649_0000522 3300046694 Bacteria 32722
612 Ga0495649_0000730 3300046694 Bacteria 26728
613 Ga0495649_0001159 3300046694 Bacteria 20469
614 Ga0495649_0001636 3300046694 Bacteria 16660
615 Ga0495649_0005565 3300046694 Bacteria 7976
616 Ga0495649_0020753 3300046694 Bacteria 3681
617 Ga0495649_0027715 3300046694 Bacteria 3142
618 Ga0495649_0102920 3300046694 Bacteria 1517
619 Ga0495649_0199777 3300046694 Bacteria 1038
620 Ga0495649_0204579 3300046694 Bacteria 1024
621 Ga0495589_0000028 3300046794 Bacteria 179523
622 Ga0495589_0000169 3300046794 Bacteria 59795
623 Ga0495589_0000988 3300046794 Bacteria 17305
624 Ga0495589_0002325 3300046794 Bacteria 10680
625 Ga0495589_0002877 3300046794 Bacteria 9531
626 Ga0495589_0004778 3300046794 Bacteria 7200
627 Ga0495660_0000006 3300046810 Bacteria 571713
628 Ga0495660_0000010 3300046810 Bacteria 370769
629 Ga0495660_0000635 3300046810 Bacteria 27337
630 Ga0495660_0004434 3300046810 Bacteria 8489
631 Ga0495660_0004548 3300046810 Bacteria 8379
632 Ga0495660_0017362 3300046810 Bacteria 4143
633 Ga0495660_0023109 3300046810 Bacteria 3548
634 Ga0495660_0027295 3300046810 Bacteria 3231
635 Ga0495660_0186639 3300046810 Bacteria 999
636 Ga0495660_0215917 3300046810 Bacteria 907
637 Ga0495604_0865151 3300047317 Bacteria 566
638 Ga0495674_0015748 3300047319 Bacteria 7058
639 Ga0495672_0000039 3300047320 Bacteria 272506
640 Ga0495672_0000052 3300047320 Bacteria 236266
641 Ga0495672_0000062 3300047320 Bacteria 211745
642 Ga0495672_0000104 3300047320 Bacteria 134535
643 Ga0495672_0008182 3300047320 Bacteria 7757
644 Ga0495672_0018818 3300047320 Bacteria 4574
645 Ga0495672_0032265 3300047320 Bacteria 3260
646 Ga0495672_0202035 3300047320 Bacteria 993
647 Ga0495676_0000071 3300047321 Bacteria 76592
648 Ga0495683_0000003 3300047323 Bacteria 383992
649 Ga0495683_0000828 3300047323 Bacteria 22065
650 Ga0495683_0000865 3300047323 Bacteria 21370
651 Ga0495683_0001140 3300047323 Bacteria 18282
652 Ga0495683_0001901 3300047323 Bacteria 13058
653 Ga0495683_0016844 3300047323 Bacteria 3792
654 Ga0495683_0025915 3300047323 Bacteria 3002
655 Ga0495683_0034067 3300047323 Bacteria 2590
656 Ga0495683_0040788 3300047323 Bacteria 2344
657 Ga0495683_0041535 3300047323 Bacteria 2320
658 Ga0495683_0075740 3300047323 Bacteria 1647
659 Ga0495687_044680 3300047443 Bacteria 1923
660 Ga0495679_000051 3300047446 Bacteria 121243
661 Ga0495679_000157 3300047446 Bacteria 61342
662 Ga0495679_000191 3300047446 Bacteria 54219
663 Ga0495679_000475 3300047446 Bacteria 29071
664 Ga0495679_000798 3300047446 Bacteria 20006
665 Ga0495679_001706 3300047446 Bacteria 12157
666 Ga0495679_003326 3300047446 Bacteria 7775
667 Ga0495679_011880 3300047446 Bacteria 3343
668 Ga0495679_040018 3300047446 Bacteria 1459
669 Ga0495673_0000007 3300047469 Bacteria 796722
670 Ga0495673_0000086 3300047469 Bacteria 192268
671 Ga0495673_0003637 3300047469 Bacteria 10070
672 Ga0495673_0022481 3300047469 Bacteria 3089
673 Ga0495673_0041711 3300047469 Bacteria 2064
674 Ga0495681_0000241 3300047470 Bacteria 45418
675 Ga0495681_0001888 3300047470 Bacteria 15382
676 Ga0495681_0002039 3300047470 Bacteria 14726
677 Ga0495681_0002736 3300047470 Bacteria 12479
678 Ga0495681_0014380 3300047470 Bacteria 4539
679 Ga0495681_0019610 3300047470 Bacteria 3687
680 Ga0495681_0032912 3300047470 Bacteria 2603
681 Ga0495686_0116662 3300047472 Bacteria 1595
682 Ga0495602_0018327 3300048088 Bacteria 6997
683 Ga0495626_0000045 3300048091 Bacteria 164931
684 Ga0495626_0009096 3300048091 Bacteria 5388
685 Ga0495626_0148187 3300048091 Bacteria 991
686 Ga0495626_0155765 3300048091 Bacteria 960
687 Ga0496100_0413478 3300048903 Bacteria 1029
688 Ga0496101_0000150 3300048904 Bacteria 60044
689 Ga0496101_0012069 3300048904 Bacteria 5756
690 Ga0496101_0046364 3300048904 Bacteria 3117
691 Ga0496102_0031509 3300048905 Bacteria 4756
692 Ga0496103_0005059 3300048906 Bacteria 7948
693 Ga0496104_0007607 3300048907 Bacteria 9593
694 Ga0496104_0039228 3300048907 Bacteria 4434
695 Ga0496104_0115149 3300048907 Bacteria 2579
696 Ga0496104_0371667 3300048907 Bacteria 1342
697 Ga0496105_0002937 3300048908 Bacteria 12518
698 Ga0496105_0005369 3300048908 Bacteria 9717
699 Ga0496105_0147091 3300048908 Bacteria 1937
700 Ga0496106_0014248 3300048909 Bacteria 5873
701 Ga0496107_0009588 3300048910 Bacteria 6714
702 Ga0496110_0059769 3300048913 Bacteria 3360
703 Ga0496110_0295810 3300048913 Bacteria 1475
704 Ga0496111_0042879 3300048914 Bacteria 3250
705 Ga0496112_0377797 3300048915 Bacteria 1358
706 Ga0496113_0091294 3300048916 Bacteria 2347
707 Ga0496116_0000020 3300048919 Bacteria 501307
708 Ga0496116_0000145 3300048919 Bacteria 145993
709 Ga0496116_0000462 3300048919 Bacteria 56233
710 Ga0496116_0000712 3300048919 Bacteria 42647
711 Ga0496116_0004705 3300048919 Bacteria 12895
712 Ga0496116_0004836 3300048919 Bacteria 12705
713 Ga0496116_0005378 3300048919 Bacteria 11916
714 Ga0496116_0007367 3300048919 Bacteria 9779
715 Ga0496116_0007585 3300048919 Bacteria 9589
716 Ga0496116_0008305 3300048919 Bacteria 9024
717 Ga0496116_0015460 3300048919 Bacteria 6032
718 Ga0496116_0022516 3300048919 Bacteria 4719
719 Ga0496116_0040187 3300048919 Bacteria 3223
720 Ga0496116_0044974 3300048919 Bacteria 2992
721 Ga0496116_0124060 3300048919 Bacteria 1487
722 Ga0496117_0000078 3300048920 Bacteria 227068
723 Ga0496117_0001316 3300048920 Bacteria 36551
724 Ga0496117_0001546 3300048920 Bacteria 32720
725 Ga0496117_0002315 3300048920 Bacteria 24429
726 Ga0496117_0003030 3300048920 Bacteria 20148
727 Ga0496117_0004270 3300048920 Bacteria 15932
728 Ga0496117_0005638 3300048920 Bacteria 13064
729 Ga0496117_0006600 3300048920 Bacteria 11663
730 Ga0496117_0008685 3300048920 Bacteria 9603
731 Ga0496117_0015725 3300048920 Bacteria 6427
732 Ga0496117_0017321 3300048920 Bacteria 6023
733 Ga0496117_0025330 3300048920 Bacteria 4666
734 Ga0496117_0031661 3300048920 Bacteria 4033
735 Ga0496117_0037663 3300048920 Bacteria 3599
736 Ga0496117_0046683 3300048920 Bacteria 3113
737 Ga0496117_0049803 3300048920 Bacteria 2975
738 Ga0496117_0063330 3300048920 Bacteria 2528
739 Ga0496117_0064618 3300048920 Bacteria 2494
740 Ga0496117_0094765 3300048920 Bacteria 1909
741 Ga0496117_0186487 3300048920 Bacteria 1186
742 Ga0496117_0209669 3300048920 Bacteria 1093
743 Ga0496117_0250789 3300048920 Bacteria 965
744 Ga0496117_0252010 3300048920 Bacteria 962
745 Ga0496117_0455327 3300048920 Bacteria 632
746 Ga0496118_0000059 3300048921 Bacteria 226336
747 Ga0496118_0000205 3300048921 Bacteria 104149
748 Ga0496118_0000767 3300048921 Bacteria 51508
749 Ga0496118_0001133 3300048921 Bacteria 41145
750 Ga0496118_0001161 3300048921 Bacteria 40611
751 Ga0496118_0001430 3300048921 Bacteria 35935
752 Ga0496118_0001552 3300048921 Bacteria 34152
753 Ga0496118_0003609 3300048921 Bacteria 19228
754 Ga0496118_0005858 3300048921 Bacteria 13775
755 Ga0496118_0009915 3300048921 Bacteria 9519
756 Ga0496118_0011471 3300048921 Bacteria 8643
757 Ga0496118_0021502 3300048921 Bacteria 5673
758 Ga0496118_0023427 3300048921 Bacteria 5362
759 Ga0496118_0030212 3300048921 Bacteria 4526
760 Ga0496118_0065371 3300048921 Bacteria 2662
761 Ga0496118_0067081 3300048921 Bacteria 2615
762 Ga0496118_0077159 3300048921 Bacteria 2364
763 Ga0496118_0087539 3300048921 Bacteria 2159
764 Ga0496118_0115151 3300048921 Bacteria 1770
765 Ga0496118_0135034 3300048921 Bacteria 1576
766 Ga0496118_0162484 3300048921 Bacteria 1378
767 Ga0496119_0000264 3300048922 Bacteria 74383
768 Ga0496119_0001327 3300048922 Bacteria 30412
769 Ga0496119_0002023 3300048922 Bacteria 22964
770 Ga0496119_0004029 3300048922 Bacteria 14846
771 Ga0496119_0004379 3300048922 Bacteria 14086
772 Ga0496119_0007142 3300048922 Bacteria 10133
773 Ga0496119_0013870 3300048922 Bacteria 6362
774 Ga0496119_0015218 3300048922 Bacteria 5948
775 Ga0496119_0035209 3300048922 Bacteria 3283
776 Ga0496119_0043031 3300048922 Bacteria 2858
777 Ga0496119_0045567 3300048922 Bacteria 2747
778 Ga0496119_0063766 3300048922 Bacteria 2190
779 Ga0496119_0138332 3300048922 Bacteria 1318
780 Ga0496119_0216682 3300048922 Bacteria 982
781 Ga0496119_0237536 3300048922 Bacteria 924
782 Ga0496119_0239119 3300048922 Bacteria 920
783 Ga0496119_0254809 3300048922 Bacteria 883
784 Ga0496120_0000141 3300048923 Bacteria 120086
785 Ga0496120_0000327 3300048923 Bacteria 79029
786 Ga0496120_0000445 3300048923 Bacteria 65470
787 Ga0496120_0001107 3300048923 Bacteria 35107
788 Ga0496120_0001215 3300048923 Bacteria 32564
789 Ga0496120_0001360 3300048923 Bacteria 30031
790 Ga0496120_0004312 3300048923 Bacteria 12047
791 Ga0496120_0004646 3300048923 Bacteria 11363
792 Ga0496120_0006547 3300048923 Bacteria 8901
793 Ga0496120_0006581 3300048923 Bacteria 8875
794 Ga0496120_0008985 3300048923 Bacteria 7149
795 Ga0496120_0010197 3300048923 Bacteria 6578
796 Ga0496120_0063296 3300048923 Bacteria 2058
797 Ga0496120_0080015 3300048923 Bacteria 1772
798 Ga0496120_0106935 3300048923 Bacteria 1468
799 Ga0496120_0211065 3300048923 Bacteria 933
800 Ga0496121_0000224 3300048924 Bacteria 122378
801 Ga0496121_0000558 3300048924 Bacteria 70344
802 Ga0496121_0000565 3300048924 Bacteria 69798
803 Ga0496121_0000830 3300048924 Bacteria 56289
804 Ga0496121_0002504 3300048924 Bacteria 27914
805 Ga0496121_0002549 3300048924 Bacteria 27629
806 Ga0496121_0002795 3300048924 Bacteria 25847
807 Ga0496121_0003284 3300048924 Bacteria 23213
808 Ga0496121_0010643 3300048924 Bacteria 10327
809 Ga0496121_0013368 3300048924 Bacteria 8829
810 Ga0496121_0016031 3300048924 Bacteria 7768
811 Ga0496121_0019344 3300048924 Bacteria 6812
812 Ga0496121_0025399 3300048924 Bacteria 5620
813 Ga0496121_0041973 3300048924 Bacteria 3988
814 Ga0496121_0142901 3300048924 Bacteria 1772
815 Ga0496121_0177334 3300048924 Bacteria 1542
816 Ga0496122_0000005 3300048925 Bacteria 630659
817 Ga0496122_0000010 3300048925 Bacteria 547417
818 Ga0496122_0000645 3300048925 Bacteria 70755
819 Ga0496122_0001029 3300048925 Bacteria 49078
820 Ga0496122_0001508 3300048925 Bacteria 37124
821 Ga0496122_0001789 3300048925 Bacteria 32915
822 Ga0496122_0002048 3300048925 Bacteria 29921
823 Ga0496122_0002879 3300048925 Bacteria 23552
824 Ga0496122_0002965 3300048925 Bacteria 23138
825 Ga0496122_0004295 3300048925 Bacteria 17858
826 Ga0496122_0007709 3300048925 Bacteria 11856
827 Ga0496122_0011561 3300048925 Bacteria 8917
828 Ga0496122_0014358 3300048925 Bacteria 7664
829 Ga0496122_0020273 3300048925 Bacteria 6019
830 Ga0496122_0032633 3300048925 Bacteria 4301
831 Ga0496122_0033078 3300048925 Bacteria 4260
832 Ga0496122_0033961 3300048925 Bacteria 4185
833 Ga0496122_0063056 3300048925 Bacteria 2708
834 Ga0496122_0063318 3300048925 Bacteria 2699
835 Ga0496122_0116391 3300048925 Bacteria 1738
836 Ga0496122_0141137 3300048925 Bacteria 1507
837 Ga0496122_0184104 3300048925 Bacteria 1241
838 Ga0496123_0000008 3300048926 Bacteria 630628
839 Ga0496123_0000025 3300048926 Bacteria 323956
840 Ga0496123_0000469 3300048926 Bacteria 70755
841 Ga0496123_0000841 3300048926 Bacteria 49062
842 Ga0496123_0001242 3300048926 Bacteria 36927
843 Ga0496123_0001528 3300048926 Bacteria 31950
844 Ga0496123_0001788 3300048926 Bacteria 28317
845 Ga0496123_0001823 3300048926 Bacteria 28019
846 Ga0496123_0002844 3300048926 Bacteria 20456
847 Ga0496123_0002895 3300048926 Bacteria 20096
848 Ga0496123_0002916 3300048926 Bacteria 20004
849 Ga0496123_0003475 3300048926 Bacteria 17612
850 Ga0496123_0004906 3300048926 Bacteria 13737
851 Ga0496123_0012914 3300048926 Bacteria 7065
852 Ga0496123_0013270 3300048926 Bacteria 6939
853 Ga0496123_0025403 3300048926 Bacteria 4467
854 Ga0496123_0029777 3300048926 Bacteria 4009
855 Ga0496123_0032734 3300048926 Bacteria 3755
856 Ga0496123_0033735 3300048926 Bacteria 3677
857 Ga0496123_0034851 3300048926 Bacteria 3597
858 Ga0496123_0050245 3300048926 Bacteria 2787
859 Ga0496123_0053098 3300048926 Bacteria 2682
860 Ga0496123_0054983 3300048926 Bacteria 2615
861 Ga0496123_0094062 3300048926 Bacteria 1767
862 Ga0496124_0000084 3300048927 Bacteria 204993
863 Ga0496124_0000288 3300048927 Bacteria 95203
864 Ga0496124_0000416 3300048927 Bacteria 76111
865 Ga0496124_0000642 3300048927 Bacteria 57689
866 Ga0496124_0000753 3300048927 Bacteria 53138
867 Ga0496124_0001178 3300048927 Bacteria 40836
868 Ga0496124_0001402 3300048927 Bacteria 36072
869 Ga0496124_0002501 3300048927 Bacteria 23917
870 Ga0496124_0002703 3300048927 Bacteria 22670
871 Ga0496124_0003768 3300048927 Bacteria 18237
872 Ga0496124_0012450 3300048927 Bacteria 8396
873 Ga0496124_0016541 3300048927 Bacteria 7004
874 Ga0496124_0023314 3300048927 Bacteria 5651
875 Ga0496124_0024459 3300048927 Bacteria 5489
876 Ga0496124_0032060 3300048927 Bacteria 4646
877 Ga0496124_0033825 3300048927 Bacteria 4493
878 Ga0496124_0034505 3300048927 Bacteria 4439
879 Ga0496124_0037192 3300048927 Bacteria 4236
880 Ga0496124_0041109 3300048927 Bacteria 3994
881 Ga0496124_0046009 3300048927 Bacteria 3739
882 Ga0496124_0049192 3300048927 Bacteria 3597
883 Ga0496124_0051778 3300048927 Bacteria 3492
884 Ga0496124_0066279 3300048927 Bacteria 3007
885 Ga0496124_0074346 3300048927 Bacteria 2809
886 Ga0496124_0094667 3300048927 Bacteria 2428
887 Ga0496124_0115381 3300048927 Bacteria 2155
888 Ga0496124_0115610 3300048927 Bacteria 2152
889 Ga0496124_0147151 3300048927 Bacteria 1852
890 Ga0496124_0220114 3300048927 Bacteria 1428
891 Ga0496124_0289186 3300048927 Bacteria 1190
892 Ga0496124_0327659 3300048927 Bacteria 1093
893 Ga0496124_0396929 3300048927 Bacteria 958
894 Ga0496124_0399441 3300048927 Bacteria 954
895 Ga0496124_0582746 3300048927 Bacteria 731
896 Ga0496125_0000032 3300048928 Bacteria 354078
897 Ga0496125_0000054 3300048928 Bacteria 278377
898 Ga0496125_0000071 3300048928 Bacteria 243580
899 Ga0496125_0000418 3300048928 Bacteria 79070
900 Ga0496125_0000784 3300048928 Bacteria 51876
901 Ga0496125_0001043 3300048928 Bacteria 42850
902 Ga0496125_0001149 3300048928 Bacteria 40140
903 Ga0496125_0006561 3300048928 Bacteria 12541
904 Ga0496125_0024677 3300048928 Bacteria 5522
905 Ga0496125_0045337 3300048928 Bacteria 3702
906 Ga0496125_0063729 3300048928 Bacteria 2936
907 Ga0496125_0070771 3300048928 Bacteria 2729
908 Ga0496126_0000050 3300048929 Bacteria 316466
909 Ga0496126_0000304 3300048929 Bacteria 104416
910 Ga0496126_0000472 3300048929 Bacteria 79898
911 Ga0496126_0001428 3300048929 Bacteria 37548
912 Ga0496126_0002072 3300048929 Bacteria 28126
913 Ga0496126_0003854 3300048929 Bacteria 18534
914 Ga0496126_0008329 3300048929 Bacteria 11195
915 Ga0496126_0009538 3300048929 Bacteria 10296
916 Ga0496126_0013021 3300048929 Bacteria 8488
917 Ga0496126_0079606 3300048929 Bacteria 2900
918 Ga0496126_0085675 3300048929 Bacteria 2777
919 Ga0496126_0094931 3300048929 Bacteria 2616
920 Ga0496126_0095506 3300048929 Bacteria 2607
921 Ga0496126_0104192 3300048929 Bacteria 2478
922 Ga0496126_0137549 3300048929 Bacteria 2105
923 Ga0496126_0139150 3300048929 Bacteria 2091
924 Ga0496126_0149658 3300048929 Bacteria 2001
925 Ga0496126_0150946 3300048929 Bacteria 1991
926 Ga0496126_0161837 3300048929 Bacteria 1912
927 Ga0496126_0163870 3300048929 Bacteria 1898
928 Ga0496126_0234589 3300048929 Bacteria 1535
929 Ga0496126_0245940 3300048929 Bacteria 1492
930 Ga0496126_0248071 3300048929 Bacteria 1484
931 Ga0496126_0305269 3300048929 Bacteria 1311
932 Ga0496126_0339058 3300048929 Bacteria 1232
933 Ga0496126_0372984 3300048929 Bacteria 1163
934 Ga0496126_0568192 3300048929 Bacteria 897
935 Ga0495678_000007 3300049459 Bacteria 448039
936 Ga0495678_000421 3300049459 Bacteria 42699
937 Ga0495678_002861 3300049459 Bacteria 11167
938 Ga0495678_003209 3300049459 Bacteria 10293
939 Ga0495678_013961 3300049459 Bacteria 3750
940 Ga0495682_0000003 3300049460 Bacteria 515787
941 Ga0495682_0000111 3300049460 Bacteria 71459
942 Ga0495682_0015703 3300049460 Bacteria 2869
943 Ga0501269_003450 3300049766 Bacteria 1914
944 Ga0501226_000242 3300049853 Bacteria 8456
945 nmdc:mga00v17_8605_c1 3300050491 Bacteria 5494
946 nmdc:mga00v17_90625_c1 3300050491 Bacteria 1920
947 nmdc:mga0k408_9113_c1 3300050493 Bacteria 4944
948 nmdc:mga08x19_105349_c1 3300050514 Bacteria 1875
949 nmdc:mga08x19_54434_c1 3300050514 Bacteria 2576
950 Ga0500618_001340 3300053125 Bacteria 11258
951 Ga0500621_000007 3300053126 Bacteria 214505
952 Ga0500634_0000423 3300053161 Bacteria 13699

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2513237082 2513558206 139
2 3300006914 Ga0075436_100814169 Ga0075436_1008141691 148
3 3300046458 Ga0495591_000558 Ga0495591_000558_23638_24129 148
4 3300046507 Ga0495606_0000032 Ga0495606_0000032_94337_94828 148
5 3300046528 Ga0495642_0293589 Ga0495642_0293589_35_511 149
6 3300046810 Ga0495660_0215917 Ga0495660_0215917_302_787 150
7 iso_pu_bacteria 2501025504 2501409678 150
8 2162886007 SwRhRL2b_contig_288352 SwRhRL2b_0910.00001720 151
9 3300005289 Ga0065704_10000269 Ga0065704_1000026925 151
10 3300005289 Ga0065704_10071533 Ga0065704_100715333 151
11 3300006051 Ga0075364_10004772 Ga0075364_100047725 151
12 3300009011 Ga0105251_10001214 Ga0105251_100012145 151
13 3300009011 Ga0105251_10030945 Ga0105251_100309453 151
14 3300013100 Ga0157373_10037932 Ga0157373_100379322 151
15 3300013104 Ga0157370_10007201 Ga0157370_100072018 151
16 3300025735 Ga0207713_1000035 Ga0207713_100003533 151
17 3300025735 Ga0207713_1018388 Ga0207713_10183882 151
18 3300042010 Ga0439452_076049 Ga0439452_076049_213_704 151
19 3300048919 Ga0496116_0000712 Ga0496116_0000712_28915_29406 151
20 3300048920 Ga0496117_0049803 Ga0496117_0049803_1407_1898 151
21 3300048920 Ga0496117_0209669 Ga0496117_0209669_113_604 151
22 3300048921 Ga0496118_0023427 Ga0496118_0023427_2385_2876 151
23 3300048922 Ga0496119_0013870 Ga0496119_0013870_2576_3067 151
24 3300048923 Ga0496120_0001215 Ga0496120_0001215_6991_7482 151
25 3300048924 Ga0496121_0000830 Ga0496121_0000830_21968_22459 151
26 3300048925 Ga0496122_0000645 Ga0496122_0000645_2061_2552 151
27 3300048926 Ga0496123_0000469 Ga0496123_0000469_68204_68695 151
28 3300048927 Ga0496124_0327659 Ga0496124_0327659_78_569 151
29 3300050491 nmdc:mga00v17_8605_c1 nmdc:mga00v17_8605_c1_3792_4283 151
30 iso_pu_bacteria 8055092621 8055097301 152
31 3300046530 Ga0495654_0022456 Ga0495654_0022456_201_668 153
32 iso_pu_bacteria 2969079654 2969082643 153
33 3300009011 Ga0105251_10007520 Ga0105251_100075202 154
34 3300009092 Ga0105250_10366513 Ga0105250_103665131 154
35 3300009093 Ga0105240_10391989 Ga0105240_103919892 154
36 3300009174 Ga0105241_10695778 Ga0105241_106957781 154
37 3300009177 Ga0105248_10974370 Ga0105248_109743702 154
38 3300009551 Ga0105238_10763569 Ga0105238_107635691 154
39 3300010375 Ga0105239_10438403 Ga0105239_104384032 154
40 3300011119 Ga0105246_10189198 Ga0105246_101891982 154
41 3300013102 Ga0157371_10003635 Ga0157371_100036355 154
42 3300013104 Ga0157370_10001138 Ga0157370_1000113812 154
43 3300013105 Ga0157369_10437709 Ga0157369_104377092 154
44 3300013296 Ga0157374_10379990 Ga0157374_103799902 154
45 3300013307 Ga0157372_11743741 Ga0157372_117437412 154
46 3300041486 Ga0451807_2567597 Ga0451807_2567597_568_1041 154
47 3300044656 Ga0466969_0082280 Ga0466969_0082280_626_1093 154
48 3300044684 Ga0466966_0002832 Ga0466966_0002832_1338_1805 154
49 3300046463 Ga0495653_0026007 Ga0495653_0026007_2163_2630 154
50 3300046472 Ga0495580_0011532 Ga0495580_0011532_4175_4642 154
51 3300046477 Ga0495664_0360353 Ga0495664_0360353_37_504 154
52 3300046506 Ga0495583_0046723 Ga0495583_0046723_781_1248 154
53 3300046507 Ga0495606_0019087 Ga0495606_0019087_997_1464 154
54 3300046515 Ga0495620_0088305 Ga0495620_0088305_628_1095 154
55 3300046516 Ga0495628_0409858 Ga0495628_0409858_139_606 154
56 3300046519 Ga0495632_0012302 Ga0495632_0012302_1677_2168 154
57 3300046524 Ga0495648_0097007 Ga0495648_0097007_952_1419 154
58 3300046531 Ga0495665_0030222 Ga0495665_0030222_1830_2297 154
59 3300046690 Ga0495624_0309802 Ga0495624_0309802_369_836 154
60 3300046694 Ga0495649_0027715 Ga0495649_0027715_1664_2131 154
61 3300046694 Ga0495649_0102920 Ga0495649_0102920_1035_1502 154
62 3300047317 Ga0495604_0865151 Ga0495604_0865151_63_530 154
63 3300047319 Ga0495674_0015748 Ga0495674_0015748_6174_6641 154
64 3300047320 Ga0495672_0202035 Ga0495672_0202035_378_845 154
65 3300047323 Ga0495683_0025915 Ga0495683_0025915_197_664 154
66 3300047323 Ga0495683_0075740 Ga0495683_0075740_927_1394 154
67 3300047443 Ga0495687_044680 Ga0495687_044680_1203_1670 154
68 3300047469 Ga0495673_0041711 Ga0495673_0041711_617_1084 154
69 3300048088 Ga0495602_0018327 Ga0495602_0018327_6399_6866 154
70 3300048904 Ga0496101_0012069 Ga0496101_0012069_3192_3659 154
71 3300048905 Ga0496102_0031509 Ga0496102_0031509_4020_4487 154
72 3300048906 Ga0496103_0005059 Ga0496103_0005059_5023_5490 154
73 3300048907 Ga0496104_0039228 Ga0496104_0039228_3181_3648 154
74 3300048907 Ga0496104_0371667 Ga0496104_0371667_480_953 154
75 3300048908 Ga0496105_0147091 Ga0496105_0147091_1255_1728 154
76 3300048909 Ga0496106_0014248 Ga0496106_0014248_3587_4054 154
77 3300048910 Ga0496107_0009588 Ga0496107_0009588_3510_3977 154
78 3300048913 Ga0496110_0059769 Ga0496110_0059769_398_865 154
79 3300048914 Ga0496111_0042879 Ga0496111_0042879_628_1095 154
80 3300048915 Ga0496112_0377797 Ga0496112_0377797_267_734 154
81 3300048916 Ga0496113_0091294 Ga0496113_0091294_373_840 154
82 3300048919 Ga0496116_0124060 Ga0496116_0124060_311_778 154
83 3300048920 Ga0496117_0001316 Ga0496117_0001316_25151_25618 154
84 3300048920 Ga0496117_0025330 Ga0496117_0025330_2939_3412 154
85 3300048920 Ga0496117_0037663 Ga0496117_0037663_493_960 154
86 3300048921 Ga0496118_0005858 Ga0496118_0005858_9381_9848 154
87 3300048921 Ga0496118_0067081 Ga0496118_0067081_508_981 154
88 3300048922 Ga0496119_0035209 Ga0496119_0035209_289_762 154
89 3300048922 Ga0496119_0138332 Ga0496119_0138332_385_852 154
90 3300048923 Ga0496120_0004312 Ga0496120_0004312_6786_7259 154
91 3300048924 Ga0496121_0016031 Ga0496121_0016031_4699_5172 154
92 3300048924 Ga0496121_0041973 Ga0496121_0041973_2641_3108 154
93 3300048925 Ga0496122_0033078 Ga0496122_0033078_612_1079 154
94 3300048925 Ga0496122_0063318 Ga0496122_0063318_1636_2109 154
95 3300048926 Ga0496123_0033735 Ga0496123_0033735_2154_2627 154
96 3300048926 Ga0496123_0053098 Ga0496123_0053098_532_999 154
97 3300048927 Ga0496124_0049192 Ga0496124_0049192_2640_3107 154
98 3300048927 Ga0496124_0147151 Ga0496124_0147151_264_737 154
99 3300048928 Ga0496125_0024677 Ga0496125_0024677_3569_4036 154
100 3300048929 Ga0496126_0000050 Ga0496126_0000050_133151_133618 154
101 3300048929 Ga0496126_0079606 Ga0496126_0079606_174_647 154
102 3300053125 Ga0500618_001340 Ga0500618_001340_6161_6628 154
103 iso_pu_bacteria 2585427591 2585827036 154
104 iso_pu_bacteria 2585427591 2585828518 154
105 iso_pu_bacteria 2585427592 2585832938 154
106 iso_pu_bacteria 2585427592 2585833091 154
107 iso_pu_bacteria 2844528606 2844531241 154
108 iso_pu_bacteria 2978975091 2978976933 154
109 iso_pu_bacteria 2978975091 2978977416 154
110 3300048929 Ga0496126_0245940 Ga0496126_0245940_686_1177 155
111 3300009011 Ga0105251_10074189 Ga0105251_100741892 156
112 3300009011 Ga0105251_10113560 Ga0105251_101135602 156
113 3300009093 Ga0105240_10011917 Ga0105240_100119176 156
114 3300009101 Ga0105247_10156540 Ga0105247_101565402 156
115 3300009545 Ga0105237_10074910 Ga0105237_100749104 156
116 3300013306 Ga0163162_11493981 Ga0163162_114939812 156
117 3300017792 Ga0163161_10096099 Ga0163161_100960994 156
118 3300025735 Ga0207713_1027370 Ga0207713_10273704 156
119 3300025735 Ga0207713_1061172 Ga0207713_10611722 156
120 3300025900 Ga0207710_10461487 Ga0207710_104614872 156
121 3300025913 Ga0207695_10078883 Ga0207695_100788836 156
122 3300025914 Ga0207671_10142957 Ga0207671_101429573 156
123 3300048919 Ga0496116_0007585 Ga0496116_0007585_7002_7481 156
124 3300048919 Ga0496116_0015460 Ga0496116_0015460_3935_4414 156
125 3300048920 Ga0496117_0004270 Ga0496117_0004270_9524_10003 156
126 3300048920 Ga0496117_0008685 Ga0496117_0008685_7400_7879 156
127 3300048921 Ga0496118_0001552 Ga0496118_0001552_25738_26217 156
128 3300048921 Ga0496118_0021502 Ga0496118_0021502_3935_4414 156
129 3300048925 Ga0496122_0001789 Ga0496122_0001789_5250_5729 156
130 3300048925 Ga0496122_0032633 Ga0496122_0032633_2088_2567 156
131 3300048926 Ga0496123_0001528 Ga0496123_0001528_27187_27666 156
132 3300048926 Ga0496123_0034851 Ga0496123_0034851_1010_1489 156
133 3300048927 Ga0496124_0094667 Ga0496124_0094667_985_1464 156
134 3300048928 Ga0496125_0045337 Ga0496125_0045337_1886_2365 156
135 3300048929 Ga0496126_0085675 Ga0496126_0085675_1755_2234 156
136 iso_pu_bacteria 2508501071 2508851750 156
137 iso_pu_bacteria 2510065045 2510247672 156
138 iso_pu_bacteria 2510917014 2511099203 156
139 iso_pu_bacteria 2512047030 2512350895 156
140 iso_pu_bacteria 2513237082 2513553132 156
141 iso_pu_bacteria 2547132103 2547375155 156
142 iso_pu_bacteria 2547132181 2547696197 156
143 iso_pu_bacteria 2547132416 2548650628 156
144 iso_pu_bacteria 2561511199 2562464380 156
145 iso_pu_bacteria 2585427591 2585827102 156
146 iso_pu_bacteria 2585427591 2585828143 156
147 iso_pu_bacteria 2585427592 2585831578 156
148 iso_pu_bacteria 2585427592 2585833156 156
149 iso_pu_bacteria 2585427592 2585835190 156
150 iso_pu_bacteria 2585427592 2585835377 156
151 iso_pu_bacteria 2599185169 2599409725 156
152 iso_pu_bacteria 2600255254 2601521781 156
153 iso_pu_bacteria 2600255255 2601526806 156
154 iso_pu_bacteria 2600255256 2601535452 156
155 iso_pu_bacteria 2600255257 2601540009 156
156 iso_pu_bacteria 2600255280 2601613636 156
157 iso_pu_bacteria 2600255281 2601618359 156
158 iso_pu_bacteria 2600255287 2601643014 156
159 iso_pu_bacteria 2600255288 2601647884 156
160 iso_pu_bacteria 2600255289 2601651784 156
161 iso_pu_bacteria 2600255290 2601657111 156
162 iso_pu_bacteria 2600255291 2601662835 156
163 iso_pu_bacteria 2600255298 2601695794 156
164 iso_pu_bacteria 2600255299 2601700468 156
165 iso_pu_bacteria 2600255300 2601704908 156
166 iso_pu_bacteria 2600255301 2601709937 156
167 iso_pu_bacteria 2600255302 2601714949 156
168 iso_pu_bacteria 2600255303 2601720819 156
169 iso_pu_bacteria 2600255304 2601725355 156
170 iso_pu_bacteria 2600255305 2601729897 156
171 iso_pu_bacteria 2600255306 2601734914 156
172 iso_pu_bacteria 2600255307 2601739599 156
173 iso_pu_bacteria 2600255309 2601750088 156
174 iso_pu_bacteria 2600255310 2601758632 156
175 iso_pu_bacteria 2600255311 2601764746 156
176 iso_pu_bacteria 2600255392 2602017341 156
177 iso_pu_bacteria 2602042046 2603636793 156
178 iso_pu_bacteria 2602042047 2603645442 156
179 iso_pu_bacteria 2602042052 2603660210 156
180 iso_pu_bacteria 2602042053 2603665485 156
181 iso_pu_bacteria 2602042066 2603698708 156
182 iso_pu_bacteria 2602042067 2603704671 156
183 iso_pu_bacteria 2602042103 2603837276 156
184 iso_pu_bacteria 2602042104 2603842352 156
185 iso_pu_bacteria 2602042105 2603847425 156
186 iso_pu_bacteria 2602042106 2603852496 156
187 iso_pu_bacteria 2602042109 2603867130 156
188 iso_pu_bacteria 2602042110 2603870550 156
189 iso_pu_bacteria 2602042111 2603875488 156
190 iso_pu_bacteria 2603880178 2606047740 156
191 iso_pu_bacteria 2603880184 2606069916 156
192 iso_pu_bacteria 2603880202 2606145755 156
193 iso_pu_bacteria 2603880211 2606175142 156
194 iso_pu_bacteria 2608642108 2608670781 156
195 iso_pu_bacteria 2609459761 2609914633 156
196 iso_pu_bacteria 2619619299 2621300236 156
197 iso_pu_bacteria 2636415599 2637225653 156
198 iso_pu_bacteria 2667528172 2671105584 156
199 iso_pu_bacteria 2667528173 2671107929 156
200 iso_pu_bacteria 2671180115 2671587674 156
201 iso_pu_bacteria 2675903046 2676406874 156
202 iso_pu_bacteria 2681812866 2681996146 156
203 iso_pu_bacteria 2718217991 2719638153 156
204 iso_pu_bacteria 2738541265 2738674603 156
205 iso_pu_bacteria 2738541271 2738691243 156
206 iso_pu_bacteria 2738541282 2738752996 156
207 iso_pu_bacteria 2738541303 2738862882 156
208 iso_pu_bacteria 2738543016 2739267017 156
209 iso_pu_bacteria 2765235842 2765588378 156
210 iso_pu_bacteria 2775506706 2775540075 156
211 iso_pu_bacteria 2775507074 2777024341 156
212 iso_pu_bacteria 2791354903 2791921471 156
213 iso_pu_bacteria 2791354903 2791924820 156
214 iso_pu_bacteria 2791355275 2793403578 156
215 iso_pu_bacteria 2808606414 2809124152 156
216 iso_pu_bacteria 2808606414 2809125299 156
217 iso_pu_bacteria 2811995292 2813727807 156
218 iso_pu_bacteria 2816332298 2817490681 156
219 iso_pu_bacteria 2821118458 2821120472 156
220 iso_pu_bacteria 2821118458 2821121114 156
221 iso_pu_bacteria 2823373977 2823374168 156
222 iso_pu_bacteria 2842805378 2842808213 156
223 iso_pu_bacteria 2842854478 2842859132 156
224 iso_pu_bacteria 2844425489 2844425933 156
225 iso_pu_bacteria 2844425489 2844427417 156
226 iso_pu_bacteria 2844528606 2844529216 156
227 iso_pu_bacteria 2846540461 2846542363 156
228 iso_pu_bacteria 2847085930 2847089369 156
229 iso_pu_bacteria 2847797336 2847802443 156
230 iso_pu_bacteria 2852103415 2852103628 156
231 iso_pu_bacteria 2865014394 2865016646 156
232 iso_pu_bacteria 2869551831 2869553659 156
233 iso_pu_bacteria 2881609920 2881610343 156
234 iso_pu_bacteria 2884086401 2884087797 156
235 iso_pu_bacteria 2885270888 2885273561 156
236 iso_pu_bacteria 2885270888 2885277345 156
237 iso_pu_bacteria 2885270888 2885277350 156
238 iso_pu_bacteria 2891670763 2891671363 156
239 iso_pu_bacteria 2904474040 2904476879 156
240 iso_pu_bacteria 2904474040 2904476948 156
241 iso_pu_bacteria 2904513164 2904513485 156
242 iso_pu_bacteria 2904513164 2904515245 156
243 iso_pu_bacteria 2908669403 2908671340 156
244 iso_pu_bacteria 2908669403 2908672557 156
245 iso_pu_bacteria 2908669403 2908672764 156
246 iso_pu_bacteria 2919150387 2919153048 156
247 iso_pu_bacteria 2919150387 2919153117 156
248 iso_pu_bacteria 2923634449 2923635060 156
249 iso_pu_bacteria 2923634449 2923635168 156
250 iso_pu_bacteria 2923634449 2923635970 156
251 iso_pu_bacteria 2927143783 2927147009 156
252 iso_pu_bacteria 2927143783 2927148901 156
253 iso_pu_bacteria 2927833300 2927837537 156
254 iso_pu_bacteria 2928058823 2928063348 156
255 iso_pu_bacteria 2928135762 2928139216 156
256 iso_pu_bacteria 2939607340 2939609298 156
257 iso_pu_bacteria 2939607340 2939611146 156
258 iso_pu_bacteria 2945874760 2945879578 156
259 iso_pu_bacteria 2971820967 2971824022 156
260 iso_pu_bacteria 2974310843 2974312695 156
261 iso_pu_bacteria 2981990288 2981994138 156
262 iso_pu_bacteria 2984559226 2984559720 156
263 iso_pu_bacteria 2984595703 2984597802 156
264 iso_pu_bacteria 3000376612 3000378734 156
265 iso_pu_bacteria 640753048 640937320 156
266 iso_pu_bacteria 8011350971 8011357052 156
267 iso_pu_bacteria 8018221730 8018223023 156
268 iso_pu_bacteria 8018221730 8018225623 156
269 iso_pu_bacteria 8018221730 8018225682 156
270 iso_pu_bacteria 8054844752 8054848026 156
271 iso_pu_bacteria 8054844752 8054848085 156
272 iso_pu_bacteria 8054849141 8054851704 156
273 iso_pu_bacteria 8055087960 8055088906 156
274 iso_pu_bacteria 8055087960 8055090543 156
275 iso_pu_bacteria 8056143049 8056145878 156
276 3300046474 Ga0495605_0022807 Ga0495605_0022807_2678_3232 157
277 2162886007 SwRhRL2b_contig_1984934 SwRhRL2b_0899.00004630 158
278 3300003856 Ga0058692_1004649 Ga0058692_10046493 158
279 3300005272 Ga0065703_1024204 Ga0065703_10242041 158
280 3300005289 Ga0065704_10072828 Ga0065704_100728285 158
281 3300005347 Ga0070668_100382211 Ga0070668_1003822112 158
282 3300005457 Ga0070662_100033295 Ga0070662_1000332954 158
283 3300006051 Ga0075364_10102496 Ga0075364_101024962 158
284 3300009011 Ga0105251_10028718 Ga0105251_100287184 158
285 3300009036 Ga0105244_10053421 Ga0105244_100534212 158
286 3300011119 Ga0105246_10004178 Ga0105246_100041786 158
287 3300013102 Ga0157371_10000098 Ga0157371_1000009825 158
288 3300013105 Ga0157369_10942676 Ga0157369_109426761 158
289 3300013307 Ga0157372_10125027 Ga0157372_101250274 158
290 3300014497 Ga0182008_10022523 Ga0182008_100225234 158
291 3300015261 Ga0182006_1043697 Ga0182006_10436973 158
292 3300015262 Ga0182007_10013779 Ga0182007_100137793 158
293 3300017792 Ga0163161_10034132 Ga0163161_100341324 158
294 3300025711 Ga0207696_1020801 Ga0207696_10208012 158
295 3300025728 Ga0207655_1007471 Ga0207655_10074718 158
296 3300025735 Ga0207713_1015715 Ga0207713_10157154 158
297 3300025933 Ga0207706_10027897 Ga0207706_100278975 158
298 3300025972 Ga0207668_10048968 Ga0207668_100489682 158
299 3300027312 Ga0209371_1001551 Ga0209371_10015514 158
300 3300030500 Ga0268256_1001325 Ga0268256_10013254 158
301 3300041405 Ga0439438_008341 Ga0439438_008341_1533_2012 158
302 3300041411 Ga0439466_0066067 Ga0439466_0066067_255_734 158
303 3300042006 Ga0439432_011378 Ga0439432_011378_508_987 158
304 3300042010 Ga0439452_012964 Ga0439452_012964_1062_1541 158
305 3300042016 Ga0439463_018878 Ga0439463_018878_1083_1562 158
306 3300046458 Ga0495591_018517 Ga0495591_018517_1589_2068 158
307 3300046492 Ga0495585_0144886 Ga0495585_0144886_702_1181 158
308 3300046524 Ga0495648_0027249 Ga0495648_0027249_1557_2036 158
309 3300046674 Ga0495588_0075585 Ga0495588_0075585_891_1376 158
310 3300046694 Ga0495649_0001159 Ga0495649_0001159_2663_3148 158
311 3300046810 Ga0495660_0027295 Ga0495660_0027295_1736_2215 158
312 3300047320 Ga0495672_0000104 Ga0495672_0000104_39857_40336 158
313 3300048908 Ga0496105_0002937 Ga0496105_0002937_1925_2404 158
314 3300048913 Ga0496110_0295810 Ga0496110_0295810_588_1067 158
315 3300048920 Ga0496117_0015725 Ga0496117_0015725_1332_1811 158
316 3300048920 Ga0496117_0064618 Ga0496117_0064618_1159_1644 158
317 3300048921 Ga0496118_0000205 Ga0496118_0000205_67954_68433 158
318 3300048922 Ga0496119_0063766 Ga0496119_0063766_514_993 158
319 3300048925 Ga0496122_0063056 Ga0496122_0063056_602_1081 158
320 3300048926 Ga0496123_0029777 Ga0496123_0029777_2618_3097 158
321 3300048927 Ga0496124_0000416 Ga0496124_0000416_55672_56151 158
322 3300048927 Ga0496124_0002703 Ga0496124_0002703_1098_1583 158
323 3300048927 Ga0496124_0024459 Ga0496124_0024459_2847_3332 158
324 3300048928 Ga0496125_0063729 Ga0496125_0063729_778_1263 158
325 3300048928 Ga0496125_0070771 Ga0496125_0070771_1622_2101 158
326 3300048929 Ga0496126_0104192 Ga0496126_0104192_554_1033 158
327 3300050491 nmdc:mga00v17_90625_c1 nmdc:mga00v17_90625_c1_1122_1601 158
328 3300046452 Ga0495617_043595 Ga0495617_043595_128_607 159
329 3300047446 Ga0495679_011880 Ga0495679_011880_2199_2687 159
330 2162886007 SwRhRL2b_contig_1388857 SwRhRL2b_0288.00000620 160
331 3300001989 JGI24739J22299_10026342 JGI24739J22299_100263422 160
332 3300001990 JGI24737J22298_10033958 JGI24737J22298_100339582 160
333 3300002067 JGI24735J21928_10015425 JGI24735J21928_100154252 160
334 3300002737 JGI25162J39368_1000010 JGI25162J39368_100001011 160
335 3300002737 JGI25162J39368_1000067 JGI25162J39368_100006787 160
336 3300002771 JGI25163J39215_1000115 JGI25163J39215_100011544 160
337 3300002771 JGI25163J39215_1000122 JGI25163J39215_100012211 160
338 3300002772 JGI25164J39214_1000003 JGI25164J39214_1000003351 160
339 3300002772 JGI25164J39214_1000039 JGI25164J39214_100003951 160
340 3300003214 JGI25165J46597_1024405 JGI25165J46597_10244051 160
341 3300003316 rootH1_10159771 rootH1_101597712 160
342 3300003320 rootH2_10021910 rootH2_100219106 160
343 3300003320 rootH2_10030435 rootH2_1003043540 160
344 3300003320 rootH2_10045982 rootH2_1004598212 160
345 3300003320 rootH2_10068894 rootH2_100688944 160
346 3300003320 rootH2_10315290 rootH2_103152902 160
347 3300003322 rootL2_10084213 rootL2_1008421311 160
348 3300003323 rootH1_10054216 rootH1_100542162 160
349 3300003354 JGI25160J50197_1043116 JGI25160J50197_10431162 160
350 3300003751 Ga0055538_1000009 Ga0055538_100000911 160
351 3300003751 Ga0055538_1000052 Ga0055538_100005251 160
352 3300003752 Ga0055539_1000013 Ga0055539_100001311 160
353 3300003752 Ga0055539_1000077 Ga0055539_100007751 160
354 3300003756 Ga0055533_1000017 Ga0055533_100001711 160
355 3300003756 Ga0055533_1000083 Ga0055533_100008351 160
356 3300003759 Ga0055525_1000019 Ga0055525_100001911 160
357 3300003759 Ga0055525_1000110 Ga0055525_100011051 160
358 3300003841 Ga0055541_1000010 Ga0055541_100001011 160
359 3300003841 Ga0055541_1000054 Ga0055541_100005451 160
360 3300003856 Ga0058692_1000025 Ga0058692_10000255 160
361 3300003856 Ga0058692_1000251 Ga0058692_100025120 160
362 3300003856 Ga0058692_1000408 Ga0058692_100040814 160
363 3300003856 Ga0058692_1000529 Ga0058692_10005295 160
364 3300003856 Ga0058692_1000592 Ga0058692_100059210 160
365 3300003856 Ga0058692_1000690 Ga0058692_10006908 160
366 3300003856 Ga0058692_1000706 Ga0058692_10007067 160
367 3300003856 Ga0058692_1007215 Ga0058692_10072152 160
368 3300003856 Ga0058692_1012090 Ga0058692_10120902 160
369 3300003856 Ga0058692_1026105 Ga0058692_10261052 160
370 3300003856 Ga0058692_1054332 Ga0058692_10543321 160
371 3300005288 Ga0065714_10002884 Ga0065714_100028843 160
372 3300005289 Ga0065704_10000544 Ga0065704_100005446 160
373 3300005289 Ga0065704_10000975 Ga0065704_100009755 160
374 3300005289 Ga0065704_10070896 Ga0065704_100708962 160
375 3300005289 Ga0065704_10074914 Ga0065704_100749144 160
376 3300005289 Ga0065704_10091184 Ga0065704_100911848 160
377 3300005289 Ga0065704_10115508 Ga0065704_101155082 160
378 3300005289 Ga0065704_10128739 Ga0065704_101287394 160
379 3300005289 Ga0065704_10227335 Ga0065704_102273352 160
380 3300005327 Ga0070658_10278579 Ga0070658_102785792 160
381 3300005329 Ga0070683_101693265 Ga0070683_1016932651 160
382 3300005347 Ga0070668_100007218 Ga0070668_1000072187 160
383 3300005548 Ga0070665_100001598 Ga0070665_10000159819 160
384 3300005548 Ga0070665_101005822 Ga0070665_1010058221 160
385 3300005563 Ga0068855_100145036 Ga0068855_1001450365 160
386 3300005577 Ga0068857_100000540 Ga0068857_10000054015 160
387 3300006051 Ga0075364_10041139 Ga0075364_100411392 160
388 3300006051 Ga0075364_10186918 Ga0075364_101869181 160
389 3300006058 Ga0075432_10000001 Ga0075432_100000014 160
390 3300006058 Ga0075432_10000449 Ga0075432_100004499 160
391 3300006058 Ga0075432_10005035 Ga0075432_100050351 160
392 3300006195 Ga0075366_10076526 Ga0075366_100765266 160
393 3300006914 Ga0075436_100022387 Ga0075436_1000223872 160
394 3300006914 Ga0075436_100064656 Ga0075436_1000646562 160
395 3300006946 Ga0079104_1000083 Ga0079104_1000083116 160
396 3300006946 Ga0079104_1000555 Ga0079104_100055528 160
397 3300006946 Ga0079104_1000618 Ga0079104_100061814 160
398 3300006946 Ga0079104_1000852 Ga0079104_100085213 160
399 3300006946 Ga0079104_1000860 Ga0079104_100086014 160
400 3300006946 Ga0079104_1000946 Ga0079104_100094617 160
401 3300006946 Ga0079104_1000973 Ga0079104_10009734 160
402 3300006946 Ga0079104_1001090 Ga0079104_100109019 160
403 3300006946 Ga0079104_1001793 Ga0079104_10017933 160
404 3300006946 Ga0079104_1003138 Ga0079104_10031382 160
405 3300006946 Ga0079104_1004302 Ga0079104_10043024 160
406 3300006946 Ga0079104_1005874 Ga0079104_10058745 160
407 3300009011 Ga0105251_10001984 Ga0105251_1000198414 160
408 3300009011 Ga0105251_10002863 Ga0105251_100028633 160
409 3300009011 Ga0105251_10007168 Ga0105251_1000716810 160
410 3300009011 Ga0105251_10012397 Ga0105251_100123973 160
411 3300009011 Ga0105251_10013976 Ga0105251_100139764 160
412 3300009011 Ga0105251_10014550 Ga0105251_100145502 160
413 3300009011 Ga0105251_10052349 Ga0105251_100523494 160
414 3300009011 Ga0105251_10111049 Ga0105251_101110492 160
415 3300009011 Ga0105251_10170810 Ga0105251_101708101 160
416 3300009011 Ga0105251_10215431 Ga0105251_102154312 160
417 3300009011 Ga0105251_10267265 Ga0105251_102672652 160
418 3300009011 Ga0105251_10357144 Ga0105251_103571441 160
419 3300009011 Ga0105251_10363571 Ga0105251_103635711 160
420 3300009036 Ga0105244_10000883 Ga0105244_100008833 160
421 3300009036 Ga0105244_10000972 Ga0105244_1000097210 160
422 3300009036 Ga0105244_10001509 Ga0105244_100015094 160
423 3300009036 Ga0105244_10001550 Ga0105244_100015503 160
424 3300009036 Ga0105244_10002018 Ga0105244_100020187 160
425 3300009036 Ga0105244_10020695 Ga0105244_100206954 160
426 3300009036 Ga0105244_10054801 Ga0105244_100548012 160
427 3300009036 Ga0105244_10083790 Ga0105244_100837902 160
428 3300009036 Ga0105244_10111139 Ga0105244_101111392 160
429 3300009036 Ga0105244_10112571 Ga0105244_101125712 160
430 3300009036 Ga0105244_10149869 Ga0105244_101498691 160
431 3300009092 Ga0105250_10000018 Ga0105250_10000018153 160
432 3300009092 Ga0105250_10000378 Ga0105250_1000037810 160
433 3300009092 Ga0105250_10000991 Ga0105250_100009917 160
434 3300009092 Ga0105250_10001129 Ga0105250_1000112910 160
435 3300009092 Ga0105250_10002074 Ga0105250_1000207413 160
436 3300009092 Ga0105250_10039027 Ga0105250_100390274 160
437 3300009092 Ga0105250_10100426 Ga0105250_101004261 160
438 3300009093 Ga0105240_10471427 Ga0105240_104714272 160
439 3300009148 Ga0105243_10789025 Ga0105243_107890252 160
440 3300009545 Ga0105237_11000517 Ga0105237_110005171 160
441 3300013100 Ga0157373_10002693 Ga0157373_1000269311 160
442 3300013100 Ga0157373_10111713 Ga0157373_101117132 160
443 3300013100 Ga0157373_11024891 Ga0157373_110248911 160
444 3300013102 Ga0157371_10000020 Ga0157371_10000020261 160
445 3300013102 Ga0157371_10000152 Ga0157371_1000015258 160
446 3300013102 Ga0157371_10002597 Ga0157371_100025979 160
447 3300013102 Ga0157371_10004175 Ga0157371_100041754 160
448 3300013102 Ga0157371_10007066 Ga0157371_100070666 160
449 3300013104 Ga0157370_10004938 Ga0157370_100049383 160
450 3300013306 Ga0163162_10056578 Ga0163162_100565782 160
451 3300013306 Ga0163162_10110638 Ga0163162_101106385 160
452 3300013307 Ga0157372_10012980 Ga0157372_100129802 160
453 3300013307 Ga0157372_10017023 Ga0157372_100170232 160
454 3300013307 Ga0157372_10017921 Ga0157372_100179212 160
455 3300013307 Ga0157372_10039418 Ga0157372_100394182 160
456 3300013307 Ga0157372_10040522 Ga0157372_100405224 160
457 3300015261 Ga0182006_1000009 Ga0182006_1000009178 160
458 3300015261 Ga0182006_1000071 Ga0182006_100007199 160
459 3300015679 Ga0183366_1001 Ga0183366_10012462 160
460 3300015679 Ga0183366_1002 Ga0183366_1002422 160
461 3300015680 Ga0183370_1001 Ga0183370_10012462 160
462 3300015680 Ga0183370_1002 Ga0183370_1002422 160
463 3300015685 Ga0183369_1001 Ga0183369_10012463 160
464 3300015685 Ga0183369_1002 Ga0183369_1002422 160
465 3300015687 Ga0183368_1001 Ga0183368_10012462 160
466 3300015687 Ga0183368_1005 Ga0183368_1005422 160
467 3300015689 Ga0183360_10050 Ga0183360_100502 160
468 3300016635 Ga0183361_11658 Ga0183361_116581 160
469 3300017792 Ga0163161_10000417 Ga0163161_1000041716 160
470 3300017792 Ga0163161_10000535 Ga0163161_100005356 160
471 3300017792 Ga0163161_10003557 Ga0163161_100035575 160
472 3300017792 Ga0163161_10114291 Ga0163161_101142912 160
473 3300021384 Ga0213876_10000214 Ga0213876_1000021420 160
474 3300025207 Ga0209760_100067 Ga0209760_10006734 160
475 3300025207 Ga0209760_100070 Ga0209760_10007038 160
476 3300025224 Ga0209784_100012 Ga0209784_10001211 160
477 3300025224 Ga0209784_100012 Ga0209784_100012448 160
478 3300025225 Ga0209566_100010 Ga0209566_10001011 160
479 3300025225 Ga0209566_100010 Ga0209566_100010448 160
480 3300025226 Ga0209674_100023 Ga0209674_10002311 160
481 3300025226 Ga0209674_100023 Ga0209674_100023448 160
482 3300025230 Ga0209563_100027 Ga0209563_10002711 160
483 3300025230 Ga0209563_100027 Ga0209563_100027448 160
484 3300025231 Ga0207427_100017 Ga0207427_10001711 160
485 3300025231 Ga0207427_100017 Ga0207427_100017448 160
486 3300025233 Ga0209437_100029 Ga0209437_10002911 160
487 3300025233 Ga0209437_100029 Ga0209437_100029448 160
488 3300025253 Ga0209677_100014 Ga0209677_10001411 160
489 3300025253 Ga0209677_100014 Ga0209677_100014448 160
490 3300025254 Ga0209148_1025937 Ga0209148_10259371 160
491 3300025261 Ga0209233_1000953 Ga0209233_10009532 160
492 3300025261 Ga0209233_1001138 Ga0209233_10011382 160
493 3300025292 Ga0209676_1042156 Ga0209676_10421562 160
494 3300025295 Ga0209564_1021915 Ga0209564_10219152 160
495 3300025302 Ga0207426_1001593 Ga0207426_10015937 160
496 3300025711 Ga0207696_1000013 Ga0207696_1000013255 160
497 3300025711 Ga0207696_1000013 Ga0207696_1000013413 160
498 3300025711 Ga0207696_1000066 Ga0207696_1000066129 160
499 3300025711 Ga0207696_1000397 Ga0207696_100039710 160
500 3300025711 Ga0207696_1000529 Ga0207696_10005295 160
501 3300025711 Ga0207696_1000672 Ga0207696_10006729 160
502 3300025711 Ga0207696_1000799 Ga0207696_100079914 160
503 3300025711 Ga0207696_1000900 Ga0207696_100090021 160
504 3300025711 Ga0207696_1001086 Ga0207696_10010865 160
505 3300025711 Ga0207696_1002012 Ga0207696_100201213 160
506 3300025711 Ga0207696_1026348 Ga0207696_10263484 160
507 3300025711 Ga0207696_1065924 Ga0207696_10659241 160
508 3300025728 Ga0207655_1000002 Ga0207655_1000002181 160
509 3300025728 Ga0207655_1000042 Ga0207655_100004233 160
510 3300025728 Ga0207655_1000047 Ga0207655_100004731 160
511 3300025728 Ga0207655_1000050 Ga0207655_100005020 160
512 3300025728 Ga0207655_1000075 Ga0207655_1000075130 160
513 3300025728 Ga0207655_1000144 Ga0207655_100014483 160
514 3300025728 Ga0207655_1000314 Ga0207655_10003145 160
515 3300025728 Ga0207655_1000439 Ga0207655_10004393 160
516 3300025728 Ga0207655_1000676 Ga0207655_10006763 160
517 3300025728 Ga0207655_1000838 Ga0207655_100083826 160
518 3300025728 Ga0207655_1001127 Ga0207655_100112722 160
519 3300025728 Ga0207655_1006615 Ga0207655_10066154 160
520 3300025728 Ga0207655_1014959 Ga0207655_10149597 160
521 3300025728 Ga0207655_1020274 Ga0207655_10202742 160
522 3300025728 Ga0207655_1076620 Ga0207655_10766202 160
523 3300025728 Ga0207655_1078197 Ga0207655_10781972 160
524 3300025728 Ga0207655_1202188 Ga0207655_12021881 160
525 3300025735 Ga0207713_1000019 Ga0207713_1000019339 160
526 3300025735 Ga0207713_1000029 Ga0207713_1000029130 160
527 3300025735 Ga0207713_1000478 Ga0207713_100047824 160
528 3300025735 Ga0207713_1000766 Ga0207713_10007665 160
529 3300025735 Ga0207713_1001154 Ga0207713_10011543 160
530 3300025735 Ga0207713_1004180 Ga0207713_10041806 160
531 3300025735 Ga0207713_1006604 Ga0207713_10066045 160
532 3300025735 Ga0207713_1009765 Ga0207713_10097654 160
533 3300025735 Ga0207713_1019238 Ga0207713_10192382 160
534 3300025735 Ga0207713_1044361 Ga0207713_10443612 160
535 3300025735 Ga0207713_1045414 Ga0207713_10454143 160
536 3300025735 Ga0207713_1047995 Ga0207713_10479952 160
537 3300025735 Ga0207713_1072732 Ga0207713_10727321 160
538 3300025735 Ga0207713_1082468 Ga0207713_10824682 160
539 3300025735 Ga0207713_1092294 Ga0207713_10922942 160
540 3300025904 Ga0207647_10099486 Ga0207647_100994862 160
541 3300025909 Ga0207705_10810475 Ga0207705_108104751 160
542 3300025913 Ga0207695_10270573 Ga0207695_102705732 160
543 3300025913 Ga0207695_10598145 Ga0207695_105981452 160
544 3300025914 Ga0207671_10581116 Ga0207671_105811161 160
545 3300025914 Ga0207671_10594199 Ga0207671_105941991 160
546 3300025949 Ga0207667_10320960 Ga0207667_103209603 160
547 3300026116 Ga0207674_10000214 Ga0207674_100002145 160
548 3300027111 Ga0209281_1000109 Ga0209281_1000109123 160
549 3300027111 Ga0209281_1000130 Ga0209281_1000130115 160
550 3300027111 Ga0209281_1000143 Ga0209281_1000143173 160
551 3300027111 Ga0209281_1000239 Ga0209281_10002398 160
552 3300027111 Ga0209281_1000284 Ga0209281_100028429 160
553 3300027111 Ga0209281_1000340 Ga0209281_100034048 160
554 3300027111 Ga0209281_1000352 Ga0209281_100035224 160
555 3300027111 Ga0209281_1000378 Ga0209281_100037826 160
556 3300027111 Ga0209281_1000419 Ga0209281_100041962 160
557 3300027111 Ga0209281_1000443 Ga0209281_10004436 160
558 3300027111 Ga0209281_1000613 Ga0209281_100061320 160
559 3300027111 Ga0209281_1000872 Ga0209281_100087217 160
560 3300027111 Ga0209281_1001207 Ga0209281_100120711 160
561 3300027111 Ga0209281_1001215 Ga0209281_100121520 160
562 3300027111 Ga0209281_1001700 Ga0209281_100170010 160
563 3300027111 Ga0209281_1002328 Ga0209281_10023283 160
564 3300027111 Ga0209281_1008168 Ga0209281_10081681 160
565 3300027312 Ga0209371_1000001 Ga0209371_10000012321 160
566 3300027312 Ga0209371_1000036 Ga0209371_10000365 160
567 3300027312 Ga0209371_1000108 Ga0209371_1000108118 160
568 3300027312 Ga0209371_1000249 Ga0209371_100024914 160
569 3300027312 Ga0209371_1000278 Ga0209371_100027863 160
570 3300027312 Ga0209371_1000528 Ga0209371_100052820 160
571 3300027312 Ga0209371_1000532 Ga0209371_100053222 160
572 3300027312 Ga0209371_1000664 Ga0209371_10006645 160
573 3300027312 Ga0209371_1001264 Ga0209371_10012643 160
574 3300027312 Ga0209371_1001883 Ga0209371_10018839 160
575 3300027312 Ga0209371_1002589 Ga0209371_10025899 160
576 3300027312 Ga0209371_1002877 Ga0209371_10028773 160
577 3300027312 Ga0209371_1003068 Ga0209371_10030685 160
578 3300027312 Ga0209371_1003547 Ga0209371_10035474 160
579 3300027312 Ga0209371_1003942 Ga0209371_10039427 160
580 3300027312 Ga0209371_1005282 Ga0209371_10052822 160
581 3300027312 Ga0209371_1005651 Ga0209371_10056513 160
582 3300027312 Ga0209371_1007490 Ga0209371_10074902 160
583 3300027907 Ga0207428_10000155 Ga0207428_1000015525 160
584 3300027907 Ga0207428_10029760 Ga0207428_100297602 160
585 3300028379 Ga0268266_10001140 Ga0268266_1000114027 160
586 3300028379 Ga0268266_10384723 Ga0268266_103847232 160
587 3300028379 Ga0268266_10981552 Ga0268266_109815521 160
588 3300028800 Ga0265338_10016048 Ga0265338_100160484 160
589 3300030083 Ga0237817_13135 Ga0237817_131351 160
590 3300030500 Ga0268256_1000001 Ga0268256_1000001319 160
591 3300030500 Ga0268256_1000040 Ga0268256_1000040314 160
592 3300030500 Ga0268256_1000076 Ga0268256_100007683 160
593 3300030500 Ga0268256_1000231 Ga0268256_100023163 160
594 3300030500 Ga0268256_1000256 Ga0268256_100025624 160
595 3300030500 Ga0268256_1000493 Ga0268256_100049320 160
596 3300030500 Ga0268256_1000563 Ga0268256_10005632 160
597 3300030500 Ga0268256_1001062 Ga0268256_100106217 160
598 3300030500 Ga0268256_1001456 Ga0268256_100145610 160
599 3300030500 Ga0268256_1001620 Ga0268256_10016203 160
600 3300030500 Ga0268256_1001717 Ga0268256_100171711 160
601 3300030500 Ga0268256_1002282 Ga0268256_10022829 160
602 3300030500 Ga0268256_1002754 Ga0268256_10027545 160
603 3300030500 Ga0268256_1003246 Ga0268256_10032464 160
604 3300030500 Ga0268256_1005130 Ga0268256_10051302 160
605 3300030500 Ga0268256_1005267 Ga0268256_10052672 160
606 3300030500 Ga0268256_1005414 Ga0268256_10054143 160
607 3300030500 Ga0268256_1007724 Ga0268256_10077242 160
608 3300030500 Ga0268256_1011535 Ga0268256_10115354 160
609 3300030500 Ga0268256_1055530 Ga0268256_10555301 160
610 3300030521 Ga0307511_10351545 Ga0307511_103515451 160
611 3300031344 Ga0265316_10229264 Ga0265316_102292642 160
612 3300031344 Ga0265316_10943168 Ga0265316_109431681 160
613 3300031548 Ga0307408_100002112 Ga0307408_1000021123 160
614 3300031824 Ga0307413_10052041 Ga0307413_100520412 160
615 3300031911 Ga0307412_10001707 Ga0307412_100017073 160
616 3300031911 Ga0307412_10004085 Ga0307412_100040852 160
617 3300033180 Ga0307510_10046032 Ga0307510_100460322 160
618 3300039437 Ga0436365_1279401 Ga0436365_1279401_18483_18974 160
619 3300039447 Ga0436361_0927016 Ga0436361_0927016_510_995 160
620 3300041404 Ga0439436_0000421 Ga0439436_0000421_8204_8695 160
621 3300041405 Ga0439438_000001 Ga0439438_000001_590742_591233 160
622 3300041405 Ga0439438_001009 Ga0439438_001009_2931_3422 160
623 3300041405 Ga0439438_003553 Ga0439438_003553_1805_2296 160
624 3300041405 Ga0439438_005546 Ga0439438_005546_3064_3555 160
625 3300041405 Ga0439438_065487 Ga0439438_065487_298_789 160
626 3300041407 Ga0439447_000630 Ga0439447_000630_8791_9282 160
627 3300041407 Ga0439447_001263 Ga0439447_001263_6335_6826 160
628 3300041407 Ga0439447_003288 Ga0439447_003288_4146_4637 160
629 3300041407 Ga0439447_023613 Ga0439447_023613_821_1312 160
630 3300041411 Ga0439466_0001819 Ga0439466_0001819_5473_5964 160
631 3300041411 Ga0439466_0062443 Ga0439466_0062443_593_1084 160
632 3300041507 Ga0451851_0824615 Ga0451851_0824615_1189_1680 160
633 3300042006 Ga0439432_005097 Ga0439432_005097_2611_3093 160
634 3300042006 Ga0439432_026013 Ga0439432_026013_569_1054 160
635 3300042006 Ga0439432_026964 Ga0439432_026964_418_900 160
636 3300042006 Ga0439432_041917 Ga0439432_041917_415_906 160
637 3300042010 Ga0439452_000109 Ga0439452_000109_44818_45300 160
638 3300042010 Ga0439452_000144 Ga0439452_000144_31303_31794 160
639 3300042010 Ga0439452_000593 Ga0439452_000593_207_698 160
640 3300042010 Ga0439452_001307 Ga0439452_001307_3138_3629 160
641 3300042010 Ga0439452_003083 Ga0439452_003083_1108_1599 160
642 3300042010 Ga0439452_008008 Ga0439452_008008_2538_3029 160
643 3300042013 Ga0439456_010605 Ga0439456_010605_295_786 160
644 3300042125 Ga0450923_010535 Ga0450923_010535_107_598 160
645 3300042137 Ga0450902_005088 Ga0450902_005088_198_680 160
646 3300042137 Ga0450902_012726 Ga0450902_012726_644_1126 160
647 3300042138 Ga0450903_002554 Ga0450903_002554_991_1473 160
648 3300042156 Ga0439446_0011832 Ga0439446_0011832_345_836 160
649 3300042435 Ga0439434_0000782 Ga0439434_0000782_1133_1624 160
650 3300042532 Ga0450893_0092904 Ga0450893_0092904_107_592 160
651 3300044669 Ga0466981_0000004 Ga0466981_0000004_167143_167634 160
652 3300044669 Ga0466981_0305472 Ga0466981_0305472_24_509 160
653 3300044693 Ga0466961_0052627 Ga0466961_0052627_452_937 160
654 3300044842 Ga0466957_0040905 Ga0466957_0040905_648_1133 160
655 3300045049 Ga0466959_0023933 Ga0466959_0023933_607_1092 160
656 3300046452 Ga0495617_004643 Ga0495617_004643_1232_1723 160
657 3300046452 Ga0495617_009951 Ga0495617_009951_2103_2594 160
658 3300046453 Ga0495627_000023 Ga0495627_000023_95981_96463 160
659 3300046453 Ga0495627_001183 Ga0495627_001183_3821_4312 160
660 3300046453 Ga0495627_017740 Ga0495627_017740_1277_1768 160
661 3300046453 Ga0495627_041229 Ga0495627_041229_367_849 160
662 3300046457 Ga0495590_0012563 Ga0495590_0012563_882_1373 160
663 3300046458 Ga0495591_000017 Ga0495591_000017_237780_238271 160
664 3300046458 Ga0495591_000768 Ga0495591_000768_1724_2215 160
665 3300046458 Ga0495591_001381 Ga0495591_001381_6891_7373 160
666 3300046458 Ga0495591_001484 Ga0495591_001484_9928_10419 160
667 3300046458 Ga0495591_001642 Ga0495591_001642_5676_6158 160
668 3300046458 Ga0495591_002873 Ga0495591_002873_6710_7201 160
669 3300046458 Ga0495591_004272 Ga0495591_004272_4226_4717 160
670 3300046458 Ga0495591_005120 Ga0495591_005120_2413_2910 160
671 3300046458 Ga0495591_012859 Ga0495591_012859_2373_2864 160
672 3300046458 Ga0495591_014904 Ga0495591_014904_15_506 160
673 3300046458 Ga0495591_019914 Ga0495591_019914_1598_2080 160
674 3300046460 Ga0495638_0002143 Ga0495638_0002143_4260_4751 160
675 3300046460 Ga0495638_0006966 Ga0495638_0006966_431_913 160
676 3300046460 Ga0495638_0024674 Ga0495638_0024674_2193_2684 160
677 3300046471 Ga0495650_0000088 Ga0495650_0000088_230030_230521 160
678 3300046471 Ga0495650_0003618 Ga0495650_0003618_10484_10981 160
679 3300046471 Ga0495650_0004230 Ga0495650_0004230_2086_2577 160
680 3300046471 Ga0495650_0009928 Ga0495650_0009928_410_901 160
681 3300046471 Ga0495650_0012743 Ga0495650_0012743_3981_4472 160
682 3300046471 Ga0495650_0044859 Ga0495650_0044859_967_1449 160
683 3300046474 Ga0495605_0000026 Ga0495605_0000026_16046_16543 160
684 3300046474 Ga0495605_0000067 Ga0495605_0000067_79351_79842 160
685 3300046474 Ga0495605_0000355 Ga0495605_0000355_28206_28688 160
686 3300046474 Ga0495605_0011659 Ga0495605_0011659_2929_3420 160
687 3300046474 Ga0495605_0012558 Ga0495605_0012558_4175_4666 160
688 3300046474 Ga0495605_0109132 Ga0495605_0109132_351_842 160
689 3300046491 Ga0495584_0003419 Ga0495584_0003419_1036_1527 160
690 3300046491 Ga0495584_0007923 Ga0495584_0007923_2930_3421 160
691 3300046491 Ga0495584_0011381 Ga0495584_0011381_4024_4515 160
692 3300046492 Ga0495585_0003783 Ga0495585_0003783_6369_6860 160
693 3300046492 Ga0495585_0029471 Ga0495585_0029471_1739_2230 160
694 3300046499 Ga0495594_0015797 Ga0495594_0015797_2357_2854 160
695 3300046500 Ga0495596_0000128 Ga0495596_0000128_48872_49363 160
696 3300046500 Ga0495596_0078039 Ga0495596_0078039_312_803 160
697 3300046501 Ga0495607_0010162 Ga0495607_0010162_3924_4415 160
698 3300046501 Ga0495607_0010576 Ga0495607_0010576_959_1450 160
699 3300046501 Ga0495607_0013109 Ga0495607_0013109_2584_3075 160
700 3300046501 Ga0495607_0036031 Ga0495607_0036031_1669_2160 160
701 3300046501 Ga0495607_0101794 Ga0495607_0101794_146_637 160
702 3300046506 Ga0495583_0000043 Ga0495583_0000043_162190_162687 160
703 3300046506 Ga0495583_0000334 Ga0495583_0000334_3401_3892 160
704 3300046506 Ga0495583_0000457 Ga0495583_0000457_53600_54091 160
705 3300046506 Ga0495583_0003126 Ga0495583_0003126_1580_2062 160
706 3300046507 Ga0495606_0000314 Ga0495606_0000314_14667_15158 160
707 3300046507 Ga0495606_0001287 Ga0495606_0001287_6403_6894 160
708 3300046507 Ga0495606_0016109 Ga0495606_0016109_2823_3314 160
709 3300046512 Ga0495610_0001881 Ga0495610_0001881_10871_11362 160
710 3300046512 Ga0495610_0003940 Ga0495610_0003940_8872_9369 160
711 3300046512 Ga0495610_0006268 Ga0495610_0006268_3429_3920 160
712 3300046512 Ga0495610_0044985 Ga0495610_0044985_109_600 160
713 3300046512 Ga0495610_0056149 Ga0495610_0056149_453_944 160
714 3300046513 Ga0495616_0013698 Ga0495616_0013698_2214_2705 160
715 3300046513 Ga0495616_0016246 Ga0495616_0016246_1104_1595 160
716 3300046515 Ga0495620_0000114 Ga0495620_0000114_68_565 160
717 3300046515 Ga0495620_0000656 Ga0495620_0000656_16830_17321 160
718 3300046515 Ga0495620_0002257 Ga0495620_0002257_1571_2053 160
719 3300046515 Ga0495620_0005229 Ga0495620_0005229_5702_6193 160
720 3300046515 Ga0495620_0022126 Ga0495620_0022126_2282_2773 160
721 3300046515 Ga0495620_0054735 Ga0495620_0054735_79_570 160
722 3300046518 Ga0495631_0000609 Ga0495631_0000609_18243_18740 160
723 3300046518 Ga0495631_0002216 Ga0495631_0002216_3204_3695 160
724 3300046518 Ga0495631_0025951 Ga0495631_0025951_778_1260 160
725 3300046519 Ga0495632_0003142 Ga0495632_0003142_5531_6022 160
726 3300046519 Ga0495632_0012435 Ga0495632_0012435_1298_1789 160
727 3300046519 Ga0495632_0037465 Ga0495632_0037465_370_861 160
728 3300046520 Ga0495637_0000082 Ga0495637_0000082_2933_3424 160
729 3300046520 Ga0495637_0010895 Ga0495637_0010895_3558_4055 160
730 3300046520 Ga0495637_0014783 Ga0495637_0014783_2376_2867 160
731 3300046520 Ga0495637_0082297 Ga0495637_0082297_744_1235 160
732 3300046520 Ga0495637_0099927 Ga0495637_0099927_289_780 160
733 3300046520 Ga0495637_0281469 Ga0495637_0281469_14_496 160
734 3300046522 Ga0495643_0006000 Ga0495643_0006000_7495_7986 160
735 3300046522 Ga0495643_0101770 Ga0495643_0101770_907_1398 160
736 3300046522 Ga0495643_0206637 Ga0495643_0206637_222_713 160
737 3300046523 Ga0495644_0000367 Ga0495644_0000367_2930_3421 160
738 3300046523 Ga0495644_0001147 Ga0495644_0001147_7814_8305 160
739 3300046523 Ga0495644_0003581 Ga0495644_0003581_2660_3151 160
740 3300046524 Ga0495648_0000368 Ga0495648_0000368_3986_4477 160
741 3300046524 Ga0495648_0000996 Ga0495648_0000996_21214_21705 160
742 3300046524 Ga0495648_0009739 Ga0495648_0009739_2441_2932 160
743 3300046524 Ga0495648_0012042 Ga0495648_0012042_4550_5041 160
744 3300046524 Ga0495648_0016305 Ga0495648_0016305_1824_2315 160
745 3300046524 Ga0495648_0058441 Ga0495648_0058441_261_752 160
746 3300046524 Ga0495648_0088454 Ga0495648_0088454_119_616 160
747 3300046529 Ga0495652_0077686 Ga0495652_0077686_944_1435 160
748 3300046530 Ga0495654_0000027 Ga0495654_0000027_102062_102553 160
749 3300046530 Ga0495654_0000168 Ga0495654_0000168_9704_10195 160
750 3300046530 Ga0495654_0000936 Ga0495654_0000936_20763_21260 160
751 3300046530 Ga0495654_0003688 Ga0495654_0003688_6342_6833 160
752 3300046530 Ga0495654_0003711 Ga0495654_0003711_7382_7864 160
753 3300046530 Ga0495654_0008050 Ga0495654_0008050_1669_2160 160
754 3300046530 Ga0495654_0009699 Ga0495654_0009699_3046_3537 160
755 3300046530 Ga0495654_0015805 Ga0495654_0015805_2601_3092 160
756 3300046530 Ga0495654_0029800 Ga0495654_0029800_1552_2043 160
757 3300046530 Ga0495654_0049552 Ga0495654_0049552_1386_1877 160
758 3300046530 Ga0495654_0061715 Ga0495654_0061715_304_795 160
759 3300046530 Ga0495654_0063844 Ga0495654_0063844_981_1472 160
760 3300046530 Ga0495654_0095915 Ga0495654_0095915_728_1219 160
761 3300046538 Ga0495609_0000036 Ga0495609_0000036_162513_163010 160
762 3300046538 Ga0495609_0000043 Ga0495609_0000043_162972_163463 160
763 3300046538 Ga0495609_0000118 Ga0495609_0000118_35640_36131 160
764 3300046538 Ga0495609_0000353 Ga0495609_0000353_28599_29081 160
765 3300046542 Ga0495597_0001293 Ga0495597_0001293_8089_8580 160
766 3300046542 Ga0495597_0007423 Ga0495597_0007423_4578_5069 160
767 3300046542 Ga0495597_0015252 Ga0495597_0015252_2882_3379 160
768 3300046542 Ga0495597_0016111 Ga0495597_0016111_2847_3338 160
769 3300046542 Ga0495597_0019756 Ga0495597_0019756_1836_2318 160
770 3300046542 Ga0495597_0020269 Ga0495597_0020269_1679_2170 160
771 3300046543 Ga0495645_0046855 Ga0495645_0046855_1713_2207 160
772 3300046557 Ga0495622_0087277 Ga0495622_0087277_157_648 160
773 3300046558 Ga0495633_0000229 Ga0495633_0000229_2968_3465 160
774 3300046558 Ga0495633_0002494 Ga0495633_0002494_11010_11492 160
775 3300046615 Ga0495656_0141742 Ga0495656_0141742_634_1125 160
776 3300046616 Ga0495668_0002560 Ga0495668_0002560_3047_3538 160
777 3300046616 Ga0495668_0049908 Ga0495668_0049908_138_629 160
778 3300046648 Ga0495611_0001403 Ga0495611_0001403_7811_8302 160
779 3300046648 Ga0495611_0001841 Ga0495611_0001841_3119_3616 160
780 3300046648 Ga0495611_0002903 Ga0495611_0002903_4242_4733 160
781 3300046648 Ga0495611_0004141 Ga0495611_0004141_1515_1997 160
782 3300046660 Ga0495625_0000039 Ga0495625_0000039_22263_22754 160
783 3300046660 Ga0495625_0000101 Ga0495625_0000101_106248_106739 160
784 3300046660 Ga0495625_0009255 Ga0495625_0009255_2674_3156 160
785 3300046660 Ga0495625_0011449 Ga0495625_0011449_6369_6860 160
786 3300046665 Ga0495661_0000024 Ga0495661_0000024_150902_151393 160
787 3300046665 Ga0495661_0000545 Ga0495661_0000545_18276_18773 160
788 3300046665 Ga0495661_0002293 Ga0495661_0002293_4077_4568 160
789 3300046665 Ga0495661_0003960 Ga0495661_0003960_6492_6983 160
790 3300046665 Ga0495661_0051768 Ga0495661_0051768_1232_1723 160
791 3300046674 Ga0495588_0001806 Ga0495588_0001806_4642_5133 160
792 3300046674 Ga0495588_0009525 Ga0495588_0009525_2427_2918 160
793 3300046691 Ga0495670_0001972 Ga0495670_0001972_6594_7085 160
794 3300046691 Ga0495670_0004301 Ga0495670_0004301_4005_4487 160
795 3300046691 Ga0495670_0033302 Ga0495670_0033302_730_1227 160
796 3300046692 Ga0495671_0000355 Ga0495671_0000355_33420_33911 160
797 3300046692 Ga0495671_0001787 Ga0495671_0001787_2926_3417 160
798 3300046692 Ga0495671_0006014 Ga0495671_0006014_3567_4058 160
799 3300046692 Ga0495671_0016210 Ga0495671_0016210_645_1142 160
800 3300046692 Ga0495671_0029624 Ga0495671_0029624_1772_2263 160
801 3300046692 Ga0495671_0049474 Ga0495671_0049474_1551_2033 160
802 3300046694 Ga0495649_0000032 Ga0495649_0000032_39462_39953 160
803 3300046694 Ga0495649_0000271 Ga0495649_0000271_9615_10106 160
804 3300046694 Ga0495649_0000730 Ga0495649_0000730_6834_7316 160
805 3300046694 Ga0495649_0001636 Ga0495649_0001636_9265_9756 160
806 3300046694 Ga0495649_0020753 Ga0495649_0020753_796_1287 160
807 3300046794 Ga0495589_0000028 Ga0495589_0000028_28757_29248 160
808 3300046794 Ga0495589_0000169 Ga0495589_0000169_21104_21595 160
809 3300046794 Ga0495589_0000988 Ga0495589_0000988_2207_2698 160
810 3300046794 Ga0495589_0002325 Ga0495589_0002325_8859_9341 160
811 3300046794 Ga0495589_0002877 Ga0495589_0002877_2224_2715 160
812 3300046794 Ga0495589_0004778 Ga0495589_0004778_4077_4559 160
813 3300046810 Ga0495660_0000006 Ga0495660_0000006_508792_509283 160
814 3300046810 Ga0495660_0000010 Ga0495660_0000010_244689_245180 160
815 3300046810 Ga0495660_0000635 Ga0495660_0000635_23068_23565 160
816 3300046810 Ga0495660_0004548 Ga0495660_0004548_5121_5612 160
817 3300046810 Ga0495660_0017362 Ga0495660_0017362_1588_2079 160
818 3300046810 Ga0495660_0023109 Ga0495660_0023109_553_1044 160
819 3300046810 Ga0495660_0186639 Ga0495660_0186639_225_707 160
820 3300047320 Ga0495672_0000039 Ga0495672_0000039_81033_81524 160
821 3300047320 Ga0495672_0000062 Ga0495672_0000062_98160_98651 160
822 3300047320 Ga0495672_0008182 Ga0495672_0008182_3482_3973 160
823 3300047320 Ga0495672_0018818 Ga0495672_0018818_647_1138 160
824 3300047320 Ga0495672_0032265 Ga0495672_0032265_1638_2129 160
825 3300047321 Ga0495676_0000071 Ga0495676_0000071_3200_3691 160
826 3300047323 Ga0495683_0000003 Ga0495683_0000003_214114_214611 160
827 3300047323 Ga0495683_0000828 Ga0495683_0000828_4085_4576 160
828 3300047323 Ga0495683_0000865 Ga0495683_0000865_8898_9389 160
829 3300047323 Ga0495683_0001140 Ga0495683_0001140_2969_3460 160
830 3300047323 Ga0495683_0001901 Ga0495683_0001901_11008_11490 160
831 3300047323 Ga0495683_0016844 Ga0495683_0016844_2683_3174 160
832 3300047323 Ga0495683_0034067 Ga0495683_0034067_497_988 160
833 3300047323 Ga0495683_0041535 Ga0495683_0041535_194_685 160
834 3300047446 Ga0495679_000051 Ga0495679_000051_106793_107284 160
835 3300047446 Ga0495679_000157 Ga0495679_000157_31252_31743 160
836 3300047446 Ga0495679_000191 Ga0495679_000191_29592_30083 160
837 3300047446 Ga0495679_000475 Ga0495679_000475_25385_25882 160
838 3300047446 Ga0495679_000798 Ga0495679_000798_2929_3420 160
839 3300047446 Ga0495679_001706 Ga0495679_001706_10039_10521 160
840 3300047446 Ga0495679_003326 Ga0495679_003326_3886_4377 160
841 3300047446 Ga0495679_040018 Ga0495679_040018_940_1422 160
842 3300047469 Ga0495673_0000007 Ga0495673_0000007_146939_147430 160
843 3300047469 Ga0495673_0000086 Ga0495673_0000086_123734_124225 160
844 3300047469 Ga0495673_0003637 Ga0495673_0003637_6406_6897 160
845 3300047469 Ga0495673_0022481 Ga0495673_0022481_185_682 160
846 3300047470 Ga0495681_0000241 Ga0495681_0000241_17187_17678 160
847 3300047470 Ga0495681_0001888 Ga0495681_0001888_6346_6837 160
848 3300047470 Ga0495681_0002039 Ga0495681_0002039_10264_10755 160
849 3300047470 Ga0495681_0002736 Ga0495681_0002736_1290_1787 160
850 3300047470 Ga0495681_0014380 Ga0495681_0014380_58_549 160
851 3300047470 Ga0495681_0019610 Ga0495681_0019610_2477_2968 160
852 3300047470 Ga0495681_0032912 Ga0495681_0032912_50_541 160
853 3300047472 Ga0495686_0116662 Ga0495686_0116662_809_1300 160
854 3300048091 Ga0495626_0000045 Ga0495626_0000045_2952_3443 160
855 3300048091 Ga0495626_0009096 Ga0495626_0009096_2984_3475 160
856 3300048091 Ga0495626_0148187 Ga0495626_0148187_249_740 160
857 3300048903 Ga0496100_0413478 Ga0496100_0413478_150_632 160
858 3300048904 Ga0496101_0046364 Ga0496101_0046364_821_1312 160
859 3300048907 Ga0496104_0007607 Ga0496104_0007607_1710_2201 160
860 3300048907 Ga0496104_0115149 Ga0496104_0115149_13_495 160
861 3300048908 Ga0496105_0005369 Ga0496105_0005369_7399_7890 160
862 3300048919 Ga0496116_0000462 Ga0496116_0000462_46799_47290 160
863 3300048919 Ga0496116_0004705 Ga0496116_0004705_9139_9630 160
864 3300048919 Ga0496116_0004836 Ga0496116_0004836_8796_9281 160
865 3300048919 Ga0496116_0007367 Ga0496116_0007367_1471_1962 160
866 3300048919 Ga0496116_0008305 Ga0496116_0008305_3660_4151 160
867 3300048919 Ga0496116_0040187 Ga0496116_0040187_310_792 160
868 3300048919 Ga0496116_0044974 Ga0496116_0044974_902_1393 160
869 3300048920 Ga0496117_0001546 Ga0496117_0001546_9388_9879 160
870 3300048920 Ga0496117_0003030 Ga0496117_0003030_5894_6385 160
871 3300048920 Ga0496117_0005638 Ga0496117_0005638_7558_8049 160
872 3300048920 Ga0496117_0006600 Ga0496117_0006600_8925_9416 160
873 3300048920 Ga0496117_0017321 Ga0496117_0017321_1094_1585 160
874 3300048920 Ga0496117_0031661 Ga0496117_0031661_3200_3682 160
875 3300048920 Ga0496117_0046683 Ga0496117_0046683_629_1120 160
876 3300048920 Ga0496117_0094765 Ga0496117_0094765_1068_1553 160
877 3300048920 Ga0496117_0186487 Ga0496117_0186487_434_916 160
878 3300048920 Ga0496117_0250789 Ga0496117_0250789_133_615 160
879 3300048920 Ga0496117_0252010 Ga0496117_0252010_112_603 160
880 3300048920 Ga0496117_0455327 Ga0496117_0455327_109_600 160
881 3300048921 Ga0496118_0000767 Ga0496118_0000767_22019_22510 160
882 3300048921 Ga0496118_0001161 Ga0496118_0001161_10603_11094 160
883 3300048921 Ga0496118_0001430 Ga0496118_0001430_16443_16934 160
884 3300048921 Ga0496118_0003609 Ga0496118_0003609_4974_5465 160
885 3300048921 Ga0496118_0009915 Ga0496118_0009915_1471_1962 160
886 3300048921 Ga0496118_0011471 Ga0496118_0011471_5929_6411 160
887 3300048921 Ga0496118_0065371 Ga0496118_0065371_413_895 160
888 3300048921 Ga0496118_0087539 Ga0496118_0087539_209_700 160
889 3300048921 Ga0496118_0115151 Ga0496118_0115151_372_857 160
890 3300048921 Ga0496118_0135034 Ga0496118_0135034_491_976 160
891 3300048921 Ga0496118_0162484 Ga0496118_0162484_547_1029 160
892 3300048922 Ga0496119_0000264 Ga0496119_0000264_33072_33563 160
893 3300048922 Ga0496119_0001327 Ga0496119_0001327_24313_24804 160
894 3300048922 Ga0496119_0002023 Ga0496119_0002023_389_880 160
895 3300048922 Ga0496119_0007142 Ga0496119_0007142_4549_5040 160
896 3300048922 Ga0496119_0015218 Ga0496119_0015218_5059_5541 160
897 3300048922 Ga0496119_0216682 Ga0496119_0216682_84_566 160
898 3300048922 Ga0496119_0237536 Ga0496119_0237536_373_858 160
899 3300048922 Ga0496119_0254809 Ga0496119_0254809_350_832 160
900 3300048923 Ga0496120_0000141 Ga0496120_0000141_19350_19841 160
901 3300048923 Ga0496120_0000327 Ga0496120_0000327_56644_57126 160
902 3300048923 Ga0496120_0000445 Ga0496120_0000445_32051_32542 160
903 3300048923 Ga0496120_0001107 Ga0496120_0001107_30369_30860 160
904 3300048923 Ga0496120_0001360 Ga0496120_0001360_4562_5053 160
905 3300048923 Ga0496120_0004646 Ga0496120_0004646_9020_9511 160
906 3300048923 Ga0496120_0008985 Ga0496120_0008985_4807_5298 160
907 3300048923 Ga0496120_0080015 Ga0496120_0080015_1014_1496 160
908 3300048923 Ga0496120_0106935 Ga0496120_0106935_756_1241 160
909 3300048923 Ga0496120_0211065 Ga0496120_0211065_238_720 160
910 3300048924 Ga0496121_0000224 Ga0496121_0000224_7383_7874 160
911 3300048924 Ga0496121_0000565 Ga0496121_0000565_47265_47747 160
912 3300048924 Ga0496121_0002504 Ga0496121_0002504_18541_19032 160
913 3300048924 Ga0496121_0002549 Ga0496121_0002549_7763_8254 160
914 3300048924 Ga0496121_0003284 Ga0496121_0003284_17111_17602 160
915 3300048924 Ga0496121_0010643 Ga0496121_0010643_3800_4291 160
916 3300048924 Ga0496121_0013368 Ga0496121_0013368_6778_7269 160
917 3300048924 Ga0496121_0019344 Ga0496121_0019344_1175_1657 160
918 3300048924 Ga0496121_0025399 Ga0496121_0025399_1089_1571 160
919 3300048924 Ga0496121_0142901 Ga0496121_0142901_374_859 160
920 3300048924 Ga0496121_0177334 Ga0496121_0177334_271_753 160
921 3300048925 Ga0496122_0000005 Ga0496122_0000005_178048_178539 160
922 3300048925 Ga0496122_0000010 Ga0496122_0000010_222888_223379 160
923 3300048925 Ga0496122_0001029 Ga0496122_0001029_18584_19075 160
924 3300048925 Ga0496122_0001508 Ga0496122_0001508_28706_29197 160
925 3300048925 Ga0496122_0002048 Ga0496122_0002048_3115_3597 160
926 3300048925 Ga0496122_0002965 Ga0496122_0002965_6932_7423 160
927 3300048925 Ga0496122_0007709 Ga0496122_0007709_8184_8675 160
928 3300048925 Ga0496122_0011561 Ga0496122_0011561_1644_2135 160
929 3300048925 Ga0496122_0014358 Ga0496122_0014358_545_1036 160
930 3300048925 Ga0496122_0020273 Ga0496122_0020273_5470_5961 160
931 3300048925 Ga0496122_0033961 Ga0496122_0033961_451_948 160
932 3300048925 Ga0496122_0116391 Ga0496122_0116391_351_836 160
933 3300048925 Ga0496122_0184104 Ga0496122_0184104_17_499 160
934 3300048926 Ga0496123_0000008 Ga0496123_0000008_452090_452581 160
935 3300048926 Ga0496123_0000025 Ga0496123_0000025_317128_317619 160
936 3300048926 Ga0496123_0000841 Ga0496123_0000841_29993_30484 160
937 3300048926 Ga0496123_0001242 Ga0496123_0001242_18100_18591 160
938 3300048926 Ga0496123_0001788 Ga0496123_0001788_20221_20712 160
939 3300048926 Ga0496123_0002844 Ga0496123_0002844_1516_1998 160
940 3300048926 Ga0496123_0002895 Ga0496123_0002895_8840_9331 160
941 3300048926 Ga0496123_0003475 Ga0496123_0003475_38_529 160
942 3300048926 Ga0496123_0004906 Ga0496123_0004906_3182_3673 160
943 3300048926 Ga0496123_0012914 Ga0496123_0012914_2410_2907 160
944 3300048926 Ga0496123_0013270 Ga0496123_0013270_5154_5645 160
945 3300048926 Ga0496123_0050245 Ga0496123_0050245_1284_1769 160
946 3300048926 Ga0496123_0054983 Ga0496123_0054983_1847_2338 160
947 3300048926 Ga0496123_0094062 Ga0496123_0094062_1180_1662 160
948 3300048927 Ga0496124_0000642 Ga0496124_0000642_31978_32469 160
949 3300048927 Ga0496124_0000753 Ga0496124_0000753_18571_19062 160
950 3300048927 Ga0496124_0001178 Ga0496124_0001178_30900_31391 160
951 3300048927 Ga0496124_0001402 Ga0496124_0001402_28978_29469 160
952 3300048927 Ga0496124_0002501 Ga0496124_0002501_19701_20192 160
953 3300048927 Ga0496124_0003768 Ga0496124_0003768_2393_2884 160
954 3300048927 Ga0496124_0012450 Ga0496124_0012450_4414_4905 160
955 3300048927 Ga0496124_0023314 Ga0496124_0023314_1917_2408 160
956 3300048927 Ga0496124_0032060 Ga0496124_0032060_4096_4581 160
957 3300048927 Ga0496124_0033825 Ga0496124_0033825_163_654 160
958 3300048927 Ga0496124_0034505 Ga0496124_0034505_620_1111 160
959 3300048927 Ga0496124_0041109 Ga0496124_0041109_2108_2590 160
960 3300048927 Ga0496124_0046009 Ga0496124_0046009_2762_3253 160
961 3300048927 Ga0496124_0051778 Ga0496124_0051778_1777_2259 160
962 3300048927 Ga0496124_0066279 Ga0496124_0066279_1890_2372 160
963 3300048927 Ga0496124_0074346 Ga0496124_0074346_2238_2729 160
964 3300048927 Ga0496124_0220114 Ga0496124_0220114_903_1388 160
965 3300048927 Ga0496124_0396929 Ga0496124_0396929_351_833 160
966 3300048927 Ga0496124_0399441 Ga0496124_0399441_121_603 160
967 3300048927 Ga0496124_0582746 Ga0496124_0582746_94_585 160
968 3300048928 Ga0496125_0000032 Ga0496125_0000032_59480_59962 160
969 3300048928 Ga0496125_0000054 Ga0496125_0000054_6042_6533 160
970 3300048928 Ga0496125_0000418 Ga0496125_0000418_14965_15456 160
971 3300048928 Ga0496125_0000784 Ga0496125_0000784_3182_3673 160
972 3300048928 Ga0496125_0001043 Ga0496125_0001043_913_1398 160
973 3300048928 Ga0496125_0006561 Ga0496125_0006561_11068_11559 160
974 3300048929 Ga0496126_0000472 Ga0496126_0000472_69156_69647 160
975 3300048929 Ga0496126_0001428 Ga0496126_0001428_7873_8364 160
976 3300048929 Ga0496126_0003854 Ga0496126_0003854_4308_4799 160
977 3300048929 Ga0496126_0008329 Ga0496126_0008329_6914_7405 160
978 3300048929 Ga0496126_0009538 Ga0496126_0009538_1874_2365 160
979 3300048929 Ga0496126_0013021 Ga0496126_0013021_7373_7894 160
980 3300048929 Ga0496126_0094931 Ga0496126_0094931_1798_2289 160
981 3300048929 Ga0496126_0095506 Ga0496126_0095506_761_1243 160
982 3300048929 Ga0496126_0137549 Ga0496126_0137549_360_842 160
983 3300048929 Ga0496126_0139150 Ga0496126_0139150_563_1054 160
984 3300048929 Ga0496126_0149658 Ga0496126_0149658_614_1105 160
985 3300048929 Ga0496126_0150946 Ga0496126_0150946_1180_1671 160
986 3300048929 Ga0496126_0161837 Ga0496126_0161837_218_709 160
987 3300048929 Ga0496126_0163870 Ga0496126_0163870_416_901 160
988 3300048929 Ga0496126_0234589 Ga0496126_0234589_187_678 160
989 3300048929 Ga0496126_0248071 Ga0496126_0248071_251_742 160
990 3300048929 Ga0496126_0305269 Ga0496126_0305269_757_1248 160
991 3300048929 Ga0496126_0339058 Ga0496126_0339058_589_1071 160
992 3300048929 Ga0496126_0372984 Ga0496126_0372984_106_597 160
993 3300048929 Ga0496126_0568192 Ga0496126_0568192_29_511 160
994 3300049459 Ga0495678_000007 Ga0495678_000007_251620_252117 160
995 3300049459 Ga0495678_000421 Ga0495678_000421_32169_32651 160
996 3300049459 Ga0495678_002861 Ga0495678_002861_4199_4690 160
997 3300049459 Ga0495678_013961 Ga0495678_013961_2300_2791 160
998 3300049460 Ga0495682_0000003 Ga0495682_0000003_511131_511622 160
999 3300049460 Ga0495682_0000111 Ga0495682_0000111_15824_16315 160
1000 3300049460 Ga0495682_0015703 Ga0495682_0015703_1684_2175 160
1001 3300049766 Ga0501269_003450 Ga0501269_003450_208_699 160
1002 3300049853 Ga0501226_000242 Ga0501226_000242_7563_8054 160
1003 3300050493 nmdc:mga0k408_9113_c1 nmdc:mga0k408_9113_c1_1415_1897 160
1004 3300050514 nmdc:mga08x19_105349_c1 nmdc:mga08x19_105349_c1_933_1424 160
1005 3300050514 nmdc:mga08x19_54434_c1 nmdc:mga08x19_54434_c1_1068_1559 160
1006 3300053126 Ga0500621_000007 Ga0500621_000007_64556_65047 160
1007 3300053161 Ga0500634_0000423 Ga0500634_0000423_10234_10725 160
1008 3300009011 Ga0105251_10017003 Ga0105251_100170033 161
1009 3300009036 Ga0105244_10000298 Ga0105244_100002989 161
1010 3300009036 Ga0105244_10012009 Ga0105244_100120092 161
1011 3300009036 Ga0105244_10048080 Ga0105244_100480802 161
1012 3300009092 Ga0105250_10100191 Ga0105250_101001912 161
1013 3300013100 Ga0157373_10007838 Ga0157373_1000783811 161
1014 3300013100 Ga0157373_10020473 Ga0157373_100204732 161
1015 3300013100 Ga0157373_10126488 Ga0157373_101264882 161
1016 3300013102 Ga0157371_10000317 Ga0157371_1000031733 161
1017 3300013102 Ga0157371_10523210 Ga0157371_105232102 161
1018 3300013102 Ga0157371_10681118 Ga0157371_106811181 161
1019 3300013102 Ga0157371_10801238 Ga0157371_108012381 161
1020 3300013105 Ga0157369_10041502 Ga0157369_100415022 161
1021 3300013105 Ga0157369_10180925 Ga0157369_101809252 161
1022 3300013307 Ga0157372_10013473 Ga0157372_100134737 161
1023 3300013307 Ga0157372_10045838 Ga0157372_100458388 161
1024 3300041405 Ga0439438_000182 Ga0439438_000182_26647_27153 161
1025 3300042006 Ga0439432_005935 Ga0439432_005935_1466_1972 161
1026 3300042006 Ga0439432_027437 Ga0439432_027437_114_620 161
1027 3300042010 Ga0439452_000132 Ga0439452_000132_19204_19710 161
1028 3300046460 Ga0495638_0008397 Ga0495638_0008397_6383_6889 161
1029 3300046471 Ga0495650_0000692 Ga0495650_0000692_22515_23021 161
1030 3300046810 Ga0495660_0004434 Ga0495660_0004434_4023_4529 161
1031 3300048919 Ga0496116_0022516 Ga0496116_0022516_639_1145 161
1032 3300048920 Ga0496117_0000078 Ga0496117_0000078_93562_94068 161
1033 3300048921 Ga0496118_0000059 Ga0496118_0000059_133001_133507 161
1034 3300048922 Ga0496119_0239119 Ga0496119_0239119_246_752 161
1035 3300048923 Ga0496120_0010197 Ga0496120_0010197_5891_6397 161
1036 3300048925 Ga0496122_0004295 Ga0496122_0004295_2107_2613 161
1037 3300048926 Ga0496123_0002916 Ga0496123_0002916_2107_2613 161
1038 3300048926 Ga0496123_0032734 Ga0496123_0032734_2755_3261 161
1039 3300048927 Ga0496124_0000288 Ga0496124_0000288_10244_10750 161
1040 3300048927 Ga0496124_0037192 Ga0496124_0037192_910_1416 161
1041 3300048927 Ga0496124_0115610 Ga0496124_0115610_824_1330 161
1042 3300041405 Ga0439438_005716 Ga0439438_005716_2922_3437 162
1043 3300041411 Ga0439466_0007318 Ga0439466_0007318_3542_4057 162
1044 3300042010 Ga0439452_088376 Ga0439452_088376_44_559 162
1045 3300046460 Ga0495638_0006559 Ga0495638_0006559_3989_4522 162
1046 3300046460 Ga0495638_0087533 Ga0495638_0087533_1165_1680 162
1047 3300046471 Ga0495650_0000102 Ga0495650_0000102_80279_80821 162
1048 3300046474 Ga0495605_0046002 Ga0495605_0046002_1216_1731 162
1049 3300046474 Ga0495605_0048887 Ga0495605_0048887_1216_1749 162
1050 3300046501 Ga0495607_0004348 Ga0495607_0004348_3518_4051 162
1051 3300046507 Ga0495606_0007406 Ga0495606_0007406_6322_6837 162
1052 3300046513 Ga0495616_0072832 Ga0495616_0072832_1036_1551 162
1053 3300046515 Ga0495620_0212659 Ga0495620_0212659_66_599 162
1054 3300046520 Ga0495637_0006292 Ga0495637_0006292_3046_3561 162
1055 3300046522 Ga0495643_0019424 Ga0495643_0019424_3157_3690 162
1056 3300046530 Ga0495654_0209229 Ga0495654_0209229_40_573 162
1057 3300046542 Ga0495597_0002746 Ga0495597_0002746_3763_4296 162
1058 3300046558 Ga0495633_0286607 Ga0495633_0286607_194_709 162
1059 3300046648 Ga0495611_0104821 Ga0495611_0104821_172_705 162
1060 3300046694 Ga0495649_0005565 Ga0495649_0005565_276_809 162
1061 3300046694 Ga0495649_0199777 Ga0495649_0199777_202_735 162
1062 3300046694 Ga0495649_0204579 Ga0495649_0204579_308_823 162
1063 3300046810 Ga0495660_0000006 Ga0495660_0000006_435398_435940 162
1064 3300047323 Ga0495683_0040788 Ga0495683_0040788_254_787 162
1065 3300048091 Ga0495626_0155765 Ga0495626_0155765_174_707 162
1066 3300048919 Ga0496116_0000020 Ga0496116_0000020_451375_451917 162
1067 3300048920 Ga0496117_0063330 Ga0496117_0063330_555_1097 162
1068 3300048921 Ga0496118_0030212 Ga0496118_0030212_2698_3186 162
1069 3300048921 Ga0496118_0077159 Ga0496118_0077159_250_792 162
1070 3300048922 Ga0496119_0045567 Ga0496119_0045567_1889_2431 162
1071 3300048923 Ga0496120_0063296 Ga0496120_0063296_317_859 162
1072 3300048927 Ga0496124_0000084 Ga0496124_0000084_51975_52517 162
1073 3300048928 Ga0496125_0000071 Ga0496125_0000071_64844_65386 162
1074 3300048929 Ga0496126_0000304 Ga0496126_0000304_99081_99623 162
1075 3300049459 Ga0495678_003209 Ga0495678_003209_6371_6904 162
1076 3300046458 Ga0495591_023403 Ga0495591_023403_211_729 164
1077 3300046616 Ga0495668_0225474 Ga0495668_0225474_256_774 164
1078 2162886007 SwRhRL2b_contig_1116176 SwRhRL2b_0883.00005610 165
1079 3300009036 Ga0105244_10001219 Ga0105244_1000121922 165
1080 3300009036 Ga0105244_10008637 Ga0105244_100086373 165
1081 3300009036 Ga0105244_10014891 Ga0105244_100148912 165
1082 3300009036 Ga0105244_10090210 Ga0105244_100902103 165
1083 3300009092 Ga0105250_10000819 Ga0105250_100008199 165
1084 3300009092 Ga0105250_10001311 Ga0105250_100013119 165
1085 3300013100 Ga0157373_11007862 Ga0157373_110078621 165
1086 3300013102 Ga0157371_10000331 Ga0157371_1000033119 165
1087 3300046453 Ga0495627_042386 Ga0495627_042386_248_775 165
1088 3300046458 Ga0495591_007139 Ga0495591_007139_429_956 165
1089 3300046530 Ga0495654_0002279 Ga0495654_0002279_11866_12393 165
1090 3300046694 Ga0495649_0000522 Ga0495649_0000522_3949_4476 165
1091 3300047320 Ga0495672_0000052 Ga0495672_0000052_231532_232059 165
1092 3300048904 Ga0496101_0000150 Ga0496101_0000150_23993_24520 165
1093 3300048919 Ga0496116_0000145 Ga0496116_0000145_143515_144042 165
1094 3300048919 Ga0496116_0005378 Ga0496116_0005378_9103_9630 165
1095 3300048920 Ga0496117_0002315 Ga0496117_0002315_6482_7009 165
1096 3300048921 Ga0496118_0001133 Ga0496118_0001133_29488_30015 165
1097 3300048922 Ga0496119_0004029 Ga0496119_0004029_6511_7038 165
1098 3300048922 Ga0496119_0004379 Ga0496119_0004379_6679_7206 165
1099 3300048922 Ga0496119_0043031 Ga0496119_0043031_1107_1664 165
1100 3300048923 Ga0496120_0006547 Ga0496120_0006547_1864_2391 165
1101 3300048923 Ga0496120_0006581 Ga0496120_0006581_5560_6117 165
1102 3300048924 Ga0496121_0000558 Ga0496121_0000558_18427_18954 165
1103 3300048924 Ga0496121_0002795 Ga0496121_0002795_20267_20794 165
1104 3300048925 Ga0496122_0002879 Ga0496122_0002879_68_595 165
1105 3300048925 Ga0496122_0141137 Ga0496122_0141137_144_701 165
1106 3300048926 Ga0496123_0001823 Ga0496123_0001823_68_595 165
1107 3300048926 Ga0496123_0025403 Ga0496123_0025403_1473_2030 165
1108 3300048927 Ga0496124_0016541 Ga0496124_0016541_3736_4263 165
1109 3300048927 Ga0496124_0115381 Ga0496124_0115381_1211_1738 165
1110 3300048927 Ga0496124_0289186 Ga0496124_0289186_260_787 165
1111 3300048928 Ga0496125_0001149 Ga0496125_0001149_9223_9750 165
1112 3300048929 Ga0496126_0002072 Ga0496126_0002072_19409_19966 165
1113 iso_pu_bacteria 2744054900 2746084806 165
1114 iso_pu_bacteria 2744054901 2746098570 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05638

T6SS_HCP

Type VI secretion system effector, Hcp

33

173

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hkh-assembly2.cif.gz_B structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w 0.9845 8 162
4hkh-assembly4.cif.gz_E structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w 0.9802 7 164
4hkh-assembly5.cif.gz_F structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w 0.9738 7 162
4hkh-assembly4.cif.gz_E structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w 0.9731 7 164
4hkh-assembly3.cif.gz_D structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w 0.9717 8 162
ID Description Score Start End Superfamily
4hkhG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.97 8 162 2.30.110.20
4hkhG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9566 8 162 2.30.110.20
6a2vB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8891 7 162 2.30.110.20
6a2vB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8782 7 162 2.30.110.20
3he1F00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8696 9 163 2.30.110.20
ID Description Score Start End GO Terms
AF-H2J0B8-F1-model_v4 Type VI secretion system effector, Hcp1 family 0.9945 6 165
AF-A0A7Y8YLV8-F1-model_v4 deleted 0.9938 6 161
AF-A0A3N7ZU88-F1-model_v4 Type VI secretion system tube protein Hcp 0.991 6 164
AF-A0A6D0M0L6-F1-model_v4 deleted 0.9908 23 156
AF-A0A2W7GLI8-F1-model_v4 deleted 0.99 6 165

Feature Viewer

pLDDT pTM Quality
94.13 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map