F490221

General Info

Members Datasets Scaffolds Average Seq Length
1110 436 909 317

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0027860|Ga0495605_0027860_1887_2879
Length 330
Sequence MRAIPLVPLLLGGWLVLPVHADDAQDQLKRLAQAEQQQSFQGTFVYERNGSFSTHRIWHRVADGKVSEHLLQLDGSAQEVLRVDGVTQCVSGTLEAGVSNLPDSPAHAFDAAKLSAWYDMKVAGSSRVAGRPATVVTLTPRDQHRYGIELHLDNQTGLPLKSLLLSDKGQLLERFQFTELNSADPLTDQMLQPSADCKTVTVAKTKPEPQKQQVAWHSDWLPPGFELSNAAARKDPDSKTLVTSLMYDDGLARFSVFIEPVSGAAVTDIRTQLGPTVAVSRRLTTPKGDAMVTVVGEIPIGTAERIALSMRNDPATSSAGSKASGATSKN

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231006 Pseudomonas sp. GM17 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231008 Pseudomonas sp. GM21 Isolate Nodule
8 2511231010 Pseudomonas sp. GM25 Isolate Nodule
9 2511231011 Pseudomonas sp. GM30 Isolate Nodule
10 2511231012 Pseudomonas sp. GM33 Isolate Nodule
11 2511231014 Pseudomonas sp. GM48 Isolate Nodule
12 2511231015 Pseudomonas sp. GM49 Isolate Nodule
13 2511231016 Pseudomonas sp. GM50 Isolate Nodule
14 2511231017 Pseudomonas sp. GM55 Isolate Nodule
15 2511231018 Pseudomonas sp. GM60 Isolate Nodule
16 2511231019 Pseudomonas sp. GM67 Isolate Nodule
17 2511231020 Pseudomonas sp. GM74 Isolate Nodule
18 2511231021 Pseudomonas sp. GM78 Isolate Nodule
19 2511231022 Pseudomonas sp. GM79 Isolate Nodule
20 2511231023 Pseudomonas sp. GM80 Isolate Nodule
21 2511231024 Pseudomonas sp. GM84 Isolate Nodule
22 2511231031 Pseudomonas sp. GM16 Isolate Nodule
23 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
24 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
25 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
26 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
27 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
28 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
29 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
30 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
31 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
32 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
33 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
34 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
35 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
36 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
37 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
38 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
39 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
40 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
41 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
42 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
43 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
44 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
45 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
46 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
47 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
48 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
49 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
50 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
51 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
52 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
53 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
54 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
55 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
56 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
57 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
58 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
59 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
60 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
61 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
62 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
63 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
64 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
65 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
66 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
67 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
68 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
69 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
70 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
71 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
72 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
73 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
74 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
75 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
76 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
77 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
78 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
79 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
80 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
81 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
82 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
83 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
84 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
85 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
86 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
87 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
88 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
89 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
90 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
91 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
92 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
93 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
94 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
95 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
96 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
97 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
98 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
99 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
100 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
101 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
102 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
103 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
104 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
105 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
106 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
107 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
108 2765235841 Pseudomonas putida AA7 Isolate Unclassified
109 2773857670 Pseudomonas sp. 478 Isolate Unclassified
110 2773857673 Pseudomonas sp. 443 Isolate Unclassified
111 2784132063 Pseudomonas sp. 424 Isolate Unclassified
112 2784132072 Pseudomonas sp. 460 Isolate Unclassified
113 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
114 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
115 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
116 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
117 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
118 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
119 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
120 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
121 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
122 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
123 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
124 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
125 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
126 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
127 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
128 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
129 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
130 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
131 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
132 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
133 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
134 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
135 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
136 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
137 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
138 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
139 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
140 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
141 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
142 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
143 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
144 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
145 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
146 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
147 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
148 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
149 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
150 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
151 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
152 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
153 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
154 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
155 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
156 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
157 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
158 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
159 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
160 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
161 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
162 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
163 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
164 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
165 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
166 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
167 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
168 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
169 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
170 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
171 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
172 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
173 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
174 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
175 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
176 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
177 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
178 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
179 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
180 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
181 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
182 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
183 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
184 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
185 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
186 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
187 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
188 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
189 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
190 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
191 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
192 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
193 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
194 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
195 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
196 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
197 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
198 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
199 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
200 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
201 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
202 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
203 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
204 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
205 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
206 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
207 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
208 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
209 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
210 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
211 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
212 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
213 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
214 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
215 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
216 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
217 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
218 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
219 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
220 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
221 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
222 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
223 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
224 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
225 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
226 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
227 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
229 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
230 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
231 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
232 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
233 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
244 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
245 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
251 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
252 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
253 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
254 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
255 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
256 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
257 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
260 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
261 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
262 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
263 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
264 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
265 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
266 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
267 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
268 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
269 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
270 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
271 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
272 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
273 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
274 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
275 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
276 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
277 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
278 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
279 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
280 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
281 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
282 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
283 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
284 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
285 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
286 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
287 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
288 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
289 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
290 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
291 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
292 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
293 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
294 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
295 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
296 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
297 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
298 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
299 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
300 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
301 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
302 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
303 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
304 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
305 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
306 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
307 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
308 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
309 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
310 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
311 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
312 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
313 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
314 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
315 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
316 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
317 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
318 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
319 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
320 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
321 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
322 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
323 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
324 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
325 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
326 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
327 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
328 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
329 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
330 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
331 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
332 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
333 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
334 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
335 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
336 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
337 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
338 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
339 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
340 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
341 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
342 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
343 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
344 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
345 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
346 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
347 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
348 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
349 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
350 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
351 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
352 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
353 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
354 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
355 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
356 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
357 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
358 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
359 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
360 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
361 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
362 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
363 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
364 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
365 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
366 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
367 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
368 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
369 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
370 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
371 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
372 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
373 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
374 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
375 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
376 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
377 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
378 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
379 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
380 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
381 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
382 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
383 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
384 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
385 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
388 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
389 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
390 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
391 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
392 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
393 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
394 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
395 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
396 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
397 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
398 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
399 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
400 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
401 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
402 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
403 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
409 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
410 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
413 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
414 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
415 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
417 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
418 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
419 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
420 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
421 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
422 8052494512 Pseudomonas putida LD6 Isolate Unclassified
423 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
424 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
425 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
426 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
427 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
428 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
429 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
430 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
431 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
432 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
433 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
434 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
435 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
436 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.35
Metatranscriptomes 0.54
Isolates 18.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.77
Nodule 2.61
Rhizoplane 6.58
Rhizosphere 74.77
Stem 0
Stem Tuber 0
Unclassified 11.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_27 2124908027 Bacteria 53155
2 MRS2a_Contig_6276 2124908027 Bacteria 2644
3 SwRhRL2b_contig_722602 2162886007 Bacteria 2196
4 MRS1b_contig_3814 2162886011 Bacteria 1952
5 JGI25162J39368_1000132 3300002737 Bacteria 80803
6 JGI25163J39215_1001003 3300002771 Bacteria 6221
7 JGI25163J39215_1001640 3300002771 Bacteria 3322
8 JGI25164J39214_1000029 3300002772 Bacteria 147779
9 JGI25164J39214_1000106 3300002772 Bacteria 80803
10 JGI25165J46597_1000111 3300003214 Bacteria 147779
11 JGI25165J46597_1000217 3300003214 Bacteria 80803
12 rootH1_10289084 3300003323 Bacteria 1442
13 Ga0006562J51391_1005324 3300003578 Bacteria 4100
14 Ga0055536_1000043 3300003781 Bacteria 124663
15 Ga0055536_1004002 3300003781 Bacteria 7698
16 Ga0055536_1004073 3300003781 Bacteria 7606
17 Ga0055536_1036712 3300003781 Bacteria 1208
18 Ga0055530_10000031 3300003791 Bacteria 122117
19 Ga0055530_10004130 3300003791 Bacteria 7698
20 Ga0055530_10004172 3300003791 Bacteria 7630
21 Ga0055540_1000415 3300003792 Bacteria 34269
22 Ga0055540_1003406 3300003792 Bacteria 7698
23 Ga0055540_1003457 3300003792 Bacteria 7630
24 Ga0055540_1018326 3300003792 Bacteria 1921
25 Ga0055531_10000283 3300003794 Bacteria 51426
26 Ga0065714_10000009 3300005288 Bacteria 21525
27 Ga0065714_10003519 3300005288 Bacteria 6867
28 Ga0065714_10004035 3300005288 Bacteria 6830
29 Ga0065714_10019813 3300005288 Bacteria 1931
30 Ga0065714_10065522 3300005288 Bacteria 9626
31 Ga0065714_10068042 3300005288 Bacteria 5010
32 Ga0065714_10068362 3300005288 Bacteria 4768
33 Ga0065714_10071009 3300005288 Bacteria 3703
34 Ga0065714_10078627 3300005288 Bacteria 2582
35 Ga0065714_10082576 3300005288 Bacteria 2295
36 Ga0065704_10001998 3300005289 Bacteria 6708
37 Ga0065704_10006243 3300005289 Bacteria 3375
38 Ga0065704_10006864 3300005289 Bacteria 2617
39 Ga0065704_10086866 3300005289 Bacteria 3065
40 Ga0065712_10000649 3300005290 Bacteria 9303
41 Ga0065712_10067895 3300005290 Bacteria 22221
42 Ga0065715_10008316 3300005293 Bacteria 5960
43 Ga0070669_100306876 3300005353 Bacteria 1278
44 Ga0070662_100019401 3300005457 Bacteria 4616
45 Ga0075364_10089589 3300006051 Bacteria 2040
46 Ga0075364_10163874 3300006051 Bacteria 1501
47 Ga0075364_10325072 3300006051 Bacteria 1047
48 Ga0075432_10004652 3300006058 Bacteria 4672
49 Ga0075432_10007662 3300006058 Bacteria 3683
50 Ga0075432_10037467 3300006058 Bacteria 1688
51 Ga0075432_10054030 3300006058 Bacteria 1421
52 Ga0075362_10113548 3300006177 Bacteria 1277
53 Ga0099823_1016692 3300006944 Bacteria 7191
54 Ga0079104_1000090 3300006946 Bacteria 132824
55 Ga0079104_1000134 3300006946 Bacteria 103774
56 Ga0099826_10003760 3300006948 Bacteria 10433
57 Ga0105251_10000004 3300009011 Bacteria 285212
58 Ga0105251_10000149 3300009011 Bacteria 71244
59 Ga0105251_10001609 3300009011 Bacteria 19193
60 Ga0105251_10006481 3300009011 Bacteria 7443
61 Ga0105251_10020224 3300009011 Bacteria 3501
62 Ga0105251_10020962 3300009011 Bacteria 3422
63 Ga0105251_10077823 3300009011 Bacteria 1537
64 Ga0105244_10000922 3300009036 Bacteria 24861
65 Ga0105244_10012941 3300009036 Bacteria 4908
66 Ga0105244_10013329 3300009036 Bacteria 4812
67 Ga0105244_10020751 3300009036 Bacteria 3644
68 Ga0105244_10022164 3300009036 Bacteria 3498
69 Ga0105244_10024012 3300009036 Bacteria 3333
70 Ga0105244_10025221 3300009036 Bacteria 3235
71 Ga0105244_10031172 3300009036 Bacteria 2830
72 Ga0105244_10036374 3300009036 Bacteria 2580
73 Ga0105244_10037258 3300009036 Bacteria 2543
74 Ga0105244_10059997 3300009036 Bacteria 1917
75 Ga0105244_10066409 3300009036 Bacteria 1806
76 Ga0105244_10070997 3300009036 Bacteria 1736
77 Ga0105244_10071768 3300009036 Bacteria 1726
78 Ga0105244_10074577 3300009036 Bacteria 1687
79 Ga0105244_10081183 3300009036 Bacteria 1605
80 Ga0105244_10114729 3300009036 Bacteria 1308
81 Ga0105250_10000235 3300009092 Bacteria 46317
82 Ga0105250_10005280 3300009092 Bacteria 5803
83 Ga0105250_10012229 3300009092 Bacteria 3546
84 Ga0105250_10018577 3300009092 Bacteria 2815
85 Ga0105250_10045489 3300009092 Bacteria 1760
86 Ga0105250_10092306 3300009092 Bacteria 1232
87 Ga0105243_10000144 3300009148 Bacteria 81484
88 Ga0105243_10000218 3300009148 Bacteria 67019
89 Ga0105243_10051760 3300009148 Bacteria 3249
90 Ga0105243_10080446 3300009148 Bacteria 2658
91 Ga0105243_10130389 3300009148 Bacteria 2132
92 Ga0105243_10200699 3300009148 Bacteria 1749
93 Ga0105242_10123597 3300009176 Bacteria 2225
94 Ga0105246_10000228 3300011119 Bacteria 28707
95 Ga0105246_10295921 3300011119 Bacteria 1304
96 Ga0105246_10336244 3300011119 Bacteria 1232
97 Ga0157345_1000028 3300012498 Bacteria 37231
98 Ga0157373_10008179 3300013100 Bacteria 7780
99 Ga0157373_10008952 3300013100 Bacteria 7405
100 Ga0157373_10009220 3300013100 Bacteria 7297
101 Ga0157373_10009462 3300013100 Bacteria 7199
102 Ga0157373_10013114 3300013100 Bacteria 6084
103 Ga0157373_10070497 3300013100 Bacteria 2470
104 Ga0157373_10164417 3300013100 Bacteria 1562
105 Ga0157373_10312381 3300013100 Bacteria 1117
106 Ga0157371_10000230 3300013102 Bacteria 80303
107 Ga0157371_10000460 3300013102 Bacteria 49750
108 Ga0157371_10008723 3300013102 Bacteria 8047
109 Ga0157371_10015482 3300013102 Bacteria 5720
110 Ga0157370_10036735 3300013104 Bacteria 4753
111 Ga0157370_10102041 3300013104 Bacteria 2687
112 Ga0157370_10217470 3300013104 Bacteria 1770
113 Ga0157370_10374505 3300013104 Bacteria 1312
114 Ga0157369_10019705 3300013105 Bacteria 7550
115 Ga0157369_10260890 3300013105 Bacteria 1807
116 Ga0157369_10356841 3300013105 Bacteria 1518
117 Ga0157369_10356882 3300013105 Bacteria 1518
118 Ga0163162_10098170 3300013306 Bacteria 3018
119 Ga0163162_10108221 3300013306 Bacteria 2876
120 Ga0157372_10000815 3300013307 Bacteria 33774
121 Ga0157372_10120467 3300013307 Bacteria 3013
122 Ga0157375_10518220 3300013308 Bacteria 1356
123 Ga0157375_10611678 3300013308 Bacteria 1248
124 Ga0157375_10646505 3300013308 Bacteria 1214
125 Ga0182008_10000783 3300014497 Bacteria 22244
126 Ga0182008_10011690 3300014497 Bacteria 4658
127 Ga0182008_10014603 3300014497 Bacteria 4107
128 Ga0182008_10036226 3300014497 Bacteria 2469
129 Ga0182008_10038445 3300014497 Bacteria 2393
130 Ga0182008_10057774 3300014497 Bacteria 1916
131 Ga0182008_10065702 3300014497 Bacteria 1784
132 Ga0182008_10124341 3300014497 Bacteria 1283
133 Ga0182008_10156246 3300014497 Bacteria 1146
134 Ga0182006_1001311 3300015261 Bacteria 15281
135 Ga0182006_1003963 3300015261 Bacteria 7405
136 Ga0182006_1004043 3300015261 Bacteria 7314
137 Ga0182006_1006595 3300015261 Bacteria 5378
138 Ga0182006_1011169 3300015261 Bacteria 3964
139 Ga0182006_1014072 3300015261 Bacteria 3454
140 Ga0182006_1018198 3300015261 Bacteria 2973
141 Ga0182006_1049750 3300015261 Bacteria 1617
142 Ga0182006_1066701 3300015261 Bacteria 1344
143 Ga0182007_10003527 3300015262 Bacteria 7366
144 Ga0182005_1001973 3300015265 Bacteria 7707
145 Ga0182005_1015473 3300015265 Bacteria 2127
146 Ga0182005_1018865 3300015265 Bacteria 1905
147 Ga0182005_1050588 3300015265 Bacteria 1130
148 Ga0182005_1050589 3300015265 Bacteria 1130
149 Ga0163161_10010705 3300017792 Bacteria 6352
150 Ga0163161_10018309 3300017792 Bacteria 4908
151 Ga0163161_10071149 3300017792 Bacteria 2545
152 Ga0163161_10085613 3300017792 Bacteria 2325
153 Ga0163161_10151862 3300017792 Bacteria 1761
154 Ga0163161_10489344 3300017792 Bacteria 1000
155 Ga0206356_11555357 3300020070 Bacteria 1266
156 Ga0209760_100015 3300025207 Bacteria 176281
157 Ga0209760_100047 3300025207 Bacteria 107520
158 Ga0209563_100515 3300025230 Bacteria 13129
159 Ga0207427_100001 3300025231 Bacteria 1410763
160 Ga0207427_100029 3300025231 Bacteria 376678
161 Ga0209437_100003 3300025233 Bacteria 1517827
162 Ga0209437_100009 3300025233 Bacteria 915954
163 Ga0209759_1019525 3300025256 Bacteria 1604
164 Ga0209233_1000007 3300025261 Bacteria 1411234
165 Ga0209233_1000032 3300025261 Bacteria 623596
166 Ga0209675_1004059 3300025291 Bacteria 6668
167 Ga0209676_1000016 3300025292 Bacteria 655561
168 Ga0209676_1000033 3300025292 Bacteria 463236
169 Ga0209676_1000080 3300025292 Bacteria 287400
170 Ga0209676_1000721 3300025292 Bacteria 45474
171 Ga0209676_1001858 3300025292 Bacteria 17373
172 Ga0209676_1003397 3300025292 Bacteria 9864
173 Ga0209050_1000009 3300025298 Bacteria 1047265
174 Ga0209050_1000036 3300025298 Bacteria 423070
175 Ga0209050_1000117 3300025298 Bacteria 202979
176 Ga0209050_1001816 3300025298 Bacteria 20822
177 Ga0209051_1000053 3300025303 Bacteria 281564
178 Ga0209051_1000077 3300025303 Bacteria 202959
179 Ga0209051_1000094 3300025303 Bacteria 168538
180 Ga0209051_1014768 3300025303 Bacteria 3627
181 Ga0209257_1000173 3300025304 Bacteria 166678
182 Ga0209257_1026276 3300025304 Bacteria 1966
183 Ga0207696_1000022 3300025711 Bacteria 427529
184 Ga0207696_1000044 3300025711 Bacteria 300953
185 Ga0207696_1000083 3300025711 Bacteria 197352
186 Ga0207696_1002326 3300025711 Bacteria 9424
187 Ga0207696_1003920 3300025711 Bacteria 6561
188 Ga0207696_1004851 3300025711 Bacteria 5701
189 Ga0207696_1006039 3300025711 Bacteria 4939
190 Ga0207696_1029848 3300025711 Bacteria 1662
191 Ga0207655_1000005 3300025728 Bacteria 917277
192 Ga0207655_1000015 3300025728 Bacteria 600662
193 Ga0207655_1000193 3300025728 Bacteria 107789
194 Ga0207655_1000240 3300025728 Bacteria 90267
195 Ga0207655_1000516 3300025728 Bacteria 49122
196 Ga0207655_1001511 3300025728 Bacteria 21214
197 Ga0207655_1002564 3300025728 Bacteria 14532
198 Ga0207655_1005303 3300025728 Bacteria 8825
199 Ga0207655_1012339 3300025728 Bacteria 5001
200 Ga0207655_1019915 3300025728 Bacteria 3478
201 Ga0207655_1025696 3300025728 Bacteria 2852
202 Ga0207655_1026474 3300025728 Bacteria 2785
203 Ga0207655_1043244 3300025728 Bacteria 1908
204 Ga0207655_1045470 3300025728 Bacteria 1833
205 Ga0207655_1074279 3300025728 Bacteria 1251
206 Ga0207713_1000013 3300025735 Bacteria 475751
207 Ga0207713_1000104 3300025735 Bacteria 138310
208 Ga0207713_1000933 3300025735 Bacteria 26222
209 Ga0207713_1000977 3300025735 Bacteria 25286
210 Ga0207713_1003887 3300025735 Bacteria 9953
211 Ga0207713_1007436 3300025735 Bacteria 6465
212 Ga0207713_1007908 3300025735 Bacteria 6195
213 Ga0207713_1010208 3300025735 Bacteria 5215
214 Ga0207713_1010346 3300025735 Bacteria 5171
215 Ga0207713_1010443 3300025735 Bacteria 5135
216 Ga0207713_1020768 3300025735 Bacteria 3170
217 Ga0207713_1020816 3300025735 Bacteria 3164
218 Ga0207713_1024766 3300025735 Bacteria 2788
219 Ga0207713_1060892 3300025735 Bacteria 1439
220 Ga0207681_10337243 3300025923 Bacteria 1203
221 Ga0207706_10031700 3300025933 Bacteria 4707
222 Ga0207709_10000036 3300025935 Bacteria 292568
223 Ga0207709_10000250 3300025935 Bacteria 65488
224 Ga0207709_10011638 3300025935 Bacteria 4851
225 Ga0207709_10080242 3300025935 Bacteria 2100
226 Ga0209281_1000013 3300027111 Bacteria 653449
227 Ga0209281_1000172 3300027111 Bacteria 151766
228 Ga0209281_1008449 3300027111 Bacteria 2499
229 Ga0209281_1014360 3300027111 Bacteria 1679
230 Ga0209389_1000002 3300027296 Bacteria 333932
231 Ga0209371_1000414 3300027312 Bacteria 44059
232 Ga0209999_1005350 3300027543 Bacteria 2311
233 Ga0209282_1042241 3300027666 Bacteria 2692
234 Ga0207428_10029703 3300027907 Bacteria 4527
235 Ga0207428_10126181 3300027907 Bacteria 1960
236 Ga0207428_10233821 3300027907 Bacteria 1375
237 Ga0207428_10352501 3300027907 Bacteria 1083
238 Ga0268266_10156206 3300028379 Bacteria 2060
239 Ga0307517_10168130 3300028786 Bacteria 1450
240 Ga0307517_10239473 3300028786 Bacteria 1078
241 Ga0268256_1000355 3300030500 Bacteria 44059
242 Ga0314311_1203986 3300030733 Bacteria 4286
243 Ga0316178_1048493 3300030735 Bacteria 14555
244 Ga0316183_1025019 3300030742 Bacteria 2522
245 Ga0316183_1065202 3300030742 Bacteria 2363
246 Ga0316181_1070701 3300030744 Bacteria 1436
247 Ga0307408_100000081 3300031548 Bacteria 106920
248 Ga0307408_100003809 3300031548 Bacteria 10270
249 Ga0307408_100019038 3300031548 Bacteria 4618
250 Ga0307408_100062293 3300031548 Bacteria 2725
251 Ga0307408_100304399 3300031548 Bacteria 1336
252 Ga0307405_10008655 3300031731 Bacteria 5173
253 Ga0307412_10014719 3300031911 Bacteria 4623
254 Ga0307412_10015341 3300031911 Bacteria 4540
255 Ga0307412_10160042 3300031911 Bacteria 1671
256 Ga0307412_10203664 3300031911 Bacteria 1504
257 Ga0307412_10347440 3300031911 Bacteria 1189
258 Ga0307409_100238037 3300031995 Bacteria 1655
259 Ga0307414_10015196 3300032004 Bacteria 4641
260 Ga0307414_10060093 3300032004 Bacteria 2686
261 Ga0307414_10085384 3300032004 Bacteria 2325
262 Ga0307414_10122593 3300032004 Bacteria 2001
263 Ga0307411_10092953 3300032005 Bacteria 2110
264 Ga0307510_10020770 3300033180 Bacteria 7666
265 Ga0307510_10156577 3300033180 Bacteria 1884
266 Ga0237819_00586 3300038705 Bacteria 12170
267 Ga0439436_0006624 3300041404 Bacteria 3556
268 Ga0439438_000992 3300041405 Bacteria 12681
269 Ga0439438_001224 3300041405 Bacteria 11394
270 Ga0439438_002780 3300041405 Bacteria 7325
271 Ga0439438_004117 3300041405 Bacteria 5678
272 Ga0439438_005242 3300041405 Bacteria 4807
273 Ga0439438_005988 3300041405 Bacteria 4381
274 Ga0439438_006395 3300041405 Bacteria 4165
275 Ga0439438_009648 3300041405 Bacteria 3111
276 Ga0439438_015423 3300041405 Bacteria 2248
277 Ga0439438_020237 3300041405 Bacteria 1870
278 Ga0439438_024721 3300041405 Bacteria 1642
279 Ga0439447_000502 3300041407 Bacteria 14543
280 Ga0439447_001881 3300041407 Bacteria 7679
281 Ga0439447_003703 3300041407 Bacteria 5386
282 Ga0439447_007850 3300041407 Bacteria 3347
283 Ga0439447_008366 3300041407 Bacteria 3208
284 Ga0439447_008833 3300041407 Bacteria 3095
285 Ga0439447_010942 3300041407 Bacteria 2671
286 Ga0439466_0000342 3300041411 Bacteria 17912
287 Ga0439466_0001434 3300041411 Bacteria 9311
288 Ga0439466_0001459 3300041411 Bacteria 9229
289 Ga0439466_0002230 3300041411 Bacteria 7590
290 Ga0439466_0003988 3300041411 Bacteria 5695
291 Ga0439466_0005828 3300041411 Bacteria 4693
292 Ga0439466_0007938 3300041411 Bacteria 4002
293 Ga0439466_0012473 3300041411 Bacteria 3129
294 Ga0439466_0015533 3300041411 Bacteria 2765
295 Ga0439466_0018697 3300041411 Bacteria 2484
296 Ga0439466_0021069 3300041411 Bacteria 2315
297 Ga0439466_0054853 3300041411 Bacteria 1297
298 Ga0439465_0003166 3300041413 Bacteria 5368
299 Ga0439465_0027031 3300041413 Bacteria 1816
300 Ga0439431_0002910 3300041997 Bacteria 3762
301 Ga0439431_0005964 3300041997 Bacteria 2688
302 Ga0439431_0007018 3300041997 Bacteria 2506
303 Ga0439445_0033542 3300042004 Bacteria 1342
304 Ga0439445_0050313 3300042004 Bacteria 1124
305 Ga0439432_002305 3300042006 Bacteria 7190
306 Ga0439432_003429 3300042006 Bacteria 5884
307 Ga0439432_005514 3300042006 Bacteria 4550
308 Ga0439432_008520 3300042006 Bacteria 3598
309 Ga0439432_019693 3300042006 Bacteria 2246
310 Ga0439432_023356 3300042006 Bacteria 2037
311 Ga0439432_027182 3300042006 Bacteria 1869
312 Ga0439451_001946 3300042009 Bacteria 4129
313 Ga0439452_000500 3300042010 Bacteria 21349
314 Ga0439452_001277 3300042010 Bacteria 10694
315 Ga0439452_001890 3300042010 Bacteria 8061
316 Ga0439452_001939 3300042010 Bacteria 7918
317 Ga0439452_003673 3300042010 Bacteria 5318
318 Ga0439452_003981 3300042010 Bacteria 5048
319 Ga0439452_009442 3300042010 Bacteria 2872
320 Ga0439452_011351 3300042010 Bacteria 2563
321 Ga0439452_011895 3300042010 Bacteria 2490
322 Ga0439455_0005047 3300042012 Bacteria 2659
323 Ga0439456_000039 3300042013 Bacteria 48127
324 Ga0439456_000851 3300042013 Bacteria 6167
325 Ga0439456_004460 3300042013 Bacteria 2829
326 Ga0439456_005650 3300042013 Bacteria 2542
327 Ga0439456_007987 3300042013 Bacteria 2181
328 Ga0439456_012300 3300042013 Bacteria 1774
329 Ga0439456_017389 3300042013 Bacteria 1508
330 Ga0439463_001515 3300042016 Bacteria 6127
331 Ga0439463_005478 3300042016 Bacteria 3152
332 Ga0439463_017111 3300042016 Bacteria 1795
333 Ga0439463_035096 3300042016 Bacteria 1269
334 Ga0450911_000037 3300042115 Bacteria 60341
335 Ga0450911_000292 3300042115 Bacteria 18338
336 Ga0450911_004861 3300042115 Bacteria 2149
337 Ga0450919_003445 3300042121 Bacteria 1979
338 Ga0450922_001710 3300042124 Bacteria 2133
339 Ga0450922_002063 3300042124 Bacteria 1912
340 Ga0450890_000422 3300042127 Bacteria 6182
341 Ga0450891_002006 3300042129 Bacteria 2084
342 Ga0450900_000809 3300042136 Bacteria 2732
343 Ga0450902_000567 3300042137 Bacteria 4678
344 Ga0450902_020770 3300042137 Bacteria 1083
345 Ga0450903_000781 3300042138 Bacteria 6196
346 Ga0450904_000012 3300042139 Bacteria 42482
347 Ga0450904_001656 3300042139 Bacteria 2991
348 Ga0450905_000074 3300042142 Bacteria 9342
349 Ga0450905_001959 3300042142 Bacteria 2623
350 Ga0450905_004581 3300042142 Bacteria 1837
351 Ga0450905_011138 3300042142 Bacteria 1254
352 Ga0450906_000157 3300042145 Bacteria 12663
353 Ga0450907_000591 3300042146 Bacteria 9694
354 Ga0450907_001368 3300042146 Bacteria 5368
355 Ga0450910_005405 3300042147 Bacteria 1742
356 Ga0450910_008145 3300042147 Bacteria 1470
357 Ga0439446_0001558 3300042156 Bacteria 5265
358 Ga0439446_0002615 3300042156 Bacteria 4346
359 Ga0439446_0004462 3300042156 Bacteria 3548
360 Ga0439446_0005697 3300042156 Bacteria 3215
361 Ga0450909_003876 3300042185 Bacteria 2128
362 Ga0450909_004616 3300042185 Bacteria 1969
363 Ga0450909_006490 3300042185 Bacteria 1686
364 Ga0439434_0000189 3300042435 Bacteria 16824
365 Ga0439434_0002776 3300042435 Bacteria 5104
366 Ga0439434_0019941 3300042435 Bacteria 2012
367 Ga0439459_0001248 3300042438 Bacteria 3719
368 Ga0439464_0001261 3300042439 Bacteria 5884
369 Ga0439460_0000237 3300042461 Bacteria 11180
370 Ga0450916_000955 3300042530 Bacteria 2779
371 Ga0450916_005396 3300042530 Bacteria 1477
372 Ga0450918_005125 3300042531 Bacteria 2360
373 Ga0450893_0003354 3300042532 Bacteria 2523
374 Ga0450893_0004277 3300042532 Bacteria 2275
375 Ga0450901_000655 3300042533 Bacteria 4073
376 Ga0439440_0008818 3300042993 Bacteria 2076
377 Ga0439440_0016140 3300042993 Bacteria 1630
378 Ga0495617_001816 3300046452 Bacteria 9091
379 Ga0495617_012260 3300046452 Bacteria 2920
380 Ga0495617_023649 3300046452 Bacteria 2075
381 Ga0495617_031553 3300046452 Bacteria 1779
382 Ga0495617_033987 3300046452 Bacteria 1711
383 Ga0495617_061220 3300046452 Bacteria 1244
384 Ga0495617_072426 3300046452 Bacteria 1133
385 Ga0495627_000021 3300046453 Bacteria 282454
386 Ga0495627_000279 3300046453 Bacteria 51531
387 Ga0495627_002666 3300046453 Bacteria 8372
388 Ga0495627_002922 3300046453 Bacteria 7853
389 Ga0495627_012582 3300046453 Bacteria 2997
390 Ga0495627_033788 3300046453 Bacteria 1601
391 Ga0495603_0015991 3300046455 Bacteria 4536
392 Ga0495590_0000920 3300046457 Bacteria 13074
393 Ga0495590_0002374 3300046457 Bacteria 7801
394 Ga0495590_0026903 3300046457 Bacteria 2019
395 Ga0495590_0040384 3300046457 Bacteria 1627
396 Ga0495590_0042127 3300046457 Bacteria 1591
397 Ga0495591_000015 3300046458 Bacteria 252107
398 Ga0495591_001627 3300046458 Bacteria 13592
399 Ga0495591_003627 3300046458 Bacteria 7858
400 Ga0495591_003905 3300046458 Bacteria 7511
401 Ga0495591_005627 3300046458 Bacteria 5746
402 Ga0495591_006409 3300046458 Bacteria 5206
403 Ga0495591_006828 3300046458 Bacteria 4962
404 Ga0495591_007829 3300046458 Bacteria 4465
405 Ga0495591_008115 3300046458 Bacteria 4339
406 Ga0495591_008517 3300046458 Bacteria 4193
407 Ga0495591_027684 3300046458 Bacteria 1744
408 Ga0495591_041331 3300046458 Bacteria 1309
409 Ga0495629_0009993 3300046459 Bacteria 6924
410 Ga0495638_0007630 3300046460 Bacteria 7733
411 Ga0495638_0008249 3300046460 Bacteria 7401
412 Ga0495638_0015483 3300046460 Bacteria 5118
413 Ga0495638_0028103 3300046460 Bacteria 3634
414 Ga0495638_0083788 3300046460 Bacteria 1930
415 Ga0495638_0084376 3300046460 Bacteria 1922
416 Ga0495638_0097596 3300046460 Bacteria 1761
417 Ga0495638_0111073 3300046460 Bacteria 1628
418 Ga0495638_0116695 3300046460 Bacteria 1581
419 Ga0495638_0134801 3300046460 Bacteria 1447
420 Ga0495638_0203110 3300046460 Bacteria 1117
421 Ga0495638_0221724 3300046460 Bacteria 1056
422 Ga0495653_0009661 3300046463 Bacteria 7889
423 Ga0495653_0018187 3300046463 Bacteria 5712
424 Ga0495653_0035403 3300046463 Bacteria 3939
425 Ga0495650_0001786 3300046471 Bacteria 19471
426 Ga0495650_0011839 3300046471 Bacteria 4735
427 Ga0495650_0012047 3300046471 Bacteria 4679
428 Ga0495650_0015563 3300046471 Bacteria 3895
429 Ga0495650_0030937 3300046471 Bacteria 2416
430 Ga0495650_0098300 3300046471 Bacteria 1102
431 Ga0495582_0034309 3300046473 Bacteria 2789
432 Ga0495605_0000016 3300046474 Bacteria 289508
433 Ga0495605_0000031 3300046474 Bacteria 213242
434 Ga0495605_0000917 3300046474 Bacteria 20251
435 Ga0495605_0003709 3300046474 Bacteria 9061
436 Ga0495605_0004707 3300046474 Bacteria 7981
437 Ga0495605_0012909 3300046474 Bacteria 4622
438 Ga0495605_0020163 3300046474 Bacteria 3545
439 Ga0495605_0027860 3300046474 Bacteria 2922
440 Ga0495605_0029273 3300046474 Bacteria 2837
441 Ga0495605_0038274 3300046474 Bacteria 2407
442 Ga0495605_0045604 3300046474 Bacteria 2160
443 Ga0495639_0001930 3300046475 Bacteria 9203
444 Ga0495639_0022310 3300046475 Bacteria 2776
445 Ga0495584_0003475 3300046491 Bacteria 8661
446 Ga0495584_0004191 3300046491 Bacteria 7779
447 Ga0495584_0010552 3300046491 Bacteria 4744
448 Ga0495584_0024071 3300046491 Bacteria 3087
449 Ga0495584_0027340 3300046491 Bacteria 2890
450 Ga0495584_0042112 3300046491 Bacteria 2304
451 Ga0495584_0082595 3300046491 Bacteria 1617
452 Ga0495584_0092493 3300046491 Bacteria 1525
453 Ga0495584_0103383 3300046491 Bacteria 1440
454 Ga0495585_0004523 3300046492 Bacteria 9010
455 Ga0495585_0005559 3300046492 Bacteria 7923
456 Ga0495585_0013222 3300046492 Bacteria 4835
457 Ga0495585_0042969 3300046492 Bacteria 2529
458 Ga0495585_0048827 3300046492 Bacteria 2352
459 Ga0495585_0049967 3300046492 Bacteria 2320
460 Ga0495585_0066460 3300046492 Bacteria 1974
461 Ga0495585_0072113 3300046492 Bacteria 1882
462 Ga0495585_0072861 3300046492 Bacteria 1870
463 Ga0495585_0077270 3300046492 Bacteria 1807
464 Ga0495585_0142747 3300046492 Bacteria 1253
465 Ga0495594_0010081 3300046499 Bacteria 4894
466 Ga0495594_0031690 3300046499 Bacteria 2867
467 Ga0495594_0047830 3300046499 Bacteria 2349
468 Ga0495596_0003952 3300046500 Bacteria 7332
469 Ga0495596_0016460 3300046500 Bacteria 3071
470 Ga0495607_0000162 3300046501 Bacteria 71325
471 Ga0495607_0000566 3300046501 Bacteria 36103
472 Ga0495607_0001224 3300046501 Bacteria 23039
473 Ga0495607_0005921 3300046501 Bacteria 8671
474 Ga0495607_0013895 3300046501 Bacteria 5260
475 Ga0495607_0026684 3300046501 Bacteria 3582
476 Ga0495607_0028908 3300046501 Bacteria 3414
477 Ga0495607_0036902 3300046501 Bacteria 2940
478 Ga0495607_0042021 3300046501 Bacteria 2712
479 Ga0495607_0048157 3300046501 Bacteria 2493
480 Ga0495607_0049410 3300046501 Bacteria 2452
481 Ga0495607_0055547 3300046501 Bacteria 2277
482 Ga0495607_0060550 3300046501 Bacteria 2154
483 Ga0495607_0175758 3300046501 Bacteria 1077
484 Ga0495583_0000041 3300046506 Bacteria 234707
485 Ga0495583_0000698 3300046506 Bacteria 43244
486 Ga0495583_0001999 3300046506 Bacteria 18668
487 Ga0495583_0013199 3300046506 Bacteria 4621
488 Ga0495583_0025229 3300046506 Bacteria 2973
489 Ga0495583_0025374 3300046506 Bacteria 2961
490 Ga0495583_0072459 3300046506 Bacteria 1511
491 Ga0495606_0002535 3300046507 Bacteria 21017
492 Ga0495606_0009839 3300046507 Bacteria 8023
493 Ga0495606_0018681 3300046507 Bacteria 5188
494 Ga0495606_0033013 3300046507 Bacteria 3576
495 Ga0495606_0039096 3300046507 Bacteria 3202
496 Ga0495606_0190423 3300046507 Bacteria 1176
497 Ga0495610_0013447 3300046512 Bacteria 4863
498 Ga0495610_0017340 3300046512 Bacteria 4108
499 Ga0495610_0018209 3300046512 Bacteria 3975
500 Ga0495610_0023445 3300046512 Bacteria 3354
501 Ga0495610_0037736 3300046512 Bacteria 2456
502 Ga0495610_0060137 3300046512 Bacteria 1810
503 Ga0495610_0061875 3300046512 Bacteria 1776
504 Ga0495610_0124723 3300046512 Bacteria 1124
505 Ga0495616_0001130 3300046513 Bacteria 18916
506 Ga0495616_0004373 3300046513 Bacteria 8913
507 Ga0495616_0064488 3300046513 Bacteria 1787
508 Ga0495616_0066627 3300046513 Bacteria 1751
509 Ga0495616_0123915 3300046513 Bacteria 1190
510 Ga0495620_0000013 3300046515 Bacteria 160349
511 Ga0495620_0000015 3300046515 Bacteria 154625
512 Ga0495620_0010128 3300046515 Bacteria 4983
513 Ga0495620_0013776 3300046515 Bacteria 4133
514 Ga0495620_0027507 3300046515 Bacteria 2659
515 Ga0495630_0065472 3300046517 Bacteria 2731
516 Ga0495630_0109774 3300046517 Bacteria 2089
517 Ga0495631_0000635 3300046518 Bacteria 22971
518 Ga0495631_0012293 3300046518 Bacteria 4187
519 Ga0495631_0014178 3300046518 Bacteria 3851
520 Ga0495631_0040095 3300046518 Bacteria 2075
521 Ga0495631_0052373 3300046518 Bacteria 1782
522 Ga0495631_0061981 3300046518 Bacteria 1621
523 Ga0495631_0107489 3300046518 Bacteria 1199
524 Ga0495632_0000217 3300046519 Bacteria 58142
525 Ga0495632_0005235 3300046519 Bacteria 8636
526 Ga0495632_0006704 3300046519 Bacteria 7361
527 Ga0495632_0010845 3300046519 Bacteria 5360
528 Ga0495632_0012977 3300046519 Bacteria 4776
529 Ga0495632_0013137 3300046519 Bacteria 4741
530 Ga0495632_0015983 3300046519 Bacteria 4187
531 Ga0495632_0017098 3300046519 Bacteria 4013
532 Ga0495632_0021570 3300046519 Bacteria 3469
533 Ga0495632_0037714 3300046519 Bacteria 2450
534 Ga0495632_0071991 3300046519 Bacteria 1659
535 Ga0495632_0077674 3300046519 Bacteria 1587
536 Ga0495632_0118313 3300046519 Bacteria 1239
537 Ga0495637_0000381 3300046520 Bacteria 33258
538 Ga0495637_0003308 3300046520 Bacteria 8571
539 Ga0495637_0007187 3300046520 Bacteria 5543
540 Ga0495637_0009513 3300046520 Bacteria 4735
541 Ga0495637_0011974 3300046520 Bacteria 4158
542 Ga0495637_0012545 3300046520 Bacteria 4049
543 Ga0495637_0013794 3300046520 Bacteria 3828
544 Ga0495637_0017806 3300046520 Bacteria 3302
545 Ga0495637_0020579 3300046520 Bacteria 3035
546 Ga0495637_0028441 3300046520 Bacteria 2497
547 Ga0495637_0031160 3300046520 Bacteria 2360
548 Ga0495637_0039255 3300046520 Bacteria 2044
549 Ga0495637_0040168 3300046520 Bacteria 2015
550 Ga0495637_0041340 3300046520 Bacteria 1978
551 Ga0495637_0044102 3300046520 Bacteria 1900
552 Ga0495637_0049744 3300046520 Bacteria 1759
553 Ga0495637_0052071 3300046520 Bacteria 1710
554 Ga0495637_0080267 3300046520 Bacteria 1301
555 Ga0495643_0002001 3300046522 Bacteria 16994
556 Ga0495643_0002058 3300046522 Bacteria 16681
557 Ga0495643_0013131 3300046522 Bacteria 4971
558 Ga0495643_0023247 3300046522 Bacteria 3525
559 Ga0495643_0044163 3300046522 Bacteria 2422
560 Ga0495643_0085971 3300046522 Bacteria 1629
561 Ga0495643_0166499 3300046522 Bacteria 1080
562 Ga0495643_0210797 3300046522 Bacteria 927
563 Ga0495644_0003315 3300046523 Bacteria 6364
564 Ga0495644_0006231 3300046523 Bacteria 4638
565 Ga0495644_0026504 3300046523 Bacteria 2198
566 Ga0495644_0038103 3300046523 Bacteria 1813
567 Ga0495648_0000491 3300046524 Bacteria 42524
568 Ga0495648_0006371 3300046524 Bacteria 9647
569 Ga0495648_0019057 3300046524 Bacteria 4839
570 Ga0495648_0027715 3300046524 Bacteria 3788
571 Ga0495648_0053504 3300046524 Bacteria 2445
572 Ga0495648_0053694 3300046524 Bacteria 2439
573 Ga0495648_0100133 3300046524 Bacteria 1601
574 Ga0495648_0107478 3300046524 Bacteria 1525
575 Ga0495648_0156955 3300046524 Bacteria 1180
576 Ga0495666_0012934 3300046526 Bacteria 4158
577 Ga0495666_0039955 3300046526 Bacteria 2276
578 Ga0495666_0073093 3300046526 Bacteria 1627
579 Ga0495642_0000097 3300046528 Bacteria 49030
580 Ga0495642_0001859 3300046528 Bacteria 9009
581 Ga0495642_0004237 3300046528 Bacteria 5581
582 Ga0495654_0002407 3300046530 Bacteria 12063
583 Ga0495654_0003357 3300046530 Bacteria 9863
584 Ga0495654_0005010 3300046530 Bacteria 7775
585 Ga0495654_0006722 3300046530 Bacteria 6506
586 Ga0495654_0008163 3300046530 Bacteria 5800
587 Ga0495654_0012957 3300046530 Bacteria 4469
588 Ga0495654_0015256 3300046530 Bacteria 4082
589 Ga0495654_0027538 3300046530 Bacteria 2913
590 Ga0495654_0029347 3300046530 Bacteria 2805
591 Ga0495654_0042593 3300046530 Bacteria 2252
592 Ga0495654_0045971 3300046530 Bacteria 2152
593 Ga0495654_0055987 3300046530 Bacteria 1907
594 Ga0495654_0063832 3300046530 Bacteria 1762
595 Ga0495654_0069104 3300046530 Bacteria 1677
596 Ga0495654_0089076 3300046530 Bacteria 1434
597 Ga0495654_0110992 3300046530 Bacteria 1251
598 Ga0495654_0124592 3300046530 Bacteria 1162
599 Ga0495586_0060315 3300046535 Bacteria 2062
600 Ga0495587_0034356 3300046536 Bacteria 3058
601 Ga0495587_0046458 3300046536 Bacteria 2577
602 Ga0495609_0000015 3300046538 Bacteria 322474
603 Ga0495609_0000066 3300046538 Bacteria 131202
604 Ga0495609_0000070 3300046538 Bacteria 128181
605 Ga0495609_0004218 3300046538 Bacteria 7951
606 Ga0495609_0007336 3300046538 Bacteria 5516
607 Ga0495609_0055546 3300046538 Bacteria 1756
608 Ga0495609_0070513 3300046538 Bacteria 1536
609 Ga0495597_0000005 3300046542 Bacteria 286580
610 Ga0495597_0002158 3300046542 Bacteria 12930
611 Ga0495597_0016962 3300046542 Bacteria 3433
612 Ga0495597_0028135 3300046542 Bacteria 2574
613 Ga0495597_0062218 3300046542 Bacteria 1624
614 Ga0495622_0002478 3300046557 Bacteria 8930
615 Ga0495622_0010641 3300046557 Bacteria 4244
616 Ga0495622_0012691 3300046557 Bacteria 3905
617 Ga0495622_0027676 3300046557 Bacteria 2645
618 Ga0495622_0039371 3300046557 Bacteria 2201
619 Ga0495633_0000060 3300046558 Bacteria 144561
620 Ga0495633_0035970 3300046558 Bacteria 2375
621 Ga0495633_0050809 3300046558 Bacteria 1953
622 Ga0495656_0008233 3300046615 Bacteria 3716
623 Ga0495656_0090793 3300046615 Bacteria 1396
624 Ga0495668_0004245 3300046616 Bacteria 10296
625 Ga0495668_0026574 3300046616 Bacteria 3283
626 Ga0495668_0051766 3300046616 Bacteria 2273
627 Ga0495668_0061318 3300046616 Bacteria 2074
628 Ga0495668_0090575 3300046616 Bacteria 1676
629 Ga0495634_0001715 3300046642 Bacteria 19024
630 Ga0495634_0211204 3300046642 Bacteria 1201
631 Ga0495611_0000817 3300046648 Bacteria 17225
632 Ga0495611_0000934 3300046648 Bacteria 15695
633 Ga0495611_0090840 3300046648 Bacteria 1411
634 Ga0495625_0001491 3300046660 Bacteria 28149
635 Ga0495625_0009777 3300046660 Bacteria 7979
636 Ga0495625_0014823 3300046660 Bacteria 6202
637 Ga0495625_0031221 3300046660 Bacteria 3964
638 Ga0495625_0042717 3300046660 Bacteria 3292
639 Ga0495625_0077707 3300046660 Bacteria 2318
640 Ga0495625_0079533 3300046660 Bacteria 2285
641 Ga0495625_0118193 3300046660 Bacteria 1806
642 Ga0495625_0166964 3300046660 Bacteria 1471
643 Ga0495635_0005514 3300046663 Bacteria 8800
644 Ga0495635_0006971 3300046663 Bacteria 7894
645 Ga0495659_0001693 3300046664 Bacteria 7373
646 Ga0495659_0013279 3300046664 Bacteria 2681
647 Ga0495661_0000110 3300046665 Bacteria 97854
648 Ga0495661_0000139 3300046665 Bacteria 85160
649 Ga0495661_0000194 3300046665 Bacteria 70173
650 Ga0495661_0000304 3300046665 Bacteria 56019
651 Ga0495661_0081571 3300046665 Bacteria 1863
652 Ga0495661_0088921 3300046665 Bacteria 1762
653 Ga0495588_0001397 3300046674 Bacteria 10320
654 Ga0495657_0093451 3300046675 Bacteria 1925
655 Ga0495623_0024250 3300046679 Bacteria 3911
656 Ga0495623_0060098 3300046679 Bacteria 2385
657 Ga0495646_0048954 3300046680 Bacteria 2566
658 Ga0495646_0106616 3300046680 Bacteria 1599
659 Ga0495669_0012665 3300046684 Bacteria 3591
660 Ga0495613_0063638 3300046689 Bacteria 2698
661 Ga0495624_0011063 3300046690 Bacteria 6210
662 Ga0495670_0043323 3300046691 Bacteria 2246
663 Ga0495670_0048843 3300046691 Bacteria 2116
664 Ga0495670_0063197 3300046691 Bacteria 1863
665 Ga0495670_0070265 3300046691 Bacteria 1771
666 Ga0495670_0070579 3300046691 Bacteria 1767
667 Ga0495670_0091929 3300046691 Bacteria 1553
668 Ga0495671_0002259 3300046692 Bacteria 12245
669 Ga0495671_0008071 3300046692 Bacteria 5943
670 Ga0495671_0010083 3300046692 Bacteria 5252
671 Ga0495671_0045812 3300046692 Bacteria 2188
672 Ga0495671_0075286 3300046692 Bacteria 1655
673 Ga0495671_0077677 3300046692 Bacteria 1627
674 Ga0495671_0131644 3300046692 Bacteria 1219
675 Ga0495671_0135458 3300046692 Bacteria 1201
676 Ga0495671_0189561 3300046692 Bacteria 998
677 Ga0495649_0010015 3300046694 Bacteria 5603
678 Ga0495649_0012226 3300046694 Bacteria 5004
679 Ga0495649_0016114 3300046694 Bacteria 4241
680 Ga0495649_0023293 3300046694 Bacteria 3460
681 Ga0495649_0031126 3300046694 Bacteria 2943
682 Ga0495649_0045899 3300046694 Bacteria 2380
683 Ga0495649_0047424 3300046694 Bacteria 2336
684 Ga0495649_0049048 3300046694 Bacteria 2293
685 Ga0495649_0080939 3300046694 Bacteria 1736
686 Ga0495649_0137999 3300046694 Bacteria 1284
687 Ga0495649_0139555 3300046694 Bacteria 1276
688 Ga0495589_0004531 3300046794 Bacteria 7387
689 Ga0495589_0007586 3300046794 Bacteria 5684
690 Ga0495589_0009282 3300046794 Bacteria 5115
691 Ga0495589_0071619 3300046794 Bacteria 1693
692 Ga0495600_0015424 3300046809 Bacteria 4830
693 Ga0495600_0054749 3300046809 Bacteria 2605
694 Ga0495600_0102968 3300046809 Bacteria 1860
695 Ga0495660_0000469 3300046810 Bacteria 33478
696 Ga0495660_0008400 3300046810 Bacteria 6042
697 Ga0495660_0009165 3300046810 Bacteria 5780
698 Ga0495660_0012657 3300046810 Bacteria 4897
699 Ga0495660_0017631 3300046810 Bacteria 4108
700 Ga0495660_0023858 3300046810 Bacteria 3486
701 Ga0495660_0032179 3300046810 Bacteria 2945
702 Ga0495660_0036400 3300046810 Bacteria 2745
703 Ga0495660_0036679 3300046810 Bacteria 2733
704 Ga0495660_0065774 3300046810 Bacteria 1934
705 Ga0495660_0070394 3300046810 Bacteria 1856
706 Ga0495660_0074058 3300046810 Bacteria 1799
707 Ga0495660_0098684 3300046810 Bacteria 1506
708 Ga0495660_0147356 3300046810 Bacteria 1165
709 Ga0495660_0180797 3300046810 Bacteria 1020
710 Ga0495581_0034122 3300047315 Bacteria 2944
711 Ga0495581_0053092 3300047315 Bacteria 2341
712 Ga0495604_0005968 3300047317 Bacteria 9667
713 Ga0495604_0015007 3300047317 Bacteria 6180
714 Ga0495604_0122428 3300047317 Bacteria 1881
715 Ga0495636_0045497 3300047318 Bacteria 1829
716 Ga0495674_0013987 3300047319 Bacteria 7526
717 Ga0495672_0003898 3300047320 Bacteria 12520
718 Ga0495672_0010049 3300047320 Bacteria 6778
719 Ga0495672_0010488 3300047320 Bacteria 6600
720 Ga0495672_0011159 3300047320 Bacteria 6353
721 Ga0495672_0017369 3300047320 Bacteria 4814
722 Ga0495672_0033043 3300047320 Bacteria 3209
723 Ga0495672_0039094 3300047320 Bacteria 2887
724 Ga0495672_0054233 3300047320 Bacteria 2344
725 Ga0495672_0078358 3300047320 Bacteria 1848
726 Ga0495672_0087989 3300047320 Bacteria 1713
727 Ga0495672_0093579 3300047320 Bacteria 1645
728 Ga0495672_0093653 3300047320 Bacteria 1644
729 Ga0495672_0101790 3300047320 Bacteria 1556
730 Ga0495672_0149530 3300047320 Bacteria 1212
731 Ga0495672_0151469 3300047320 Bacteria 1202
732 Ga0495676_0000013 3300047321 Bacteria 213031
733 Ga0495676_0009626 3300047321 Bacteria 8793
734 Ga0495676_0019756 3300047321 Bacteria 5922
735 Ga0495680_0000389 3300047322 Bacteria 49112
736 Ga0495680_0051855 3300047322 Bacteria 3200
737 Ga0495680_0078655 3300047322 Bacteria 2495
738 Ga0495680_0132019 3300047322 Bacteria 1834
739 Ga0495683_0000027 3300047323 Bacteria 153730
740 Ga0495683_0000261 3300047323 Bacteria 47209
741 Ga0495683_0004737 3300047323 Bacteria 7646
742 Ga0495683_0005086 3300047323 Bacteria 7353
743 Ga0495683_0017386 3300047323 Bacteria 3728
744 Ga0495683_0022429 3300047323 Bacteria 3246
745 Ga0495683_0026508 3300047323 Bacteria 2966
746 Ga0495683_0037153 3300047323 Bacteria 2470
747 Ga0495683_0057727 3300047323 Bacteria 1928
748 Ga0495683_0108210 3300047323 Bacteria 1329
749 Ga0495683_0118939 3300047323 Bacteria 1255
750 Ga0495683_0121135 3300047323 Bacteria 1241
751 Ga0495683_0144895 3300047323 Bacteria 1110
752 Ga0495687_005844 3300047443 Bacteria 7704
753 Ga0495687_013303 3300047443 Bacteria 4306
754 Ga0495687_017430 3300047443 Bacteria 3584
755 Ga0495687_036841 3300047443 Bacteria 2184
756 Ga0495675_0001992 3300047444 Bacteria 12194
757 Ga0495675_0113108 3300047444 Bacteria 1693
758 Ga0495677_0004953 3300047445 Bacteria 5079
759 Ga0495679_000206 3300047446 Bacteria 51518
760 Ga0495679_001765 3300047446 Bacteria 11865
761 Ga0495679_019678 3300047446 Bacteria 2365
762 Ga0495679_021420 3300047446 Bacteria 2232
763 Ga0495685_036695 3300047447 Bacteria 1682
764 Ga0495673_0002278 3300047469 Bacteria 13760
765 Ga0495673_0005752 3300047469 Bacteria 7433
766 Ga0495673_0005888 3300047469 Bacteria 7320
767 Ga0495673_0011917 3300047469 Bacteria 4643
768 Ga0495673_0014906 3300047469 Bacteria 4025
769 Ga0495673_0015222 3300047469 Bacteria 3970
770 Ga0495673_0018742 3300047469 Bacteria 3483
771 Ga0495673_0022950 3300047469 Bacteria 3047
772 Ga0495673_0024014 3300047469 Bacteria 2954
773 Ga0495673_0038565 3300047469 Bacteria 2172
774 Ga0495673_0042216 3300047469 Bacteria 2048
775 Ga0495673_0050387 3300047469 Bacteria 1827
776 Ga0495673_0050886 3300047469 Bacteria 1816
777 Ga0495673_0063147 3300047469 Bacteria 1579
778 Ga0495673_0090907 3300047469 Bacteria 1247
779 Ga0495681_0000933 3300047470 Bacteria 22521
780 Ga0495681_0005006 3300047470 Bacteria 8932
781 Ga0495681_0006277 3300047470 Bacteria 7828
782 Ga0495681_0007132 3300047470 Bacteria 7201
783 Ga0495681_0007434 3300047470 Bacteria 6999
784 Ga0495681_0011304 3300047470 Bacteria 5325
785 Ga0495681_0014618 3300047470 Bacteria 4485
786 Ga0495681_0015582 3300047470 Bacteria 4294
787 Ga0495681_0026422 3300047470 Bacteria 3021
788 Ga0495681_0035133 3300047470 Bacteria 2491
789 Ga0495681_0059790 3300047470 Bacteria 1760
790 Ga0495681_0061499 3300047470 Bacteria 1729
791 Ga0495681_0075599 3300047470 Bacteria 1516
792 Ga0495681_0104002 3300047470 Bacteria 1238
793 Ga0495684_0111655 3300047471 Bacteria 2062
794 Ga0495686_0005865 3300047472 Bacteria 9574
795 Ga0495686_0072055 3300047472 Bacteria 2125
796 Ga0495593_0045550 3300047673 Bacteria 2340
797 Ga0495602_0030701 3300048088 Bacteria 5092
798 Ga0495614_0047085 3300048089 Bacteria 1849
799 Ga0495626_0000056 3300048091 Bacteria 150654
800 Ga0495626_0001227 3300048091 Bacteria 21100
801 Ga0495626_0005367 3300048091 Bacteria 7532
802 Ga0495626_0005402 3300048091 Bacteria 7493
803 Ga0495626_0005494 3300048091 Bacteria 7383
804 Ga0495626_0005538 3300048091 Bacteria 7346
805 Ga0495626_0011405 3300048091 Bacteria 4702
806 Ga0495626_0021571 3300048091 Bacteria 3194
807 Ga0495626_0031306 3300048091 Bacteria 2561
808 Ga0495626_0044990 3300048091 Bacteria 2062
809 Ga0496101_0035587 3300048904 Bacteria 3523
810 Ga0496102_0000242 3300048905 Bacteria 71504
811 Ga0496102_0423730 3300048905 Bacteria 1250
812 Ga0496103_0005866 3300048906 Bacteria 7335
813 Ga0496105_0209384 3300048908 Bacteria 1590
814 Ga0496107_0119091 3300048910 Bacteria 1944
815 Ga0496110_0038308 3300048913 Bacteria 4171
816 Ga0496110_0052260 3300048913 Bacteria 3591
817 Ga0496110_0278104 3300048913 Bacteria 1524
818 Ga0496111_0047643 3300048914 Bacteria 3087
819 Ga0496114_0028827 3300048917 Bacteria 4559
820 Ga0496114_0043828 3300048917 Bacteria 3710
821 Ga0496115_0047584 3300048918 Bacteria 3430
822 Ga0496116_0000126 3300048919 Bacteria 160425
823 Ga0496116_0002028 3300048919 Bacteria 21733
824 Ga0496116_0010805 3300048919 Bacteria 7616
825 Ga0496116_0053813 3300048919 Bacteria 2656
826 Ga0496116_0058892 3300048919 Bacteria 2501
827 Ga0496117_0003126 3300048920 Bacteria 19758
828 Ga0496117_0006498 3300048920 Bacteria 11792
829 Ga0496117_0023336 3300048920 Bacteria 4933
830 Ga0496117_0036924 3300048920 Bacteria 3647
831 Ga0496117_0040121 3300048920 Bacteria 3448
832 Ga0496117_0105075 3300048920 Bacteria 1776
833 Ga0496118_0001807 3300048921 Bacteria 30813
834 Ga0496118_0004616 3300048921 Bacteria 16182
835 Ga0496118_0013626 3300048921 Bacteria 7676
836 Ga0496118_0040470 3300048921 Bacteria 3705
837 Ga0496118_0041417 3300048921 Bacteria 3647
838 Ga0496118_0078499 3300048921 Bacteria 2335
839 Ga0496118_0099746 3300048921 Bacteria 1967
840 Ga0496119_0000112 3300048922 Bacteria 114767
841 Ga0496119_0059393 3300048922 Bacteria 2297
842 Ga0496120_0009793 3300048923 Bacteria 6755
843 Ga0496121_0000142 3300048924 Bacteria 160072
844 Ga0496121_0003009 3300048924 Bacteria 24478
845 Ga0496121_0003989 3300048924 Bacteria 20359
846 Ga0496121_0048899 3300048924 Bacteria 3593
847 Ga0496121_0131863 3300048924 Bacteria 1868
848 Ga0496121_0152333 3300048924 Bacteria 1700
849 Ga0496122_0000122 3300048925 Bacteria 181491
850 Ga0496122_0018867 3300048925 Bacteria 6339
851 Ga0496122_0019568 3300048925 Bacteria 6175
852 Ga0496122_0023279 3300048925 Bacteria 5468
853 Ga0496122_0047710 3300048925 Bacteria 3303
854 Ga0496122_0050923 3300048925 Bacteria 3153
855 Ga0496122_0074368 3300048925 Bacteria 2404
856 Ga0496122_0204774 3300048925 Bacteria 1149
857 Ga0496123_0000391 3300048926 Bacteria 82015
858 Ga0496123_0001340 3300048926 Bacteria 34830
859 Ga0496123_0022720 3300048926 Bacteria 4823
860 Ga0496123_0039683 3300048926 Bacteria 3290
861 Ga0496123_0042255 3300048926 Bacteria 3148
862 Ga0496123_0049954 3300048926 Bacteria 2799
863 Ga0496123_0089571 3300048926 Bacteria 1832
864 Ga0496124_0000222 3300048927 Bacteria 110854
865 Ga0496124_0027948 3300048927 Bacteria 5052
866 Ga0496124_0031437 3300048927 Bacteria 4699
867 Ga0496124_0042438 3300048927 Bacteria 3917
868 Ga0496124_0044384 3300048927 Bacteria 3814
869 Ga0496124_0049542 3300048927 Bacteria 3583
870 Ga0496124_0050720 3300048927 Bacteria 3534
871 Ga0496124_0089843 3300048927 Bacteria 2507
872 Ga0496124_0124989 3300048927 Bacteria 2050
873 Ga0496124_0158616 3300048927 Bacteria 1766
874 Ga0496124_0182132 3300048927 Bacteria 1615
875 Ga0496124_0329520 3300048927 Bacteria 1089
876 Ga0496124_0329531 3300048927 Bacteria 1089
877 Ga0496125_0039458 3300048928 Bacteria 4064
878 Ga0496125_0040148 3300048928 Bacteria 4017
879 Ga0496125_0043847 3300048928 Bacteria 3791
880 Ga0496125_0090275 3300048928 Bacteria 2300
881 Ga0496125_0092749 3300048928 Bacteria 2256
882 Ga0496125_0188204 3300048928 Bacteria 1366
883 Ga0496126_0085998 3300048929 Bacteria 2772
884 Ga0496126_0121779 3300048929 Bacteria 2261
885 Ga0495678_000031 3300049459 Bacteria 215528
886 Ga0495678_000039 3300049459 Bacteria 191665
887 Ga0495678_004719 3300049459 Bacteria 7782
888 Ga0495678_008542 3300049459 Bacteria 5155
889 Ga0495678_017480 3300049459 Bacteria 3249
890 Ga0495678_018063 3300049459 Bacteria 3179
891 Ga0495678_024412 3300049459 Bacteria 2611
892 Ga0495678_039396 3300049459 Bacteria 1906
893 Ga0495682_0000078 3300049460 Bacteria 85448
894 Ga0495682_0000860 3300049460 Bacteria 18879
895 Ga0495682_0004502 3300049460 Bacteria 5945
896 Ga0495682_0049418 3300049460 Bacteria 1532
897 Ga0501314_000374 3300049530 Bacteria 2714
898 Ga0501323_003470 3300049539 Bacteria 1612
899 Ga0501324_004059 3300049540 Bacteria 1149
900 Ga0501034_0000137 3300049571 Bacteria 136592
901 Ga0501037_0076117 3300049573 Bacteria 2437
902 Ga0501222_003868 3300049662 Bacteria 2031
903 Ga0501241_000766 3300049758 Bacteria 6877
904 Ga0501226_000017 3300049853 Bacteria 150879
905 nmdc:mga00v17_112753_c1 3300050491 Bacteria 1726
906 Ga0500618_007836 3300053125 Bacteria 3017
907 Ga0500659_0002202 3300053135 Bacteria 11827
908 Ga0500573_0022482 3300053140 Bacteria 3619
909 Ga0587068_001963 3300059641 Bacteria 2425

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042530 Ga0450916_000955 Ga0450916_000955_1256_2116 280
2 3300041997 Ga0439431_0002910 Ga0439431_0002910_1039_1905 282
3 3300042012 Ga0439455_0005047 Ga0439455_0005047_1034_1900 282
4 3300042013 Ga0439456_005650 Ga0439456_005650_1586_2452 282
5 3300042115 Ga0450911_000037 Ga0450911_000037_39457_40323 282
6 3300042142 Ga0450905_004581 Ga0450905_004581_707_1573 282
7 3300042156 Ga0439446_0002615 Ga0439446_0002615_2354_3220 282
8 3300042438 Ga0439459_0001248 Ga0439459_0001248_1375_2241 282
9 3300042530 Ga0450916_005396 Ga0450916_005396_127_993 282
10 3300049530 Ga0501314_000374 Ga0501314_000374_1208_2077 283
11 3300049853 Ga0501226_000017 Ga0501226_000017_44983_45852 283
12 3300015261 Ga0182006_1049750 Ga0182006_10497502 284
13 3300042016 Ga0439463_017111 Ga0439463_017111_533_1387 284
14 iso_pu_bacteria 2825651385 2825653316 284
15 iso_pu_bacteria 2913036834 2913038304 284
16 iso_pu_bacteria 2919481497 2919481573 284
17 iso_pu_bacteria 2929144301 2929145745 284
18 iso_pu_bacteria 2904550169 2904551554 287
19 3300046522 Ga0495643_0210797 Ga0495643_0210797_29_898 288
20 3300046648 Ga0495611_0090840 Ga0495611_0090840_495_1364 288
21 3300046520 Ga0495637_0028441 Ga0495637_0028441_28_909 289
22 3300046460 Ga0495638_0221724 Ga0495638_0221724_10_891 290
23 3300047470 Ga0495681_0075599 Ga0495681_0075599_10_888 290
24 3300046452 Ga0495617_061220 Ga0495617_061220_326_1210 291
25 3300046512 Ga0495610_0124723 Ga0495610_0124723_31_906 291
26 3300046692 Ga0495671_0189561 Ga0495671_0189561_10_888 291
27 3300046694 Ga0495649_0045899 Ga0495649_0045899_1489_2367 291
28 3300046810 Ga0495660_0180797 Ga0495660_0180797_11_889 291
29 3300041411 Ga0439466_0005828 Ga0439466_0005828_1043_1996 294
30 3300048927 Ga0496124_0049542 Ga0496124_0049542_706_1623 299
31 iso_pu_bacteria 2808606373 2808904668 299
32 3300042137 Ga0450902_000567 Ga0450902_000567_2770_3690 300
33 3300042142 Ga0450905_000074 Ga0450905_000074_2398_3318 300
34 3300042533 Ga0450901_000655 Ga0450901_000655_753_1673 300
35 3300042439 Ga0439464_0001261 Ga0439464_0001261_2898_3845 302
36 iso_pu_bacteria 2599185212 2599615495 302
37 iso_pu_bacteria 2599185318 2600036367 302
38 iso_pu_bacteria 2599185322 2600061882 302
39 3300002771 JGI25163J39215_1001640 JGI25163J39215_10016402 303
40 3300002772 JGI25164J39214_1000029 JGI25164J39214_10000297 303
41 3300003214 JGI25165J46597_1000111 JGI25165J46597_1000111137 303
42 3300025207 Ga0209760_100015 Ga0209760_100015134 303
43 3300025231 Ga0207427_100001 Ga0207427_100001619 303
44 3300025233 Ga0209437_100003 Ga0209437_100003753 303
45 3300025261 Ga0209233_1000007 Ga0209233_1000007619 303
46 3300031548 Ga0307408_100000081 Ga0307408_10000008110 303
47 3300042004 Ga0439445_0050313 Ga0439445_0050313_169_1086 305
48 3300046463 Ga0495653_0018187 Ga0495653_0018187_2509_3435 305
49 3300046492 Ga0495585_0072113 Ga0495585_0072113_528_1454 305
50 3300046507 Ga0495606_0018681 Ga0495606_0018681_3421_4347 305
51 3300049459 Ga0495678_024412 Ga0495678_024412_643_1569 305
52 3300042139 Ga0450904_000012 Ga0450904_000012_39071_40009 306
53 3300046501 Ga0495607_0028908 Ga0495607_0028908_1745_2674 306
54 iso_pu_bacteria 2600254954 2600442968 307
55 iso_pu_bacteria 2600255389 2602009556 307
56 iso_pu_bacteria 2823421272 2823424597 307
57 iso_pu_bacteria 2919501602 2919504327 307
58 iso_pu_bacteria 2926063275 2926065100 307
59 iso_pu_bacteria 8034962539 8034962582 307
60 2162886007 SwRhRL2b_contig_722602 SwRhRL2b_0837.00001900 308
61 iso_pu_bacteria 2554235132 2554817012 308
62 iso_pu_bacteria 2606217733 2608379669 308
63 iso_pu_bacteria 2811994881 2812368120 308
64 iso_pu_bacteria 2923519811 2923522173 308
65 iso_pu_bacteria 2990196909 2990198328 308
66 3300041407 Ga0439447_008366 Ga0439447_008366_12_944 309
67 3300046501 Ga0495607_0042021 Ga0495607_0042021_21_953 309
68 3300046501 Ga0495607_0175758 Ga0495607_0175758_134_1066 309
69 3300046507 Ga0495606_0190423 Ga0495606_0190423_225_1157 309
70 3300046810 Ga0495660_0147356 Ga0495660_0147356_221_1153 309
71 iso_pu_bacteria 2600255283 2601625739 309
72 iso_pu_bacteria 2919155634 2919159278 309
73 3300009036 Ga0105244_10020751 Ga0105244_100207512 310
74 iso_pu_bacteria 2599185302 2599945509 310
75 iso_pu_bacteria 2599185304 2599956627 310
76 iso_pu_bacteria 2599185307 2599974101 310
77 iso_pu_bacteria 2599185309 2599985451 310
78 iso_pu_bacteria 2599185310 2599991798 310
79 iso_pu_bacteria 2599185312 2600002405 310
80 iso_pu_bacteria 2599185320 2600049938 310
81 iso_pu_bacteria 2738541271 2738691557 310
82 iso_pu_bacteria 2738543016 2739267332 310
83 iso_pu_bacteria 2808606361 2808856810 310
84 iso_pu_bacteria 2808606376 2808924091 310
85 iso_pu_bacteria 2808606378 2808936741 310
86 iso_pu_bacteria 2808606379 2808941648 310
87 iso_pu_bacteria 2808606380 2808946032 310
88 iso_pu_bacteria 2808606383 2808965197 310
89 iso_pu_bacteria 2808606389 2809000089 310
90 iso_pu_bacteria 2988728565 2988733284 310
91 3300013102 Ga0157371_10000460 Ga0157371_1000046013 311
92 iso_pu_bacteria 2511231024 2511375568 311
93 iso_pu_bacteria 2511231156 2511823403 311
94 iso_pu_bacteria 2554235231 2555244592 311
95 iso_pu_bacteria 2599185188 2599505304 311
96 iso_pu_bacteria 2599185248 2599772786 311
97 iso_pu_bacteria 2599185289 2599889282 311
98 iso_pu_bacteria 2599185291 2599896604 311
99 iso_pu_bacteria 2599185300 2599931858 311
100 iso_pu_bacteria 2599185305 2599962565 311
101 iso_pu_bacteria 2599185306 2599968377 311
102 iso_pu_bacteria 2599185308 2599979564 311
103 iso_pu_bacteria 2599185311 2599996613 311
104 iso_pu_bacteria 2599185313 2600006828 311
105 iso_pu_bacteria 2599185314 2600013376 311
106 iso_pu_bacteria 2599185315 2600020077 311
107 iso_pu_bacteria 2599185316 2600026079 311
108 iso_pu_bacteria 2599185317 2600031724 311
109 iso_pu_bacteria 2599185319 2600043666 311
110 iso_pu_bacteria 2599185321 2600053466 311
111 iso_pu_bacteria 2599185323 2600067108 311
112 iso_pu_bacteria 2599185324 2600070448 311
113 iso_pu_bacteria 2599185325 2600080057 311
114 iso_pu_bacteria 2600254930 2600361505 311
115 iso_pu_bacteria 2643221650 2644283576 311
116 iso_pu_bacteria 2651869719 2652548240 311
117 iso_pu_bacteria 2667528170 2671090479 311
118 iso_pu_bacteria 2667528176 2671127789 311
119 iso_pu_bacteria 2675903515 2678262329 311
120 iso_pu_bacteria 2744054620 2745008676 311
121 iso_pu_bacteria 2765235841 2765585699 311
122 iso_pu_bacteria 2791355520 2794596127 311
123 iso_pu_bacteria 2806310737 2807406916 311
124 iso_pu_bacteria 2806310745 2807455248 311
125 iso_pu_bacteria 2826581358 2826585730 311
126 iso_pu_bacteria 2842815866 2842818600 311
127 iso_pu_bacteria 2842849001 2842853822 311
128 iso_pu_bacteria 2842854478 2842858937 311
129 iso_pu_bacteria 2912963787 2912967963 311
130 iso_pu_bacteria 2923586266 2923587579 311
131 iso_pu_bacteria 2931369376 2931370918 311
132 iso_pu_bacteria 2939651529 2939652392 311
133 iso_pu_bacteria 3007803356 3007808417 311
134 iso_pu_bacteria 3007866637 3007867937 311
135 iso_pu_bacteria 3007872151 3007875422 311
136 iso_pu_bacteria 8052494512 8052495666 311
137 iso_pu_bacteria 8054929484 8054933232 311
138 iso_pu_bacteria 8055878733 8055884057 311
139 iso_pu_bacteria 8056115690 8056117432 311
140 iso_pu_bacteria 8056120720 8056124782 311
141 iso_pu_bacteria 8056137416 8056138570 311
142 iso_pu_bacteria 8056143049 8056147531 311
143 3300046515 Ga0495620_0010128 Ga0495620_0010128_562_1524 312
144 3300046520 Ga0495637_0040168 Ga0495637_0040168_35_997 312
145 3300047469 Ga0495673_0018742 Ga0495673_0018742_599_1561 312
146 iso_pu_bacteria 2599185155 2599330091 312
147 3300013307 Ga0157372_10000815 Ga0157372_1000081522 313
148 3300033180 Ga0307510_10156577 Ga0307510_101565772 313
149 3300041404 Ga0439436_0006624 Ga0439436_0006624_2292_3242 313
150 3300041405 Ga0439438_004117 Ga0439438_004117_1915_2865 313
151 3300041407 Ga0439447_003703 Ga0439447_003703_2108_3058 313
152 3300041411 Ga0439466_0000342 Ga0439466_0000342_14651_15601 313
153 3300041997 Ga0439431_0007018 Ga0439431_0007018_519_1469 313
154 3300042006 Ga0439432_003429 Ga0439432_003429_2712_3662 313
155 3300042010 Ga0439452_003673 Ga0439452_003673_2388_3338 313
156 3300042156 Ga0439446_0005697 Ga0439446_0005697_292_1242 313
157 3300042435 Ga0439434_0002776 Ga0439434_0002776_2165_3115 313
158 3300046457 Ga0495590_0026903 Ga0495590_0026903_316_1278 313
159 3300046458 Ga0495591_005627 Ga0495591_005627_2948_3910 313
160 3300046458 Ga0495591_006828 Ga0495591_006828_3412_4374 313
161 3300046491 Ga0495584_0004191 Ga0495584_0004191_3793_4755 313
162 3300046492 Ga0495585_0005559 Ga0495585_0005559_2887_3849 313
163 3300046501 Ga0495607_0013895 Ga0495607_0013895_3643_4608 313
164 3300046506 Ga0495583_0025374 Ga0495583_0025374_30_992 313
165 3300046518 Ga0495631_0012293 Ga0495631_0012293_1989_2951 313
166 3300046518 Ga0495631_0052373 Ga0495631_0052373_204_1166 313
167 3300046519 Ga0495632_0015983 Ga0495632_0015983_1989_2951 313
168 3300046520 Ga0495637_0000381 Ga0495637_0000381_30257_31219 313
169 3300046522 Ga0495643_0023247 Ga0495643_0023247_1974_2936 313
170 3300046523 Ga0495644_0003315 Ga0495644_0003315_2294_3256 313
171 3300046524 Ga0495648_0053504 Ga0495648_0053504_1280_2242 313
172 3300046530 Ga0495654_0110992 Ga0495654_0110992_69_1031 313
173 3300046538 Ga0495609_0000066 Ga0495609_0000066_3010_3972 313
174 3300046557 Ga0495622_0010641 Ga0495622_0010641_2241_3203 313
175 3300046660 Ga0495625_0001491 Ga0495625_0001491_11881_12843 313
176 3300046665 Ga0495661_0000139 Ga0495661_0000139_72319_73281 313
177 3300046694 Ga0495649_0031126 Ga0495649_0031126_228_1190 313
178 3300046810 Ga0495660_0032179 Ga0495660_0032179_1237_2199 313
179 3300047320 Ga0495672_0033043 Ga0495672_0033043_1611_2573 313
180 3300047321 Ga0495676_0000013 Ga0495676_0000013_200213_201175 313
181 3300047323 Ga0495683_0026508 Ga0495683_0026508_603_1565 313
182 3300047446 Ga0495679_000206 Ga0495679_000206_38828_39790 313
183 3300047469 Ga0495673_0038565 Ga0495673_0038565_669_1631 313
184 3300047470 Ga0495681_0014618 Ga0495681_0014618_610_1572 313
185 3300048091 Ga0495626_0000056 Ga0495626_0000056_137821_138783 313
186 3300048922 Ga0496119_0000112 Ga0496119_0000112_109699_110658 313
187 3300048923 Ga0496120_0009793 Ga0496120_0009793_2106_3065 313
188 3300049459 Ga0495678_000031 Ga0495678_000031_96275_97237 313
189 3300049573 Ga0501037_0076117 Ga0501037_0076117_704_1654 313
190 iso_pu_bacteria 2511231004 2511254429 313
191 iso_pu_bacteria 2511231007 2511274286 313
192 iso_pu_bacteria 2511231010 2511291891 313
193 iso_pu_bacteria 2511231011 2511294989 313
194 iso_pu_bacteria 2511231016 2511329312 313
195 iso_pu_bacteria 2511231022 2511364928 313
196 iso_pu_bacteria 2600255318 2601799912 313
197 iso_pu_bacteria 2603880185 2606074289 313
198 iso_pu_bacteria 2603880199 2606127151 313
199 iso_pu_bacteria 2623620443 2624479195 313
200 iso_pu_bacteria 2623620446 2624493804 313
201 iso_pu_bacteria 2643221571 2643873065 313
202 iso_pu_bacteria 2643221633 2644187530 313
203 iso_pu_bacteria 2713897149 2715759716 313
204 iso_pu_bacteria 2773857673 2774136031 313
205 iso_pu_bacteria 2784132063 2784260101 313
206 iso_pu_bacteria 2808606445 2809216148 313
207 iso_pu_bacteria 2818991456 2819654589 313
208 iso_pu_bacteria 2852657418 2852658669 313
209 iso_pu_bacteria 2860339153 2860340297 313
210 iso_pu_bacteria 2878029506 2878031156 313
211 iso_pu_bacteria 2880230671 2880232054 313
212 iso_pu_bacteria 2904518522 2904522411 313
213 iso_pu_bacteria 2919063839 2919064319 313
214 iso_pu_bacteria 2919697872 2919700291 313
215 iso_pu_bacteria 2931396565 2931399797 313
216 iso_pu_bacteria 3007718800 3007723043 313
217 iso_pu_bacteria 8019775933 8019776946 313
218 iso_pu_bacteria 8056155041 8056159378 313
219 iso_pu_bacteria 8056172158 8056175779 313
220 iso_pu_bacteria 8056569372 8056570052 313
221 3300013100 Ga0157373_10008179 Ga0157373_100081792 314
222 3300013100 Ga0157373_10009220 Ga0157373_100092202 314
223 3300017792 Ga0163161_10085613 Ga0163161_100856132 314
224 3300025292 Ga0209676_1000721 Ga0209676_100072132 314
225 3300032004 Ga0307414_10122593 Ga0307414_101225931 314
226 3300042129 Ga0450891_002006 Ga0450891_002006_490_1434 314
227 3300042156 Ga0439446_0001558 Ga0439446_0001558_1234_2190 314
228 3300042993 Ga0439440_0008818 Ga0439440_0008818_682_1626 314
229 3300046453 Ga0495627_012582 Ga0495627_012582_1332_2297 314
230 3300046458 Ga0495591_001627 Ga0495591_001627_3427_4392 314
231 3300046458 Ga0495591_007829 Ga0495591_007829_2094_3059 314
232 3300046474 Ga0495605_0027860 Ga0495605_0027860_1887_2879 314
233 3300046474 Ga0495605_0038274 Ga0495605_0038274_796_1752 314
234 3300046492 Ga0495585_0013222 Ga0495585_0013222_976_1929 314
235 3300046501 Ga0495607_0000566 Ga0495607_0000566_28010_28966 314
236 3300046501 Ga0495607_0026684 Ga0495607_0026684_647_1639 314
237 3300046507 Ga0495606_0002535 Ga0495606_0002535_19980_20945 314
238 3300046616 Ga0495668_0051766 Ga0495668_0051766_297_1253 314
239 3300046616 Ga0495668_0061318 Ga0495668_0061318_432_1397 314
240 3300046665 Ga0495661_0000304 Ga0495661_0000304_45512_46465 314
241 3300046691 Ga0495670_0043323 Ga0495670_0043323_651_1616 314
242 3300046810 Ga0495660_0000469 Ga0495660_0000469_31252_32208 314
243 3300047469 Ga0495673_0024014 Ga0495673_0024014_60_1025 314
244 3300048924 Ga0496121_0003989 Ga0496121_0003989_2340_3305 314
245 3300048926 Ga0496123_0039683 Ga0496123_0039683_1150_2115 314
246 3300048927 Ga0496124_0000222 Ga0496124_0000222_38368_39330 314
247 3300048927 Ga0496124_0031437 Ga0496124_0031437_2923_3888 314
248 3300049540 Ga0501324_004059 Ga0501324_004059_179_1123 314
249 iso_pu_bacteria 2511231006 2511267880 314
250 iso_pu_bacteria 2511231008 2511276418 314
251 iso_pu_bacteria 2511231012 2511304396 314
252 iso_pu_bacteria 2511231014 2511312894 314
253 iso_pu_bacteria 2511231015 2511319158 314
254 iso_pu_bacteria 2511231017 2511333075 314
255 iso_pu_bacteria 2511231018 2511341260 314
256 iso_pu_bacteria 2511231019 2511341803 314
257 iso_pu_bacteria 2511231020 2511350902 314
258 iso_pu_bacteria 2511231021 2511354636 314
259 iso_pu_bacteria 2511231023 2511366930 314
260 iso_pu_bacteria 2511231031 2511412242 314
261 iso_pu_bacteria 2512047018 2512328991 314
262 iso_pu_bacteria 2554235341 2555668428 314
263 iso_pu_bacteria 2582580891 2583790626 314
264 iso_pu_bacteria 2597489887 2597856611 314
265 iso_pu_bacteria 2599185160 2599355428 314
266 iso_pu_bacteria 2599185161 2599360753 314
267 iso_pu_bacteria 2599185162 2599367075 314
268 iso_pu_bacteria 2599185163 2599373865 314
269 iso_pu_bacteria 2599185164 2599380534 314
270 iso_pu_bacteria 2599185165 2599386981 314
271 iso_pu_bacteria 2599185166 2599392723 314
272 iso_pu_bacteria 2599185168 2599404490 314
273 iso_pu_bacteria 2599185181 2599462262 314
274 iso_pu_bacteria 2599185182 2599466696 314
275 iso_pu_bacteria 2599185185 2599483139 314
276 iso_pu_bacteria 2599185186 2599490646 314
277 iso_pu_bacteria 2599185257 2599805040 314
278 iso_pu_bacteria 2599185356 2600214884 314
279 iso_pu_bacteria 2600254931 2600363753 314
280 iso_pu_bacteria 2600255313 2601774411 314
281 iso_pu_bacteria 2643221565 2643845202 314
282 iso_pu_bacteria 2643221589 2643951966 314
283 iso_pu_bacteria 2643221602 2644024275 314
284 iso_pu_bacteria 2667528171 2671098030 314
285 iso_pu_bacteria 2671180172 2671768226 314
286 iso_pu_bacteria 2713897148 2715751732 314
287 iso_pu_bacteria 2718217725 2718633063 314
288 iso_pu_bacteria 2738543004 2739198712 314
289 iso_pu_bacteria 2738543015 2739256522 314
290 iso_pu_bacteria 2738543025 2739314340 314
291 iso_pu_bacteria 2740892503 2743736035 314
292 iso_pu_bacteria 2773857670 2774121398 314
293 iso_pu_bacteria 2784132072 2784315714 314
294 iso_pu_bacteria 2808606377 2808929278 314
295 iso_pu_bacteria 2808606381 2808951614 314
296 iso_pu_bacteria 2808606382 2808957416 314
297 iso_pu_bacteria 2818991464 2819703115 314
298 iso_pu_bacteria 2842832357 2842832983 314
299 iso_pu_bacteria 2842843487 2842848401 314
300 iso_pu_bacteria 2844665904 2844668942 314
301 iso_pu_bacteria 2917070673 2917072196 314
302 iso_pu_bacteria 2919385768 2919386182 314
303 iso_pu_bacteria 2919456309 2919462047 314
304 iso_pu_bacteria 2919487758 2919491736 314
305 iso_pu_bacteria 2923153595 2923155045 314
306 iso_pu_bacteria 2935353572 2935354367 314
307 iso_pu_bacteria 2939636861 2939637734 314
308 iso_pu_bacteria 2969304461 2969305983 314
309 iso_pu_bacteria 2974289157 2974292431 314
310 iso_pu_bacteria 2984286254 2984290995 314
311 iso_pu_bacteria 2998139840 2998141390 314
312 iso_pu_bacteria 3007395558 3007400575 314
313 iso_pu_bacteria 3007419365 3007420840 314
314 iso_pu_bacteria 3007511990 3007512769 314
315 iso_pu_bacteria 3007614139 3007616234 314
316 iso_pu_bacteria 3007619802 3007620455 314
317 iso_pu_bacteria 3007855910 3007855984 314
318 iso_pu_bacteria 3007861166 3007863378 314
319 iso_pu_bacteria 637000220 637318790 314
320 iso_pu_bacteria 8015687852 8015689267 314
321 iso_pu_bacteria 8019769354 8019770980 314
322 iso_pu_bacteria 8029995093 8029999360 314
323 iso_pu_bacteria 8055770955 8055772383 314
324 iso_pu_bacteria 8056125926 8056127431 314
325 iso_pu_bacteria 8056166840 8056169670 314
326 iso_pu_bacteria 8056177738 8056180228 314
327 iso_pu_bacteria 8057798959 8057803727 314
328 2162886011 MRS1b_contig_3814 MRS1b_0795.00000990 315
329 3300003781 Ga0055536_1036712 Ga0055536_10367121 315
330 3300003791 Ga0055530_10004130 Ga0055530_100041308 315
331 3300003792 Ga0055540_1003406 Ga0055540_10034068 315
332 3300005288 Ga0065714_10065522 Ga0065714_100655225 315
333 3300005288 Ga0065714_10071009 Ga0065714_100710094 315
334 3300005289 Ga0065704_10001998 Ga0065704_100019982 315
335 3300005289 Ga0065704_10006864 Ga0065704_100068642 315
336 3300005289 Ga0065704_10086866 Ga0065704_100868662 315
337 3300005290 Ga0065712_10067895 Ga0065712_100678959 315
338 3300006944 Ga0099823_1016692 Ga0099823_10166923 315
339 3300006946 Ga0079104_1000134 Ga0079104_100013461 315
340 3300006948 Ga0099826_10003760 Ga0099826_1000376010 315
341 3300009011 Ga0105251_10000149 Ga0105251_1000014947 315
342 3300009011 Ga0105251_10020224 Ga0105251_100202242 315
343 3300009011 Ga0105251_10020962 Ga0105251_100209623 315
344 3300009036 Ga0105244_10012941 Ga0105244_100129412 315
345 3300009036 Ga0105244_10022164 Ga0105244_100221642 315
346 3300009036 Ga0105244_10024012 Ga0105244_100240122 315
347 3300009036 Ga0105244_10025221 Ga0105244_100252212 315
348 3300009036 Ga0105244_10070997 Ga0105244_100709973 315
349 3300009036 Ga0105244_10071768 Ga0105244_100717682 315
350 3300009092 Ga0105250_10018577 Ga0105250_100185772 315
351 3300009148 Ga0105243_10130389 Ga0105243_101303892 315
352 3300014497 Ga0182008_10038445 Ga0182008_100384453 315
353 3300015261 Ga0182006_1011169 Ga0182006_10111693 315
354 3300025292 Ga0209676_1001858 Ga0209676_10018589 315
355 3300025298 Ga0209050_1000009 Ga0209050_100000975 315
356 3300025303 Ga0209051_1000053 Ga0209051_100005375 315
357 3300025304 Ga0209257_1026276 Ga0209257_10262762 315
358 3300025711 Ga0207696_1000022 Ga0207696_100002294 315
359 3300025711 Ga0207696_1003920 Ga0207696_10039202 315
360 3300025711 Ga0207696_1029848 Ga0207696_10298482 315
361 3300025728 Ga0207655_1000240 Ga0207655_100024038 315
362 3300025728 Ga0207655_1000516 Ga0207655_100051643 315
363 3300025728 Ga0207655_1002564 Ga0207655_100256410 315
364 3300025728 Ga0207655_1019915 Ga0207655_10199152 315
365 3300025728 Ga0207655_1025696 Ga0207655_10256962 315
366 3300025735 Ga0207713_1000104 Ga0207713_100010418 315
367 3300025735 Ga0207713_1003887 Ga0207713_10038875 315
368 3300025735 Ga0207713_1007436 Ga0207713_10074364 315
369 3300025735 Ga0207713_1020816 Ga0207713_10208162 315
370 3300025735 Ga0207713_1024766 Ga0207713_10247662 315
371 3300025935 Ga0207709_10011638 Ga0207709_100116384 315
372 3300025935 Ga0207709_10080242 Ga0207709_100802422 315
373 3300027111 Ga0209281_1000172 Ga0209281_100017263 315
374 3300027296 Ga0209389_1000002 Ga0209389_1000002260 315
375 3300027312 Ga0209371_1000414 Ga0209371_100041444 315
376 3300027666 Ga0209282_1042241 Ga0209282_10422412 315
377 3300030500 Ga0268256_1000355 Ga0268256_100035544 315
378 3300030733 Ga0314311_1203986 Ga0314311_12039864 315
379 3300030742 Ga0316183_1025019 Ga0316183_10250192 315
380 3300030742 Ga0316183_1065202 Ga0316183_10652022 315
381 3300030744 Ga0316181_1070701 Ga0316181_10707011 315
382 3300031548 Ga0307408_100003809 Ga0307408_1000038096 315
383 3300031548 Ga0307408_100019038 Ga0307408_1000190382 315
384 3300031548 Ga0307408_100304399 Ga0307408_1003043992 315
385 3300031731 Ga0307405_10008655 Ga0307405_100086553 315
386 3300031911 Ga0307412_10014719 Ga0307412_100147192 315
387 3300031911 Ga0307412_10347440 Ga0307412_103474401 315
388 3300032004 Ga0307414_10015196 Ga0307414_100151963 315
389 3300041405 Ga0439438_001224 Ga0439438_001224_2326_3288 315
390 3300041405 Ga0439438_005242 Ga0439438_005242_2723_3670 315
391 3300041405 Ga0439438_005988 Ga0439438_005988_2787_3734 315
392 3300041405 Ga0439438_009648 Ga0439438_009648_1151_2098 315
393 3300041411 Ga0439466_0015533 Ga0439466_0015533_882_1829 315
394 3300041997 Ga0439431_0005964 Ga0439431_0005964_822_1769 315
395 3300042006 Ga0439432_005514 Ga0439432_005514_2673_3638 315
396 3300042006 Ga0439432_008520 Ga0439432_008520_2424_3371 315
397 3300042010 Ga0439452_011895 Ga0439452_011895_691_1638 315
398 3300042013 Ga0439456_000039 Ga0439456_000039_18820_19785 315
399 3300042136 Ga0450900_000809 Ga0450900_000809_650_1615 315
400 3300042142 Ga0450905_001959 Ga0450905_001959_755_1720 315
401 3300042142 Ga0450905_011138 Ga0450905_011138_252_1217 315
402 3300042185 Ga0450909_004616 Ga0450909_004616_138_1085 315
403 3300046453 Ga0495627_000021 Ga0495627_000021_154641_155600 315
404 3300046453 Ga0495627_000279 Ga0495627_000279_41618_42586 315
405 3300046453 Ga0495627_002666 Ga0495627_002666_2425_3384 315
406 3300046458 Ga0495591_000015 Ga0495591_000015_232987_233946 315
407 3300046458 Ga0495591_008115 Ga0495591_008115_1510_2469 315
408 3300046471 Ga0495650_0015563 Ga0495650_0015563_990_1958 315
409 3300046474 Ga0495605_0000016 Ga0495605_0000016_201258_202217 315
410 3300046474 Ga0495605_0000031 Ga0495605_0000031_154162_155127 315
411 3300046474 Ga0495605_0000917 Ga0495605_0000917_2379_3338 315
412 3300046501 Ga0495607_0000162 Ga0495607_0000162_68357_69316 315
413 3300046506 Ga0495583_0000041 Ga0495583_0000041_50434_51393 315
414 3300046506 Ga0495583_0000698 Ga0495583_0000698_949_1908 315
415 3300046506 Ga0495583_0013199 Ga0495583_0013199_1252_2217 315
416 3300046515 Ga0495620_0000013 Ga0495620_0000013_106153_107118 315
417 3300046515 Ga0495620_0000015 Ga0495620_0000015_50403_51362 315
418 3300046518 Ga0495631_0014178 Ga0495631_0014178_779_1747 315
419 3300046519 Ga0495632_0000217 Ga0495632_0000217_3993_4958 315
420 3300046519 Ga0495632_0010845 Ga0495632_0010845_964_1923 315
421 3300046519 Ga0495632_0017098 Ga0495632_0017098_2456_3424 315
422 3300046519 Ga0495632_0021570 Ga0495632_0021570_1912_2880 315
423 3300046520 Ga0495637_0012545 Ga0495637_0012545_2436_3395 315
424 3300046520 Ga0495637_0013794 Ga0495637_0013794_674_1633 315
425 3300046520 Ga0495637_0017806 Ga0495637_0017806_226_1182 315
426 3300046520 Ga0495637_0041340 Ga0495637_0041340_440_1396 315
427 3300046522 Ga0495643_0002001 Ga0495643_0002001_1818_2783 315
428 3300046522 Ga0495643_0002058 Ga0495643_0002058_13751_14716 315
429 3300046524 Ga0495648_0000491 Ga0495648_0000491_39282_40247 315
430 3300046524 Ga0495648_0019057 Ga0495648_0019057_2944_3903 315
431 3300046530 Ga0495654_0002407 Ga0495654_0002407_2108_3076 315
432 3300046530 Ga0495654_0003357 Ga0495654_0003357_3091_4050 315
433 3300046538 Ga0495609_0000015 Ga0495609_0000015_270979_271938 315
434 3300046538 Ga0495609_0000070 Ga0495609_0000070_104389_105354 315
435 3300046542 Ga0495597_0000005 Ga0495597_0000005_173166_174125 315
436 3300046542 Ga0495597_0002158 Ga0495597_0002158_8877_9836 315
437 3300046542 Ga0495597_0028135 Ga0495597_0028135_858_1823 315
438 3300046558 Ga0495633_0000060 Ga0495633_0000060_107470_108429 315
439 3300046648 Ga0495611_0000817 Ga0495611_0000817_12452_13411 315
440 3300046660 Ga0495625_0042717 Ga0495625_0042717_1881_2843 315
441 3300046665 Ga0495661_0000110 Ga0495661_0000110_43884_44843 315
442 3300046665 Ga0495661_0000194 Ga0495661_0000194_39839_40798 315
443 3300046692 Ga0495671_0002259 Ga0495671_0002259_2410_3369 315
444 3300046692 Ga0495671_0010083 Ga0495671_0010083_2809_3777 315
445 3300046694 Ga0495649_0010015 Ga0495649_0010015_2803_3759 315
446 3300046794 Ga0495589_0009282 Ga0495589_0009282_1998_2957 315
447 3300046810 Ga0495660_0008400 Ga0495660_0008400_1498_2457 315
448 3300046810 Ga0495660_0009165 Ga0495660_0009165_2143_3102 315
449 3300047320 Ga0495672_0003898 Ga0495672_0003898_10263_11231 315
450 3300047321 Ga0495676_0009626 Ga0495676_0009626_7748_8704 315
451 3300047323 Ga0495683_0000027 Ga0495683_0000027_101969_102928 315
452 3300047323 Ga0495683_0000261 Ga0495683_0000261_134_1090 315
453 3300047446 Ga0495679_001765 Ga0495679_001765_2315_3274 315
454 3300047469 Ga0495673_0002278 Ga0495673_0002278_10572_11534 315
455 3300047469 Ga0495673_0014906 Ga0495673_0014906_392_1351 315
456 3300047469 Ga0495673_0015222 Ga0495673_0015222_2048_3013 315
457 3300047470 Ga0495681_0015582 Ga0495681_0015582_2128_3087 315
458 3300048904 Ga0496101_0035587 Ga0496101_0035587_1771_2739 315
459 3300048905 Ga0496102_0423730 Ga0496102_0423730_239_1207 315
460 3300048913 Ga0496110_0038308 Ga0496110_0038308_1992_2966 315
461 3300048914 Ga0496111_0047643 Ga0496111_0047643_545_1519 315
462 3300048917 Ga0496114_0028827 Ga0496114_0028827_2042_3007 315
463 3300048917 Ga0496114_0043828 Ga0496114_0043828_1919_2884 315
464 3300048919 Ga0496116_0053813 Ga0496116_0053813_66_1031 315
465 3300048920 Ga0496117_0006498 Ga0496117_0006498_8909_9874 315
466 3300048920 Ga0496117_0036924 Ga0496117_0036924_941_1906 315
467 3300048920 Ga0496117_0040121 Ga0496117_0040121_479_1444 315
468 3300048921 Ga0496118_0001807 Ga0496118_0001807_17897_18862 315
469 3300048921 Ga0496118_0004616 Ga0496118_0004616_11916_12881 315
470 3300048924 Ga0496121_0003009 Ga0496121_0003009_11807_12775 315
471 3300048924 Ga0496121_0048899 Ga0496121_0048899_981_1946 315
472 3300048924 Ga0496121_0152333 Ga0496121_0152333_597_1562 315
473 3300048925 Ga0496122_0000122 Ga0496122_0000122_169770_170738 315
474 3300048925 Ga0496122_0019568 Ga0496122_0019568_3281_4246 315
475 3300048925 Ga0496122_0023279 Ga0496122_0023279_1380_2339 315
476 3300048925 Ga0496122_0050923 Ga0496122_0050923_396_1361 315
477 3300048926 Ga0496123_0000391 Ga0496123_0000391_23426_24391 315
478 3300048926 Ga0496123_0001340 Ga0496123_0001340_11430_12398 315
479 3300048926 Ga0496123_0049954 Ga0496123_0049954_1803_2768 315
480 3300048926 Ga0496123_0089571 Ga0496123_0089571_208_1182 315
481 3300048927 Ga0496124_0027948 Ga0496124_0027948_1514_2479 315
482 3300048927 Ga0496124_0042438 Ga0496124_0042438_928_1893 315
483 3300048927 Ga0496124_0044384 Ga0496124_0044384_789_1763 315
484 3300048927 Ga0496124_0050720 Ga0496124_0050720_755_1720 315
485 3300048927 Ga0496124_0329520 Ga0496124_0329520_51_1016 315
486 3300048927 Ga0496124_0329531 Ga0496124_0329531_74_1039 315
487 3300048928 Ga0496125_0039458 Ga0496125_0039458_1982_2947 315
488 3300048928 Ga0496125_0040148 Ga0496125_0040148_1897_2862 315
489 3300048928 Ga0496125_0043847 Ga0496125_0043847_2083_3057 315
490 3300048929 Ga0496126_0085998 Ga0496126_0085998_1016_1990 315
491 3300049459 Ga0495678_000039 Ga0495678_000039_140106_141065 315
492 3300049539 Ga0501323_003470 Ga0501323_003470_35_982 315
493 3300049571 Ga0501034_0000137 Ga0501034_0000137_98027_98992 315
494 3300049662 Ga0501222_003868 Ga0501222_003868_573_1520 315
495 3300053125 Ga0500618_007836 Ga0500618_007836_922_1878 315
496 3300053135 Ga0500659_0002202 Ga0500659_0002202_10115_11080 315
497 3300053140 Ga0500573_0022482 Ga0500573_0022482_617_1576 315
498 3300009011 Ga0105251_10000004 Ga0105251_10000004118 316
499 3300009036 Ga0105244_10000922 Ga0105244_1000092217 316
500 3300009092 Ga0105250_10000235 Ga0105250_1000023541 316
501 3300009148 Ga0105243_10080446 Ga0105243_100804462 316
502 3300025711 Ga0207696_1000044 Ga0207696_100004499 316
503 3300025728 Ga0207655_1001511 Ga0207655_10015117 316
504 3300025735 Ga0207713_1000013 Ga0207713_1000013163 316
505 3300046501 Ga0495607_0036902 Ga0495607_0036902_1163_2131 316
506 3300046506 Ga0495583_0025229 Ga0495583_0025229_32_1003 316
507 3300048927 Ga0496124_0089843 Ga0496124_0089843_356_1315 316
508 3300049460 Ga0495682_0000078 Ga0495682_0000078_81334_82293 316
509 2124908027 MRS2a_Contig_6276 MRS2a_00177290 317
510 3300003323 rootH1_10289084 rootH1_102890841 317
511 3300003578 Ga0006562J51391_1005324 Ga0006562J51391_10053243 317
512 3300003781 Ga0055536_1004073 Ga0055536_10040738 317
513 3300003791 Ga0055530_10004172 Ga0055530_100041728 317
514 3300003792 Ga0055540_1003457 Ga0055540_10034578 317
515 3300003794 Ga0055531_10000283 Ga0055531_1000028313 317
516 3300005288 Ga0065714_10003519 Ga0065714_100035198 317
517 3300005288 Ga0065714_10082576 Ga0065714_100825762 317
518 3300005353 Ga0070669_100306876 Ga0070669_1003068762 317
519 3300005457 Ga0070662_100019401 Ga0070662_1000194014 317
520 3300009011 Ga0105251_10077823 Ga0105251_100778231 317
521 3300009036 Ga0105244_10036374 Ga0105244_100363743 317
522 3300009036 Ga0105244_10037258 Ga0105244_100372583 317
523 3300009036 Ga0105244_10059997 Ga0105244_100599973 317
524 3300009036 Ga0105244_10066409 Ga0105244_100664092 317
525 3300009036 Ga0105244_10081183 Ga0105244_100811832 317
526 3300009148 Ga0105243_10000218 Ga0105243_1000021862 317
527 3300011119 Ga0105246_10000228 Ga0105246_1000022831 317
528 3300011119 Ga0105246_10336244 Ga0105246_103362442 317
529 3300013100 Ga0157373_10009462 Ga0157373_100094628 317
530 3300013100 Ga0157373_10312381 Ga0157373_103123812 317
531 3300013102 Ga0157371_10008723 Ga0157371_100087234 317
532 3300013307 Ga0157372_10120467 Ga0157372_101204673 317
533 3300013308 Ga0157375_10518220 Ga0157375_105182202 317
534 3300014497 Ga0182008_10036226 Ga0182008_100362262 317
535 3300014497 Ga0182008_10057774 Ga0182008_100577742 317
536 3300015261 Ga0182006_1004043 Ga0182006_10040432 317
537 3300015261 Ga0182006_1018198 Ga0182006_10181982 317
538 3300015262 Ga0182007_10003527 Ga0182007_100035278 317
539 3300015265 Ga0182005_1018865 Ga0182005_10188652 317
540 3300015265 Ga0182005_1050588 Ga0182005_10505881 317
541 3300015265 Ga0182005_1050589 Ga0182005_10505891 317
542 3300017792 Ga0163161_10151862 Ga0163161_101518622 317
543 3300025230 Ga0209563_100515 Ga0209563_1005159 317
544 3300025291 Ga0209675_1004059 Ga0209675_10040595 317
545 3300025292 Ga0209676_1000016 Ga0209676_1000016311 317
546 3300025298 Ga0209050_1000036 Ga0209050_1000036247 317
547 3300025303 Ga0209051_1000094 Ga0209051_100009434 317
548 3300025304 Ga0209257_1000173 Ga0209257_1000173156 317
549 3300025711 Ga0207696_1000083 Ga0207696_1000083150 317
550 3300025711 Ga0207696_1006039 Ga0207696_10060395 317
551 3300025728 Ga0207655_1000193 Ga0207655_100019344 317
552 3300025728 Ga0207655_1005303 Ga0207655_10053034 317
553 3300025728 Ga0207655_1012339 Ga0207655_10123392 317
554 3300025728 Ga0207655_1026474 Ga0207655_10264742 317
555 3300025735 Ga0207713_1000933 Ga0207713_10009336 317
556 3300025735 Ga0207713_1010208 Ga0207713_10102082 317
557 3300025735 Ga0207713_1010346 Ga0207713_10103463 317
558 3300025735 Ga0207713_1060892 Ga0207713_10608923 317
559 3300025923 Ga0207681_10337243 Ga0207681_103372432 317
560 3300025933 Ga0207706_10031700 Ga0207706_100317003 317
561 3300025935 Ga0207709_10000036 Ga0207709_10000036174 317
562 3300027543 Ga0209999_1005350 Ga0209999_10053503 317
563 3300027907 Ga0207428_10233821 Ga0207428_102338212 317
564 3300038705 Ga0237819_00586 Ga0237819_00586_5521_6483 317
565 3300041405 Ga0439438_000992 Ga0439438_000992_5692_6654 317
566 3300041407 Ga0439447_008833 Ga0439447_008833_1087_2049 317
567 3300041411 Ga0439466_0001459 Ga0439466_0001459_4675_5637 317
568 3300041413 Ga0439465_0003166 Ga0439465_0003166_3680_4642 317
569 3300042006 Ga0439432_002305 Ga0439432_002305_2565_3527 317
570 3300042010 Ga0439452_003981 Ga0439452_003981_1155_2117 317
571 3300042013 Ga0439456_000851 Ga0439456_000851_4048_5010 317
572 3300042016 Ga0439463_005478 Ga0439463_005478_684_1646 317
573 3300042115 Ga0450911_004861 Ga0450911_004861_1145_2107 317
574 3300042121 Ga0450919_003445 Ga0450919_003445_839_1801 317
575 3300042127 Ga0450890_000422 Ga0450890_000422_4065_5027 317
576 3300042138 Ga0450903_000781 Ga0450903_000781_4082_5044 317
577 3300042145 Ga0450906_000157 Ga0450906_000157_10067_11029 317
578 3300042146 Ga0450907_001368 Ga0450907_001368_1155_2117 317
579 3300042156 Ga0439446_0004462 Ga0439446_0004462_23_985 317
580 3300042185 Ga0450909_003876 Ga0450909_003876_1124_2086 317
581 3300042435 Ga0439434_0019941 Ga0439434_0019941_984_1946 317
582 3300042461 Ga0439460_0000237 Ga0439460_0000237_4249_5211 317
583 3300042532 Ga0450893_0003354 Ga0450893_0003354_1088_2050 317
584 3300042532 Ga0450893_0004277 Ga0450893_0004277_695_1657 317
585 3300046452 Ga0495617_001816 Ga0495617_001816_481_1443 317
586 3300046457 Ga0495590_0000920 Ga0495590_0000920_11295_12257 317
587 3300046460 Ga0495638_0015483 Ga0495638_0015483_3185_4147 317
588 3300046460 Ga0495638_0134801 Ga0495638_0134801_56_1018 317
589 3300046463 Ga0495653_0009661 Ga0495653_0009661_1292_2254 317
590 3300046463 Ga0495653_0035403 Ga0495653_0035403_407_1360 317
591 3300046471 Ga0495650_0001786 Ga0495650_0001786_11720_12682 317
592 3300046474 Ga0495605_0003709 Ga0495605_0003709_7493_8455 317
593 3300046474 Ga0495605_0012909 Ga0495605_0012909_488_1450 317
594 3300046474 Ga0495605_0029273 Ga0495605_0029273_1263_2216 317
595 3300046475 Ga0495639_0001930 Ga0495639_0001930_7071_8033 317
596 3300046491 Ga0495584_0003475 Ga0495584_0003475_4507_5469 317
597 3300046492 Ga0495585_0042969 Ga0495585_0042969_825_1787 317
598 3300046501 Ga0495607_0001224 Ga0495607_0001224_14540_15502 317
599 3300046501 Ga0495607_0005921 Ga0495607_0005921_603_1565 317
600 3300046506 Ga0495583_0072459 Ga0495583_0072459_135_1094 317
601 3300046513 Ga0495616_0001130 Ga0495616_0001130_6147_7109 317
602 3300046513 Ga0495616_0066627 Ga0495616_0066627_286_1248 317
603 3300046517 Ga0495630_0109774 Ga0495630_0109774_787_1740 317
604 3300046519 Ga0495632_0005235 Ga0495632_0005235_7100_8062 317
605 3300046520 Ga0495637_0011974 Ga0495637_0011974_2533_3495 317
606 3300046520 Ga0495637_0031160 Ga0495637_0031160_717_1679 317
607 3300046520 Ga0495637_0080267 Ga0495637_0080267_264_1226 317
608 3300046524 Ga0495648_0107478 Ga0495648_0107478_20_982 317
609 3300046524 Ga0495648_0156955 Ga0495648_0156955_170_1132 317
610 3300046526 Ga0495666_0073093 Ga0495666_0073093_287_1249 317
611 3300046528 Ga0495642_0004237 Ga0495642_0004237_4041_5003 317
612 3300046530 Ga0495654_0008163 Ga0495654_0008163_4196_5158 317
613 3300046530 Ga0495654_0069104 Ga0495654_0069104_465_1424 317
614 3300046530 Ga0495654_0089076 Ga0495654_0089076_151_1113 317
615 3300046536 Ga0495587_0046458 Ga0495587_0046458_1188_2141 317
616 3300046538 Ga0495609_0007336 Ga0495609_0007336_3637_4599 317
617 3300046557 Ga0495622_0002478 Ga0495622_0002478_7319_8281 317
618 3300046558 Ga0495633_0035970 Ga0495633_0035970_555_1514 317
619 3300046642 Ga0495634_0001715 Ga0495634_0001715_10337_11290 317
620 3300046663 Ga0495635_0006971 Ga0495635_0006971_1056_2009 317
621 3300046664 Ga0495659_0001693 Ga0495659_0001693_600_1562 317
622 3300046679 Ga0495623_0024250 Ga0495623_0024250_2058_3011 317
623 3300046680 Ga0495646_0106616 Ga0495646_0106616_21_974 317
624 3300046690 Ga0495624_0011063 Ga0495624_0011063_4067_5029 317
625 3300046691 Ga0495670_0063197 Ga0495670_0063197_103_1065 317
626 3300046692 Ga0495671_0008071 Ga0495671_0008071_4318_5280 317
627 3300046692 Ga0495671_0045812 Ga0495671_0045812_967_1929 317
628 3300046694 Ga0495649_0047424 Ga0495649_0047424_240_1202 317
629 3300046694 Ga0495649_0049048 Ga0495649_0049048_831_1793 317
630 3300046694 Ga0495649_0137999 Ga0495649_0137999_83_1045 317
631 3300046794 Ga0495589_0004531 Ga0495589_0004531_5822_6784 317
632 3300046794 Ga0495589_0071619 Ga0495589_0071619_221_1183 317
633 3300046809 Ga0495600_0015424 Ga0495600_0015424_3825_4787 317
634 3300046810 Ga0495660_0098684 Ga0495660_0098684_420_1382 317
635 3300047315 Ga0495581_0053092 Ga0495581_0053092_1082_2044 317
636 3300047317 Ga0495604_0005968 Ga0495604_0005968_4672_5625 317
637 3300047318 Ga0495636_0045497 Ga0495636_0045497_388_1350 317
638 3300047319 Ga0495674_0013987 Ga0495674_0013987_1007_1960 317
639 3300047320 Ga0495672_0011159 Ga0495672_0011159_1273_2235 317
640 3300047320 Ga0495672_0054233 Ga0495672_0054233_240_1202 317
641 3300047320 Ga0495672_0078358 Ga0495672_0078358_240_1202 317
642 3300047322 Ga0495680_0051855 Ga0495680_0051855_260_1213 317
643 3300047322 Ga0495680_0078655 Ga0495680_0078655_361_1323 317
644 3300047323 Ga0495683_0057727 Ga0495683_0057727_684_1646 317
645 3300047323 Ga0495683_0108210 Ga0495683_0108210_103_1065 317
646 3300047443 Ga0495687_005844 Ga0495687_005844_636_1598 317
647 3300047443 Ga0495687_013303 Ga0495687_013303_2207_3169 317
648 3300047444 Ga0495675_0113108 Ga0495675_0113108_651_1604 317
649 3300047469 Ga0495673_0050387 Ga0495673_0050387_602_1564 317
650 3300047469 Ga0495673_0063147 Ga0495673_0063147_92_1054 317
651 3300047469 Ga0495673_0090907 Ga0495673_0090907_21_983 317
652 3300047470 Ga0495681_0000933 Ga0495681_0000933_14535_15497 317
653 3300048088 Ga0495602_0030701 Ga0495602_0030701_3879_4841 317
654 3300048091 Ga0495626_0005538 Ga0495626_0005538_5735_6697 317
655 3300048091 Ga0495626_0031306 Ga0495626_0031306_647_1609 317
656 3300048091 Ga0495626_0044990 Ga0495626_0044990_757_1719 317
657 3300048905 Ga0496102_0000242 Ga0496102_0000242_7750_8703 317
658 3300048906 Ga0496103_0005866 Ga0496103_0005866_5637_6590 317
659 3300048910 Ga0496107_0119091 Ga0496107_0119091_635_1597 317
660 3300048918 Ga0496115_0047584 Ga0496115_0047584_1511_2464 317
661 3300048919 Ga0496116_0010805 Ga0496116_0010805_6104_7066 317
662 3300048919 Ga0496116_0058892 Ga0496116_0058892_894_1856 317
663 3300048920 Ga0496117_0023336 Ga0496117_0023336_578_1540 317
664 3300048920 Ga0496117_0105075 Ga0496117_0105075_240_1202 317
665 3300048921 Ga0496118_0013626 Ga0496118_0013626_6140_7102 317
666 3300048921 Ga0496118_0040470 Ga0496118_0040470_768_1730 317
667 3300048921 Ga0496118_0078499 Ga0496118_0078499_622_1575 317
668 3300048921 Ga0496118_0099746 Ga0496118_0099746_173_1135 317
669 3300048922 Ga0496119_0059393 Ga0496119_0059393_1307_2269 317
670 3300048924 Ga0496121_0131863 Ga0496121_0131863_36_998 317
671 3300048925 Ga0496122_0018867 Ga0496122_0018867_1122_2084 317
672 3300048925 Ga0496122_0074368 Ga0496122_0074368_553_1515 317
673 3300048925 Ga0496122_0204774 Ga0496122_0204774_159_1121 317
674 3300048926 Ga0496123_0022720 Ga0496123_0022720_3290_4252 317
675 3300048927 Ga0496124_0182132 Ga0496124_0182132_531_1490 317
676 3300048928 Ga0496125_0188204 Ga0496125_0188204_12_971 317
677 3300048929 Ga0496126_0121779 Ga0496126_0121779_954_1907 317
678 3300049460 Ga0495682_0049418 Ga0495682_0049418_460_1422 317
679 3300059641 Ga0587068_001963 Ga0587068_001963_1437_2399 317
680 2124908027 MRS2a_Contig_27 MRS2a_00170910 318
681 3300002737 JGI25162J39368_1000132 JGI25162J39368_10001327 318
682 3300002771 JGI25163J39215_1001003 JGI25163J39215_10010032 318
683 3300002772 JGI25164J39214_1000106 JGI25164J39214_100010680 318
684 3300003214 JGI25165J46597_1000217 JGI25165J46597_10002177 318
685 3300003781 Ga0055536_1000043 Ga0055536_100004312 318
686 3300003781 Ga0055536_1004002 Ga0055536_10040027 318
687 3300003791 Ga0055530_10000031 Ga0055530_10000031110 318
688 3300003792 Ga0055540_1000415 Ga0055540_100041523 318
689 3300003792 Ga0055540_1018326 Ga0055540_10183262 318
690 3300005288 Ga0065714_10000009 Ga0065714_1000000911 318
691 3300005288 Ga0065714_10004035 Ga0065714_100040356 318
692 3300005288 Ga0065714_10019813 Ga0065714_100198132 318
693 3300005288 Ga0065714_10068042 Ga0065714_100680422 318
694 3300005288 Ga0065714_10068362 Ga0065714_100683623 318
695 3300005288 Ga0065714_10078627 Ga0065714_100786272 318
696 3300005289 Ga0065704_10006243 Ga0065704_100062433 318
697 3300005290 Ga0065712_10000649 Ga0065712_100006494 318
698 3300005293 Ga0065715_10008316 Ga0065715_100083162 318
699 3300006051 Ga0075364_10089589 Ga0075364_100895892 318
700 3300006051 Ga0075364_10163874 Ga0075364_101638743 318
701 3300006051 Ga0075364_10325072 Ga0075364_103250721 318
702 3300006058 Ga0075432_10004652 Ga0075432_100046522 318
703 3300006058 Ga0075432_10007662 Ga0075432_100076623 318
704 3300006058 Ga0075432_10037467 Ga0075432_100374672 318
705 3300006058 Ga0075432_10054030 Ga0075432_100540302 318
706 3300006177 Ga0075362_10113548 Ga0075362_101135482 318
707 3300006946 Ga0079104_1000090 Ga0079104_100009011 318
708 3300009011 Ga0105251_10001609 Ga0105251_1000160919 318
709 3300009011 Ga0105251_10006481 Ga0105251_100064817 318
710 3300009036 Ga0105244_10013329 Ga0105244_100133295 318
711 3300009036 Ga0105244_10031172 Ga0105244_100311721 318
712 3300009036 Ga0105244_10074577 Ga0105244_100745771 318
713 3300009036 Ga0105244_10114729 Ga0105244_101147291 318
714 3300009092 Ga0105250_10005280 Ga0105250_100052806 318
715 3300009092 Ga0105250_10012229 Ga0105250_100122293 318
716 3300009092 Ga0105250_10045489 Ga0105250_100454892 318
717 3300009092 Ga0105250_10092306 Ga0105250_100923061 318
718 3300009148 Ga0105243_10000144 Ga0105243_1000014475 318
719 3300009148 Ga0105243_10051760 Ga0105243_100517603 318
720 3300009148 Ga0105243_10200699 Ga0105243_102006992 318
721 3300009176 Ga0105242_10123597 Ga0105242_101235973 318
722 3300011119 Ga0105246_10295921 Ga0105246_102959212 318
723 3300012498 Ga0157345_1000028 Ga0157345_10000289 318
724 3300013100 Ga0157373_10008952 Ga0157373_100089522 318
725 3300013100 Ga0157373_10013114 Ga0157373_100131142 318
726 3300013100 Ga0157373_10070497 Ga0157373_100704972 318
727 3300013100 Ga0157373_10164417 Ga0157373_101644172 318
728 3300013102 Ga0157371_10000230 Ga0157371_1000023075 318
729 3300013102 Ga0157371_10015482 Ga0157371_100154825 318
730 3300013104 Ga0157370_10036735 Ga0157370_100367353 318
731 3300013104 Ga0157370_10102041 Ga0157370_101020412 318
732 3300013104 Ga0157370_10217470 Ga0157370_102174702 318
733 3300013104 Ga0157370_10374505 Ga0157370_103745052 318
734 3300013105 Ga0157369_10019705 Ga0157369_100197058 318
735 3300013105 Ga0157369_10260890 Ga0157369_102608902 318
736 3300013105 Ga0157369_10356841 Ga0157369_103568411 318
737 3300013105 Ga0157369_10356882 Ga0157369_103568821 318
738 3300013306 Ga0163162_10098170 Ga0163162_100981702 318
739 3300013306 Ga0163162_10108221 Ga0163162_101082212 318
740 3300013308 Ga0157375_10611678 Ga0157375_106116781 318
741 3300013308 Ga0157375_10646505 Ga0157375_106465051 318
742 3300014497 Ga0182008_10000783 Ga0182008_1000078314 318
743 3300014497 Ga0182008_10011690 Ga0182008_100116903 318
744 3300014497 Ga0182008_10014603 Ga0182008_100146032 318
745 3300014497 Ga0182008_10065702 Ga0182008_100657021 318
746 3300014497 Ga0182008_10124341 Ga0182008_101243411 318
747 3300014497 Ga0182008_10156246 Ga0182008_101562461 318
748 3300015261 Ga0182006_1001311 Ga0182006_10013117 318
749 3300015261 Ga0182006_1003963 Ga0182006_10039638 318
750 3300015261 Ga0182006_1006595 Ga0182006_10065954 318
751 3300015261 Ga0182006_1014072 Ga0182006_10140723 318
752 3300015261 Ga0182006_1066701 Ga0182006_10667011 318
753 3300015265 Ga0182005_1001973 Ga0182005_10019738 318
754 3300015265 Ga0182005_1015473 Ga0182005_10154731 318
755 3300017792 Ga0163161_10010705 Ga0163161_100107052 318
756 3300017792 Ga0163161_10018309 Ga0163161_100183092 318
757 3300017792 Ga0163161_10071149 Ga0163161_100711492 318
758 3300017792 Ga0163161_10489344 Ga0163161_104893441 318
759 3300020070 Ga0206356_11555357 Ga0206356_115553572 318
760 3300025207 Ga0209760_100047 Ga0209760_100047104 318
761 3300025231 Ga0207427_100029 Ga0207427_100029104 318
762 3300025233 Ga0209437_100009 Ga0209437_100009359 318
763 3300025256 Ga0209759_1019525 Ga0209759_10195252 318
764 3300025261 Ga0209233_1000032 Ga0209233_1000032359 318
765 3300025292 Ga0209676_1000033 Ga0209676_1000033138 318
766 3300025292 Ga0209676_1000080 Ga0209676_100008056 318
767 3300025292 Ga0209676_1003397 Ga0209676_10033978 318
768 3300025298 Ga0209050_1000117 Ga0209050_100011710 318
769 3300025298 Ga0209050_1001816 Ga0209050_10018163 318
770 3300025303 Ga0209051_1000077 Ga0209051_100007710 318
771 3300025303 Ga0209051_1014768 Ga0209051_10147683 318
772 3300025711 Ga0207696_1002326 Ga0207696_10023268 318
773 3300025711 Ga0207696_1004851 Ga0207696_10048512 318
774 3300025728 Ga0207655_1000005 Ga0207655_1000005427 318
775 3300025728 Ga0207655_1000015 Ga0207655_1000015516 318
776 3300025728 Ga0207655_1043244 Ga0207655_10432443 318
777 3300025728 Ga0207655_1045470 Ga0207655_10454701 318
778 3300025728 Ga0207655_1074279 Ga0207655_10742791 318
779 3300025735 Ga0207713_1000977 Ga0207713_10009775 318
780 3300025735 Ga0207713_1007908 Ga0207713_10079086 318
781 3300025735 Ga0207713_1010443 Ga0207713_10104432 318
782 3300025735 Ga0207713_1020768 Ga0207713_10207682 318
783 3300025935 Ga0207709_10000250 Ga0207709_1000025059 318
784 3300027111 Ga0209281_1000013 Ga0209281_1000013595 318
785 3300027111 Ga0209281_1008449 Ga0209281_10084493 318
786 3300027111 Ga0209281_1014360 Ga0209281_10143602 318
787 3300027907 Ga0207428_10029703 Ga0207428_100297033 318
788 3300027907 Ga0207428_10126181 Ga0207428_101261812 318
789 3300027907 Ga0207428_10352501 Ga0207428_103525012 318
790 3300028379 Ga0268266_10156206 Ga0268266_101562062 318
791 3300028786 Ga0307517_10168130 Ga0307517_101681302 318
792 3300028786 Ga0307517_10239473 Ga0307517_102394731 318
793 3300030735 Ga0316178_1048493 Ga0316178_104849313 318
794 3300031548 Ga0307408_100062293 Ga0307408_1000622933 318
795 3300031911 Ga0307412_10015341 Ga0307412_100153413 318
796 3300031911 Ga0307412_10160042 Ga0307412_101600422 318
797 3300031911 Ga0307412_10203664 Ga0307412_102036642 318
798 3300031995 Ga0307409_100238037 Ga0307409_1002380372 318
799 3300032004 Ga0307414_10060093 Ga0307414_100600932 318
800 3300032004 Ga0307414_10085384 Ga0307414_100853842 318
801 3300032005 Ga0307411_10092953 Ga0307411_100929531 318
802 3300033180 Ga0307510_10020770 Ga0307510_100207702 318
803 3300041405 Ga0439438_002780 Ga0439438_002780_5762_6718 318
804 3300041405 Ga0439438_006395 Ga0439438_006395_1165_2127 318
805 3300041405 Ga0439438_015423 Ga0439438_015423_678_1637 318
806 3300041405 Ga0439438_020237 Ga0439438_020237_391_1350 318
807 3300041405 Ga0439438_024721 Ga0439438_024721_235_1200 318
808 3300041407 Ga0439447_000502 Ga0439447_000502_7514_8470 318
809 3300041407 Ga0439447_001881 Ga0439447_001881_6118_7077 318
810 3300041407 Ga0439447_007850 Ga0439447_007850_669_1631 318
811 3300041407 Ga0439447_010942 Ga0439447_010942_1315_2280 318
812 3300041411 Ga0439466_0001434 Ga0439466_0001434_163_1122 318
813 3300041411 Ga0439466_0002230 Ga0439466_0002230_916_1878 318
814 3300041411 Ga0439466_0003988 Ga0439466_0003988_645_1604 318
815 3300041411 Ga0439466_0007938 Ga0439466_0007938_943_1899 318
816 3300041411 Ga0439466_0012473 Ga0439466_0012473_669_1631 318
817 3300041411 Ga0439466_0018697 Ga0439466_0018697_1003_1962 318
818 3300041411 Ga0439466_0021069 Ga0439466_0021069_518_1483 318
819 3300041411 Ga0439466_0054853 Ga0439466_0054853_235_1194 318
820 3300041413 Ga0439465_0027031 Ga0439465_0027031_781_1737 318
821 3300042004 Ga0439445_0033542 Ga0439445_0033542_235_1191 318
822 3300042006 Ga0439432_019693 Ga0439432_019693_765_1724 318
823 3300042006 Ga0439432_023356 Ga0439432_023356_841_1797 318
824 3300042006 Ga0439432_027182 Ga0439432_027182_852_1817 318
825 3300042009 Ga0439451_001946 Ga0439451_001946_1619_2578 318
826 3300042010 Ga0439452_000500 Ga0439452_000500_13491_14456 318
827 3300042010 Ga0439452_001277 Ga0439452_001277_6072_7028 318
828 3300042010 Ga0439452_001890 Ga0439452_001890_6447_7406 318
829 3300042010 Ga0439452_001939 Ga0439452_001939_5767_6729 318
830 3300042010 Ga0439452_009442 Ga0439452_009442_1379_2338 318
831 3300042010 Ga0439452_011351 Ga0439452_011351_719_1678 318
832 3300042013 Ga0439456_004460 Ga0439456_004460_1426_2382 318
833 3300042013 Ga0439456_007987 Ga0439456_007987_95_1060 318
834 3300042013 Ga0439456_012300 Ga0439456_012300_659_1618 318
835 3300042013 Ga0439456_017389 Ga0439456_017389_364_1326 318
836 3300042016 Ga0439463_001515 Ga0439463_001515_1088_2050 318
837 3300042016 Ga0439463_035096 Ga0439463_035096_165_1121 318
838 3300042115 Ga0450911_000292 Ga0450911_000292_13335_14300 318
839 3300042124 Ga0450922_001710 Ga0450922_001710_592_1551 318
840 3300042124 Ga0450922_002063 Ga0450922_002063_847_1806 318
841 3300042137 Ga0450902_020770 Ga0450902_020770_14_979 318
842 3300042139 Ga0450904_001656 Ga0450904_001656_1026_1991 318
843 3300042146 Ga0450907_000591 Ga0450907_000591_1967_2923 318
844 3300042147 Ga0450910_005405 Ga0450910_005405_344_1303 318
845 3300042147 Ga0450910_008145 Ga0450910_008145_309_1265 318
846 3300042185 Ga0450909_006490 Ga0450909_006490_668_1624 318
847 3300042435 Ga0439434_0000189 Ga0439434_0000189_4286_5242 318
848 3300042531 Ga0450918_005125 Ga0450918_005125_675_1640 318
849 3300042993 Ga0439440_0016140 Ga0439440_0016140_554_1516 318
850 3300046452 Ga0495617_012260 Ga0495617_012260_1377_2333 318
851 3300046452 Ga0495617_023649 Ga0495617_023649_572_1534 318
852 3300046452 Ga0495617_031553 Ga0495617_031553_526_1485 318
853 3300046452 Ga0495617_033987 Ga0495617_033987_610_1569 318
854 3300046452 Ga0495617_072426 Ga0495617_072426_47_1006 318
855 3300046453 Ga0495627_002922 Ga0495627_002922_743_1708 318
856 3300046453 Ga0495627_033788 Ga0495627_033788_438_1397 318
857 3300046455 Ga0495603_0015991 Ga0495603_0015991_1184_2140 318
858 3300046457 Ga0495590_0002374 Ga0495590_0002374_581_1540 318
859 3300046457 Ga0495590_0040384 Ga0495590_0040384_537_1493 318
860 3300046457 Ga0495590_0042127 Ga0495590_0042127_11_970 318
861 3300046458 Ga0495591_003627 Ga0495591_003627_5806_6771 318
862 3300046458 Ga0495591_003905 Ga0495591_003905_5719_6678 318
863 3300046458 Ga0495591_006409 Ga0495591_006409_3154_4119 318
864 3300046458 Ga0495591_008517 Ga0495591_008517_3156_4121 318
865 3300046458 Ga0495591_027684 Ga0495591_027684_171_1127 318
866 3300046458 Ga0495591_041331 Ga0495591_041331_308_1267 318
867 3300046459 Ga0495629_0009993 Ga0495629_0009993_1748_2707 318
868 3300046460 Ga0495638_0007630 Ga0495638_0007630_6176_7135 318
869 3300046460 Ga0495638_0008249 Ga0495638_0008249_5844_6803 318
870 3300046460 Ga0495638_0028103 Ga0495638_0028103_590_1549 318
871 3300046460 Ga0495638_0083788 Ga0495638_0083788_796_1752 318
872 3300046460 Ga0495638_0084376 Ga0495638_0084376_485_1444 318
873 3300046460 Ga0495638_0097596 Ga0495638_0097596_176_1132 318
874 3300046460 Ga0495638_0111073 Ga0495638_0111073_122_1084 318
875 3300046460 Ga0495638_0116695 Ga0495638_0116695_55_1014 318
876 3300046460 Ga0495638_0203110 Ga0495638_0203110_139_1098 318
877 3300046471 Ga0495650_0011839 Ga0495650_0011839_3001_3957 318
878 3300046471 Ga0495650_0012047 Ga0495650_0012047_3118_4077 318
879 3300046471 Ga0495650_0030937 Ga0495650_0030937_797_1753 318
880 3300046471 Ga0495650_0098300 Ga0495650_0098300_25_984 318
881 3300046473 Ga0495582_0034309 Ga0495582_0034309_915_1874 318
882 3300046474 Ga0495605_0004707 Ga0495605_0004707_6377_7336 318
883 3300046474 Ga0495605_0020163 Ga0495605_0020163_1975_2931 318
884 3300046474 Ga0495605_0045604 Ga0495605_0045604_143_1108 318
885 3300046475 Ga0495639_0022310 Ga0495639_0022310_999_1958 318
886 3300046491 Ga0495584_0010552 Ga0495584_0010552_974_1930 318
887 3300046491 Ga0495584_0024071 Ga0495584_0024071_1551_2510 318
888 3300046491 Ga0495584_0027340 Ga0495584_0027340_917_1873 318
889 3300046491 Ga0495584_0042112 Ga0495584_0042112_1055_2011 318
890 3300046491 Ga0495584_0082595 Ga0495584_0082595_632_1591 318
891 3300046491 Ga0495584_0092493 Ga0495584_0092493_74_1030 318
892 3300046491 Ga0495584_0103383 Ga0495584_0103383_138_1097 318
893 3300046492 Ga0495585_0004523 Ga0495585_0004523_585_1541 318
894 3300046492 Ga0495585_0048827 Ga0495585_0048827_561_1526 318
895 3300046492 Ga0495585_0049967 Ga0495585_0049967_744_1703 318
896 3300046492 Ga0495585_0066460 Ga0495585_0066460_536_1495 318
897 3300046492 Ga0495585_0072861 Ga0495585_0072861_771_1727 318
898 3300046492 Ga0495585_0077270 Ga0495585_0077270_615_1571 318
899 3300046492 Ga0495585_0142747 Ga0495585_0142747_135_1097 318
900 3300046499 Ga0495594_0010081 Ga0495594_0010081_1041_1997 318
901 3300046499 Ga0495594_0031690 Ga0495594_0031690_1389_2348 318
902 3300046499 Ga0495594_0047830 Ga0495594_0047830_551_1507 318
903 3300046500 Ga0495596_0003952 Ga0495596_0003952_5718_6677 318
904 3300046500 Ga0495596_0016460 Ga0495596_0016460_219_1184 318
905 3300046501 Ga0495607_0048157 Ga0495607_0048157_990_1955 318
906 3300046501 Ga0495607_0049410 Ga0495607_0049410_1169_2125 318
907 3300046501 Ga0495607_0055547 Ga0495607_0055547_540_1499 318
908 3300046501 Ga0495607_0060550 Ga0495607_0060550_759_1715 318
909 3300046506 Ga0495583_0001999 Ga0495583_0001999_15737_16693 318
910 3300046507 Ga0495606_0009839 Ga0495606_0009839_596_1555 318
911 3300046507 Ga0495606_0033013 Ga0495606_0033013_657_1616 318
912 3300046507 Ga0495606_0039096 Ga0495606_0039096_1632_2588 318
913 3300046512 Ga0495610_0013447 Ga0495610_0013447_881_1840 318
914 3300046512 Ga0495610_0017340 Ga0495610_0017340_3120_4085 318
915 3300046512 Ga0495610_0018209 Ga0495610_0018209_650_1615 318
916 3300046512 Ga0495610_0023445 Ga0495610_0023445_625_1584 318
917 3300046512 Ga0495610_0037736 Ga0495610_0037736_632_1591 318
918 3300046512 Ga0495610_0060137 Ga0495610_0060137_504_1463 318
919 3300046512 Ga0495610_0061875 Ga0495610_0061875_171_1130 318
920 3300046513 Ga0495616_0004373 Ga0495616_0004373_6922_7887 318
921 3300046513 Ga0495616_0064488 Ga0495616_0064488_579_1538 318
922 3300046513 Ga0495616_0123915 Ga0495616_0123915_187_1146 318
923 3300046515 Ga0495620_0013776 Ga0495620_0013776_15_971 318
924 3300046515 Ga0495620_0027507 Ga0495620_0027507_1129_2094 318
925 3300046517 Ga0495630_0065472 Ga0495630_0065472_885_1844 318
926 3300046518 Ga0495631_0000635 Ga0495631_0000635_4194_5150 318
927 3300046518 Ga0495631_0040095 Ga0495631_0040095_456_1412 318
928 3300046518 Ga0495631_0061981 Ga0495631_0061981_625_1584 318
929 3300046518 Ga0495631_0107489 Ga0495631_0107489_22_981 318
930 3300046519 Ga0495632_0006704 Ga0495632_0006704_664_1620 318
931 3300046519 Ga0495632_0012977 Ga0495632_0012977_675_1640 318
932 3300046519 Ga0495632_0013137 Ga0495632_0013137_610_1569 318
933 3300046519 Ga0495632_0037714 Ga0495632_0037714_496_1455 318
934 3300046519 Ga0495632_0071991 Ga0495632_0071991_184_1143 318
935 3300046519 Ga0495632_0077674 Ga0495632_0077674_516_1475 318
936 3300046519 Ga0495632_0118313 Ga0495632_0118313_110_1069 318
937 3300046520 Ga0495637_0003308 Ga0495637_0003308_6994_7953 318
938 3300046520 Ga0495637_0007187 Ga0495637_0007187_3165_4130 318
939 3300046520 Ga0495637_0009513 Ga0495637_0009513_659_1618 318
940 3300046520 Ga0495637_0020579 Ga0495637_0020579_1480_2436 318
941 3300046520 Ga0495637_0039255 Ga0495637_0039255_975_1934 318
942 3300046520 Ga0495637_0044102 Ga0495637_0044102_298_1257 318
943 3300046520 Ga0495637_0049744 Ga0495637_0049744_194_1150 318
944 3300046520 Ga0495637_0052071 Ga0495637_0052071_169_1125 318
945 3300046522 Ga0495643_0013131 Ga0495643_0013131_3978_4937 318
946 3300046522 Ga0495643_0044163 Ga0495643_0044163_820_1779 318
947 3300046522 Ga0495643_0085971 Ga0495643_0085971_10_966 318
948 3300046522 Ga0495643_0166499 Ga0495643_0166499_31_990 318
949 3300046523 Ga0495644_0006231 Ga0495644_0006231_612_1571 318
950 3300046523 Ga0495644_0026504 Ga0495644_0026504_625_1584 318
951 3300046523 Ga0495644_0038103 Ga0495644_0038103_328_1287 318
952 3300046524 Ga0495648_0006371 Ga0495648_0006371_6698_7654 318
953 3300046524 Ga0495648_0027715 Ga0495648_0027715_610_1569 318
954 3300046524 Ga0495648_0053694 Ga0495648_0053694_923_1888 318
955 3300046524 Ga0495648_0100133 Ga0495648_0100133_150_1106 318
956 3300046526 Ga0495666_0012934 Ga0495666_0012934_2738_3697 318
957 3300046526 Ga0495666_0039955 Ga0495666_0039955_791_1750 318
958 3300046528 Ga0495642_0000097 Ga0495642_0000097_8709_9668 318
959 3300046528 Ga0495642_0001859 Ga0495642_0001859_1150_2106 318
960 3300046530 Ga0495654_0005010 Ga0495654_0005010_6068_7033 318
961 3300046530 Ga0495654_0006722 Ga0495654_0006722_5003_5962 318
962 3300046530 Ga0495654_0012957 Ga0495654_0012957_3115_4074 318
963 3300046530 Ga0495654_0015256 Ga0495654_0015256_545_1504 318
964 3300046530 Ga0495654_0027538 Ga0495654_0027538_1274_2239 318
965 3300046530 Ga0495654_0029347 Ga0495654_0029347_618_1574 318
966 3300046530 Ga0495654_0042593 Ga0495654_0042593_543_1502 318
967 3300046530 Ga0495654_0045971 Ga0495654_0045971_607_1566 318
968 3300046530 Ga0495654_0055987 Ga0495654_0055987_430_1389 318
969 3300046530 Ga0495654_0063832 Ga0495654_0063832_643_1599 318
970 3300046530 Ga0495654_0124592 Ga0495654_0124592_136_1095 318
971 3300046535 Ga0495586_0060315 Ga0495586_0060315_251_1210 318
972 3300046536 Ga0495587_0034356 Ga0495587_0034356_1337_2296 318
973 3300046538 Ga0495609_0004218 Ga0495609_0004218_5752_6708 318
974 3300046538 Ga0495609_0055546 Ga0495609_0055546_142_1107 318
975 3300046538 Ga0495609_0070513 Ga0495609_0070513_564_1523 318
976 3300046542 Ga0495597_0016962 Ga0495597_0016962_1814_2770 318
977 3300046542 Ga0495597_0062218 Ga0495597_0062218_272_1228 318
978 3300046557 Ga0495622_0012691 Ga0495622_0012691_1972_2928 318
979 3300046557 Ga0495622_0027676 Ga0495622_0027676_1055_2014 318
980 3300046557 Ga0495622_0039371 Ga0495622_0039371_476_1432 318
981 3300046558 Ga0495633_0050809 Ga0495633_0050809_460_1416 318
982 3300046615 Ga0495656_0008233 Ga0495656_0008233_78_1034 318
983 3300046615 Ga0495656_0090793 Ga0495656_0090793_131_1090 318
984 3300046616 Ga0495668_0004245 Ga0495668_0004245_8687_9646 318
985 3300046616 Ga0495668_0026574 Ga0495668_0026574_315_1274 318
986 3300046616 Ga0495668_0090575 Ga0495668_0090575_491_1447 318
987 3300046642 Ga0495634_0211204 Ga0495634_0211204_37_996 318
988 3300046648 Ga0495611_0000934 Ga0495611_0000934_14512_15477 318
989 3300046660 Ga0495625_0009777 Ga0495625_0009777_6411_7370 318
990 3300046660 Ga0495625_0014823 Ga0495625_0014823_1025_1990 318
991 3300046660 Ga0495625_0031221 Ga0495625_0031221_2963_3919 318
992 3300046660 Ga0495625_0077707 Ga0495625_0077707_716_1672 318
993 3300046660 Ga0495625_0079533 Ga0495625_0079533_575_1540 318
994 3300046660 Ga0495625_0118193 Ga0495625_0118193_222_1181 318
995 3300046660 Ga0495625_0166964 Ga0495625_0166964_90_1046 318
996 3300046663 Ga0495635_0005514 Ga0495635_0005514_913_1872 318
997 3300046664 Ga0495659_0013279 Ga0495659_0013279_1456_2412 318
998 3300046665 Ga0495661_0081571 Ga0495661_0081571_10_966 318
999 3300046665 Ga0495661_0088921 Ga0495661_0088921_19_978 318
1000 3300046674 Ga0495588_0001397 Ga0495588_0001397_7045_8001 318
1001 3300046675 Ga0495657_0093451 Ga0495657_0093451_787_1746 318
1002 3300046679 Ga0495623_0060098 Ga0495623_0060098_595_1554 318
1003 3300046680 Ga0495646_0048954 Ga0495646_0048954_973_1932 318
1004 3300046684 Ga0495669_0012665 Ga0495669_0012665_1865_2821 318
1005 3300046689 Ga0495613_0063638 Ga0495613_0063638_887_1846 318
1006 3300046691 Ga0495670_0048843 Ga0495670_0048843_697_1659 318
1007 3300046691 Ga0495670_0070265 Ga0495670_0070265_184_1143 318
1008 3300046691 Ga0495670_0070579 Ga0495670_0070579_167_1123 318
1009 3300046691 Ga0495670_0091929 Ga0495670_0091929_277_1233 318
1010 3300046692 Ga0495671_0075286 Ga0495671_0075286_89_1048 318
1011 3300046692 Ga0495671_0077677 Ga0495671_0077677_11_970 318
1012 3300046692 Ga0495671_0131644 Ga0495671_0131644_51_1010 318
1013 3300046692 Ga0495671_0135458 Ga0495671_0135458_58_1017 318
1014 3300046694 Ga0495649_0012226 Ga0495649_0012226_1087_2052 318
1015 3300046694 Ga0495649_0016114 Ga0495649_0016114_2939_3898 318
1016 3300046694 Ga0495649_0023293 Ga0495649_0023293_607_1566 318
1017 3300046694 Ga0495649_0080939 Ga0495649_0080939_535_1494 318
1018 3300046694 Ga0495649_0139555 Ga0495649_0139555_76_1032 318
1019 3300046794 Ga0495589_0007586 Ga0495589_0007586_412_1371 318
1020 3300046809 Ga0495600_0054749 Ga0495600_0054749_1396_2355 318
1021 3300046809 Ga0495600_0102968 Ga0495600_0102968_375_1334 318
1022 3300046810 Ga0495660_0012657 Ga0495660_0012657_565_1530 318
1023 3300046810 Ga0495660_0017631 Ga0495660_0017631_259_1224 318
1024 3300046810 Ga0495660_0023858 Ga0495660_0023858_657_1616 318
1025 3300046810 Ga0495660_0036400 Ga0495660_0036400_1000_1965 318
1026 3300046810 Ga0495660_0036679 Ga0495660_0036679_647_1603 318
1027 3300046810 Ga0495660_0065774 Ga0495660_0065774_292_1248 318
1028 3300046810 Ga0495660_0070394 Ga0495660_0070394_149_1114 318
1029 3300046810 Ga0495660_0074058 Ga0495660_0074058_498_1457 318
1030 3300047315 Ga0495581_0034122 Ga0495581_0034122_1322_2281 318
1031 3300047317 Ga0495604_0015007 Ga0495604_0015007_664_1623 318
1032 3300047317 Ga0495604_0122428 Ga0495604_0122428_110_1069 318
1033 3300047320 Ga0495672_0010049 Ga0495672_0010049_2488_3453 318
1034 3300047320 Ga0495672_0010488 Ga0495672_0010488_5358_6317 318
1035 3300047320 Ga0495672_0017369 Ga0495672_0017369_3084_4043 318
1036 3300047320 Ga0495672_0039094 Ga0495672_0039094_688_1644 318
1037 3300047320 Ga0495672_0087989 Ga0495672_0087989_626_1585 318
1038 3300047320 Ga0495672_0093579 Ga0495672_0093579_366_1325 318
1039 3300047320 Ga0495672_0093653 Ga0495672_0093653_642_1601 318
1040 3300047320 Ga0495672_0101790 Ga0495672_0101790_554_1513 318
1041 3300047320 Ga0495672_0149530 Ga0495672_0149530_103_1062 318
1042 3300047320 Ga0495672_0151469 Ga0495672_0151469_182_1138 318
1043 3300047321 Ga0495676_0019756 Ga0495676_0019756_1006_1971 318
1044 3300047322 Ga0495680_0000389 Ga0495680_0000389_8724_9683 318
1045 3300047322 Ga0495680_0132019 Ga0495680_0132019_543_1502 318
1046 3300047323 Ga0495683_0004737 Ga0495683_0004737_6080_7039 318
1047 3300047323 Ga0495683_0005086 Ga0495683_0005086_5751_6707 318
1048 3300047323 Ga0495683_0017386 Ga0495683_0017386_333_1289 318
1049 3300047323 Ga0495683_0022429 Ga0495683_0022429_1688_2647 318
1050 3300047323 Ga0495683_0037153 Ga0495683_0037153_544_1503 318
1051 3300047323 Ga0495683_0118939 Ga0495683_0118939_113_1072 318
1052 3300047323 Ga0495683_0121135 Ga0495683_0121135_52_1017 318
1053 3300047323 Ga0495683_0144895 Ga0495683_0144895_78_1043 318
1054 3300047443 Ga0495687_017430 Ga0495687_017430_529_1491 318
1055 3300047443 Ga0495687_036841 Ga0495687_036841_554_1513 318
1056 3300047444 Ga0495675_0001992 Ga0495675_0001992_11021_11980 318
1057 3300047445 Ga0495677_0004953 Ga0495677_0004953_2878_3834 318
1058 3300047446 Ga0495679_019678 Ga0495679_019678_1134_2099 318
1059 3300047446 Ga0495679_021420 Ga0495679_021420_575_1531 318
1060 3300047447 Ga0495685_036695 Ga0495685_036695_41_997 318
1061 3300047469 Ga0495673_0005752 Ga0495673_0005752_724_1680 318
1062 3300047469 Ga0495673_0005888 Ga0495673_0005888_635_1591 318
1063 3300047469 Ga0495673_0011917 Ga0495673_0011917_3077_4036 318
1064 3300047469 Ga0495673_0022950 Ga0495673_0022950_496_1452 318
1065 3300047469 Ga0495673_0042216 Ga0495673_0042216_341_1306 318
1066 3300047469 Ga0495673_0050886 Ga0495673_0050886_325_1284 318
1067 3300047470 Ga0495681_0005006 Ga0495681_0005006_1352_2317 318
1068 3300047470 Ga0495681_0006277 Ga0495681_0006277_5707_6663 318
1069 3300047470 Ga0495681_0007132 Ga0495681_0007132_545_1504 318
1070 3300047470 Ga0495681_0007434 Ga0495681_0007434_5681_6637 318
1071 3300047470 Ga0495681_0011304 Ga0495681_0011304_644_1603 318
1072 3300047470 Ga0495681_0026422 Ga0495681_0026422_1224_2183 318
1073 3300047470 Ga0495681_0035133 Ga0495681_0035133_38_997 318
1074 3300047470 Ga0495681_0059790 Ga0495681_0059790_618_1577 318
1075 3300047470 Ga0495681_0061499 Ga0495681_0061499_587_1546 318
1076 3300047470 Ga0495681_0104002 Ga0495681_0104002_175_1131 318
1077 3300047471 Ga0495684_0111655 Ga0495684_0111655_377_1336 318
1078 3300047472 Ga0495686_0005865 Ga0495686_0005865_8403_9368 318
1079 3300047472 Ga0495686_0072055 Ga0495686_0072055_523_1482 318
1080 3300047673 Ga0495593_0045550 Ga0495593_0045550_757_1716 318
1081 3300048089 Ga0495614_0047085 Ga0495614_0047085_377_1333 318
1082 3300048091 Ga0495626_0001227 Ga0495626_0001227_13571_14530 318
1083 3300048091 Ga0495626_0005367 Ga0495626_0005367_2773_3729 318
1084 3300048091 Ga0495626_0005402 Ga0495626_0005402_5786_6751 318
1085 3300048091 Ga0495626_0005494 Ga0495626_0005494_6075_7040 318
1086 3300048091 Ga0495626_0011405 Ga0495626_0011405_3132_4091 318
1087 3300048091 Ga0495626_0021571 Ga0495626_0021571_589_1548 318
1088 3300048908 Ga0496105_0209384 Ga0496105_0209384_151_1107 318
1089 3300048913 Ga0496110_0052260 Ga0496110_0052260_2583_3539 318
1090 3300048913 Ga0496110_0278104 Ga0496110_0278104_304_1263 318
1091 3300048919 Ga0496116_0000126 Ga0496116_0000126_150574_151530 318
1092 3300048919 Ga0496116_0002028 Ga0496116_0002028_14582_15547 318
1093 3300048920 Ga0496117_0003126 Ga0496117_0003126_5341_6297 318
1094 3300048921 Ga0496118_0041417 Ga0496118_0041417_2117_3076 318
1095 3300048924 Ga0496121_0000142 Ga0496121_0000142_150237_151193 318
1096 3300048925 Ga0496122_0047710 Ga0496122_0047710_2099_3055 318
1097 3300048926 Ga0496123_0042255 Ga0496123_0042255_1275_2231 318
1098 3300048927 Ga0496124_0124989 Ga0496124_0124989_495_1451 318
1099 3300048927 Ga0496124_0158616 Ga0496124_0158616_748_1713 318
1100 3300048928 Ga0496125_0090275 Ga0496125_0090275_820_1776 318
1101 3300048928 Ga0496125_0092749 Ga0496125_0092749_599_1555 318
1102 3300049459 Ga0495678_004719 Ga0495678_004719_6143_7108 318
1103 3300049459 Ga0495678_008542 Ga0495678_008542_3553_4509 318
1104 3300049459 Ga0495678_017480 Ga0495678_017480_625_1584 318
1105 3300049459 Ga0495678_018063 Ga0495678_018063_1685_2644 318
1106 3300049459 Ga0495678_039396 Ga0495678_039396_353_1312 318
1107 3300049460 Ga0495682_0000860 Ga0495682_0000860_6169_7134 318
1108 3300049460 Ga0495682_0004502 Ga0495682_0004502_1975_2931 318
1109 3300049758 Ga0501241_000766 Ga0501241_000766_5278_6243 318
1110 3300050491 nmdc:mga00v17_112753_c1 nmdc:mga00v17_112753_c1_344_1303 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17188

MucB_RseB_C

MucB/RseB C-terminal domain

210

311

0.96

PF03888

MucB_RseB

MucB/RseB N-terminal domain

23

195

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6in9-assembly1.cif.gz_A crystal structure of mucb in complex with muca(peri) 0.9317 24 315
6jau-assembly1.cif.gz_A the complex structure of pseudomonas aeruginosa muca/mucb. 0.9299 23 315
6in9-assembly1.cif.gz_A crystal structure of mucb in complex with muca(peri) 0.9251 24 315
6jau-assembly1.cif.gz_A the complex structure of pseudomonas aeruginosa muca/mucb. 0.9236 23 315
6in9-assembly2.cif.gz_B crystal structure of mucb in complex with muca(peri) 0.9172 23 315
ID Description Score Start End Superfamily
2p4bB02 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;MucB/RseB, C-terminal domain 0.8916 212 312 3.30.200.100
2p4bB02 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;MucB/RseB, C-terminal domain 0.8745 212 312 3.30.200.100
2v43A01 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.8146 24 187 2.50.20.10
2p4bB01 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7997 28 180 2.50.20.10
2p4bB01 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7536 28 180 2.50.20.10
ID Description Score Start End GO Terms
AF-A0A3M4ABD5-F1-model_v4 MucB/RseB C-terminal domain-containing protein 0.96 216 318 GO:0030288
GO:0032885
GO:0045152
AF-V4QEU7-F1-model_v4 Sigma factor AlgU regulatory protein MucB 0.9477 30 314 GO:0030288
GO:0032885
GO:0045152
AF-A0A2V0QCQ3-F1-model_v4 Negative regulator of sigma E activity 0.9354 128 318 GO:0030288
GO:0032885
GO:0045152
AF-S6AMD7-F1-model_v4 Sigma-22 factor regulatory protein MucB 0.931 67 318 GO:0030288
GO:0032885
GO:0045152
AF-A0A3M2ZNL8-F1-model_v4 Sigma factor algU regulatory protein MucB 0.9263 228 318 GO:0030288
GO:0032885
GO:0045152

Feature Viewer

pLDDT pTM Quality
84.14 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map