F490164

General Info

Members Datasets Scaffolds Average Seq Length
1106 831 534 308

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2889790730|2889794252
Length 305
Sequence ISISKLSKVYDSGLAALQEVDLDIRNGEILALLGPNGAGKTTLISIVCGIVNPTNGKVSVQGHDIISEFRAARELIGLVPQELHVETFETVWDTVSYSRGLFGKKPKPELIEQLLRDLTLWDKKDNKILELSGGMKRRVMIAKALAHEPKILFLDEPTAGVDVELRKDMWQLVRRLREEGGVTIILTTHYIEEAEEIADRVGVINKGRLILVEEKKELMRKLGKKQLTLDLNDVLETLPEALGRYDLDLENGGERLVYRYDTQAERTGIGSLLADLNRAGISIKDLDTEQSSLEDIFVTLVEETR

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
16 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
17 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
18 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
23 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
31 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
32 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
33 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
34 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
35 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
36 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
37 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
38 2516143018 Ensifer sp. BR816 Isolate Nodule
39 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
40 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
41 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
42 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
43 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
44 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
45 2519899620 Rhizobium sp. Pop5 Isolate Nodule
46 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
47 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
48 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
49 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
50 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
54 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
55 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
56 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
57 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
58 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
59 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
60 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
61 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
62 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
63 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
64 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
65 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
66 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
67 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
68 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
69 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
70 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
71 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
72 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
73 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
74 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
75 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
76 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
77 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
78 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
79 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
80 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
81 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
82 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
83 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
84 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
85 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
86 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
87 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
88 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
89 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
90 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
91 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
92 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
93 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
94 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
95 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
96 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
97 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
98 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
99 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
100 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
101 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
102 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
103 2643221557 Ensifer sp. Root558 Isolate Unclassified
104 2643221558 Rhizobium sp. Root149 Isolate Unclassified
105 2643221568 Rhizobium sp. Root564 Isolate Unclassified
106 2643221582 Rhizobium sp. Root651 Isolate Unclassified
107 2643221599 Rhizobium sp. Root708 Isolate Unclassified
108 2643221607 Rhizobium sp. Root73 Isolate Unclassified
109 2643221610 Ensifer sp. Root74 Isolate Unclassified
110 2643221618 Ensifer sp. Root231 Isolate Unclassified
111 2643221626 Ensifer sp. Root31 Isolate Unclassified
112 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
113 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
114 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
115 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
116 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
117 2643221655 Ensifer sp. Root1252 Isolate Unclassified
118 2643221659 Ensifer sp. Root127 Isolate Unclassified
119 2643221668 Ensifer sp. Root423 Isolate Unclassified
120 2643221675 Ensifer sp. Root1298 Isolate Unclassified
121 2643221680 Ensifer sp. Root1312 Isolate Unclassified
122 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
123 2643221688 Rhizobium sp. Root482 Isolate Unclassified
124 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
125 2643221693 Rhizobium sp. Root491 Isolate Unclassified
126 2643221698 Ensifer sp. Root142 Isolate Unclassified
127 2643221712 Ensifer sp. Root258 Isolate Unclassified
128 2643221718 Rhizobium sp. Root268 Isolate Unclassified
129 2643221719 Rhizobium sp. Root274 Isolate Unclassified
130 2643221723 Ensifer sp. Root278 Isolate Unclassified
131 2643221726 Ensifer sp. Root954 Isolate Unclassified
132 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
133 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
134 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
135 2718217882 Rhizobium sp. N741 Isolate Nodule
136 2718217927 Rhizobium sp. N324 Isolate Nodule
137 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
138 2718218009 Rhizobium sp. N561 Isolate Nodule
139 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
140 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
141 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
142 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
143 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
144 2718218363 Rhizobium sp. N113 Isolate Nodule
145 2718218365 Rhizobium sp. N731 Isolate Nodule
146 2718218366 Rhizobium sp. N621 Isolate Nodule
147 2718218423 Rhizobium sp. N941 Isolate Nodule
148 2721755514 Rhizobium sp. N6212 Isolate Nodule
149 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
150 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
151 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
152 2721755809 Rhizobium sp. N541 Isolate Nodule
153 2721755810 Rhizobium sp. N871 Isolate Nodule
154 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
155 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
156 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
157 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
158 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
159 2728369365 Rhizobium sp. N1341 Isolate Nodule
160 2728369397 Rhizobium sp. N1314 Isolate Nodule
161 2738541293 Rhizobium sp. GV031 Isolate Unclassified
162 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
163 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
164 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
165 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
166 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
167 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
168 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
169 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
170 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
171 2791355256 Rhizobium sp. M10 Isolate Nodule
172 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
173 2791355260 Rhizobium sp. L9 Isolate Nodule
174 2791355261 Rhizobium sp. J15 Isolate Nodule
175 2791355262 Rhizobium sp. M1 Isolate Nodule
176 2791355263 Rhizobium chutanense C5 Isolate Nodule
177 2791355264 Rhizobium sp. S9 Isolate Nodule
178 2791355265 Rhizobium sp. H4 Isolate Nodule
179 2791355266 Rhizobium sp. L43 Isolate Nodule
180 2791355267 Rhizobium sp. L18 Isolate Nodule
181 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
182 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
183 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
184 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
185 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
186 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
187 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
188 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
189 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
190 2802429633 Rhizobium anhuiense J3 Isolate Nodule
191 2802429634 Rhizobium anhuiense S10 Isolate Nodule
192 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
193 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
194 2802429637 Rhizobium anhuiense C15 Isolate Nodule
195 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
196 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
197 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
198 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
199 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
200 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
201 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
202 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
203 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
204 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
205 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
206 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
207 2838048938 Rhizobium pisi 27/80 Isolate Nodule
208 2838061910 Rhizobium phaseoli L15 Isolate Nodule
209 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
210 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
211 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
212 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
213 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
214 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
215 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
216 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
217 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
218 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
219 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
220 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
221 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
222 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
223 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
224 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
225 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
226 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
227 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
228 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
229 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
230 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
231 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
232 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
233 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
234 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
235 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
236 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
237 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
238 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
239 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
240 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
241 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
242 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
243 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
244 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
245 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
246 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
247 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
248 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
249 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
250 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
251 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
252 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
253 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
254 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
255 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
256 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
257 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
258 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
259 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
260 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
261 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
262 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
263 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
264 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
265 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
266 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
267 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
268 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
269 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
270 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
271 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
272 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
273 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
274 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
275 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
276 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
277 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
278 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
279 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
280 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
281 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
282 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
283 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
284 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
285 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
286 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
287 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
288 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
289 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
290 2844163670 Ensifer sp. 1H6 Isolate Unclassified
291 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
292 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
293 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
294 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
295 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
296 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
297 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
298 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
299 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
300 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
301 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
302 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
303 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
304 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
305 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
306 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
307 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
308 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
309 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
310 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
311 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
312 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
313 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
314 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
315 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
316 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
317 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
318 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
319 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
320 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
321 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
322 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
323 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
324 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
325 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
326 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
327 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
328 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
329 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
330 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
331 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
332 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
333 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
334 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
335 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
336 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
337 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
338 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
339 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
340 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
341 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
342 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
343 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
344 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
345 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
346 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
347 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
348 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
349 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
350 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
351 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
352 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
353 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
354 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
355 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
356 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
357 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
358 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
359 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
360 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
361 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
362 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
363 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
364 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
365 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
366 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
367 2933599457 Rhizobium phaseoli M3 Isolate Nodule
368 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
369 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
370 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
371 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
372 2936381700 Rhizobium chutanense C16 Isolate Unclassified
373 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
374 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
375 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
376 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
377 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
378 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
379 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
380 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
381 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
382 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
383 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
384 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
385 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
386 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
387 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
388 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
389 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
390 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
391 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
392 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
393 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
394 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
395 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
396 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
397 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
398 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
399 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
400 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
401 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
402 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
403 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
404 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
405 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
406 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
407 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
408 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
409 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
410 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
411 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
412 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
413 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
414 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
415 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
416 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
417 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
418 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
419 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
420 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
421 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
422 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
423 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
424 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
425 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
426 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
427 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
428 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
429 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
430 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
431 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
432 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
433 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
434 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
435 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
436 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
437 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
438 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
439 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
440 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
441 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
442 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
443 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
444 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
445 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
446 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
447 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
448 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
449 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
450 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
451 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
452 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
453 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
454 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
455 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
456 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
457 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
458 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
459 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
460 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
461 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
462 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
463 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
464 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
465 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
466 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
467 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
468 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
469 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
470 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
471 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
472 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
473 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
474 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
475 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
476 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
477 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
478 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
479 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
480 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
481 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
482 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
483 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
484 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
485 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
486 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
487 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
488 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
489 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
490 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
491 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
492 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
493 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
494 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
495 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
496 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
497 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
498 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
499 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
500 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
501 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
502 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
503 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
504 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
505 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
506 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
507 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
508 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
509 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
510 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
511 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
512 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
513 2996887358 Rhizobium sp. R711 Isolate Nodule
514 2996893221 Rhizobium sp. R635 Isolate Nodule
515 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
516 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
517 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
518 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
519 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
520 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
521 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
522 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
523 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
524 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
525 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
526 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
527 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
528 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
529 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
530 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
531 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
532 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
533 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
534 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
535 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
536 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
537 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
538 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
539 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
540 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
541 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
542 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
543 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
544 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
545 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
546 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
547 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
548 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
549 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
550 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
551 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
552 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
553 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
554 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
555 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
556 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
557 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
558 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
559 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
560 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
561 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
562 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
563 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
564 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
565 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
566 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
567 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
568 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
569 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
570 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
571 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
572 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
573 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
574 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
575 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
576 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
577 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
578 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
579 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
580 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
581 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
582 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
583 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
584 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
585 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
586 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
587 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
588 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
589 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
590 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
591 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
592 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
593 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
594 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
595 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
596 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
597 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
598 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
599 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
600 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
601 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
602 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
603 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
604 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
605 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
606 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
607 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
608 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
609 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
627 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
628 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
630 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
631 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
632 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
633 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
636 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
637 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
638 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
639 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
640 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
641 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
642 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
643 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
644 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
645 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
646 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
647 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
648 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
649 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
650 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
651 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
652 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
653 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
654 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
655 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
656 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
657 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
658 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
659 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
660 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
661 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
662 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
663 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
664 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
665 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
666 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
667 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
668 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
669 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
670 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
671 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
672 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
673 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
674 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
675 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
676 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
677 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
678 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
679 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
680 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
681 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
682 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
683 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
684 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
685 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
686 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
687 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
688 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
689 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
690 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
691 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
692 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
693 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
694 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
695 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
696 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
697 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
698 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
699 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
700 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
701 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
702 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
703 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
704 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
705 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
706 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
707 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
708 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
709 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
710 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
711 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
712 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
713 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
714 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
715 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
716 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
717 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
718 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
719 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
720 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
721 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
722 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
723 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
724 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
725 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
726 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
727 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
728 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
729 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
730 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
731 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
732 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
733 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
734 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
735 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
736 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
737 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
738 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
739 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
740 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
741 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
742 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
743 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
744 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
745 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
746 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
747 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
748 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
749 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
750 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
751 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
752 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
753 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
754 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
755 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
756 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
757 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
758 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
759 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
760 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
761 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
762 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
763 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
764 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
765 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
766 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
767 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
768 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
769 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
770 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
771 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
772 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
773 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
774 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
775 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
776 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
777 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
778 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
779 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
780 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
781 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
782 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
783 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
784 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
785 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
786 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
787 8005258706 Rhizobium sp. R693 Isolate Nodule
788 8005275841 Rhizobium sp. N4311 Isolate Nodule
789 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
790 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
791 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
792 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
793 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
794 8005321885 Rhizobium sp. R72 Isolate Nodule
795 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
796 8005382845 Rhizobium sp. R634 Isolate Nodule
797 8005395548 Rhizobium sp. R339 Isolate Nodule
798 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
799 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
800 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
801 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
802 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
803 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
804 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
805 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
806 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
807 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
808 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
809 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
810 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
811 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
812 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
813 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
814 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
815 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
816 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
817 8018176218 Rhizobium sp. N122 Isolate Nodule
818 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
819 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
820 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
821 8024501048 Rhizobium sp. H4 Isolate Nodule
822 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
823 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
824 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
825 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
826 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
827 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
828 8056382006 Rhizobium croatiense 13T Isolate Nodule
829 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
830 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
831 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.92
Metatranscriptomes 0.36
Isolates 51.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 18.17
Nodule 39.6
Rhizoplane 2.35
Rhizosphere 22.24
Stem 0
Stem Tuber 0
Unclassified 17.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000001 3300002704 Bacteria 354543
2 JGI25156J39149_1000001 3300002705 Bacteria 354557
3 JGI25162J39368_1000209 3300002737 Bacteria 61889
4 JGI25162J39368_1000245 3300002737 Bacteria 54142
5 JGI25154J39366_1000011 3300002738 Bacteria 296007
6 JGI25158J39367_1000389 3300002739 Bacteria 9240
7 JGI25158J39367_1000892 3300002739 Bacteria 5632
8 JGI25157J39369_1000030 3300002741 Bacteria 146112
9 JGI25150J39212_1000160 3300002774 Bacteria 38064
10 JGI25159J45721_1000082 3300002987 Bacteria 45028
11 JGI25159J45721_1000519 3300002987 Bacteria 17645
12 JGI25159J45721_1002718 3300002987 Bacteria 6567
13 JGI25151J46595_10000083 3300003187 Bacteria 130658
14 JGI25151J46595_10000603 3300003187 Bacteria 31677
15 JGI25151J46595_10008521 3300003187 Bacteria 4926
16 JGI25151J46595_10055710 3300003187 Bacteria 1301
17 JGI25151J46595_10061128 3300003187 Bacteria 1200
18 JGI25165J46597_1000302 3300003214 Bacteria 61889
19 JGI25165J46597_1003012 3300003214 Bacteria 4624
20 JGI25153J46596_10000377 3300003215 Bacteria 30499
21 JGI25153J46596_10005742 3300003215 Bacteria 6467
22 JGI25153J46596_10006671 3300003215 Bacteria 5805
23 JGI25153J46596_10032457 3300003215 Bacteria 1741
24 rootH1_10168964 3300003323 Bacteria 3127
25 JGI25160J50197_1000010 3300003354 Bacteria 279365
26 JGI25160J50197_1000011 3300003354 Bacteria 275577
27 JGI25160J50197_1001097 3300003354 Bacteria 13825
28 JGI25160J50197_1011066 3300003354 Bacteria 3222
29 JGI25161J50226_1000006 3300003374 Bacteria 279563
30 JGI25161J50226_1000135 3300003374 Bacteria 51243
31 JGI25161J50226_1000386 3300003374 Bacteria 22222
32 JGI25161J50226_1001023 3300003374 Bacteria 9734
33 Ga0055526_1000966 3300003771 Bacteria 21268
34 Ga0055526_1000998 3300003771 Bacteria 20772
35 Ga0055526_1003879 3300003771 Bacteria 9273
36 Ga0055526_1004396 3300003771 Bacteria 8484
37 Ga0055524_1001285 3300003775 Bacteria 14728
38 Ga0055524_1001423 3300003775 Bacteria 13756
39 Ga0055524_1005600 3300003775 Bacteria 5578
40 Ga0055524_1009738 3300003775 Bacteria 3881
41 Ga0055524_1011321 3300003775 Bacteria 3497
42 Ga0055524_1013582 3300003775 Bacteria 3066
43 Ga0055536_1000683 3300003781 Bacteria 22791
44 Ga0055536_1006078 3300003781 Bacteria 5723
45 Ga0055528_1000057 3300003790 Bacteria 89062
46 Ga0055528_1000676 3300003790 Bacteria 24723
47 Ga0055528_1001698 3300003790 Bacteria 12832
48 Ga0055528_1017773 3300003790 Bacteria 2446
49 Ga0055528_1024612 3300003790 Bacteria 1799
50 Ga0055528_1026737 3300003790 Bacteria 1647
51 Ga0055530_10014446 3300003791 Bacteria 2629
52 Ga0055540_1000354 3300003792 Bacteria 38972
53 Ga0055540_1003917 3300003792 Bacteria 6974
54 Ga0055531_10003139 3300003794 Bacteria 10647
55 Ga0055531_10007227 3300003794 Bacteria 6106
56 Ga0058692_1001385 3300003856 Bacteria 8966
57 Ga0058692_1001689 3300003856 Bacteria 7913
58 Ga0058692_1005892 3300003856 Bacteria 3428
59 Ga0055543_1000210 3300004625 Bacteria 47374
60 Ga0055543_1000219 3300004625 Bacteria 45978
61 Ga0055543_1000281 3300004625 Bacteria 37377
62 Ga0055543_1006052 3300004625 Bacteria 2988
63 Ga0065165_1000018 3300005262 Bacteria 275082
64 Ga0065165_1002907 3300005262 Bacteria 13126
65 Ga0065165_1011929 3300005262 Bacteria 3576
66 Ga0065165_1027954 3300005262 Bacteria 1829
67 Ga0070670_100002254 3300005331 Bacteria 15856
68 Ga0068868_100002744 3300005338 Bacteria 12203
69 Ga0070660_100123104 3300005339 Bacteria 2071
70 Ga0070659_100005963 3300005366 Bacteria 8785
71 Ga0070663_100206256 3300005455 Bacteria 1537
72 Ga0070663_100526472 3300005455 Bacteria 985
73 Ga0070662_100036242 3300005457 Bacteria 3488
74 Ga0070679_100023720 3300005530 Bacteria 6011
75 Ga0070679_100091369 3300005530 Bacteria 3032
76 Ga0070665_100004423 3300005548 Bacteria 14764
77 Ga0070665_100316130 3300005548 Bacteria 1566
78 Ga0068855_100024084 3300005563 Bacteria 7286
79 Ga0068855_100462121 3300005563 Bacteria 1384
80 Ga0068856_100003012 3300005614 Bacteria 17248
81 Ga0068856_100269427 3300005614 Bacteria 1719
82 Ga0068852_100008346 3300005616 Bacteria 7628
83 Ga0075365_10000306 3300006038 Bacteria 17174
84 Ga0075365_10005301 3300006038 Bacteria 6936
85 Ga0075365_10024880 3300006038 Bacteria 3784
86 Ga0075365_10035632 3300006038 Bacteria 3221
87 Ga0075368_10014305 3300006042 Bacteria 2928
88 Ga0075368_10092563 3300006042 Bacteria 1237
89 Ga0075363_100018849 3300006048 Bacteria 3443
90 Ga0075364_10000062 3300006051 Bacteria 40697
91 Ga0075362_10002198 3300006177 Bacteria 6472
92 Ga0075362_10005192 3300006177 Bacteria 4746
93 Ga0075367_10001214 3300006178 Bacteria 10821
94 Ga0075367_10059374 3300006178 Bacteria 2277
95 Ga0075367_10143651 3300006178 Bacteria 1479
96 Ga0075369_10002498 3300006186 Bacteria 6565
97 Ga0075369_10021925 3300006186 Bacteria 2630
98 Ga0075369_10035069 3300006186 Bacteria 2131
99 Ga0075366_10055065 3300006195 Bacteria 2362
100 Ga0075366_10109239 3300006195 Bacteria 1663
101 Ga0075366_10178951 3300006195 Bacteria 1288
102 Ga0075370_10008899 3300006353 Bacteria 5186
103 Ga0068871_100001547 3300006358 Bacteria 15436
104 Ga0079104_1000022 3300006946 Bacteria 223522
105 Ga0079104_1005993 3300006946 Bacteria 4710
106 Ga0099826_10001252 3300006948 Bacteria 14874
107 Ga0105240_10000005 3300009093 Bacteria 702630
108 Ga0105240_10136586 3300009093 Bacteria 2936
109 Ga0105243_10007952 3300009148 Bacteria 8146
110 Ga0105243_10033768 3300009148 Bacteria 3957
111 Ga0105248_10522939 3300009177 Bacteria 1338
112 Ga0105237_10002054 3300009545 Bacteria 25563
113 Ga0105238_10016781 3300009551 Bacteria 7423
114 Ga0105238_10352693 3300009551 Bacteria 1460
115 Ga0123341_1000188 3300009765 Bacteria 31454
116 Ga0123342_1019153 3300009766 Bacteria 5291
117 Ga0157326_1003237 3300012513 Bacteria 1719
118 Ga0157373_10005452 3300013100 Bacteria 9550
119 Ga0157373_10016514 3300013100 Bacteria 5383
120 Ga0157371_10000240 3300013102 Bacteria 78391
121 Ga0157370_10000046 3300013104 Bacteria 125612
122 Ga0157370_10000322 3300013104 Bacteria 59997
123 Ga0157370_10245081 3300013104 Bacteria 1658
124 Ga0171463_1003 3300013249 Bacteria 695693
125 Ga0163162_10124933 3300013306 Bacteria 2678
126 Ga0163163_10189410 3300014325 Bacteria 2106
127 Ga0182007_10001390 3300015262 Bacteria 13015
128 Ga0183363_1076 3300015690 Bacteria 29735
129 Ga0214544_1003180 3300021320 Bacteria 34290
130 Ga0214542_1006037 3300021321 Bacteria 22467
131 Ga0214542_1016584 3300021321 Bacteria 7064
132 Ga0214543_1000011 3300021327 Bacteria 344093
133 Ga0214543_1005795 3300021327 Bacteria 22425
134 Ga0228711_1003475 3300022739 Bacteria 24453
135 Ga0228710_1003691 3300022740 Bacteria 24269
136 Ga0209435_100012 3300025206 Bacteria 401621
137 Ga0209436_100059 3300025208 Bacteria 60623
138 Ga0209436_103167 3300025208 Bacteria 4500
139 Ga0209437_100047 3300025233 Bacteria 405163
140 Ga0209437_100165 3300025233 Bacteria 145009
141 Ga0209437_102553 3300025233 Bacteria 3505
142 Ga0207425_1000024 3300025245 Bacteria 328978
143 Ga0207425_1002285 3300025245 Bacteria 6895
144 Ga0207425_1004847 3300025245 Bacteria 3946
145 Ga0209646_1000026 3300025246 Bacteria 401621
146 Ga0209026_1000014 3300025250 Bacteria 401621
147 Ga0209677_101200 3300025253 Bacteria 11790
148 Ga0209759_1000012 3300025256 Bacteria 401621
149 Ga0209129_1000069 3300025258 Bacteria 212790
150 Ga0209129_1000184 3300025258 Bacteria 87102
151 Ga0209129_1000376 3300025258 Bacteria 36225
152 Ga0209129_1001566 3300025258 Bacteria 12551
153 Ga0209129_1006080 3300025258 Bacteria 4034
154 Ga0209233_1000048 3300025261 Bacteria 453669
155 Ga0209233_1000069 3300025261 Bacteria 367639
156 Ga0209233_1000195 3300025261 Bacteria 125863
157 Ga0209673_1000013 3300025273 Bacteria 571633
158 Ga0209673_1000048 3300025273 Bacteria 287976
159 Ga0209673_1000296 3300025273 Bacteria 92350
160 Ga0209673_1000850 3300025273 Bacteria 39843
161 Ga0209673_1005236 3300025273 Bacteria 6605
162 Ga0209673_1005529 3300025273 Bacteria 6324
163 Ga0209673_1017286 3300025273 Bacteria 2662
164 Ga0209673_1017552 3300025273 Bacteria 2636
165 Ga0209673_1028720 3300025273 Bacteria 1784
166 Ga0209130_1000004 3300025284 Bacteria 633436
167 Ga0209130_1000021 3300025284 Bacteria 374278
168 Ga0209130_1000029 3300025284 Bacteria 323399
169 Ga0209676_1011502 3300025292 Bacteria 3561
170 Ga0209676_1013886 3300025292 Bacteria 3067
171 Ga0209025_1000050 3300025294 Bacteria 331531
172 Ga0209025_1000119 3300025294 Bacteria 210606
173 Ga0209025_1000166 3300025294 Bacteria 164692
174 Ga0209025_1000445 3300025294 Bacteria 81092
175 Ga0209025_1000843 3300025294 Bacteria 48547
176 Ga0209025_1001294 3300025294 Bacteria 34187
177 Ga0209025_1004960 3300025294 Bacteria 11144
178 Ga0209025_1014039 3300025294 Bacteria 4974
179 Ga0209025_1014255 3300025294 Bacteria 4910
180 Ga0209025_1031377 3300025294 Bacteria 2515
181 Ga0209025_1061613 3300025294 Bacteria 1399
182 Ga0209564_1000362 3300025295 Bacteria 84376
183 Ga0209564_1000501 3300025295 Bacteria 64474
184 Ga0209564_1000584 3300025295 Bacteria 57729
185 Ga0209564_1000920 3300025295 Bacteria 38309
186 Ga0209564_1011379 3300025295 Bacteria 3994
187 Ga0209564_1020744 3300025295 Bacteria 2394
188 Ga0209758_1000083 3300025297 Bacteria 257283
189 Ga0209758_1000155 3300025297 Bacteria 160455
190 Ga0209758_1000770 3300025297 Bacteria 46037
191 Ga0209758_1001392 3300025297 Bacteria 28724
192 Ga0209758_1001541 3300025297 Bacteria 26483
193 Ga0209758_1004667 3300025297 Bacteria 11205
194 Ga0209758_1031289 3300025297 Bacteria 2185
195 Ga0209758_1043080 3300025297 Bacteria 1667
196 Ga0209050_1002344 3300025298 Bacteria 16575
197 Ga0209050_1016881 3300025298 Bacteria 2951
198 Ga0209050_1018210 3300025298 Bacteria 2742
199 Ga0209256_1000194 3300025299 Bacteria 116709
200 Ga0209256_1000383 3300025299 Bacteria 70773
201 Ga0209256_1000588 3300025299 Bacteria 50690
202 Ga0209256_1001125 3300025299 Bacteria 30497
203 Ga0209256_1010263 3300025299 Bacteria 3951
204 Ga0209256_1013180 3300025299 Bacteria 3088
205 Ga0209256_1016860 3300025299 Bacteria 2461
206 Ga0209256_1027123 3300025299 Bacteria 1637
207 Ga0207426_1000003 3300025302 Bacteria 1063212
208 Ga0207426_1000010 3300025302 Bacteria 796003
209 Ga0207426_1000039 3300025302 Bacteria 439937
210 Ga0207426_1000074 3300025302 Bacteria 323399
211 Ga0207426_1004684 3300025302 Bacteria 6565
212 Ga0209051_1000611 3300025303 Bacteria 41422
213 Ga0209051_1000691 3300025303 Bacteria 37343
214 Ga0209051_1002092 3300025303 Bacteria 15051
215 Ga0209051_1004215 3300025303 Bacteria 8971
216 Ga0209051_1010363 3300025303 Bacteria 4718
217 Ga0209051_1011328 3300025303 Bacteria 4410
218 Ga0209051_1030892 3300025303 Bacteria 2071
219 Ga0209257_1002345 3300025304 Bacteria 19036
220 Ga0209257_1002801 3300025304 Bacteria 16394
221 Ga0209257_1007967 3300025304 Bacteria 6200
222 Ga0207656_10025339 3300025321 Bacteria 2407
223 Ga0207705_10002300 3300025909 Bacteria 14785
224 Ga0207705_10018354 3300025909 Bacteria 5003
225 Ga0207695_10000011 3300025913 Bacteria 910221
226 Ga0207671_10000241 3300025914 Bacteria 81847
227 Ga0207657_10010030 3300025919 Bacteria 9477
228 Ga0207657_10047528 3300025919 Bacteria 3751
229 Ga0207649_10018650 3300025920 Bacteria 3951
230 Ga0207652_10075520 3300025921 Bacteria 2937
231 Ga0207694_10007386 3300025924 Bacteria 8335
232 Ga0207650_10003509 3300025925 Bacteria 10768
233 Ga0207659_10149695 3300025926 Bacteria 1821
234 Ga0207644_10005615 3300025931 Bacteria 8170
235 Ga0207644_10167843 3300025931 Bacteria 1711
236 Ga0207706_10110741 3300025933 Bacteria 2415
237 Ga0207709_10072636 3300025935 Bacteria 2189
238 Ga0207711_10380397 3300025941 Bacteria 1310
239 Ga0207689_10041319 3300025942 Bacteria 3816
240 Ga0207679_10007394 3300025945 Bacteria 6963
241 Ga0207679_10056293 3300025945 Bacteria 2903
242 Ga0207667_10132884 3300025949 Bacteria 2563
243 Ga0207640_10068498 3300025981 Bacteria 2379
244 Ga0207677_10001645 3300026023 Bacteria 11837
245 Ga0207677_10009612 3300026023 Bacteria 5444
246 Ga0207678_10042481 3300026067 Bacteria 3937
247 Ga0207678_10131859 3300026067 Bacteria 2132
248 Ga0207702_10002981 3300026078 Bacteria 15760
249 Ga0209281_1000036 3300027111 Bacteria 369415
250 Ga0209281_1000047 3300027111 Bacteria 326514
251 Ga0209281_1000483 3300027111 Bacteria 55407
252 Ga0209281_1000663 3300027111 Bacteria 36448
253 Ga0209371_1000058 3300027312 Bacteria 237920
254 Ga0209371_1006281 3300027312 Bacteria 4440
255 Ga0209371_1013122 3300027312 Bacteria 2349
256 Ga0209282_1000189 3300027666 Bacteria 32962
257 Ga0209282_1007853 3300027666 Bacteria 6705
258 Ga0268266_10115715 3300028379 Bacteria 2381
259 Ga0268266_10196785 3300028379 Bacteria 1843
260 Ga0268266_10404076 3300028379 Bacteria 1292
261 Ga0268264_10059747 3300028381 Bacteria 3195
262 Ga0307515_10000023 3300028794 Bacteria 400846
263 Ga0307515_10015209 3300028794 Bacteria 14195
264 Ga0307515_10073060 3300028794 Bacteria 4617
265 Ga0268256_1000056 3300030500 Bacteria 231684
266 Ga0268256_1006303 3300030500 Bacteria 4440
267 Ga0307513_10007902 3300031456 Bacteria 13706
268 Ga0307513_10093984 3300031456 Bacteria 3045
269 Ga0307509_10000074 3300031507 Bacteria 140111
270 Ga0307408_100012769 3300031548 Bacteria 5570
271 Ga0307405_10081922 3300031731 Bacteria 2111
272 Ga0307410_10129823 3300031852 Bacteria 1850
273 Ga0307406_10021730 3300031901 Bacteria 3799
274 Ga0307406_10084389 3300031901 Bacteria 2121
275 Ga0307412_10000790 3300031911 Bacteria 18230
276 Ga0315914_1003371 3300031967 Bacteria 24290
277 Ga0307409_100240045 3300031995 Bacteria 1649
278 Ga0307416_100245995 3300032002 Bacteria 1737
279 Ga0315913_1001807 3300033430 Bacteria 24300
280 Ga0315915_1000701 3300033464 Bacteria 36541
281 Ga0316584_0236810 3300036712 Bacteria 1337
282 Ga0400483_271592 3300039062 Bacteria 3180
283 Ga0436363_0979243 3300039450 Bacteria 3088
284 Ga0439436_0004359 3300041404 Bacteria 4336
285 Ga0439436_0052738 3300041404 Bacteria 1147
286 Ga0439447_033566 3300041407 Bacteria 1279
287 Ga0439465_0011758 3300041413 Bacteria 2743
288 Ga0439465_0015833 3300041413 Bacteria 2352
289 Ga0451841_0793278 3300041498 Bacteria 1494
290 Ga0451847_0382210 3300041503 Bacteria 1725
291 Ga0451843_0071175 3300041509 Bacteria 2601
292 Ga0452268_35806 3300041907 Bacteria 1947
293 Ga0439449_0006685 3300042007 Bacteria 4404
294 Ga0439449_0029465 3300042007 Bacteria 2046
295 Ga0450906_006472 3300042145 Bacteria 2365
296 Ga0439434_0017060 3300042435 Bacteria 2172
297 Ga0466966_0037593 3300044684 Bacteria 3121
298 Ga0466966_0091819 3300044684 Bacteria 1884
299 Ga0466966_0093455 3300044684 Bacteria 1865
300 Ga0466963_0020054 3300044694 Bacteria 4201
301 Ga0466970_0000517 3300044765 Bacteria 19001
302 Ga0466959_0037880 3300045049 Bacteria 3564
303 Ga0466958_0065259 3300045836 Bacteria 2222
304 Ga0466967_0018889 3300045976 Bacteria 5528
305 Ga0466967_0060874 3300045976 Bacteria 3348
306 Ga0495592_0029394 3300046454 Bacteria 4162
307 Ga0495629_0066202 3300046459 Bacteria 2522
308 Ga0495638_0000453 3300046460 Bacteria 49159
309 Ga0495605_0002378 3300046474 Bacteria 11676
310 Ga0495662_0000738 3300046476 Bacteria 15658
311 Ga0495584_0182580 3300046491 Bacteria 1066
312 Ga0495585_0026540 3300046492 Bacteria 3309
313 Ga0495585_0168852 3300046492 Bacteria 1131
314 Ga0495583_0003907 3300046506 Bacteria 11034
315 Ga0495583_0009228 3300046506 Bacteria 5916
316 Ga0495606_0000896 3300046507 Bacteria 44373
317 Ga0495606_0013851 3300046507 Bacteria 6332
318 Ga0495606_0096727 3300046507 Bacteria 1805
319 Ga0495610_0001683 3300046512 Bacteria 19423
320 Ga0495610_0032325 3300046512 Bacteria 2719
321 Ga0495616_0013399 3300046513 Bacteria 4625
322 Ga0495616_0066835 3300046513 Bacteria 1749
323 Ga0495620_0038596 3300046515 Bacteria 2118
324 Ga0495631_0015517 3300046518 Bacteria 3647
325 Ga0495632_0020234 3300046519 Bacteria 3607
326 Ga0495643_0018990 3300046522 Bacteria 3981
327 Ga0495643_0052561 3300046522 Bacteria 2187
328 Ga0495648_0040559 3300046524 Bacteria 2951
329 Ga0495648_0075474 3300046524 Bacteria 1939
330 Ga0495654_0000090 3300046530 Bacteria 101947
331 Ga0495609_0046143 3300046538 Bacteria 1951
332 Ga0495668_0029254 3300046616 Bacteria 3113
333 Ga0495611_0008813 3300046648 Bacteria 4267
334 Ga0495625_0004833 3300046660 Bacteria 12583
335 Ga0495625_0031199 3300046660 Bacteria 3966
336 Ga0495625_0107263 3300046660 Bacteria 1912
337 Ga0495588_0007589 3300046674 Bacteria 4946
338 Ga0495588_0090827 3300046674 Bacteria 1600
339 Ga0495657_0037878 3300046675 Bacteria 3321
340 Ga0495670_0099239 3300046691 Bacteria 1498
341 Ga0495671_0010564 3300046692 Bacteria 5105
342 Ga0495600_0026498 3300046809 Bacteria 3741
343 Ga0495660_0023572 3300046810 Bacteria 3510
344 Ga0495660_0034796 3300046810 Bacteria 2817
345 Ga0495604_0019136 3300047317 Bacteria 5483
346 Ga0495672_0172356 3300047320 Bacteria 1102
347 Ga0495687_084227 3300047443 Bacteria 1236
348 Ga0495673_0034799 3300047469 Bacteria 2327
349 Ga0495681_0037762 3300047470 Bacteria 2375
350 Ga0495686_0001000 3300047472 Bacteria 34410
351 Ga0495686_0005796 3300047472 Bacteria 9635
352 Ga0495686_0018060 3300047472 Bacteria 4740
353 Ga0495686_0069687 3300047472 Bacteria 2167
354 Ga0495602_0083858 3300048088 Bacteria 2668
355 Ga0495626_0050600 3300048091 Bacteria 1919
356 Ga0496100_0029967 3300048903 Bacteria 3370
357 Ga0496100_0408480 3300048903 Bacteria 1035
358 Ga0496101_0042328 3300048904 Bacteria 3251
359 Ga0496103_0113207 3300048906 Bacteria 1724
360 Ga0496104_0000771 3300048907 Bacteria 27410
361 Ga0496104_0166225 3300048907 Bacteria 2116
362 Ga0496106_0055859 3300048909 Bacteria 2985
363 Ga0496108_0001711 3300048911 Bacteria 17382
364 Ga0496108_0039655 3300048911 Bacteria 3925
365 Ga0496109_0007550 3300048912 Bacteria 9219
366 Ga0496109_0171241 3300048912 Bacteria 2037
367 Ga0496110_0001734 3300048913 Bacteria 16069
368 Ga0496111_0001636 3300048914 Bacteria 12984
369 Ga0496111_0066988 3300048914 Bacteria 2608
370 Ga0496112_0015892 3300048915 Bacteria 7033
371 Ga0496113_0019435 3300048916 Bacteria 4752
372 Ga0496113_0052692 3300048916 Bacteria 3040
373 Ga0496116_0000275 3300048919 Bacteria 89714
374 Ga0496116_0001253 3300048919 Bacteria 29488
375 Ga0496116_0002733 3300048919 Bacteria 18133
376 Ga0496116_0003264 3300048919 Bacteria 16159
377 Ga0496116_0114290 3300048919 Bacteria 1577
378 Ga0496116_0115880 3300048919 Bacteria 1562
379 Ga0496117_0000002 3300048920 Bacteria 2483758
380 Ga0496117_0000353 3300048920 Bacteria 81061
381 Ga0496117_0003834 3300048920 Bacteria 17102
382 Ga0496117_0004228 3300048920 Bacteria 16031
383 Ga0496117_0023039 3300048920 Bacteria 4976
384 Ga0496117_0029447 3300048920 Bacteria 4233
385 Ga0496117_0096579 3300048920 Bacteria 1885
386 Ga0496118_0000204 3300048921 Bacteria 104260
387 Ga0496118_0000319 3300048921 Bacteria 83025
388 Ga0496118_0063833 3300048921 Bacteria 2707
389 Ga0496118_0176869 3300048921 Bacteria 1295
390 Ga0496119_0004702 3300048922 Bacteria 13425
391 Ga0496119_0014718 3300048922 Bacteria 6094
392 Ga0496119_0018311 3300048922 Bacteria 5224
393 Ga0496119_0037065 3300048922 Bacteria 3173
394 Ga0496119_0066779 3300048922 Bacteria 2123
395 Ga0496120_0000947 3300048923 Bacteria 39671
396 Ga0496120_0039314 3300048923 Bacteria 2792
397 Ga0496121_0000003 3300048924 Bacteria 1191431
398 Ga0496121_0000378 3300048924 Bacteria 91381
399 Ga0496121_0001670 3300048924 Bacteria 36603
400 Ga0496121_0008020 3300048924 Bacteria 12595
401 Ga0496121_0021296 3300048924 Bacteria 6358
402 Ga0496121_0042142 3300048924 Bacteria 3977
403 Ga0496121_0072728 3300048924 Bacteria 2759
404 Ga0496121_0143325 3300048924 Bacteria 1769
405 Ga0496121_0148193 3300048924 Bacteria 1731
406 Ga0496122_0000001 3300048925 Bacteria 1827766
407 Ga0496122_0000025 3300048925 Bacteria 362915
408 Ga0496122_0000525 3300048925 Bacteria 79294
409 Ga0496122_0003799 3300048925 Bacteria 19440
410 Ga0496122_0006342 3300048925 Bacteria 13608
411 Ga0496122_0006594 3300048925 Bacteria 13250
412 Ga0496122_0020401 3300048925 Bacteria 5989
413 Ga0496122_0040318 3300048925 Bacteria 3713
414 Ga0496122_0047484 3300048925 Bacteria 3314
415 Ga0496123_0000001 3300048926 Bacteria 1831497
416 Ga0496123_0000032 3300048926 Bacteria 285282
417 Ga0496123_0001014 3300048926 Bacteria 42878
418 Ga0496123_0002174 3300048926 Bacteria 25015
419 Ga0496123_0005810 3300048926 Bacteria 12244
420 Ga0496123_0009156 3300048926 Bacteria 8954
421 Ga0496123_0013259 3300048926 Bacteria 6942
422 Ga0496123_0029085 3300048926 Bacteria 4078
423 Ga0496124_0001286 3300048927 Bacteria 38095
424 Ga0496124_0003917 3300048927 Bacteria 17784
425 Ga0496124_0004533 3300048927 Bacteria 16175
426 Ga0496124_0004950 3300048927 Bacteria 15269
427 Ga0496124_0021945 3300048927 Bacteria 5872
428 Ga0496124_0028464 3300048927 Bacteria 4998
429 Ga0496124_0032379 3300048927 Bacteria 4616
430 Ga0496124_0034591 3300048927 Bacteria 4432
431 Ga0496124_0054395 3300048927 Bacteria 3388
432 Ga0496124_0054665 3300048927 Bacteria 3378
433 Ga0496124_0077930 3300048927 Bacteria 2732
434 Ga0496124_0083043 3300048927 Bacteria 2629
435 Ga0496124_0099503 3300048927 Bacteria 2358
436 Ga0496124_0120434 3300048927 Bacteria 2098
437 Ga0496124_0268034 3300048927 Bacteria 1252
438 Ga0496125_0000141 3300048928 Bacteria 158991
439 Ga0496125_0001877 3300048928 Bacteria 28869
440 Ga0496125_0002169 3300048928 Bacteria 26237
441 Ga0496125_0002998 3300048928 Bacteria 21129
442 Ga0496125_0004376 3300048928 Bacteria 16353
443 Ga0496125_0026549 3300048928 Bacteria 5272
444 Ga0496125_0111788 3300048928 Bacteria 1976
445 Ga0496125_0163255 3300048928 Bacteria 1509
446 Ga0496126_0000824 3300048929 Bacteria 55178
447 Ga0496126_0001019 3300048929 Bacteria 47578
448 Ga0496126_0035063 3300048929 Bacteria 4705
449 Ga0496126_0053480 3300048929 Bacteria 3663
450 Ga0496126_0111978 3300048929 Bacteria 2377
451 Ga0496126_0127027 3300048929 Bacteria 2206
452 Ga0495678_040915 3300049459 Bacteria 1859
453 Ga0495678_081747 3300049459 Bacteria 1158
454 Ga0495682_0058947 3300049460 Bacteria 1388
455 Ga0501031_0047894 3300049568 Bacteria 2786
456 Ga0501032_0111451 3300049569 Bacteria 1810
457 Ga0501032_0122933 3300049569 Bacteria 1715
458 Ga0501034_0094364 3300049571 Bacteria 2988
459 Ga0501034_0109330 3300049571 Bacteria 2755
460 Ga0501036_0004299 3300049572 Bacteria 11505
461 Ga0501037_0084886 3300049573 Bacteria 2292
462 Ga0501037_0113275 3300049573 Bacteria 1953
463 Ga0501037_0311932 3300049573 Bacteria 1090
464 Ga0501038_0165218 3300049574 Bacteria 1796
465 Ga0501038_0448421 3300049574 Bacteria 992
466 Ga0501039_0134220 3300049575 Bacteria 1943
467 Ga0501043_0046274 3300049579 Bacteria 3421
468 Ga0501046_0071755 3300049580 Bacteria 2689
469 Ga0501047_0047685 3300049581 Bacteria 4138
470 Ga0501047_0279435 3300049581 Bacteria 1514
471 Ga0501067_0083698 3300049583 Bacteria 1770
472 Ga0501068_0021279 3300049584 Bacteria 3786
473 Ga0501073_0081258 3300049589 Bacteria 2254
474 Ga0501074_0031636 3300049590 Bacteria 3833
475 Ga0501076_0413090 3300049592 Bacteria 1110
476 Ga0501227_043405 3300049665 Bacteria 1117
477 Ga0501079_0007301 3300049741 Bacteria 8347
478 Ga0501080_0059453 3300049742 Bacteria 3556
479 Ga0501080_0082768 3300049742 Bacteria 2981
480 Ga0501080_0291514 3300049742 Bacteria 1482
481 Ga0501083_0078119 3300049744 Bacteria 2196
482 Ga0501280_002708 3300049776 Bacteria 2880
483 Ga0501044_0000351 3300049823 Bacteria 57748
484 Ga0501044_0053600 3300049823 Bacteria 4149
485 Ga0501044_0168565 3300049823 Bacteria 2162
486 Ga0501044_0401419 3300049823 Bacteria 1283
487 Ga0501045_0115040 3300049824 Bacteria 1995
488 nmdc:mga03n38_4597_c1 3300050490 Bacteria 4594
489 nmdc:mga00v17_107_c1 3300050491 Bacteria 49224
490 nmdc:mga00v17_204314_c1 3300050491 Bacteria 1277
491 nmdc:mga00v17_77_c2 3300050491 Bacteria 48963
492 nmdc:mga0yw44_27396_c1 3300050492 Bacteria 3263
493 nmdc:mga0yw44_61038_c1 3300050492 Bacteria 2312
494 nmdc:mga0k408_55639_c1 3300050493 Bacteria 2294
495 nmdc:mga06z11_19122_c1 3300050494 Bacteria 3143
496 nmdc:mga06z11_233476_c1 3300050494 Bacteria 1078
497 nmdc:mga06z11_8273_c1 3300050494 Bacteria 4328
498 nmdc:mga04h51_2273_c1 3300050495 Bacteria 4532
499 nmdc:mga07m45_9261_c1 3300050496 Bacteria 5098
500 nmdc:mga0sz30_10436_c1 3300050516 Bacteria 3561
501 nmdc:mga0sz30_28781_c1 3300050516 Bacteria 2287
502 Ga0495601_0146192 3300053077 Bacteria 1543
503 Ga0500610_0065099 3300053079 Bacteria 1901
504 Ga0500578_0082893 3300053086 Bacteria 2038
505 Ga0500578_0088529 3300053086 Bacteria 1966
506 Ga0500560_000596 3300053107 Bacteria 5248
507 Ga0500560_010809 3300053107 Bacteria 2303
508 Ga0500569_001590 3300053109 Bacteria 4306
509 Ga0500569_006582 3300053109 Bacteria 2558
510 Ga0500618_000125 3300053125 Bacteria 63168
511 Ga0500618_000261 3300053125 Bacteria 41070
512 Ga0500618_001334 3300053125 Bacteria 11277
513 Ga0500658_0001147 3300053134 Bacteria 10807
514 Ga0500561_0000496 3300053137 Bacteria 6374
515 Ga0500568_0001773 3300053139 Bacteria 13311
516 Ga0500568_0080537 3300053139 Bacteria 1237
517 Ga0500573_0000277 3300053140 Bacteria 21756
518 Ga0500590_007266 3300053148 Bacteria 5459
519 Ga0500616_0001525 3300053153 Bacteria 21822
520 Ga0500616_0003879 3300053153 Bacteria 11000
521 Ga0500616_0040257 3300053153 Bacteria 2514
522 Ga0500622_0000443 3300053156 Bacteria 39403
523 Ga0500622_0105017 3300053156 Bacteria 1386
524 Ga0500624_003434 3300053157 Bacteria 2079
525 Ga0500627_0016200 3300053158 Bacteria 2902
526 Ga0500634_0092498 3300053161 Bacteria 1531
527 Ga0500636_0000118 3300053177 Bacteria 41422
528 Ga0500636_0009118 3300053177 Bacteria 5766
529 Ga0500636_0101511 3300053177 Bacteria 1635
530 Ga0501084_0414640 3300054114 Bacteria 1138
531 Ga0587075_001785 3300059644 Bacteria 2167
532 Ga0587076_010305 3300059645 Bacteria 1347
533 Ga0587078_001579 3300059646 Bacteria 2069
534 Ga0501082_0175862 3300060353 Bacteria 1861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2919171160 2919175294 300
2 iso_pu_bacteria 8005658619 8005659143 303
3 iso_pu_bacteria 8054558443 8054559878 303
4 iso_pu_bacteria 8055431914 8055435144 303
5 3300003215 JGI25153J46596_10032457 JGI25153J46596_100324571 304
6 3300003794 Ga0055531_10003139 Ga0055531_100031396 304
7 3300025297 Ga0209758_1000155 Ga0209758_100015551 304
8 iso_pu_bacteria 2508501122 2509111833 304
9 iso_pu_bacteria 2509276019 2509375786 304
10 iso_pu_bacteria 2509276021 2509392535 304
11 iso_pu_bacteria 2509276033 2509446550 304
12 iso_pu_bacteria 2510065019 2510133442 304
13 iso_pu_bacteria 2510065057 2510303323 304
14 iso_pu_bacteria 2510461076 2510894829 304
15 iso_pu_bacteria 2510917022 2511135199 304
16 iso_pu_bacteria 2510917026 2511171917 304
17 iso_pu_bacteria 2510917028 2511185702 304
18 iso_pu_bacteria 2511231052 2511501860 304
19 iso_pu_bacteria 2512047086 2512533297 304
20 iso_pu_bacteria 2512875026 2512971207 304
21 iso_pu_bacteria 2513237084 2513572371 304
22 iso_pu_bacteria 2513237085 2513577414 304
23 iso_pu_bacteria 2513237086 2513584718 304
24 iso_pu_bacteria 2513237088 2513594663 304
25 iso_pu_bacteria 2513237089 2513606177 304
26 iso_pu_bacteria 2513237091 2513615428 304
27 iso_pu_bacteria 2513237093 2513629952 304
28 iso_pu_bacteria 2513237138 2513864724 304
29 iso_pu_bacteria 2513237140 2513881216 304
30 iso_pu_bacteria 2513237143 2513905642 304
31 iso_pu_bacteria 2513237144 2513912507 304
32 iso_pu_bacteria 2513237146 2513926140 304
33 iso_pu_bacteria 2513237156 2513988191 304
34 iso_pu_bacteria 2513237159 2513997118 304
35 iso_pu_bacteria 2513237160 2514008779 304
36 iso_pu_bacteria 2513237162 2514021954 304
37 iso_pu_bacteria 2515075009 2515112407 304
38 iso_pu_bacteria 2515154107 2515608724 304
39 iso_pu_bacteria 2515154113 2515632756 304
40 iso_pu_bacteria 2515154114 2515639904 304
41 iso_pu_bacteria 2515154116 2515655891 304
42 iso_pu_bacteria 2515154134 2515740327 304
43 iso_pu_bacteria 2516143018 2516209657 304
44 iso_pu_bacteria 2516653046 2516893154 304
45 iso_pu_bacteria 2516653077 2517036139 304
46 iso_pu_bacteria 2516653085 2517076529 304
47 iso_pu_bacteria 2517287029 2517406899 304
48 iso_pu_bacteria 2517487022 2517569912 304
49 iso_pu_bacteria 2519899620 2520379234 304
50 iso_pu_bacteria 2524023207 2524448874 304
51 iso_pu_bacteria 2524023209 2524460197 304
52 iso_pu_bacteria 2529292951 2530645648 304
53 iso_pu_bacteria 2534681796 2535516572 304
54 iso_pu_bacteria 2537561587 2537873722 304
55 iso_pu_bacteria 2551306084 2551679575 304
56 iso_pu_bacteria 2551306085 2551686631 304
57 iso_pu_bacteria 2551306086 2551696262 304
58 iso_pu_bacteria 2551306087 2551697687 304
59 iso_pu_bacteria 2551306089 2551713808 304
60 iso_pu_bacteria 2551306090 2551721910 304
61 iso_pu_bacteria 2551306091 2551727133 304
62 iso_pu_bacteria 2551306092 2551736248 304
63 iso_pu_bacteria 2551306093 2551742980 304
64 iso_pu_bacteria 2558860100 2558868054 304
65 iso_pu_bacteria 2558860242 2559295171 304
66 iso_pu_bacteria 2558860983 2561468969 304
67 iso_pu_bacteria 2582581283 2585166086 304
68 iso_pu_bacteria 2582581294 2585200249 304
69 iso_pu_bacteria 2582581299 2585229922 304
70 iso_pu_bacteria 2582581304 2585254828 304
71 iso_pu_bacteria 2582581306 2585268109 304
72 iso_pu_bacteria 2582581307 2585270940 304
73 iso_pu_bacteria 2582581308 2585277289 304
74 iso_pu_bacteria 2582581315 2585323701 304
75 iso_pu_bacteria 2582581316 2585331675 304
76 iso_pu_bacteria 2582581865 2585386788 304
77 iso_pu_bacteria 2582581866 2585396677 304
78 iso_pu_bacteria 2582581867 2585402089 304
79 iso_pu_bacteria 2585427526 2585527768 304
80 iso_pu_bacteria 2585427527 2585533977 304
81 iso_pu_bacteria 2585427528 2585537663 304
82 iso_pu_bacteria 2585427530 2585552173 304
83 iso_pu_bacteria 2585427531 2585558664 304
84 iso_pu_bacteria 2585427590 2585821874 304
85 iso_pu_bacteria 2585427593 2585835613 304
86 iso_pu_bacteria 2585427594 2585846801 304
87 iso_pu_bacteria 2585427608 2585898025 304
88 iso_pu_bacteria 2585427609 2585904366 304
89 iso_pu_bacteria 2585427633 2585995697 304
90 iso_pu_bacteria 2585427634 2586000264 304
91 iso_pu_bacteria 2585428125 2587980517 304
92 iso_pu_bacteria 2599185156 2599331552 304
93 iso_pu_bacteria 2599185170 2599417616 304
94 iso_pu_bacteria 2599185210 2599601494 304
95 iso_pu_bacteria 2599185236 2599721155 304
96 iso_pu_bacteria 2599185352 2600193140 304
97 iso_pu_bacteria 2600254933 2600374475 304
98 iso_pu_bacteria 2600255279 2601612121 304
99 iso_pu_bacteria 2600255308 2601749095 304
100 iso_pu_bacteria 2615840624 2616292347 304
101 iso_pu_bacteria 2615840626 2616308666 304
102 iso_pu_bacteria 2615840698 2616557028 304
103 iso_pu_bacteria 2617270742 2617385762 304
104 iso_pu_bacteria 2643221557 2643803636 304
105 iso_pu_bacteria 2643221558 2643811674 304
106 iso_pu_bacteria 2643221582 2643919593 304
107 iso_pu_bacteria 2643221599 2644003834 304
108 iso_pu_bacteria 2643221607 2644049086 304
109 iso_pu_bacteria 2643221610 2644067605 304
110 iso_pu_bacteria 2643221618 2644107754 304
111 iso_pu_bacteria 2643221626 2644148574 304
112 iso_pu_bacteria 2643221634 2644192706 304
113 iso_pu_bacteria 2643221636 2644205259 304
114 iso_pu_bacteria 2643221637 2644210256 304
115 iso_pu_bacteria 2643221643 2644239643 304
116 iso_pu_bacteria 2643221653 2644298566 304
117 iso_pu_bacteria 2643221655 2644309148 304
118 iso_pu_bacteria 2643221659 2644332975 304
119 iso_pu_bacteria 2643221668 2644375283 304
120 iso_pu_bacteria 2643221675 2644418659 304
121 iso_pu_bacteria 2643221680 2644452025 304
122 iso_pu_bacteria 2643221686 2644482120 304
123 iso_pu_bacteria 2643221688 2644491767 304
124 iso_pu_bacteria 2643221689 2644501764 304
125 iso_pu_bacteria 2643221693 2644520184 304
126 iso_pu_bacteria 2643221698 2644545853 304
127 iso_pu_bacteria 2643221712 2644615090 304
128 iso_pu_bacteria 2643221718 2644653808 304
129 iso_pu_bacteria 2643221719 2644656795 304
130 iso_pu_bacteria 2643221723 2644672516 304
131 iso_pu_bacteria 2643221726 2644690788 304
132 iso_pu_bacteria 2657244999 2657685904 304
133 iso_pu_bacteria 2667528174 2671111634 304
134 iso_pu_bacteria 2690316117 2692315882 304
135 iso_pu_bacteria 2718217882 2719181298 304
136 iso_pu_bacteria 2718217927 2719385905 304
137 iso_pu_bacteria 2718217997 2719665721 304
138 iso_pu_bacteria 2718218009 2719732047 304
139 iso_pu_bacteria 2718218199 2720492141 304
140 iso_pu_bacteria 2718218232 2720613406 304
141 iso_pu_bacteria 2718218233 2720620283 304
142 iso_pu_bacteria 2718218235 2720631708 304
143 iso_pu_bacteria 2718218269 2720775436 304
144 iso_pu_bacteria 2718218363 2721147392 304
145 iso_pu_bacteria 2718218365 2721158926 304
146 iso_pu_bacteria 2718218366 2721164310 304
147 iso_pu_bacteria 2718218423 2721399684 304
148 iso_pu_bacteria 2721755514 2722840480 304
149 iso_pu_bacteria 2721755556 2723027054 304
150 iso_pu_bacteria 2721755684 2723560666 304
151 iso_pu_bacteria 2721755685 2723567255 304
152 iso_pu_bacteria 2721755809 2724038497 304
153 iso_pu_bacteria 2721755810 2724044803 304
154 iso_pu_bacteria 2721755819 2724090043 304
155 iso_pu_bacteria 2721755822 2724104520 304
156 iso_pu_bacteria 2721755823 2724110314 304
157 iso_pu_bacteria 2724679232 2725948583 304
158 iso_pu_bacteria 2728369352 2730107990 304
159 iso_pu_bacteria 2728369365 2730164535 304
160 iso_pu_bacteria 2728369397 2730298558 304
161 iso_pu_bacteria 2738541293 2738804236 304
162 iso_pu_bacteria 2738541333 2739036626 304
163 iso_pu_bacteria 2751185821 2753458849 304
164 iso_pu_bacteria 2765235942 2766067426 304
165 iso_pu_bacteria 2775507266 2778174100 304
166 iso_pu_bacteria 2791355082 2792581799 304
167 iso_pu_bacteria 2791355091 2792620131 304
168 iso_pu_bacteria 2791355092 2792626451 304
169 iso_pu_bacteria 2791355094 2792639394 304
170 iso_pu_bacteria 2791355253 2793279917 304
171 iso_pu_bacteria 2791355256 2793294799 304
172 iso_pu_bacteria 2791355259 2793312377 304
173 iso_pu_bacteria 2791355260 2793322915 304
174 iso_pu_bacteria 2791355261 2793331017 304
175 iso_pu_bacteria 2791355262 2793335935 304
176 iso_pu_bacteria 2791355263 2793341641 304
177 iso_pu_bacteria 2791355264 2793348953 304
178 iso_pu_bacteria 2791355265 2793352951 304
179 iso_pu_bacteria 2791355266 2793361048 304
180 iso_pu_bacteria 2791355267 2793366857 304
181 iso_pu_bacteria 2802428858 2802719409 304
182 iso_pu_bacteria 2802428859 2802726994 304
183 iso_pu_bacteria 2802428860 2802734483 304
184 iso_pu_bacteria 2802428861 2802740714 304
185 iso_pu_bacteria 2802428862 2802745252 304
186 iso_pu_bacteria 2802428863 2802752708 304
187 iso_pu_bacteria 2802429268 2804752352 304
188 iso_pu_bacteria 2802429605 2805925821 304
189 iso_pu_bacteria 2802429606 2805933459 304
190 iso_pu_bacteria 2802429633 2806046176 304
191 iso_pu_bacteria 2802429634 2806054556 304
192 iso_pu_bacteria 2802429635 2806060560 304
193 iso_pu_bacteria 2802429636 2806064982 304
194 iso_pu_bacteria 2802429637 2806072241 304
195 iso_pu_bacteria 2818991272 2819241567 304
196 iso_pu_bacteria 2818991448 2819608948 304
197 iso_pu_bacteria 2818991453 2819637823 304
198 iso_pu_bacteria 2838016132 2838021350 304
199 iso_pu_bacteria 2838022645 2838026297 304
200 iso_pu_bacteria 2838029111 2838030006 304
201 iso_pu_bacteria 2838035591 2838038171 304
202 iso_pu_bacteria 2838042994 2838043564 304
203 iso_pu_bacteria 2838048938 2838053479 304
204 iso_pu_bacteria 2838061910 2838065690 304
205 iso_pu_bacteria 2838068647 2838074405 304
206 iso_pu_bacteria 2838074704 2838078960 304
207 iso_pu_bacteria 2838661181 2838661922 304
208 iso_pu_bacteria 2838668709 2838671913 304
209 iso_pu_bacteria 2838680041 2838682089 304
210 iso_pu_bacteria 2838686498 2838691913 304
211 iso_pu_bacteria 2838694306 2838696661 304
212 iso_pu_bacteria 2838701080 2838704807 304
213 iso_pu_bacteria 2838707686 2838710100 304
214 iso_pu_bacteria 2838714209 2838714856 304
215 iso_pu_bacteria 2838719591 2838721343 304
216 iso_pu_bacteria 2838729681 2838732940 304
217 iso_pu_bacteria 2838736955 2838738453 304
218 iso_pu_bacteria 2838742623 2838745818 304
219 iso_pu_bacteria 2841840854 2841841178 304
220 iso_pu_bacteria 2841846520 2841848311 304
221 iso_pu_bacteria 2841851746 2841855723 304
222 iso_pu_bacteria 2841859092 2841859133 304
223 iso_pu_bacteria 2841864319 2841864413 304
224 iso_pu_bacteria 2842077413 2842078273 304
225 iso_pu_bacteria 2842110456 2842114278 304
226 iso_pu_bacteria 2842118031 2842119219 304
227 iso_pu_bacteria 2842130223 2842130869 304
228 iso_pu_bacteria 2842140634 2842140956 304
229 iso_pu_bacteria 2842146304 2842148453 304
230 iso_pu_bacteria 2842152218 2842153961 304
231 iso_pu_bacteria 2842156927 2842157285 304
232 iso_pu_bacteria 2842163707 2842167943 304
233 iso_pu_bacteria 2842170452 2842171100 304
234 iso_pu_bacteria 2842175837 2842177581 304
235 iso_pu_bacteria 2842180545 2842181131 304
236 iso_pu_bacteria 2842187318 2842187965 304
237 iso_pu_bacteria 2842192696 2842194398 304
238 iso_pu_bacteria 2842198810 2842201770 304
239 iso_pu_bacteria 2842205361 2842205916 304
240 iso_pu_bacteria 2842211629 2842212276 304
241 iso_pu_bacteria 2842217011 2842217374 304
242 iso_pu_bacteria 2842224351 2842226105 304
243 iso_pu_bacteria 2842229732 2842230811 304
244 iso_pu_bacteria 2842237096 2842239512 304
245 iso_pu_bacteria 2842243621 2842245083 304
246 iso_pu_bacteria 2842250916 2842254487 304
247 iso_pu_bacteria 2842257432 2842258896 304
248 iso_pu_bacteria 2842264693 2842265925 304
249 iso_pu_bacteria 2842271015 2842276434 304
250 iso_pu_bacteria 2842278818 2842279373 304
251 iso_pu_bacteria 2842285085 2842286023 304
252 iso_pu_bacteria 2842291075 2842291935 304
253 iso_pu_bacteria 2842298080 2842301958 304
254 iso_pu_bacteria 2842304105 2842304426 304
255 iso_pu_bacteria 2842311132 2842314355 304
256 iso_pu_bacteria 2842317721 2842317794 304
257 iso_pu_bacteria 2842341865 2842345237 304
258 iso_pu_bacteria 2842357229 2842357576 304
259 iso_pu_bacteria 2842363717 2842364682 304
260 iso_pu_bacteria 2842370503 2842372656 304
261 iso_pu_bacteria 2842377471 2842378331 304
262 iso_pu_bacteria 2842384541 2842385728 304
263 iso_pu_bacteria 2842395702 2842398804 304
264 iso_pu_bacteria 2842402390 2842403383 304
265 iso_pu_bacteria 2842409023 2842409244 304
266 iso_pu_bacteria 2842415677 2842415898 304
267 iso_pu_bacteria 2842422224 2842427479 304
268 iso_pu_bacteria 2842428310 2842429438 304
269 iso_pu_bacteria 2842434925 2842436051 304
270 iso_pu_bacteria 2842441272 2842442398 304
271 iso_pu_bacteria 2842447887 2842450689 304
272 iso_pu_bacteria 2842462802 2842463859 304
273 iso_pu_bacteria 2842469257 2842470380 304
274 iso_pu_bacteria 2842475841 2842476709 304
275 iso_pu_bacteria 2842482326 2842484752 304
276 iso_pu_bacteria 2842489311 2842490139 304
277 iso_pu_bacteria 2842495871 2842496065 304
278 iso_pu_bacteria 2842502639 2842503534 304
279 iso_pu_bacteria 2842509118 2842511350 304
280 iso_pu_bacteria 2842515876 2842515917 304
281 iso_pu_bacteria 2842521101 2842522639 304
282 iso_pu_bacteria 2842922631 2842923950 304
283 iso_pu_bacteria 2844163670 2844167530 304
284 iso_pu_bacteria 2844454524 2844459031 304
285 iso_pu_bacteria 2847417321 2847419053 304
286 iso_pu_bacteria 2848992105 2848994084 304
287 iso_pu_bacteria 2850079185 2850081086 304
288 iso_pu_bacteria 2852387548 2852389985 304
289 iso_pu_bacteria 2854896431 2854899119 304
290 iso_pu_bacteria 2854916844 2854917003 304
291 iso_pu_bacteria 2855825444 2855825955 304
292 iso_pu_bacteria 2855839649 2855841305 304
293 iso_pu_bacteria 2855872281 2855876729 304
294 iso_pu_bacteria 2857516855 2857519836 304
295 iso_pu_bacteria 2858800743 2858802283 304
296 iso_pu_bacteria 2889790730 2889794252 304
297 iso_pu_bacteria 2889914905 2889916790 304
298 iso_pu_bacteria 2891373044 2891373134 304
299 iso_pu_bacteria 2896384573 2896390826 304
300 iso_pu_bacteria 2899792073 2899794845 304
301 iso_pu_bacteria 2899803654 2899807393 304
302 iso_pu_bacteria 2899845264 2899848068 304
303 iso_pu_bacteria 2913295892 2913300872 304
304 iso_pu_bacteria 2915980308 2915986034 304
305 iso_pu_bacteria 2915986958 2915990367 304
306 iso_pu_bacteria 2915993759 2916000752 304
307 iso_pu_bacteria 2916000859 2916002800 304
308 iso_pu_bacteria 2916007675 2916014518 304
309 iso_pu_bacteria 2916014648 2916017342 304
310 iso_pu_bacteria 2916021584 2916024039 304
311 iso_pu_bacteria 2916028427 2916034287 304
312 iso_pu_bacteria 2916035215 2916036741 304
313 iso_pu_bacteria 2916041962 2916044309 304
314 iso_pu_bacteria 2916048683 2916052247 304
315 iso_pu_bacteria 2916055098 2916055566 304
316 iso_pu_bacteria 2916061851 2916068625 304
317 iso_pu_bacteria 2916068649 2916069829 304
318 iso_pu_bacteria 2916076590 2916077323 304
319 iso_pu_bacteria 2919100787 2919106819 304
320 iso_pu_bacteria 2919114240 2919114944 304
321 iso_pu_bacteria 2919408235 2919411605 304
322 iso_pu_bacteria 2920760137 2920766128 304
323 iso_pu_bacteria 2920822456 2920824673 304
324 iso_pu_bacteria 2921201388 2921204474 304
325 iso_pu_bacteria 2921208531 2921212581 304
326 iso_pu_bacteria 2921237296 2921242367 304
327 iso_pu_bacteria 2921244191 2921244748 304
328 iso_pu_bacteria 2921250672 2921256481 304
329 iso_pu_bacteria 2921257292 2921259624 304
330 iso_pu_bacteria 2921263974 2921266945 304
331 iso_pu_bacteria 2921282425 2921287375 304
332 iso_pu_bacteria 2921289301 2921290059 304
333 iso_pu_bacteria 2921296804 2921297449 304
334 iso_pu_bacteria 2923556063 2923558009 304
335 iso_pu_bacteria 2924144063 2924146018 304
336 iso_pu_bacteria 2924150972 2924154524 304
337 iso_pu_bacteria 2924158325 2924163083 304
338 iso_pu_bacteria 2924165586 2924166511 304
339 iso_pu_bacteria 2924172951 2924173316 304
340 iso_pu_bacteria 2924179722 2924186105 304
341 iso_pu_bacteria 2924186466 2924189867 304
342 iso_pu_bacteria 2924193448 2924196565 304
343 iso_pu_bacteria 2924200457 2924205849 304
344 iso_pu_bacteria 2924207177 2924212981 304
345 iso_pu_bacteria 2924214083 2924217416 304
346 iso_pu_bacteria 2924221636 2924228440 304
347 iso_pu_bacteria 2924228884 2924231420 304
348 iso_pu_bacteria 2926754445 2926755911 304
349 iso_pu_bacteria 2926760298 2926763008 304
350 iso_pu_bacteria 2933011516 2933011707 304
351 iso_pu_bacteria 2933016740 2933020554 304
352 iso_pu_bacteria 2933570622 2933571700 304
353 iso_pu_bacteria 2933586486 2933590373 304
354 iso_pu_bacteria 2933594066 2933596789 304
355 iso_pu_bacteria 2933599457 2933604861 304
356 iso_pu_bacteria 2935894831 2935897484 304
357 iso_pu_bacteria 2935901341 2935905552 304
358 iso_pu_bacteria 2936367885 2936372568 304
359 iso_pu_bacteria 2936375103 2936376436 304
360 iso_pu_bacteria 2936381700 2936387154 304
361 iso_pu_bacteria 2936996657 2936999562 304
362 iso_pu_bacteria 2937002841 2937005964 304
363 iso_pu_bacteria 2937009748 2937015315 304
364 iso_pu_bacteria 2937016420 2937019361 304
365 iso_pu_bacteria 2937023124 2937028936 304
366 iso_pu_bacteria 2937029754 2937035183 304
367 iso_pu_bacteria 2937036028 2937042802 304
368 iso_pu_bacteria 2937042894 2937047491 304
369 iso_pu_bacteria 2937049772 2937051675 304
370 iso_pu_bacteria 2937056579 2937063456 304
371 iso_pu_bacteria 2937063883 2937065613 304
372 iso_pu_bacteria 2937071275 2937077823 304
373 iso_pu_bacteria 2937078374 2937083760 304
374 iso_pu_bacteria 2937084907 2937086152 304
375 iso_pu_bacteria 2937091812 2937092821 304
376 iso_pu_bacteria 2937098957 2937099322 304
377 iso_pu_bacteria 2937106411 2937107273 304
378 iso_pu_bacteria 2937113482 2937115243 304
379 iso_pu_bacteria 2937119839 2937123330 304
380 iso_pu_bacteria 2937126314 2937132307 304
381 iso_pu_bacteria 2941499720 2941503597 304
382 iso_pu_bacteria 2957375807 2957381347 304
383 iso_pu_bacteria 2957382221 2957387532 304
384 iso_pu_bacteria 2957388812 2957391816 304
385 iso_pu_bacteria 2957395598 2957396331 304
386 iso_pu_bacteria 2957402308 2957404904 304
387 iso_pu_bacteria 2957408893 2957410941 304
388 iso_pu_bacteria 2957415311 2957420163 304
389 iso_pu_bacteria 2957422303 2957424754 304
390 iso_pu_bacteria 2957430029 2957436585 304
391 iso_pu_bacteria 2957437181 2957438300 304
392 iso_pu_bacteria 2957443900 2957445726 304
393 iso_pu_bacteria 2957450854 2957457482 304
394 iso_pu_bacteria 2957457609 2957464181 304
395 iso_pu_bacteria 2957464669 2957470821 304
396 iso_pu_bacteria 2957471148 2957472426 304
397 iso_pu_bacteria 2957478035 2957480694 304
398 iso_pu_bacteria 2957484790 2957491417 304
399 iso_pu_bacteria 2957491536 2957496633 304
400 iso_pu_bacteria 2957498199 2957503723 304
401 iso_pu_bacteria 2957505466 2957512485 304
402 iso_pu_bacteria 2960584000 2960590075 304
403 iso_pu_bacteria 2960591022 2960596495 304
404 iso_pu_bacteria 2960597568 2960603303 304
405 iso_pu_bacteria 2960603979 2960609639 304
406 iso_pu_bacteria 2960610863 2960615153 304
407 iso_pu_bacteria 2960617483 2960620862 304
408 iso_pu_bacteria 2960624210 2960624717 304
409 iso_pu_bacteria 2960631154 2960637248 304
410 iso_pu_bacteria 2960637947 2960645098 304
411 iso_pu_bacteria 2960645483 2960652811 304
412 iso_pu_bacteria 2960652885 2960659220 304
413 iso_pu_bacteria 2960660292 2960662157 304
414 iso_pu_bacteria 2960667422 2960672936 304
415 iso_pu_bacteria 2960674078 2960679701 304
416 iso_pu_bacteria 2960680706 2960686475 304
417 iso_pu_bacteria 2960687367 2960689939 304
418 iso_pu_bacteria 2960693952 2960694642 304
419 iso_pu_bacteria 2964607997 2964611759 304
420 iso_pu_bacteria 2964615318 2964616949 304
421 iso_pu_bacteria 2964621998 2964622718 304
422 iso_pu_bacteria 2964628898 2964631085 304
423 iso_pu_bacteria 2964636051 2964637577 304
424 iso_pu_bacteria 2964643177 2964646470 304
425 iso_pu_bacteria 2964649959 2964651691 304
426 iso_pu_bacteria 2964656573 2964661601 304
427 iso_pu_bacteria 2964663802 2964669912 304
428 iso_pu_bacteria 2964670856 2964676175 304
429 iso_pu_bacteria 2964678106 2964684380 304
430 iso_pu_bacteria 2964685014 2964686899 304
431 iso_pu_bacteria 2964691889 2964694375 304
432 iso_pu_bacteria 2964698721 2964701600 304
433 iso_pu_bacteria 2964705432 2964711010 304
434 iso_pu_bacteria 2964712639 2964713157 304
435 iso_pu_bacteria 2964719344 2964726427 304
436 iso_pu_bacteria 2967664464 2967665685 304
437 iso_pu_bacteria 2967671571 2967672241 304
438 iso_pu_bacteria 2967678726 2967685363 304
439 iso_pu_bacteria 2967686174 2967692980 304
440 iso_pu_bacteria 2967693043 2967697443 304
441 iso_pu_bacteria 2967699805 2967700315 304
442 iso_pu_bacteria 2967706974 2967709072 304
443 iso_pu_bacteria 2967714385 2967716843 304
444 iso_pu_bacteria 2967721400 2967726392 304
445 iso_pu_bacteria 2967728569 2967734545 304
446 iso_pu_bacteria 2967735183 2967740036 304
447 iso_pu_bacteria 2967742019 2967743637 304
448 iso_pu_bacteria 2967748971 2967753726 304
449 iso_pu_bacteria 2967755722 2967758713 304
450 iso_pu_bacteria 2967762386 2967768590 304
451 iso_pu_bacteria 2967769361 2967770938 304
452 iso_pu_bacteria 2967775926 2967780297 304
453 iso_pu_bacteria 2970019648 2970026547 304
454 iso_pu_bacteria 2970026789 2970033547 304
455 iso_pu_bacteria 2970033650 2970034198 304
456 iso_pu_bacteria 2970040964 2970046899 304
457 iso_pu_bacteria 2970047711 2970048951 304
458 iso_pu_bacteria 2970054988 2970057077 304
459 iso_pu_bacteria 2970061556 2970063054 304
460 iso_pu_bacteria 2970068827 2970070838 304
461 iso_pu_bacteria 2970076120 2970079253 304
462 iso_pu_bacteria 2970082768 2970083709 304
463 iso_pu_bacteria 2970088815 2970090433 304
464 iso_pu_bacteria 2970095765 2970097405 304
465 iso_pu_bacteria 2970102677 2970107463 304
466 iso_pu_bacteria 2970109326 2970111663 304
467 iso_pu_bacteria 2970116247 2970121520 304
468 iso_pu_bacteria 2970122695 2970128981 304
469 iso_pu_bacteria 2970129317 2970133405 304
470 iso_pu_bacteria 2970136068 2970137050 304
471 iso_pu_bacteria 2970143518 2970149579 304
472 iso_pu_bacteria 2970149975 2970156243 304
473 iso_pu_bacteria 2970156795 2970161602 304
474 iso_pu_bacteria 2970164137 2970169776 304
475 iso_pu_bacteria 2970170962 2970176636 304
476 iso_pu_bacteria 2970177841 2970180560 304
477 iso_pu_bacteria 2970184632 2970189353 304
478 iso_pu_bacteria 2970191845 2970198114 304
479 iso_pu_bacteria 2977516862 2977521437 304
480 iso_pu_bacteria 2977523885 2977529316 304
481 iso_pu_bacteria 2977530762 2977537401 304
482 iso_pu_bacteria 2977537788 2977542551 304
483 iso_pu_bacteria 2977544691 2977545960 304
484 iso_pu_bacteria 2977551784 2977556402 304
485 iso_pu_bacteria 2977558990 2977560920 304
486 iso_pu_bacteria 2977565890 2977567931 304
487 iso_pu_bacteria 2977572785 2977575200 304
488 iso_pu_bacteria 2977579622 2977584225 304
489 iso_pu_bacteria 2989349275 2989353361 304
490 iso_pu_bacteria 2989771324 2989775826 304
491 iso_pu_bacteria 2989776772 2989779096 304
492 iso_pu_bacteria 2996887358 2996891783 304
493 iso_pu_bacteria 2996893221 2996894046 304
494 iso_pu_bacteria 3003930520 3003933745 304
495 iso_pu_bacteria 3005409236 3005415058 304
496 iso_pu_bacteria 3005416602 3005420018 304
497 iso_pu_bacteria 3005445848 3005447682 304
498 iso_pu_bacteria 3005452660 3005454286 304
499 iso_pu_bacteria 639633055 639648665 304
500 iso_pu_bacteria 643692032 643825941 304
501 iso_pu_bacteria 648276728 648741273 304
502 iso_pu_bacteria 8003570095 8003571439 304
503 iso_pu_bacteria 8003992118 8003993810 304
504 iso_pu_bacteria 8003999396 8004001277 304
505 iso_pu_bacteria 8005246636 8005248654 304
506 iso_pu_bacteria 8005258706 8005263112 304
507 iso_pu_bacteria 8005275841 8005280686 304
508 iso_pu_bacteria 8005282627 8005287086 304
509 iso_pu_bacteria 8005289223 8005293210 304
510 iso_pu_bacteria 8005307578 8005309855 304
511 iso_pu_bacteria 8005314921 8005316969 304
512 iso_pu_bacteria 8005321885 8005326310 304
513 iso_pu_bacteria 8005376324 8005379352 304
514 iso_pu_bacteria 8005382845 8005388443 304
515 iso_pu_bacteria 8005395548 8005396651 304
516 iso_pu_bacteria 8005430974 8005435932 304
517 iso_pu_bacteria 8005460587 8005463078 304
518 iso_pu_bacteria 8005484373 8005485233 304
519 iso_pu_bacteria 8005497431 8005500451 304
520 iso_pu_bacteria 8005542996 8005545225 304
521 iso_pu_bacteria 8005556819 8005557581 304
522 iso_pu_bacteria 8005563573 8005568752 304
523 iso_pu_bacteria 8005570704 8005574363 304
524 iso_pu_bacteria 8005619151 8005621828 304
525 iso_pu_bacteria 8005626139 8005627071 304
526 iso_pu_bacteria 8005645114 8005649783 304
527 iso_pu_bacteria 8005668836 8005671869 304
528 iso_pu_bacteria 8005682033 8005683102 304
529 iso_pu_bacteria 8005688590 8005694689 304
530 iso_pu_bacteria 8005695170 8005699889 304
531 iso_pu_bacteria 8018127388 8018130031 304
532 iso_pu_bacteria 8018150411 8018153534 304
533 iso_pu_bacteria 8018163183 8018166668 304
534 iso_pu_bacteria 8018176218 8018179716 304
535 iso_pu_bacteria 8023680758 8023685254 304
536 iso_pu_bacteria 8024479707 8024483412 304
537 iso_pu_bacteria 8024486573 8024492181 304
538 iso_pu_bacteria 8024501048 8024501526 304
539 iso_pu_bacteria 8046767195 8046770446 304
540 iso_pu_bacteria 8049293176 8049294925 304
541 iso_pu_bacteria 8056375014 8056376742 304
542 iso_pu_bacteria 8056382006 8056387953 304
543 iso_pu_bacteria 8056875544 8056877474 304
544 iso_pu_bacteria 8057575449 8057575953 304
545 iso_pu_bacteria 8057874678 8057874931 304
546 3300005530 Ga0070679_100091369 Ga0070679_1000913692 305
547 3300025921 Ga0207652_10075520 Ga0207652_100755202 305
548 3300025942 Ga0207689_10041319 Ga0207689_100413193 306
549 3300026023 Ga0207677_10009612 Ga0207677_100096122 306
550 3300039062 Ga0400483_271592 Ga0400483_271592_519_1439 306
551 3300039450 Ga0436363_0979243 Ga0436363_0979243_764_1687 307
552 3300048924 Ga0496121_0148193 Ga0496121_0148193_306_1229 307
553 3300002704 JGI25155J39150_1000001 JGI25155J39150_100000197 308
554 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001235 308
555 3300002737 JGI25162J39368_1000209 JGI25162J39368_100020931 308
556 3300002737 JGI25162J39368_1000245 JGI25162J39368_100024531 308
557 3300002738 JGI25154J39366_1000011 JGI25154J39366_1000011148 308
558 3300002739 JGI25158J39367_1000389 JGI25158J39367_10003893 308
559 3300002739 JGI25158J39367_1000892 JGI25158J39367_10008923 308
560 3300002741 JGI25157J39369_1000030 JGI25157J39369_100003037 308
561 3300002774 JGI25150J39212_1000160 JGI25150J39212_100016013 308
562 3300002987 JGI25159J45721_1000082 JGI25159J45721_100008217 308
563 3300002987 JGI25159J45721_1000519 JGI25159J45721_10005199 308
564 3300002987 JGI25159J45721_1002718 JGI25159J45721_10027187 308
565 3300003187 JGI25151J46595_10000083 JGI25151J46595_10000083104 308
566 3300003187 JGI25151J46595_10000603 JGI25151J46595_1000060331 308
567 3300003187 JGI25151J46595_10008521 JGI25151J46595_100085215 308
568 3300003187 JGI25151J46595_10055710 JGI25151J46595_100557102 308
569 3300003187 JGI25151J46595_10061128 JGI25151J46595_100611281 308
570 3300003214 JGI25165J46597_1000302 JGI25165J46597_100030231 308
571 3300003214 JGI25165J46597_1003012 JGI25165J46597_10030123 308
572 3300003215 JGI25153J46596_10000377 JGI25153J46596_100003773 308
573 3300003215 JGI25153J46596_10005742 JGI25153J46596_100057422 308
574 3300003215 JGI25153J46596_10006671 JGI25153J46596_100066711 308
575 3300003323 rootH1_10168964 rootH1_101689644 308
576 3300003354 JGI25160J50197_1000010 JGI25160J50197_100001013 308
577 3300003354 JGI25160J50197_1000011 JGI25160J50197_100001117 308
578 3300003354 JGI25160J50197_1001097 JGI25160J50197_10010972 308
579 3300003354 JGI25160J50197_1011066 JGI25160J50197_10110662 308
580 3300003374 JGI25161J50226_1000006 JGI25161J50226_100000613 308
581 3300003374 JGI25161J50226_1000135 JGI25161J50226_100013519 308
582 3300003374 JGI25161J50226_1000386 JGI25161J50226_100038617 308
583 3300003374 JGI25161J50226_1001023 JGI25161J50226_10010232 308
584 3300003771 Ga0055526_1000966 Ga0055526_10009666 308
585 3300003771 Ga0055526_1000998 Ga0055526_100099816 308
586 3300003771 Ga0055526_1003879 Ga0055526_10038792 308
587 3300003771 Ga0055526_1004396 Ga0055526_10043963 308
588 3300003775 Ga0055524_1001285 Ga0055524_100128516 308
589 3300003775 Ga0055524_1001423 Ga0055524_100142314 308
590 3300003775 Ga0055524_1005600 Ga0055524_10056002 308
591 3300003775 Ga0055524_1009738 Ga0055524_10097384 308
592 3300003775 Ga0055524_1011321 Ga0055524_10113212 308
593 3300003775 Ga0055524_1013582 Ga0055524_10135822 308
594 3300003781 Ga0055536_1000683 Ga0055536_10006833 308
595 3300003781 Ga0055536_1006078 Ga0055536_10060785 308
596 3300003790 Ga0055528_1000057 Ga0055528_100005761 308
597 3300003790 Ga0055528_1000676 Ga0055528_10006766 308
598 3300003790 Ga0055528_1001698 Ga0055528_10016982 308
599 3300003790 Ga0055528_1017773 Ga0055528_10177731 308
600 3300003790 Ga0055528_1024612 Ga0055528_10246122 308
601 3300003790 Ga0055528_1026737 Ga0055528_10267371 308
602 3300003791 Ga0055530_10014446 Ga0055530_100144464 308
603 3300003792 Ga0055540_1000354 Ga0055540_100035411 308
604 3300003792 Ga0055540_1003917 Ga0055540_10039177 308
605 3300003794 Ga0055531_10007227 Ga0055531_100072273 308
606 3300003856 Ga0058692_1001385 Ga0058692_10013854 308
607 3300003856 Ga0058692_1001689 Ga0058692_10016893 308
608 3300003856 Ga0058692_1005892 Ga0058692_10058924 308
609 3300004625 Ga0055543_1000210 Ga0055543_100021034 308
610 3300004625 Ga0055543_1000219 Ga0055543_10002193 308
611 3300004625 Ga0055543_1000281 Ga0055543_100028113 308
612 3300004625 Ga0055543_1006052 Ga0055543_10060523 308
613 3300005262 Ga0065165_1000018 Ga0065165_100001817 308
614 3300005262 Ga0065165_1002907 Ga0065165_10029071 308
615 3300005262 Ga0065165_1011929 Ga0065165_10119292 308
616 3300005262 Ga0065165_1027954 Ga0065165_10279542 308
617 3300005331 Ga0070670_100002254 Ga0070670_10000225417 308
618 3300005338 Ga0068868_100002744 Ga0068868_10000274412 308
619 3300005339 Ga0070660_100123104 Ga0070660_1001231042 308
620 3300005366 Ga0070659_100005963 Ga0070659_1000059639 308
621 3300005455 Ga0070663_100206256 Ga0070663_1002062562 308
622 3300005455 Ga0070663_100526472 Ga0070663_1005264721 308
623 3300005457 Ga0070662_100036242 Ga0070662_1000362424 308
624 3300005530 Ga0070679_100023720 Ga0070679_1000237202 308
625 3300005548 Ga0070665_100004423 Ga0070665_1000044232 308
626 3300005548 Ga0070665_100316130 Ga0070665_1003161302 308
627 3300005563 Ga0068855_100024084 Ga0068855_1000240847 308
628 3300005563 Ga0068855_100462121 Ga0068855_1004621212 308
629 3300005614 Ga0068856_100003012 Ga0068856_10000301211 308
630 3300005614 Ga0068856_100269427 Ga0068856_1002694272 308
631 3300005616 Ga0068852_100008346 Ga0068852_1000083465 308
632 3300006038 Ga0075365_10000306 Ga0075365_100003067 308
633 3300006038 Ga0075365_10005301 Ga0075365_100053016 308
634 3300006038 Ga0075365_10024880 Ga0075365_100248802 308
635 3300006038 Ga0075365_10035632 Ga0075365_100356323 308
636 3300006042 Ga0075368_10014305 Ga0075368_100143055 308
637 3300006042 Ga0075368_10092563 Ga0075368_100925631 308
638 3300006048 Ga0075363_100018849 Ga0075363_1000188494 308
639 3300006051 Ga0075364_10000062 Ga0075364_1000006241 308
640 3300006177 Ga0075362_10002198 Ga0075362_100021983 308
641 3300006177 Ga0075362_10005192 Ga0075362_100051923 308
642 3300006178 Ga0075367_10001214 Ga0075367_100012145 308
643 3300006178 Ga0075367_10059374 Ga0075367_100593742 308
644 3300006178 Ga0075367_10143651 Ga0075367_101436512 308
645 3300006186 Ga0075369_10002498 Ga0075369_100024986 308
646 3300006186 Ga0075369_10021925 Ga0075369_100219252 308
647 3300006186 Ga0075369_10035069 Ga0075369_100350692 308
648 3300006195 Ga0075366_10055065 Ga0075366_100550651 308
649 3300006195 Ga0075366_10109239 Ga0075366_101092391 308
650 3300006195 Ga0075366_10178951 Ga0075366_101789512 308
651 3300006353 Ga0075370_10008899 Ga0075370_100088993 308
652 3300006358 Ga0068871_100001547 Ga0068871_10000154712 308
653 3300006946 Ga0079104_1000022 Ga0079104_100002218 308
654 3300006946 Ga0079104_1005993 Ga0079104_10059934 308
655 3300006948 Ga0099826_10001252 Ga0099826_1000125211 308
656 3300009093 Ga0105240_10000005 Ga0105240_10000005682 308
657 3300009093 Ga0105240_10136586 Ga0105240_101365863 308
658 3300009148 Ga0105243_10007952 Ga0105243_100079525 308
659 3300009148 Ga0105243_10033768 Ga0105243_100337683 308
660 3300009177 Ga0105248_10522939 Ga0105248_105229391 308
661 3300009545 Ga0105237_10002054 Ga0105237_1000205415 308
662 3300009551 Ga0105238_10016781 Ga0105238_100167813 308
663 3300009551 Ga0105238_10352693 Ga0105238_103526932 308
664 3300009765 Ga0123341_1000188 Ga0123341_100018828 308
665 3300009766 Ga0123342_1019153 Ga0123342_10191535 308
666 3300012513 Ga0157326_1003237 Ga0157326_10032372 308
667 3300013100 Ga0157373_10005452 Ga0157373_1000545216 308
668 3300013100 Ga0157373_10016514 Ga0157373_100165144 308
669 3300013102 Ga0157371_10000240 Ga0157371_1000024017 308
670 3300013104 Ga0157370_10000046 Ga0157370_1000004694 308
671 3300013104 Ga0157370_10000322 Ga0157370_1000032259 308
672 3300013104 Ga0157370_10245081 Ga0157370_102450812 308
673 3300013249 Ga0171463_1003 Ga0171463_1003685 308
674 3300013306 Ga0163162_10124933 Ga0163162_101249332 308
675 3300014325 Ga0163163_10189410 Ga0163163_101894102 308
676 3300015262 Ga0182007_10001390 Ga0182007_100013904 308
677 3300015690 Ga0183363_1076 Ga0183363_107618 308
678 3300021320 Ga0214544_1003180 Ga0214544_100318024 308
679 3300021321 Ga0214542_1006037 Ga0214542_100603715 308
680 3300021321 Ga0214542_1016584 Ga0214542_10165847 308
681 3300021327 Ga0214543_1000011 Ga0214543_1000011113 308
682 3300021327 Ga0214543_1005795 Ga0214543_100579515 308
683 3300022739 Ga0228711_1003475 Ga0228711_100347523 308
684 3300022740 Ga0228710_1003691 Ga0228710_100369122 308
685 3300025206 Ga0209435_100012 Ga0209435_100012147 308
686 3300025208 Ga0209436_100059 Ga0209436_10005948 308
687 3300025208 Ga0209436_103167 Ga0209436_1031676 308
688 3300025233 Ga0209437_100047 Ga0209437_100047144 308
689 3300025233 Ga0209437_100165 Ga0209437_10016545 308
690 3300025233 Ga0209437_102553 Ga0209437_1025533 308
691 3300025245 Ga0207425_1000024 Ga0207425_1000024146 308
692 3300025245 Ga0207425_1002285 Ga0207425_10022856 308
693 3300025245 Ga0207425_1004847 Ga0207425_10048472 308
694 3300025246 Ga0209646_1000026 Ga0209646_1000026147 308
695 3300025250 Ga0209026_1000014 Ga0209026_1000014147 308
696 3300025253 Ga0209677_101200 Ga0209677_10120010 308
697 3300025256 Ga0209759_1000012 Ga0209759_1000012147 308
698 3300025258 Ga0209129_1000069 Ga0209129_100006947 308
699 3300025258 Ga0209129_1000184 Ga0209129_100018434 308
700 3300025258 Ga0209129_1000376 Ga0209129_100037635 308
701 3300025258 Ga0209129_1001566 Ga0209129_100156610 308
702 3300025258 Ga0209129_1006080 Ga0209129_10060805 308
703 3300025261 Ga0209233_1000048 Ga0209233_1000048258 308
704 3300025261 Ga0209233_1000069 Ga0209233_1000069175 308
705 3300025261 Ga0209233_1000195 Ga0209233_1000195100 308
706 3300025273 Ga0209673_1000013 Ga0209673_1000013315 308
707 3300025273 Ga0209673_1000048 Ga0209673_1000048266 308
708 3300025273 Ga0209673_1000296 Ga0209673_100029639 308
709 3300025273 Ga0209673_1000850 Ga0209673_100085021 308
710 3300025273 Ga0209673_1005236 Ga0209673_10052368 308
711 3300025273 Ga0209673_1005529 Ga0209673_10055291 308
712 3300025273 Ga0209673_1017286 Ga0209673_10172863 308
713 3300025273 Ga0209673_1017552 Ga0209673_10175522 308
714 3300025273 Ga0209673_1028720 Ga0209673_10287202 308
715 3300025284 Ga0209130_1000004 Ga0209130_1000004381 308
716 3300025284 Ga0209130_1000021 Ga0209130_1000021252 308
717 3300025284 Ga0209130_1000029 Ga0209130_1000029235 308
718 3300025292 Ga0209676_1011502 Ga0209676_10115026 308
719 3300025292 Ga0209676_1013886 Ga0209676_10138865 308
720 3300025294 Ga0209025_1000050 Ga0209025_1000050181 308
721 3300025294 Ga0209025_1000119 Ga0209025_1000119113 308
722 3300025294 Ga0209025_1000166 Ga0209025_1000166142 308
723 3300025294 Ga0209025_1000445 Ga0209025_100044560 308
724 3300025294 Ga0209025_1000843 Ga0209025_100084344 308
725 3300025294 Ga0209025_1001294 Ga0209025_100129420 308
726 3300025294 Ga0209025_1004960 Ga0209025_10049604 308
727 3300025294 Ga0209025_1014039 Ga0209025_10140394 308
728 3300025294 Ga0209025_1014255 Ga0209025_10142553 308
729 3300025294 Ga0209025_1031377 Ga0209025_10313773 308
730 3300025294 Ga0209025_1061613 Ga0209025_10616132 308
731 3300025295 Ga0209564_1000362 Ga0209564_100036237 308
732 3300025295 Ga0209564_1000501 Ga0209564_100050150 308
733 3300025295 Ga0209564_1000584 Ga0209564_100058448 308
734 3300025295 Ga0209564_1000920 Ga0209564_100092032 308
735 3300025295 Ga0209564_1011379 Ga0209564_10113794 308
736 3300025295 Ga0209564_1020744 Ga0209564_10207442 308
737 3300025297 Ga0209758_1000083 Ga0209758_100008376 308
738 3300025297 Ga0209758_1000770 Ga0209758_100077046 308
739 3300025297 Ga0209758_1001392 Ga0209758_100139235 308
740 3300025297 Ga0209758_1001541 Ga0209758_100154129 308
741 3300025297 Ga0209758_1004667 Ga0209758_10046672 308
742 3300025297 Ga0209758_1031289 Ga0209758_10312893 308
743 3300025297 Ga0209758_1043080 Ga0209758_10430801 308
744 3300025298 Ga0209050_1002344 Ga0209050_100234421 308
745 3300025298 Ga0209050_1016881 Ga0209050_10168812 308
746 3300025298 Ga0209050_1018210 Ga0209050_10182104 308
747 3300025299 Ga0209256_1000194 Ga0209256_100019486 308
748 3300025299 Ga0209256_1000383 Ga0209256_100038357 308
749 3300025299 Ga0209256_1000588 Ga0209256_100058832 308
750 3300025299 Ga0209256_1001125 Ga0209256_100112518 308
751 3300025299 Ga0209256_1010263 Ga0209256_10102633 308
752 3300025299 Ga0209256_1013180 Ga0209256_10131802 308
753 3300025299 Ga0209256_1016860 Ga0209256_10168601 308
754 3300025299 Ga0209256_1027123 Ga0209256_10271232 308
755 3300025302 Ga0207426_1000003 Ga0207426_1000003346 308
756 3300025302 Ga0207426_1000010 Ga0207426_1000010106 308
757 3300025302 Ga0207426_1000039 Ga0207426_1000039231 308
758 3300025302 Ga0207426_1000074 Ga0207426_100007463 308
759 3300025302 Ga0207426_1004684 Ga0207426_10046844 308
760 3300025303 Ga0209051_1000611 Ga0209051_100061131 308
761 3300025303 Ga0209051_1000691 Ga0209051_100069135 308
762 3300025303 Ga0209051_1002092 Ga0209051_10020929 308
763 3300025303 Ga0209051_1004215 Ga0209051_10042153 308
764 3300025303 Ga0209051_1010363 Ga0209051_10103635 308
765 3300025303 Ga0209051_1011328 Ga0209051_10113282 308
766 3300025303 Ga0209051_1030892 Ga0209051_10308923 308
767 3300025304 Ga0209257_1002345 Ga0209257_10023459 308
768 3300025304 Ga0209257_1002801 Ga0209257_10028018 308
769 3300025304 Ga0209257_1007967 Ga0209257_10079676 308
770 3300025321 Ga0207656_10025339 Ga0207656_100253392 308
771 3300025909 Ga0207705_10002300 Ga0207705_1000230015 308
772 3300025909 Ga0207705_10018354 Ga0207705_100183542 308
773 3300025913 Ga0207695_10000011 Ga0207695_10000011235 308
774 3300025914 Ga0207671_10000241 Ga0207671_1000024144 308
775 3300025919 Ga0207657_10010030 Ga0207657_100100306 308
776 3300025919 Ga0207657_10047528 Ga0207657_100475282 308
777 3300025920 Ga0207649_10018650 Ga0207649_100186502 308
778 3300025924 Ga0207694_10007386 Ga0207694_100073866 308
779 3300025925 Ga0207650_10003509 Ga0207650_1000350912 308
780 3300025926 Ga0207659_10149695 Ga0207659_101496952 308
781 3300025931 Ga0207644_10005615 Ga0207644_100056155 308
782 3300025931 Ga0207644_10167843 Ga0207644_101678432 308
783 3300025933 Ga0207706_10110741 Ga0207706_101107412 308
784 3300025935 Ga0207709_10072636 Ga0207709_100726361 308
785 3300025941 Ga0207711_10380397 Ga0207711_103803971 308
786 3300025945 Ga0207679_10007394 Ga0207679_100073942 308
787 3300025945 Ga0207679_10056293 Ga0207679_100562931 308
788 3300025949 Ga0207667_10132884 Ga0207667_101328843 308
789 3300025981 Ga0207640_10068498 Ga0207640_100684982 308
790 3300026023 Ga0207677_10001645 Ga0207677_100016451 308
791 3300026067 Ga0207678_10042481 Ga0207678_100424813 308
792 3300026067 Ga0207678_10131859 Ga0207678_101318593 308
793 3300026078 Ga0207702_10002981 Ga0207702_100029819 308
794 3300027111 Ga0209281_1000036 Ga0209281_1000036297 308
795 3300027111 Ga0209281_1000047 Ga0209281_1000047239 308
796 3300027111 Ga0209281_1000483 Ga0209281_100048318 308
797 3300027111 Ga0209281_1000663 Ga0209281_10006638 308
798 3300027312 Ga0209371_1000058 Ga0209371_1000058232 308
799 3300027312 Ga0209371_1006281 Ga0209371_10062814 308
800 3300027312 Ga0209371_1013122 Ga0209371_10131222 308
801 3300027666 Ga0209282_1000189 Ga0209282_10001898 308
802 3300027666 Ga0209282_1007853 Ga0209282_10078534 308
803 3300028379 Ga0268266_10115715 Ga0268266_101157152 308
804 3300028379 Ga0268266_10196785 Ga0268266_101967852 308
805 3300028379 Ga0268266_10404076 Ga0268266_104040762 308
806 3300028381 Ga0268264_10059747 Ga0268264_100597472 308
807 3300028794 Ga0307515_10000023 Ga0307515_10000023329 308
808 3300028794 Ga0307515_10015209 Ga0307515_1001520910 308
809 3300028794 Ga0307515_10073060 Ga0307515_100730604 308
810 3300030500 Ga0268256_1000056 Ga0268256_1000056222 308
811 3300030500 Ga0268256_1006303 Ga0268256_10063034 308
812 3300031456 Ga0307513_10007902 Ga0307513_100079022 308
813 3300031456 Ga0307513_10093984 Ga0307513_100939844 308
814 3300031507 Ga0307509_10000074 Ga0307509_1000007425 308
815 3300031548 Ga0307408_100012769 Ga0307408_1000127691 308
816 3300031731 Ga0307405_10081922 Ga0307405_100819221 308
817 3300031852 Ga0307410_10129823 Ga0307410_101298232 308
818 3300031901 Ga0307406_10021730 Ga0307406_100217303 308
819 3300031901 Ga0307406_10084389 Ga0307406_100843892 308
820 3300031911 Ga0307412_10000790 Ga0307412_100007902 308
821 3300031967 Ga0315914_1003371 Ga0315914_100337122 308
822 3300031995 Ga0307409_100240045 Ga0307409_1002400452 308
823 3300032002 Ga0307416_100245995 Ga0307416_1002459952 308
824 3300033430 Ga0315913_1001807 Ga0315913_100180722 308
825 3300033464 Ga0315915_1000701 Ga0315915_10007018 308
826 3300036712 Ga0316584_0236810 Ga0316584_0236810_55_996 308
827 3300041404 Ga0439436_0004359 Ga0439436_0004359_2897_3823 308
828 3300041404 Ga0439436_0052738 Ga0439436_0052738_82_1008 308
829 3300041407 Ga0439447_033566 Ga0439447_033566_203_1129 308
830 3300041413 Ga0439465_0011758 Ga0439465_0011758_79_1005 308
831 3300041413 Ga0439465_0015833 Ga0439465_0015833_914_1840 308
832 3300041498 Ga0451841_0793278 Ga0451841_0793278_482_1408 308
833 3300041503 Ga0451847_0382210 Ga0451847_0382210_289_1215 308
834 3300041509 Ga0451843_0071175 Ga0451843_0071175_428_1354 308
835 3300041907 Ga0452268_35806 Ga0452268_35806_25_951 308
836 3300042007 Ga0439449_0006685 Ga0439449_0006685_2500_3426 308
837 3300042007 Ga0439449_0029465 Ga0439449_0029465_404_1330 308
838 3300042145 Ga0450906_006472 Ga0450906_006472_584_1510 308
839 3300042435 Ga0439434_0017060 Ga0439434_0017060_354_1283 308
840 3300044684 Ga0466966_0037593 Ga0466966_0037593_644_1582 308
841 3300044684 Ga0466966_0091819 Ga0466966_0091819_205_1143 308
842 3300044684 Ga0466966_0093455 Ga0466966_0093455_509_1435 308
843 3300044694 Ga0466963_0020054 Ga0466963_0020054_404_1330 308
844 3300044765 Ga0466970_0000517 Ga0466970_0000517_17757_18683 308
845 3300045049 Ga0466959_0037880 Ga0466959_0037880_2531_3469 308
846 3300045836 Ga0466958_0065259 Ga0466958_0065259_776_1702 308
847 3300045976 Ga0466967_0018889 Ga0466967_0018889_2953_3891 308
848 3300045976 Ga0466967_0060874 Ga0466967_0060874_401_1327 308
849 3300046454 Ga0495592_0029394 Ga0495592_0029394_2972_3898 308
850 3300046459 Ga0495629_0066202 Ga0495629_0066202_1223_2188 308
851 3300046460 Ga0495638_0000453 Ga0495638_0000453_11142_12095 308
852 3300046474 Ga0495605_0002378 Ga0495605_0002378_7822_8775 308
853 3300046476 Ga0495662_0000738 Ga0495662_0000738_12058_12984 308
854 3300046491 Ga0495584_0182580 Ga0495584_0182580_31_984 308
855 3300046492 Ga0495585_0026540 Ga0495585_0026540_1911_2864 308
856 3300046492 Ga0495585_0168852 Ga0495585_0168852_187_1113 308
857 3300046506 Ga0495583_0003907 Ga0495583_0003907_9730_10656 308
858 3300046506 Ga0495583_0009228 Ga0495583_0009228_4533_5486 308
859 3300046507 Ga0495606_0000896 Ga0495606_0000896_36903_37829 308
860 3300046507 Ga0495606_0013851 Ga0495606_0013851_499_1467 308
861 3300046507 Ga0495606_0096727 Ga0495606_0096727_718_1644 308
862 3300046512 Ga0495610_0001683 Ga0495610_0001683_14183_15109 308
863 3300046512 Ga0495610_0032325 Ga0495610_0032325_1637_2563 308
864 3300046513 Ga0495616_0013399 Ga0495616_0013399_3511_4464 308
865 3300046513 Ga0495616_0066835 Ga0495616_0066835_663_1589 308
866 3300046515 Ga0495620_0038596 Ga0495620_0038596_160_1086 308
867 3300046518 Ga0495631_0015517 Ga0495631_0015517_2441_3394 308
868 3300046519 Ga0495632_0020234 Ga0495632_0020234_10_936 308
869 3300046522 Ga0495643_0018990 Ga0495643_0018990_310_1236 308
870 3300046522 Ga0495643_0052561 Ga0495643_0052561_416_1369 308
871 3300046524 Ga0495648_0040559 Ga0495648_0040559_264_1190 308
872 3300046524 Ga0495648_0075474 Ga0495648_0075474_388_1383 308
873 3300046530 Ga0495654_0000090 Ga0495654_0000090_26419_27345 308
874 3300046538 Ga0495609_0046143 Ga0495609_0046143_145_1098 308
875 3300046616 Ga0495668_0029254 Ga0495668_0029254_1464_2417 308
876 3300046648 Ga0495611_0008813 Ga0495611_0008813_261_1214 308
877 3300046660 Ga0495625_0004833 Ga0495625_0004833_415_1368 308
878 3300046660 Ga0495625_0031199 Ga0495625_0031199_517_1443 308
879 3300046660 Ga0495625_0107263 Ga0495625_0107263_683_1609 308
880 3300046674 Ga0495588_0007589 Ga0495588_0007589_71_997 308
881 3300046674 Ga0495588_0090827 Ga0495588_0090827_568_1494 308
882 3300046675 Ga0495657_0037878 Ga0495657_0037878_1824_2750 308
883 3300046691 Ga0495670_0099239 Ga0495670_0099239_115_1068 308
884 3300046692 Ga0495671_0010564 Ga0495671_0010564_563_1489 308
885 3300046809 Ga0495600_0026498 Ga0495600_0026498_1194_2120 308
886 3300046810 Ga0495660_0023572 Ga0495660_0023572_66_1019 308
887 3300046810 Ga0495660_0034796 Ga0495660_0034796_97_1023 308
888 3300047317 Ga0495604_0019136 Ga0495604_0019136_1904_2830 308
889 3300047320 Ga0495672_0172356 Ga0495672_0172356_117_1070 308
890 3300047443 Ga0495687_084227 Ga0495687_084227_62_988 308
891 3300047469 Ga0495673_0034799 Ga0495673_0034799_1170_2096 308
892 3300047470 Ga0495681_0037762 Ga0495681_0037762_1120_2046 308
893 3300047472 Ga0495686_0001000 Ga0495686_0001000_18683_19609 308
894 3300047472 Ga0495686_0005796 Ga0495686_0005796_425_1351 308
895 3300047472 Ga0495686_0018060 Ga0495686_0018060_2215_3141 308
896 3300047472 Ga0495686_0069687 Ga0495686_0069687_752_1678 308
897 3300048088 Ga0495602_0083858 Ga0495602_0083858_762_1688 308
898 3300048091 Ga0495626_0050600 Ga0495626_0050600_809_1735 308
899 3300048903 Ga0496100_0029967 Ga0496100_0029967_26_952 308
900 3300048903 Ga0496100_0408480 Ga0496100_0408480_30_956 308
901 3300048904 Ga0496101_0042328 Ga0496101_0042328_2164_3090 308
902 3300048906 Ga0496103_0113207 Ga0496103_0113207_784_1710 308
903 3300048907 Ga0496104_0000771 Ga0496104_0000771_8533_9468 308
904 3300048907 Ga0496104_0166225 Ga0496104_0166225_602_1528 308
905 3300048909 Ga0496106_0055859 Ga0496106_0055859_414_1526 308
906 3300048911 Ga0496108_0001711 Ga0496108_0001711_2437_3372 308
907 3300048911 Ga0496108_0039655 Ga0496108_0039655_2564_3490 308
908 3300048912 Ga0496109_0007550 Ga0496109_0007550_7092_8027 308
909 3300048912 Ga0496109_0171241 Ga0496109_0171241_816_1742 308
910 3300048913 Ga0496110_0001734 Ga0496110_0001734_11465_12400 308
911 3300048914 Ga0496111_0001636 Ga0496111_0001636_1429_2355 308
912 3300048914 Ga0496111_0066988 Ga0496111_0066988_1417_2352 308
913 3300048915 Ga0496112_0015892 Ga0496112_0015892_2233_3168 308
914 3300048916 Ga0496113_0019435 Ga0496113_0019435_3764_4699 308
915 3300048916 Ga0496113_0052692 Ga0496113_0052692_14_940 308
916 3300048919 Ga0496116_0000275 Ga0496116_0000275_19097_20035 308
917 3300048919 Ga0496116_0001253 Ga0496116_0001253_22869_23795 308
918 3300048919 Ga0496116_0002733 Ga0496116_0002733_15997_16923 308
919 3300048919 Ga0496116_0003264 Ga0496116_0003264_23_949 308
920 3300048919 Ga0496116_0114290 Ga0496116_0114290_84_1010 308
921 3300048919 Ga0496116_0115880 Ga0496116_0115880_614_1540 308
922 3300048920 Ga0496117_0000002 Ga0496117_0000002_660873_661799 308
923 3300048920 Ga0496117_0000353 Ga0496117_0000353_41664_42590 308
924 3300048920 Ga0496117_0003834 Ga0496117_0003834_7091_8017 308
925 3300048920 Ga0496117_0004228 Ga0496117_0004228_8608_9534 308
926 3300048920 Ga0496117_0023039 Ga0496117_0023039_1203_2165 308
927 3300048920 Ga0496117_0029447 Ga0496117_0029447_1804_2730 308
928 3300048920 Ga0496117_0096579 Ga0496117_0096579_45_971 308
929 3300048921 Ga0496118_0000204 Ga0496118_0000204_67016_67942 308
930 3300048921 Ga0496118_0000319 Ga0496118_0000319_26800_27726 308
931 3300048921 Ga0496118_0063833 Ga0496118_0063833_1700_2626 308
932 3300048921 Ga0496118_0176869 Ga0496118_0176869_47_973 308
933 3300048922 Ga0496119_0004702 Ga0496119_0004702_1834_2760 308
934 3300048922 Ga0496119_0014718 Ga0496119_0014718_3062_3988 308
935 3300048922 Ga0496119_0018311 Ga0496119_0018311_4083_5009 308
936 3300048922 Ga0496119_0037065 Ga0496119_0037065_1745_2671 308
937 3300048922 Ga0496119_0066779 Ga0496119_0066779_694_1656 308
938 3300048923 Ga0496120_0000947 Ga0496120_0000947_33574_34500 308
939 3300048923 Ga0496120_0039314 Ga0496120_0039314_397_1359 308
940 3300048924 Ga0496121_0000003 Ga0496121_0000003_207865_208827 308
941 3300048924 Ga0496121_0000378 Ga0496121_0000378_47363_48289 308
942 3300048924 Ga0496121_0001670 Ga0496121_0001670_15067_16098 308
943 3300048924 Ga0496121_0008020 Ga0496121_0008020_1814_2740 308
944 3300048924 Ga0496121_0021296 Ga0496121_0021296_117_1043 308
945 3300048924 Ga0496121_0042142 Ga0496121_0042142_2769_3695 308
946 3300048924 Ga0496121_0072728 Ga0496121_0072728_1621_2547 308
947 3300048924 Ga0496121_0143325 Ga0496121_0143325_535_1461 308
948 3300048925 Ga0496122_0000001 Ga0496122_0000001_27429_28355 308
949 3300048925 Ga0496122_0000025 Ga0496122_0000025_268278_269204 308
950 3300048925 Ga0496122_0000525 Ga0496122_0000525_48228_49154 308
951 3300048925 Ga0496122_0003799 Ga0496122_0003799_7608_8546 308
952 3300048925 Ga0496122_0006342 Ga0496122_0006342_2281_3207 308
953 3300048925 Ga0496122_0006594 Ga0496122_0006594_211_1137 308
954 3300048925 Ga0496122_0020401 Ga0496122_0020401_2028_2954 308
955 3300048925 Ga0496122_0040318 Ga0496122_0040318_2671_3597 308
956 3300048925 Ga0496122_0047484 Ga0496122_0047484_98_1024 308
957 3300048926 Ga0496123_0000001 Ga0496123_0000001_31160_32086 308
958 3300048926 Ga0496123_0000032 Ga0496123_0000032_95009_95935 308
959 3300048926 Ga0496123_0001014 Ga0496123_0001014_24839_25765 308
960 3300048926 Ga0496123_0002174 Ga0496123_0002174_530_1456 308
961 3300048926 Ga0496123_0005810 Ga0496123_0005810_1175_2101 308
962 3300048926 Ga0496123_0009156 Ga0496123_0009156_6702_7628 308
963 3300048926 Ga0496123_0013259 Ga0496123_0013259_117_1043 308
964 3300048926 Ga0496123_0029085 Ga0496123_0029085_786_1748 308
965 3300048927 Ga0496124_0001286 Ga0496124_0001286_23225_24151 308
966 3300048927 Ga0496124_0003917 Ga0496124_0003917_84_1010 308
967 3300048927 Ga0496124_0004533 Ga0496124_0004533_4739_5665 308
968 3300048927 Ga0496124_0004950 Ga0496124_0004950_164_1090 308
969 3300048927 Ga0496124_0021945 Ga0496124_0021945_725_1651 308
970 3300048927 Ga0496124_0028464 Ga0496124_0028464_3953_4894 308
971 3300048927 Ga0496124_0032379 Ga0496124_0032379_2141_3067 308
972 3300048927 Ga0496124_0034591 Ga0496124_0034591_2324_3286 308
973 3300048927 Ga0496124_0054395 Ga0496124_0054395_2011_2937 308
974 3300048927 Ga0496124_0054665 Ga0496124_0054665_119_1045 308
975 3300048927 Ga0496124_0077930 Ga0496124_0077930_1137_2063 308
976 3300048927 Ga0496124_0083043 Ga0496124_0083043_506_1459 308
977 3300048927 Ga0496124_0099503 Ga0496124_0099503_1349_2275 308
978 3300048927 Ga0496124_0120434 Ga0496124_0120434_167_1093 308
979 3300048927 Ga0496124_0268034 Ga0496124_0268034_86_1012 308
980 3300048928 Ga0496125_0000141 Ga0496125_0000141_128706_129668 308
981 3300048928 Ga0496125_0001877 Ga0496125_0001877_10097_11023 308
982 3300048928 Ga0496125_0002169 Ga0496125_0002169_8344_9270 308
983 3300048928 Ga0496125_0002998 Ga0496125_0002998_4993_5919 308
984 3300048928 Ga0496125_0004376 Ga0496125_0004376_7978_8904 308
985 3300048928 Ga0496125_0026549 Ga0496125_0026549_1593_2519 308
986 3300048928 Ga0496125_0111788 Ga0496125_0111788_576_1502 308
987 3300048928 Ga0496125_0163255 Ga0496125_0163255_256_1182 308
988 3300048929 Ga0496126_0000824 Ga0496126_0000824_27180_28118 308
989 3300048929 Ga0496126_0001019 Ga0496126_0001019_46013_46939 308
990 3300048929 Ga0496126_0035063 Ga0496126_0035063_1299_2261 308
991 3300048929 Ga0496126_0053480 Ga0496126_0053480_1707_2633 308
992 3300048929 Ga0496126_0111978 Ga0496126_0111978_1411_2352 308
993 3300048929 Ga0496126_0127027 Ga0496126_0127027_849_1775 308
994 3300049459 Ga0495678_040915 Ga0495678_040915_231_1157 308
995 3300049459 Ga0495678_081747 Ga0495678_081747_20_946 308
996 3300049460 Ga0495682_0058947 Ga0495682_0058947_13_966 308
997 3300049568 Ga0501031_0047894 Ga0501031_0047894_1519_2445 308
998 3300049569 Ga0501032_0111451 Ga0501032_0111451_784_1719 308
999 3300049569 Ga0501032_0122933 Ga0501032_0122933_630_1556 308
1000 3300049571 Ga0501034_0094364 Ga0501034_0094364_865_1791 308
1001 3300049571 Ga0501034_0109330 Ga0501034_0109330_1613_2548 308
1002 3300049572 Ga0501036_0004299 Ga0501036_0004299_9503_10438 308
1003 3300049573 Ga0501037_0084886 Ga0501037_0084886_992_1927 308
1004 3300049573 Ga0501037_0113275 Ga0501037_0113275_538_1464 308
1005 3300049573 Ga0501037_0311932 Ga0501037_0311932_139_1065 308
1006 3300049574 Ga0501038_0165218 Ga0501038_0165218_221_1219 308
1007 3300049574 Ga0501038_0448421 Ga0501038_0448421_25_951 308
1008 3300049575 Ga0501039_0134220 Ga0501039_0134220_977_1912 308
1009 3300049579 Ga0501043_0046274 Ga0501043_0046274_779_1705 308
1010 3300049580 Ga0501046_0071755 Ga0501046_0071755_286_1221 308
1011 3300049581 Ga0501047_0047685 Ga0501047_0047685_30_956 308
1012 3300049581 Ga0501047_0279435 Ga0501047_0279435_86_1021 308
1013 3300049583 Ga0501067_0083698 Ga0501067_0083698_307_1242 308
1014 3300049584 Ga0501068_0021279 Ga0501068_0021279_1570_2505 308
1015 3300049589 Ga0501073_0081258 Ga0501073_0081258_864_1799 308
1016 3300049590 Ga0501074_0031636 Ga0501074_0031636_586_1521 308
1017 3300049592 Ga0501076_0413090 Ga0501076_0413090_73_1008 308
1018 3300049665 Ga0501227_043405 Ga0501227_043405_119_1045 308
1019 3300049741 Ga0501079_0007301 Ga0501079_0007301_6711_7646 308
1020 3300049742 Ga0501080_0059453 Ga0501080_0059453_1758_2693 308
1021 3300049742 Ga0501080_0082768 Ga0501080_0082768_349_1275 308
1022 3300049742 Ga0501080_0291514 Ga0501080_0291514_355_1353 308
1023 3300049744 Ga0501083_0078119 Ga0501083_0078119_435_1361 308
1024 3300049776 Ga0501280_002708 Ga0501280_002708_697_1623 308
1025 3300049823 Ga0501044_0000351 Ga0501044_0000351_16813_17808 308
1026 3300049823 Ga0501044_0053600 Ga0501044_0053600_3040_3966 308
1027 3300049823 Ga0501044_0168565 Ga0501044_0168565_515_1513 308
1028 3300049823 Ga0501044_0401419 Ga0501044_0401419_15_950 308
1029 3300049824 Ga0501045_0115040 Ga0501045_0115040_922_1857 308
1030 3300050490 nmdc:mga03n38_4597_c1 nmdc:mga03n38_4597_c1_3479_4405 308
1031 3300050491 nmdc:mga00v17_107_c1 nmdc:mga00v17_107_c1_39679_40605 308
1032 3300050491 nmdc:mga00v17_204314_c1 nmdc:mga00v17_204314_c1_203_1234 308
1033 3300050491 nmdc:mga00v17_77_c2 nmdc:mga00v17_77_c2_42723_43691 308
1034 3300050492 nmdc:mga0yw44_27396_c1 nmdc:mga0yw44_27396_c1_1577_2515 308
1035 3300050492 nmdc:mga0yw44_61038_c1 nmdc:mga0yw44_61038_c1_414_1340 308
1036 3300050493 nmdc:mga0k408_55639_c1 nmdc:mga0k408_55639_c1_1078_2004 308
1037 3300050494 nmdc:mga06z11_19122_c1 nmdc:mga06z11_19122_c1_1636_2562 308
1038 3300050494 nmdc:mga06z11_233476_c1 nmdc:mga06z11_233476_c1_77_1003 308
1039 3300050494 nmdc:mga06z11_8273_c1 nmdc:mga06z11_8273_c1_1101_2036 308
1040 3300050495 nmdc:mga04h51_2273_c1 nmdc:mga04h51_2273_c1_862_1797 308
1041 3300050496 nmdc:mga07m45_9261_c1 nmdc:mga07m45_9261_c1_3212_4138 308
1042 3300050516 nmdc:mga0sz30_10436_c1 nmdc:mga0sz30_10436_c1_2342_3307 308
1043 3300050516 nmdc:mga0sz30_28781_c1 nmdc:mga0sz30_28781_c1_1313_2239 308
1044 3300053077 Ga0495601_0146192 Ga0495601_0146192_169_1095 308
1045 3300053079 Ga0500610_0065099 Ga0500610_0065099_183_1136 308
1046 3300053086 Ga0500578_0082893 Ga0500578_0082893_1050_1976 308
1047 3300053086 Ga0500578_0088529 Ga0500578_0088529_759_1712 308
1048 3300053107 Ga0500560_000596 Ga0500560_000596_3119_4084 308
1049 3300053107 Ga0500560_010809 Ga0500560_010809_474_1400 308
1050 3300053109 Ga0500569_001590 Ga0500569_001590_2171_3097 308
1051 3300053109 Ga0500569_006582 Ga0500569_006582_1408_2361 308
1052 3300053125 Ga0500618_000125 Ga0500618_000125_23049_24062 308
1053 3300053125 Ga0500618_000261 Ga0500618_000261_36561_37487 308
1054 3300053125 Ga0500618_001334 Ga0500618_001334_218_1144 308
1055 3300053134 Ga0500658_0001147 Ga0500658_0001147_1482_2408 308
1056 3300053137 Ga0500561_0000496 Ga0500561_0000496_788_1714 308
1057 3300053139 Ga0500568_0001773 Ga0500568_0001773_7707_8660 308
1058 3300053139 Ga0500568_0080537 Ga0500568_0080537_265_1191 308
1059 3300053140 Ga0500573_0000277 Ga0500573_0000277_9598_10524 308
1060 3300053148 Ga0500590_007266 Ga0500590_007266_2226_3152 308
1061 3300053153 Ga0500616_0001525 Ga0500616_0001525_15678_16616 308
1062 3300053153 Ga0500616_0003879 Ga0500616_0003879_296_1249 308
1063 3300053153 Ga0500616_0040257 Ga0500616_0040257_1405_2331 308
1064 3300053156 Ga0500622_0000443 Ga0500622_0000443_36580_37506 308
1065 3300053156 Ga0500622_0105017 Ga0500622_0105017_402_1328 308
1066 3300053157 Ga0500624_003434 Ga0500624_003434_44_1009 308
1067 3300053158 Ga0500627_0016200 Ga0500627_0016200_359_1312 308
1068 3300053161 Ga0500634_0092498 Ga0500634_0092498_487_1452 308
1069 3300053177 Ga0500636_0000118 Ga0500636_0000118_7893_8831 308
1070 3300053177 Ga0500636_0009118 Ga0500636_0009118_4311_5249 308
1071 3300053177 Ga0500636_0101511 Ga0500636_0101511_218_1144 308
1072 3300054114 Ga0501084_0414640 Ga0501084_0414640_113_1048 308
1073 3300059644 Ga0587075_001785 Ga0587075_001785_1037_1963 308
1074 3300059645 Ga0587076_010305 Ga0587076_010305_337_1263 308
1075 3300059646 Ga0587078_001579 Ga0587078_001579_822_1748 308
1076 3300060353 Ga0501082_0175862 Ga0501082_0175862_583_1518 308
1077 iso_pu_bacteria 2510917030 2511195461 308
1078 iso_pu_bacteria 2513237103 2513708595 308
1079 iso_pu_bacteria 2517093000 2517095296 308
1080 iso_pu_bacteria 2554235003 2554248054 308
1081 iso_pu_bacteria 2582581298 2585224536 308
1082 iso_pu_bacteria 2585427529 2585546657 308
1083 iso_pu_bacteria 2643221568 2643857794 308
1084 iso_pu_bacteria 2808606387 2808985111 308
1085 iso_pu_bacteria 2818991439 2819559539 308
1086 iso_pu_bacteria 2818991461 2819687367 308
1087 iso_pu_bacteria 2821123053 2821128042 308
1088 iso_pu_bacteria 2838675328 2838675974 308
1089 iso_pu_bacteria 2838724970 2838725616 308
1090 iso_pu_bacteria 2842124991 2842125659 308
1091 iso_pu_bacteria 2857531043 2857535084 308
1092 iso_pu_bacteria 2919166419 2919167964 308
1093 iso_pu_bacteria 2929138655 2929140680 308
1094 iso_pu_bacteria 2933006813 2933008606 308
1095 iso_pu_bacteria 2978969890 2978974416 308
1096 iso_pu_bacteria 2979089926 2979094499 308
1097 iso_pu_bacteria 2979095461 2979098118 308
1098 iso_pu_bacteria 2979100975 2979103743 308
1099 iso_pu_bacteria 2984509177 2984511693 308
1100 iso_pu_bacteria 2984518228 2984521946 308
1101 iso_pu_bacteria 2984537506 2984541244 308
1102 iso_pu_bacteria 2984587000 2984589754 308
1103 iso_pu_bacteria 2984601300 2984603524 308
1104 iso_pu_bacteria 650716007 650740379 308
1105 iso_pu_bacteria 8005301065 8005302673 308
1106 iso_pu_bacteria 8054460903 8054462707 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

159

0.96

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

30

208

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x40-assembly1.cif.gz_B structure of a cbio dimer bound with amppcp 0.9325 1 223
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9238 1 225
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9177 1 225
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9161 5 222
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.916 3 218
ID Description Score Start End Superfamily
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9629 1 225 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9398 3 225 3.40.50.300
af_Q0E8Q7_1247_1483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9375 1 221 3.40.50.300
af_Q9VRG3_531_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9333 3 224 3.40.50.300
af_Q2FWW7_2_234_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9323 4 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2Z2I0C4-F1-model_v4 ABC transporter ATP-binding protein 0.9519 3 220 GO:0005524
GO:0016887
AF-A0A7D4BZX1-F1-model_v4 deleted 0.9444 5 220
AF-A0A1M4XG17-F1-model_v4 Peptide/nickel transport system ATP-binding protein 0.9405 2 217 GO:0005524
GO:0016887
GO:0055085
AF-A0A2E4TFJ2-F1-model_v4 MFS transporter 0.9401 5 156 GO:0005524
GO:0016887
AF-A0A2H1KK83-F1-model_v4 Glycine betaine/proline transport system ATP-binding protein (EC 3.6.3.32) 0.9399 3 222 GO:0005524
GO:0006865
GO:0016020
GO:0016887
GO:0031460

Feature Viewer

pLDDT pTM Quality
87.85 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map