F490163

General Info

Members Datasets Scaffolds Average Seq Length
1106 402 1088 386

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0002084|Ga0500568_0002084_2601_3893
Length 430
Sequence VSDDSDHRAGVITDSANNACITVAAGSGFTNGFTINPGPRMKITEIRTRVVQWRGKTVPLPPHFCTNPMDLLSLPQASMSTFTFHGWLIVEVFTDQGIVGVGNAALSPQVTKEVIDRYLAPLLIGHDPWDLEFLWQHMYRKTMAFGRKGIGMVAISAVDIALWDVLGKAAKQPCYRLLGGRTKSRVPVYASRLYSVPLDQLASEAARYKSEGYKAMKLRFGWGPVDGAEGMRKNLDLVRTVRETVGDGIDVMADAYMGWTLDYAKRMLPLLEPFNLRWLEEPVIPDDIQGYAQLKAYGRVPIAGGEHEFTLFGAHDLLQARAVDYLQVDINRVGGLTAARKISALAEAHQVPVIPHAGQMHNYHLVMASLNSPMAEHFPIVDVEVGNELFWYIFDGEPKAVDGHIDLDENKPGLGLTINEDKLREFEVTG

Samples

Sample ID Description Type Environment
1 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
2 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
3 2643221672 Variovorax sp. Root434 Isolate Unclassified
4 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
5 2721755523 Delftia sp. HK171 Isolate Unclassified
6 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
7 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
8 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
9 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
10 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
11 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
12 2928163908 Burkholderia sp. 567 Isolate Unclassified
13 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
14 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
146 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
150 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
151 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
221 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
222 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
227 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
228 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
229 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
230 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
231 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
234 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
235 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
238 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
247 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
248 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
249 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
250 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
251 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
252 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
253 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
254 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
255 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
256 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
257 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
266 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
267 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
270 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
271 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
272 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
273 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
276 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
277 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
278 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
279 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
280 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
281 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
286 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
296 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
314 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
349 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
352 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
356 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
367 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
368 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
369 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
370 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
375 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
376 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
379 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
380 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
381 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
386 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
389 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
390 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
391 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
392 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
393 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
394 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
395 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
396 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
397 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
398 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
399 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
400 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
401 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
402 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0.27
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.98
Nodule 0.18
Rhizoplane 3.25
Rhizosphere 90.33
Stem 0
Stem Tuber 0
Unclassified 2.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009447 3300001979 Bacteria 3818
2 JGI24033J26618_1000037 3300002155 Bacteria 19323
3 JGI24742J22300_10003287 3300002244 Bacteria 2619
4 rootH2_10268766 3300003320 Bacteria 2490
5 Ga0055532_1000113 3300003758 Bacteria 86629
6 Ga0055527_1000242 3300003760 Bacteria 33845
7 Ga0055535_1000099 3300003761 Bacteria 93955
8 Ga0055542_1000135 3300003762 Bacteria 93970
9 Ga0055529_1000115 3300003763 Bacteria 118392
10 Ga0055536_1001612 3300003781 Bacteria 13466
11 Ga0055528_1007543 3300003790 Bacteria 4796
12 Ga0055530_10004685 3300003791 Bacteria 6936
13 Ga0055540_1000397 3300003792 Bacteria 35727
14 Ga0055531_10000503 3300003794 Bacteria 35727
15 Ga0065704_10091282 3300005289 Bacteria 2727
16 Ga0065707_10083153 3300005295 Bacteria 10180
17 Ga0070658_10003728 3300005327 Bacteria 12466
18 Ga0070658_10004063 3300005327 Bacteria 11996
19 Ga0070658_10062775 3300005327 Bacteria 3028
20 Ga0070658_10096057 3300005327 Bacteria 2446
21 Ga0070676_10156917 3300005328 Bacteria 1461
22 Ga0070683_100009033 3300005329 Bacteria 8505
23 Ga0070683_100011056 3300005329 Bacteria 7781
24 Ga0070683_100021235 3300005329 Bacteria 5792
25 Ga0070683_100068110 3300005329 Bacteria 3316
26 Ga0070683_100069940 3300005329 Bacteria 3273
27 Ga0070683_100080234 3300005329 Unclassified 3055
28 Ga0070683_100134495 3300005329 Bacteria 2341
29 Ga0070683_100418765 3300005329 Unclassified 1278
30 Ga0070690_100019999 3300005330 Bacteria 4074
31 Ga0070670_100061559 3300005331 Bacteria 3222
32 Ga0070670_100115718 3300005331 Bacteria 2312
33 Ga0070670_100336729 3300005331 Bacteria 1324
34 Ga0068869_100003330 3300005334 Bacteria 9817
35 Ga0068869_100009877 3300005334 Bacteria 6198
36 Ga0068869_100180815 3300005334 Unclassified 1653
37 Ga0070666_10085756 3300005335 Unclassified 2157
38 Ga0070680_100028433 3300005336 Bacteria 4484
39 Ga0070680_100110941 3300005336 Bacteria 2283
40 Ga0070680_100221134 3300005336 Bacteria 1598
41 Ga0070680_100225313 3300005336 Bacteria 1583
42 Ga0070680_100309797 3300005336 Eukaryota 1339
43 Ga0070680_100330784 3300005336 Bacteria 1294
44 Ga0070682_100188796 3300005337 Bacteria 1445
45 Ga0068868_100000995 3300005338 Bacteria 19323
46 Ga0068868_100036285 3300005338 Unclassified 3815
47 Ga0068868_100075271 3300005338 Bacteria 2698
48 Ga0068868_100132870 3300005338 Bacteria 2038
49 Ga0070660_100000020 3300005339 Bacteria 98286
50 Ga0070660_100021389 3300005339 Bacteria 4770
51 Ga0070660_100102532 3300005339 Bacteria 2268
52 Ga0070660_100142442 3300005339 Bacteria 1924
53 Ga0070660_100154512 3300005339 Bacteria 1847
54 Ga0070661_100000291 3300005344 Bacteria 40590
55 Ga0070661_100005720 3300005344 Bacteria 8567
56 Ga0070661_100006096 3300005344 Bacteria 8299
57 Ga0070661_100041201 3300005344 Bacteria 3370
58 Ga0070661_100044521 3300005344 Bacteria 3242
59 Ga0070661_100053750 3300005344 Bacteria 2948
60 Ga0070661_100108621 3300005344 Bacteria 2070
61 Ga0070668_100023467 3300005347 Bacteria 4666
62 Ga0070668_100076790 3300005347 Bacteria 2610
63 Ga0070668_100166764 3300005347 Bacteria 1790
64 Ga0070669_100041171 3300005353 Bacteria 3360
65 Ga0070675_100004246 3300005354 Bacteria 10905
66 Ga0070675_100062714 3300005354 Bacteria 3071
67 Ga0070673_100104832 3300005364 Bacteria 2335
68 Ga0070688_100021582 3300005365 Bacteria 3762
69 Ga0070688_100131208 3300005365 Bacteria 1691
70 Ga0070659_100000047 3300005366 Bacteria 98286
71 Ga0070659_100017358 3300005366 Bacteria 5414
72 Ga0070659_100053246 3300005366 Bacteria 3185
73 Ga0070667_100024223 3300005367 Bacteria 5042
74 Ga0070667_100104852 3300005367 Bacteria 2446
75 Ga0070667_100169212 3300005367 Bacteria 1928
76 Ga0070667_100243182 3300005367 Bacteria 1607
77 Ga0070709_10000744 3300005434 Bacteria 18437
78 Ga0070709_10052674 3300005434 Bacteria 2559
79 Ga0070709_10156950 3300005434 Bacteria 1578
80 Ga0070714_100000027 3300005435 Bacteria 141750
81 Ga0070714_100008972 3300005435 Bacteria 7828
82 Ga0070714_100055781 3300005435 Bacteria 3378
83 Ga0070714_100409118 3300005435 Bacteria 1284
84 Ga0070713_100000070 3300005436 Bacteria 64658
85 Ga0070713_100001120 3300005436 Bacteria 17094
86 Ga0070713_100005813 3300005436 Bacteria 8478
87 Ga0070713_100006427 3300005436 Bacteria 8147
88 Ga0070713_100079033 3300005436 Bacteria 2801
89 Ga0070713_100366177 3300005436 Bacteria 1340
90 Ga0070710_10054630 3300005437 Bacteria 2254
91 Ga0070710_10062584 3300005437 Bacteria 2123
92 Ga0070710_10109345 3300005437 Bacteria 1658
93 Ga0070711_100000078 3300005439 Bacteria 54188
94 Ga0070711_100001722 3300005439 Bacteria 12135
95 Ga0070694_100220469 3300005444 Bacteria 1422
96 Ga0070708_100047456 3300005445 Bacteria 3794
97 Ga0070708_100060194 3300005445 Bacteria 3389
98 Ga0070663_100000758 3300005455 Bacteria 17506
99 Ga0070678_100141492 3300005456 Bacteria 1926
100 Ga0070678_100191780 3300005456 Bacteria 1680
101 Ga0070678_100311823 3300005456 Bacteria 1341
102 Ga0070662_100238744 3300005457 Bacteria 1457
103 Ga0070681_10000149 3300005458 Bacteria 53023
104 Ga0070681_10009094 3300005458 Bacteria 9761
105 Ga0070681_10019874 3300005458 Bacteria 6729
106 Ga0070681_10036358 3300005458 Bacteria 4945
107 Ga0070681_10117020 3300005458 Bacteria 2602
108 Ga0070681_10137801 3300005458 Bacteria 2370
109 Ga0070681_10140657 3300005458 Bacteria 2343
110 Ga0070681_10143054 3300005458 Bacteria 2321
111 Ga0070681_10162661 3300005458 Bacteria 2156
112 Ga0070681_10172737 3300005458 Bacteria 2083
113 Ga0070681_10205948 3300005458 Bacteria 1884
114 Ga0068867_100075404 3300005459 Bacteria 2530
115 Ga0068867_100087773 3300005459 Bacteria 2356
116 Ga0068867_100215325 3300005459 Bacteria 1545
117 Ga0070706_100001937 3300005467 Bacteria 21337
118 Ga0070707_100336917 3300005468 Bacteria 1466
119 Ga0070698_100382453 3300005471 Bacteria 1340
120 Ga0070699_100297796 3300005518 Bacteria 1447
121 Ga0070679_100009893 3300005530 Bacteria 9023
122 Ga0070679_100010417 3300005530 Bacteria 8819
123 Ga0070679_100015002 3300005530 Bacteria 7445
124 Ga0070679_100015901 3300005530 Bacteria 7242
125 Ga0070679_100063691 3300005530 Bacteria 3675
126 Ga0070679_100093020 3300005530 Bacteria 3003
127 Ga0070679_100119700 3300005530 Bacteria 2618
128 Ga0070679_100164794 3300005530 Bacteria 2190
129 Ga0070684_100001586 3300005535 Bacteria 16405
130 Ga0070684_100004240 3300005535 Bacteria 10865
131 Ga0070684_100038630 3300005535 Bacteria 4102
132 Ga0070684_100297393 3300005535 Bacteria 1481
133 Ga0070697_100000588 3300005536 Bacteria 27480
134 Ga0068853_100000178 3300005539 Bacteria 44364
135 Ga0068853_100031767 3300005539 Bacteria 4468
136 Ga0068853_100062523 3300005539 Bacteria 3222
137 Ga0068853_100297086 3300005539 Bacteria 1492
138 Ga0070672_100007077 3300005543 Bacteria 7587
139 Ga0070672_100055899 3300005543 Bacteria 3093
140 Ga0070686_100152998 3300005544 Bacteria 1617
141 Ga0070695_100106166 3300005545 Bacteria 1899
142 Ga0070696_100134424 3300005546 Bacteria 1802
143 Ga0070693_100040243 3300005547 Unclassified 2623
144 Ga0070665_100030207 3300005548 Bacteria 5454
145 Ga0070704_100215646 3300005549 Bacteria 1558
146 Ga0068855_100000234 3300005563 Bacteria 70713
147 Ga0068855_100000872 3300005563 Bacteria 37469
148 Ga0068855_100006297 3300005563 Bacteria 14465
149 Ga0068855_100020482 3300005563 Bacteria 7930
150 Ga0068855_100020735 3300005563 Bacteria 7883
151 Ga0068855_100039858 3300005563 Bacteria 5576
152 Ga0068855_100071120 3300005563 Bacteria 4046
153 Ga0068855_100097729 3300005563 Unclassified 3382
154 Ga0068855_100121391 3300005563 Bacteria 2991
155 Ga0068855_100159453 3300005563 Bacteria 2562
156 Ga0068855_100251807 3300005563 Unclassified 1970
157 Ga0068855_100296330 3300005563 Bacteria 1792
158 Ga0070664_100001824 3300005564 Bacteria 17055
159 Ga0070664_100115801 3300005564 Bacteria 2343
160 Ga0070664_100139417 3300005564 Bacteria 2134
161 Ga0070664_100250394 3300005564 Unclassified 1592
162 Ga0070664_100260781 3300005564 Bacteria 1559
163 Ga0068857_100001376 3300005577 Bacteria 19181
164 Ga0068857_100030923 3300005577 Bacteria 4730
165 Ga0068857_100094433 3300005577 Bacteria 2678
166 Ga0068854_100002575 3300005578 Bacteria 11232
167 Ga0068854_100008531 3300005578 Bacteria 6594
168 Ga0068854_100016429 3300005578 Bacteria 4934
169 Ga0068854_100023685 3300005578 Unclassified 4196
170 Ga0068854_100101617 3300005578 Unclassified 2156
171 Ga0068854_100109769 3300005578 Bacteria 2079
172 Ga0068856_100000062 3300005614 Bacteria 100769
173 Ga0068856_100000179 3300005614 Bacteria 66149
174 Ga0068856_100000347 3300005614 Bacteria 50484
175 Ga0068856_100000854 3300005614 Bacteria 32765
176 Ga0068856_100001690 3300005614 Bacteria 23070
177 Ga0068856_100015481 3300005614 Bacteria 7370
178 Ga0068856_100018229 3300005614 Bacteria 6805
179 Ga0068856_100019973 3300005614 Bacteria 6503
180 Ga0068856_100020628 3300005614 Bacteria 6403
181 Ga0068856_100052769 3300005614 Bacteria 4010
182 Ga0068856_100119927 3300005614 Bacteria 2632
183 Ga0070702_100080234 3300005615 Bacteria 1952
184 Ga0068852_100000015 3300005616 Bacteria 134085
185 Ga0068852_100000278 3300005616 Bacteria 34197
186 Ga0068852_100006834 3300005616 Bacteria 8287
187 Ga0068852_100080543 3300005616 Bacteria 2887
188 Ga0068852_100166280 3300005616 Bacteria 2064
189 Ga0068852_100199805 3300005616 Bacteria 1891
190 Ga0068859_100001235 3300005617 Bacteria 26117
191 Ga0068859_100005339 3300005617 Bacteria 13075
192 Ga0068859_100011501 3300005617 Bacteria 8897
193 Ga0068859_100032598 3300005617 Bacteria 5233
194 Ga0068859_100050144 3300005617 Bacteria 4193
195 Ga0068859_100285614 3300005617 Bacteria 1743
196 Ga0068864_100000129 3300005618 Bacteria 73206
197 Ga0068864_100014292 3300005618 Bacteria 6594
198 Ga0068864_100028348 3300005618 Plasmid 4731
199 Ga0068864_100321851 3300005618 Bacteria 1452
200 Ga0068866_10006317 3300005718 Bacteria 4932
201 Ga0068866_10007078 3300005718 Bacteria 4689
202 Ga0068866_10031134 3300005718 Bacteria 2567
203 Ga0068861_100016641 3300005719 Bacteria 5207
204 Ga0068861_100061316 3300005719 Bacteria 2886
205 Ga0068861_100139575 3300005719 Bacteria 1977
206 Ga0068861_100213341 3300005719 Bacteria 1627
207 Ga0068863_100000941 3300005841 Bacteria 29222
208 Ga0068863_100017867 3300005841 Bacteria 6786
209 Ga0068863_100044093 3300005841 Bacteria 4234
210 Ga0068863_100048934 3300005841 Bacteria 4008
211 Ga0068858_100002951 3300005842 Bacteria 17096
212 Ga0068858_100006877 3300005842 Bacteria 11055
213 Ga0068858_100017770 3300005842 Bacteria 6660
214 Ga0068858_100021020 3300005842 Bacteria 6097
215 Ga0068860_100008454 3300005843 Bacteria 10253
216 Ga0068860_100031048 3300005843 Bacteria 5137
217 Ga0068860_100131657 3300005843 Bacteria 2400
218 Ga0068860_100192207 3300005843 Bacteria 1975
219 Ga0068860_100366019 3300005843 Bacteria 1421
220 Ga0068862_100029668 3300005844 Bacteria 4609
221 Ga0068862_100033743 3300005844 Bacteria 4328
222 Ga0068862_100078281 3300005844 Bacteria 2864
223 Ga0068862_100110110 3300005844 Bacteria 2417
224 Ga0068862_100169510 3300005844 Bacteria 1954
225 Ga0081539_10000517 3300005985 Bacteria 80413
226 Ga0070717_10000016 3300006028 Bacteria 205932
227 Ga0070717_10001262 3300006028 Bacteria 17276
228 Ga0070717_10008871 3300006028 Bacteria 7530
229 Ga0070717_10054607 3300006028 Unclassified 3294
230 Ga0070717_10069188 3300006028 Bacteria 2939
231 Ga0070717_10129014 3300006028 Bacteria 2173
232 Ga0070717_10346191 3300006028 Bacteria 1328
233 Ga0075365_10180341 3300006038 Bacteria 1476
234 Ga0075368_10007517 3300006042 Bacteria 3845
235 Ga0075364_10006031 3300006051 Bacteria 7090
236 Ga0070715_10013806 3300006163 Unclassified 2976
237 Ga0070716_100000711 3300006173 Bacteria 14216
238 Ga0070716_100007470 3300006173 Bacteria 5386
239 Ga0070716_100008365 3300006173 Bacteria 5132
240 Ga0070712_100000038 3300006175 Bacteria 67408
241 Ga0070712_100000288 3300006175 Bacteria 28406
242 Ga0070712_100000292 3300006175 Bacteria 28152
243 Ga0070712_100015439 3300006175 Bacteria 4921
244 Ga0070712_100022744 3300006175 Bacteria 4133
245 Ga0070712_100070931 3300006175 Bacteria 2491
246 Ga0075362_10024906 3300006177 Bacteria 2541
247 Ga0075367_10036332 3300006178 Bacteria 2856
248 Ga0075366_10013447 3300006195 Bacteria 4660
249 Ga0075366_10020182 3300006195 Bacteria 3863
250 Ga0075366_10022264 3300006195 Bacteria 3685
251 Ga0075366_10043177 3300006195 Bacteria 2670
252 Ga0075366_10104505 3300006195 Bacteria 1702
253 Ga0075366_10122958 3300006195 Bacteria 1564
254 Ga0097621_100000148 3300006237 Bacteria 42932
255 Ga0097621_100000709 3300006237 Bacteria 23392
256 Ga0097621_100007133 3300006237 Bacteria 7966
257 Ga0097621_100007883 3300006237 Bacteria 7639
258 Ga0097621_100031210 3300006237 Unclassified 4227
259 Ga0097621_100113357 3300006237 Bacteria 2293
260 Ga0097621_100218106 3300006237 Bacteria 1661
261 Ga0068871_100000049 3300006358 Bacteria 65954
262 Ga0068871_100000439 3300006358 Bacteria 28672
263 Ga0068871_100000465 3300006358 Bacteria 27859
264 Ga0075430_100065475 3300006846 Bacteria 3053
265 Ga0075430_100095058 3300006846 Bacteria 2491
266 Ga0075431_100002684 3300006847 Bacteria 17243
267 Ga0075431_100188398 3300006847 Bacteria 2114
268 Ga0075433_10040006 3300006852 Bacteria 4056
269 Ga0075433_10342043 3300006852 Bacteria 1322
270 Ga0075434_100000344 3300006871 Bacteria 33535
271 Ga0075434_100004219 3300006871 Bacteria 12887
272 Ga0075434_100027321 3300006871 Bacteria 5602
273 Ga0075434_100034351 3300006871 Bacteria 5007
274 Ga0075429_100026898 3300006880 Bacteria 4994
275 Ga0068865_100016734 3300006881 Bacteria 4699
276 Ga0068865_100030922 3300006881 Bacteria 3565
277 Ga0068865_100134808 3300006881 Bacteria 1854
278 Ga0075436_100040655 3300006914 Bacteria 3208
279 Ga0097620_100001235 3300006931 Bacteria 26117
280 Ga0097620_100005338 3300006931 Bacteria 13075
281 Ga0097620_100011501 3300006931 Bacteria 8897
282 Ga0097620_100032598 3300006931 Bacteria 5233
283 Ga0097620_100050143 3300006931 Bacteria 4193
284 Ga0097620_100285612 3300006931 Bacteria 1743
285 Ga0079104_1000002 3300006946 Bacteria 514469
286 Ga0075435_100007470 3300007076 Bacteria 7792
287 Ga0075435_100034872 3300007076 Bacteria 3990
288 Ga0105250_10004011 3300009092 Bacteria 6862
289 Ga0105240_10000001 3300009093 Bacteria 2887840
290 Ga0105240_10000181 3300009093 Bacteria 128067
291 Ga0105240_10000590 3300009093 Bacteria 67365
292 Ga0105240_10000823 3300009093 Bacteria 56298
293 Ga0105240_10004970 3300009093 Bacteria 19979
294 Ga0105240_10007428 3300009093 Bacteria 15922
295 Ga0105240_10008321 3300009093 Bacteria 14846
296 Ga0105240_10021660 3300009093 Bacteria 8545
297 Ga0105240_10046652 3300009093 Bacteria 5489
298 Ga0105240_10076065 3300009093 Bacteria 4140
299 Ga0105240_10091111 3300009093 Bacteria 3726
300 Ga0105240_10133724 3300009093 Bacteria 2972
301 Ga0105240_10195882 3300009093 Bacteria 2372
302 Ga0105240_10205617 3300009093 Bacteria 2305
303 Ga0105240_10287979 3300009093 Unclassified 1884
304 Ga0111539_10001354 3300009094 Bacteria 32628
305 Ga0111539_10005577 3300009094 Bacteria 16274
306 Ga0111539_10053834 3300009094 Bacteria 4791
307 Ga0105245_10003276 3300009098 Bacteria 14530
308 Ga0105245_10006431 3300009098 Bacteria 10342
309 Ga0105245_10110320 3300009098 Bacteria 2558
310 Ga0105245_10208777 3300009098 Bacteria 1879
311 Ga0105245_10225636 3300009098 Bacteria 1810
312 Ga0105247_10012672 3300009101 Bacteria 5058
313 Ga0105247_10042813 3300009101 Bacteria 2774
314 Ga0105247_10157268 3300009101 Bacteria 1502
315 Ga0114129_10029439 3300009147 Bacteria 7779
316 Ga0114129_10120618 3300009147 Bacteria 3610
317 Ga0114129_10135131 3300009147 Bacteria 3384
318 Ga0105243_10004290 3300009148 Bacteria 11290
319 Ga0105243_10058881 3300009148 Bacteria 3063
320 Ga0105243_10147216 3300009148 Bacteria 2016
321 Ga0105241_10000074 3300009174 Bacteria 75523
322 Ga0105241_10002378 3300009174 Bacteria 14132
323 Ga0105241_10004219 3300009174 Bacteria 10613
324 Ga0105241_10012484 3300009174 Bacteria 6228
325 Ga0105241_10018618 3300009174 Bacteria 5110
326 Ga0105241_10040692 3300009174 Bacteria 3509
327 Ga0105241_10093290 3300009174 Bacteria 2379
328 Ga0105241_10106644 3300009174 Bacteria 2236
329 Ga0105242_10008739 3300009176 Bacteria 7772
330 Ga0105242_10017961 3300009176 Bacteria 5525
331 Ga0105248_10000410 3300009177 Bacteria 49815
332 Ga0105248_10001285 3300009177 Bacteria 28003
333 Ga0105248_10001713 3300009177 Bacteria 24377
334 Ga0105248_10020175 3300009177 Bacteria 7383
335 Ga0105237_10001590 3300009545 Bacteria 29558
336 Ga0105237_10051350 3300009545 Bacteria 4141
337 Ga0105237_10108211 3300009545 Bacteria 2772
338 Ga0105237_10207399 3300009545 Bacteria 1960
339 Ga0105238_10000491 3300009551 Bacteria 41568
340 Ga0105238_10000502 3300009551 Bacteria 41185
341 Ga0105238_10000609 3300009551 Bacteria 37550
342 Ga0105238_10002379 3300009551 Bacteria 18883
343 Ga0105238_10003639 3300009551 Bacteria 15369
344 Ga0105238_10022506 3300009551 Bacteria 6424
345 Ga0105238_10026649 3300009551 Bacteria 5893
346 Ga0105238_10029170 3300009551 Bacteria 5621
347 Ga0105238_10033676 3300009551 Bacteria 5212
348 Ga0105238_10038354 3300009551 Bacteria 4866
349 Ga0105238_10042995 3300009551 Bacteria 4573
350 Ga0105238_10118203 3300009551 Bacteria 2631
351 Ga0105238_10121114 3300009551 Unclassified 2596
352 Ga0105238_10259554 3300009551 Bacteria 1717
353 Ga0105249_10041183 3300009553 Bacteria 4198
354 Ga0105249_10065772 3300009553 Bacteria 3336
355 Ga0105249_10072569 3300009553 Bacteria 3182
356 Ga0105239_10001077 3300010375 Bacteria 37901
357 Ga0105239_10012674 3300010375 Bacteria 9380
358 Ga0105239_10186670 3300010375 Bacteria 2320
359 Ga0105239_10271508 3300010375 Bacteria 1907
360 Ga0105246_10042087 3300011119 Bacteria 3092
361 Ga0157373_10028847 3300013100 Unclassified 4002
362 Ga0157373_10039234 3300013100 Bacteria 3391
363 Ga0157373_10050750 3300013100 Unclassified 2954
364 Ga0157371_10065256 3300013102 Bacteria 2578
365 Ga0157371_10080205 3300013102 Unclassified 2311
366 Ga0157371_10096445 3300013102 Bacteria 2096
367 Ga0157371_10148429 3300013102 Bacteria 1672
368 Ga0157370_10000007 3300013104 Bacteria 246747
369 Ga0157370_10076055 3300013104 Unclassified 3164
370 Ga0157370_10077180 3300013104 Bacteria 3138
371 Ga0157370_10111620 3300013104 Bacteria 2556
372 Ga0157369_10000131 3300013105 Bacteria 107900
373 Ga0157369_10000159 3300013105 Bacteria 95759
374 Ga0157369_10000241 3300013105 Bacteria 75794
375 Ga0157369_10001480 3300013105 Bacteria 28802
376 Ga0157369_10004149 3300013105 Bacteria 17163
377 Ga0157369_10009797 3300013105 Bacteria 10961
378 Ga0157369_10014148 3300013105 Bacteria 9015
379 Ga0157369_10018397 3300013105 Bacteria 7835
380 Ga0157369_10036629 3300013105 Bacteria 5373
381 Ga0157369_10066048 3300013105 Bacteria 3892
382 Ga0157369_10090059 3300013105 Bacteria 3275
383 Ga0157369_10098054 3300013105 Bacteria 3126
384 Ga0157369_10104987 3300013105 Unclassified 3008
385 Ga0157369_10108431 3300013105 Unclassified 2953
386 Ga0157369_10151829 3300013105 Bacteria 2448
387 Ga0157369_10153338 3300013105 Bacteria 2435
388 Ga0157369_10236396 3300013105 Bacteria 1909
389 Ga0157369_10286091 3300013105 Bacteria 1717
390 Ga0157369_10298287 3300013105 Bacteria 1677
391 Ga0157369_10445242 3300013105 Bacteria 1341
392 Ga0157374_10000062 3300013296 Bacteria 112028
393 Ga0157374_10000454 3300013296 Bacteria 37339
394 Ga0157374_10001531 3300013296 Bacteria 19467
395 Ga0157374_10002950 3300013296 Bacteria 14245
396 Ga0157374_10006824 3300013296 Bacteria 9711
397 Ga0157374_10011409 3300013296 Bacteria 7691
398 Ga0157374_10030262 3300013296 Bacteria 4912
399 Ga0157374_10030866 3300013296 Bacteria 4867
400 Ga0157374_10034065 3300013296 Bacteria 4649
401 Ga0157374_10150845 3300013296 Bacteria 2260
402 Ga0157374_10260396 3300013296 Bacteria 1708
403 Ga0157378_10000009 3300013297 Bacteria 161557
404 Ga0157378_10000132 3300013297 Bacteria 71918
405 Ga0157378_10000345 3300013297 Bacteria 45724
406 Ga0157378_10000423 3300013297 Bacteria 41434
407 Ga0157378_10020738 3300013297 Bacteria 5780
408 Ga0157378_10037848 3300013297 Bacteria 4275
409 Ga0157378_10041753 3300013297 Bacteria 4069
410 Ga0157378_10043095 3300013297 Bacteria 4006
411 Ga0157378_10072675 3300013297 Bacteria 3091
412 Ga0157378_10183479 3300013297 Bacteria 1970
413 Ga0163162_10000119 3300013306 Bacteria 69465
414 Ga0163162_10001981 3300013306 Bacteria 19234
415 Ga0163162_10006734 3300013306 Bacteria 11149
416 Ga0163162_10008867 3300013306 Bacteria 9779
417 Ga0163162_10010214 3300013306 Bacteria 9122
418 Ga0163162_10155447 3300013306 Unclassified 2407
419 Ga0163162_10262346 3300013306 Bacteria 1859
420 Ga0163162_10276925 3300013306 Bacteria 1810
421 Ga0163162_10283849 3300013306 Bacteria 1787
422 Ga0163162_10550540 3300013306 Bacteria 1282
423 Ga0157372_10000014 3300013307 Bacteria 241589
424 Ga0157372_10000140 3300013307 Bacteria 79310
425 Ga0157372_10000845 3300013307 Bacteria 33235
426 Ga0157372_10002792 3300013307 Bacteria 18873
427 Ga0157372_10003387 3300013307 Bacteria 17201
428 Ga0157372_10003675 3300013307 Bacteria 16495
429 Ga0157372_10005454 3300013307 Bacteria 13518
430 Ga0157372_10012767 3300013307 Bacteria 8950
431 Ga0157372_10036028 3300013307 Bacteria 5451
432 Ga0157372_10071569 3300013307 Bacteria 3905
433 Ga0157372_10074388 3300013307 Bacteria 3831
434 Ga0157372_10078927 3300013307 Bacteria 3721
435 Ga0157372_10093360 3300013307 Unclassified 3425
436 Ga0157372_10167813 3300013307 Bacteria 2539
437 Ga0157372_10277145 3300013307 Bacteria 1950
438 Ga0157372_10308555 3300013307 Bacteria 1841
439 Ga0157372_10402010 3300013307 Unclassified 1596
440 Ga0157372_10466457 3300013307 Bacteria 1472
441 Ga0157375_10031791 3300013308 Bacteria 4997
442 Ga0157375_10049155 3300013308 Bacteria 4131
443 Ga0157375_10090265 3300013308 Bacteria 3122
444 Ga0157375_10170194 3300013308 Bacteria 2325
445 Ga0157375_10289206 3300013308 Bacteria 1802
446 Ga0163163_10000034 3300014325 Bacteria 161820
447 Ga0163163_10000742 3300014325 Bacteria 27758
448 Ga0163163_10083726 3300014325 Bacteria 3195
449 Ga0163163_10331824 3300014325 Bacteria 1576
450 Ga0157380_10033039 3300014326 Bacteria 3983
451 Ga0157380_10056022 3300014326 Bacteria 3133
452 Ga0182008_10002237 3300014497 Bacteria 12236
453 Ga0157377_10137890 3300014745 Bacteria 1496
454 Ga0157379_10024598 3300014968 Bacteria 5346
455 Ga0157379_10063610 3300014968 Plasmid 3298
456 Ga0157379_10092734 3300014968 Bacteria 2709
457 Ga0157379_10123904 3300014968 Bacteria 2325
458 Ga0157376_10001674 3300014969 Bacteria 14724
459 Ga0157376_10004505 3300014969 Bacteria 9709
460 Ga0157376_10018992 3300014969 Bacteria 5286
461 Ga0157376_10028333 3300014969 Bacteria 4451
462 Ga0157376_10048210 3300014969 Bacteria 3521
463 Ga0182007_10001509 3300015262 Bacteria 12423
464 Ga0182005_1006357 3300015265 Bacteria 3621
465 Ga0163161_10029674 3300017792 Bacteria 3888
466 Ga0213876_10010112 3300021384 Bacteria 5070
467 Ga0213876_10066908 3300021384 Bacteria 1897
468 Ga0224569_100903 3300022732 Unclassified 2525
469 Ga0224571_101390 3300022734 Unclassified 1510
470 Ga0209672_100086 3300025228 Bacteria 128901
471 Ga0209147_100148 3300025229 Bacteria 103421
472 Ga0209258_100114 3300025242 Bacteria 191036
473 Ga0209148_1000115 3300025254 Bacteria 191036
474 Ga0209455_1000109 3300025272 Bacteria 191036
475 Ga0209673_1000101 3300025273 Bacteria 190230
476 Ga0209676_1000375 3300025292 Bacteria 82420
477 Ga0209564_1006316 3300025295 Bacteria 6443
478 Ga0209050_1000717 3300025298 Bacteria 48623
479 Ga0209051_1000112 3300025303 Bacteria 152667
480 Ga0209257_1000290 3300025304 Bacteria 110826
481 Ga0207696_1015474 3300025711 Bacteria 2585
482 Ga0207692_10030403 3300025898 Bacteria 2576
483 Ga0207642_10004701 3300025899 Bacteria 4411
484 Ga0207642_10062203 3300025899 Unclassified 1740
485 Ga0207710_10034641 3300025900 Bacteria 2220
486 Ga0207680_10112375 3300025903 Unclassified 1769
487 Ga0207647_10006752 3300025904 Bacteria 8328
488 Ga0207647_10007077 3300025904 Bacteria 8137
489 Ga0207647_10026076 3300025904 Bacteria 3827
490 Ga0207647_10064903 3300025904 Bacteria 2217
491 Ga0207699_10000549 3300025906 Bacteria 18507
492 Ga0207699_10045764 3300025906 Bacteria 2556
493 Ga0207699_10098933 3300025906 Bacteria 1846
494 Ga0207645_10009002 3300025907 Bacteria 6929
495 Ga0207645_10032081 3300025907 Bacteria 3377
496 Ga0207645_10061558 3300025907 Bacteria 2398
497 Ga0207645_10084597 3300025907 Bacteria 2036
498 Ga0207643_10091232 3300025908 Bacteria 1777
499 Ga0207705_10003517 3300025909 Bacteria 11934
500 Ga0207705_10007192 3300025909 Bacteria 8199
501 Ga0207705_10037522 3300025909 Bacteria 3468
502 Ga0207705_10063074 3300025909 Bacteria 2677
503 Ga0207684_10005804 3300025910 Bacteria 11319
504 Ga0207654_10000238 3300025911 Bacteria 33415
505 Ga0207654_10000316 3300025911 Bacteria 29044
506 Ga0207654_10024895 3300025911 Bacteria 3223
507 Ga0207654_10033871 3300025911 Bacteria 2834
508 Ga0207654_10063649 3300025911 Bacteria 2166
509 Ga0207654_10094041 3300025911 Bacteria 1834
510 Ga0207707_10011358 3300025912 Bacteria 7754
511 Ga0207707_10014404 3300025912 Bacteria 6887
512 Ga0207707_10020215 3300025912 Bacteria 5814
513 Ga0207707_10075676 3300025912 Bacteria 2937
514 Ga0207707_10113505 3300025912 Bacteria 2368
515 Ga0207707_10326655 3300025912 Bacteria 1324
516 Ga0207695_10000001 3300025913 Bacteria 2888630
517 Ga0207695_10000069 3300025913 Bacteria 319955
518 Ga0207695_10000161 3300025913 Bacteria 199839
519 Ga0207695_10000231 3300025913 Bacteria 148736
520 Ga0207695_10000353 3300025913 Bacteria 105514
521 Ga0207695_10000368 3300025913 Bacteria 103176
522 Ga0207695_10000656 3300025913 Bacteria 68421
523 Ga0207695_10012755 3300025913 Bacteria 10061
524 Ga0207695_10022632 3300025913 Bacteria 7125
525 Ga0207695_10060464 3300025913 Bacteria 3921
526 Ga0207695_10061723 3300025913 Bacteria 3873
527 Ga0207695_10089610 3300025913 Unclassified 3093
528 Ga0207695_10138701 3300025913 Bacteria 2383
529 Ga0207695_10220814 3300025913 Unclassified 1802
530 Ga0207671_10000302 3300025914 Bacteria 72902
531 Ga0207671_10000893 3300025914 Bacteria 37726
532 Ga0207671_10029582 3300025914 Bacteria 4090
533 Ga0207671_10037550 3300025914 Bacteria 3592
534 Ga0207671_10046967 3300025914 Unclassified 3195
535 Ga0207671_10064106 3300025914 Bacteria 2732
536 Ga0207693_10000012 3300025915 Bacteria 154708
537 Ga0207693_10000058 3300025915 Bacteria 94726
538 Ga0207693_10001160 3300025915 Bacteria 23505
539 Ga0207693_10058286 3300025915 Bacteria 3026
540 Ga0207693_10065576 3300025915 Bacteria 2844
541 Ga0207693_10161948 3300025915 Bacteria 1760
542 Ga0207663_10000280 3300025916 Bacteria 22295
543 Ga0207663_10003486 3300025916 Bacteria 7701
544 Ga0207663_10243547 3300025916 Bacteria 1320
545 Ga0207660_10095265 3300025917 Bacteria 2214
546 Ga0207660_10291204 3300025917 Bacteria 1298
547 Ga0207662_10118827 3300025918 Bacteria 1656
548 Ga0207657_10000390 3300025919 Bacteria 46278
549 Ga0207657_10005169 3300025919 Bacteria 13686
550 Ga0207657_10008891 3300025919 Bacteria 10157
551 Ga0207657_10136934 3300025919 Bacteria 2003
552 Ga0207649_10002495 3300025920 Bacteria 10286
553 Ga0207649_10003157 3300025920 Bacteria 9042
554 Ga0207649_10003294 3300025920 Bacteria 8838
555 Ga0207652_10003056 3300025921 Bacteria 13968
556 Ga0207652_10023765 3300025921 Bacteria 5081
557 Ga0207652_10025236 3300025921 Bacteria 4939
558 Ga0207652_10046960 3300025921 Bacteria 3687
559 Ga0207652_10120163 3300025921 Bacteria 2337
560 Ga0207681_10061011 3300025923 Bacteria 2591
561 Ga0207694_10000137 3300025924 Bacteria 74746
562 Ga0207694_10002200 3300025924 Bacteria 16018
563 Ga0207694_10004080 3300025924 Bacteria 11483
564 Ga0207694_10004374 3300025924 Bacteria 11032
565 Ga0207694_10017121 3300025924 Bacteria 5476
566 Ga0207694_10020076 3300025924 Bacteria 5053
567 Ga0207694_10021206 3300025924 Bacteria 4921
568 Ga0207694_10103242 3300025924 Unclassified 2261
569 Ga0207694_10148383 3300025924 Bacteria 1889
570 Ga0207694_10320855 3300025924 Unclassified 1278
571 Ga0207650_10084040 3300025925 Bacteria 2419
572 Ga0207687_10006501 3300025927 Bacteria 7720
573 Ga0207687_10014350 3300025927 Bacteria 5183
574 Ga0207687_10050439 3300025927 Bacteria 2896
575 Ga0207700_10002138 3300025928 Bacteria 11308
576 Ga0207700_10003116 3300025928 Bacteria 9583
577 Ga0207700_10012980 3300025928 Bacteria 5398
578 Ga0207700_10017957 3300025928 Bacteria 4738
579 Ga0207700_10036822 3300025928 Bacteria 3538
580 Ga0207700_10077224 3300025928 Bacteria 2586
581 Ga0207664_10000098 3300025929 Bacteria 80444
582 Ga0207664_10007305 3300025929 Bacteria 7660
583 Ga0207664_10056761 3300025929 Bacteria 3111
584 Ga0207664_10092569 3300025929 Bacteria 2481
585 Ga0207644_10009960 3300025931 Bacteria 6255
586 Ga0207690_10000037 3300025932 Bacteria 142658
587 Ga0207690_10067802 3300025932 Bacteria 2449
588 Ga0207706_10017424 3300025933 Bacteria 6470
589 Ga0207706_10028125 3300025933 Bacteria 5022
590 Ga0207686_10018802 3300025934 Unclassified 3918
591 Ga0207686_10039392 3300025934 Bacteria 2867
592 Ga0207709_10000015 3300025935 Bacteria 493221
593 Ga0207709_10009883 3300025935 Bacteria 5254
594 Ga0207709_10052774 3300025935 Bacteria 2499
595 Ga0207709_10081527 3300025935 Bacteria 2086
596 Ga0207670_10105454 3300025936 Bacteria 2020
597 Ga0207670_10132068 3300025936 Bacteria 1831
598 Ga0207670_10190809 3300025936 Bacteria 1550
599 Ga0207670_10208398 3300025936 Bacteria 1489
600 Ga0207665_10003619 3300025939 Bacteria 10327
601 Ga0207665_10005922 3300025939 Bacteria 8138
602 Ga0207665_10011313 3300025939 Bacteria 5858
603 Ga0207665_10018379 3300025939 Bacteria 4594
604 Ga0207691_10028957 3300025940 Bacteria 5183
605 Ga0207691_10046834 3300025940 Bacteria 3971
606 Ga0207711_10000023 3300025941 Bacteria 327296
607 Ga0207711_10003045 3300025941 Bacteria 14653
608 Ga0207711_10004445 3300025941 Bacteria 11949
609 Ga0207711_10007008 3300025941 Bacteria 9454
610 Ga0207711_10028858 3300025941 Bacteria 4674
611 Ga0207711_10130437 3300025941 Bacteria 2253
612 Ga0207689_10001606 3300025942 Bacteria 21385
613 Ga0207689_10002614 3300025942 Bacteria 16674
614 Ga0207689_10014513 3300025942 Bacteria 6701
615 Ga0207689_10021947 3300025942 Bacteria 5369
616 Ga0207689_10037071 3300025942 Bacteria 4046
617 Ga0207689_10054566 3300025942 Bacteria 3291
618 Ga0207689_10095661 3300025942 Bacteria 2439
619 Ga0207661_10029779 3300025944 Bacteria 4196
620 Ga0207661_10048778 3300025944 Bacteria 3367
621 Ga0207661_10051469 3300025944 Bacteria 3286
622 Ga0207661_10057318 3300025944 Bacteria 3132
623 Ga0207661_10103666 3300025944 Bacteria 2394
624 Ga0207661_10158259 3300025944 Bacteria 1964
625 Ga0207679_10026234 3300025945 Bacteria 4017
626 Ga0207679_10032524 3300025945 Bacteria 3662
627 Ga0207679_10088123 3300025945 Bacteria 2392
628 Ga0207679_10120088 3300025945 Bacteria 2091
629 Ga0207679_10139108 3300025945 Bacteria 1960
630 Ga0207679_10297206 3300025945 Bacteria 1390
631 Ga0207667_10000809 3300025949 Bacteria 40616
632 Ga0207667_10003556 3300025949 Bacteria 19267
633 Ga0207667_10008104 3300025949 Bacteria 12522
634 Ga0207667_10012826 3300025949 Bacteria 9630
635 Ga0207667_10018028 3300025949 Bacteria 7929
636 Ga0207667_10045259 3300025949 Bacteria 4662
637 Ga0207667_10051579 3300025949 Bacteria 4336
638 Ga0207667_10061750 3300025949 Bacteria 3920
639 Ga0207667_10130458 3300025949 Bacteria 2589
640 Ga0207667_10144008 3300025949 Bacteria 2454
641 Ga0207667_10200301 3300025949 Bacteria 2048
642 Ga0207667_10236776 3300025949 Unclassified 1869
643 Ga0207667_10255066 3300025949 Bacteria 1794
644 Ga0207667_10255488 3300025949 Bacteria 1792
645 Ga0207667_10276114 3300025949 Bacteria 1718
646 Ga0207651_10297833 3300025960 Bacteria 1340
647 Ga0207712_10050293 3300025961 Bacteria 2909
648 Ga0207712_10204551 3300025961 Bacteria 1568
649 Ga0207668_10005700 3300025972 Bacteria 7338
650 Ga0207668_10175087 3300025972 Bacteria 1687
651 Ga0207640_10005099 3300025981 Bacteria 7142
652 Ga0207640_10038872 3300025981 Bacteria 3006
653 Ga0207640_10048138 3300025981 Unclassified 2754
654 Ga0207640_10080735 3300025981 Unclassified 2221
655 Ga0207640_10290825 3300025981 Bacteria 1288
656 Ga0207677_10001674 3300026023 Bacteria 11740
657 Ga0207677_10009196 3300026023 Bacteria 5549
658 Ga0207677_10019695 3300026023 Bacteria 4081
659 Ga0207677_10027991 3300026023 Bacteria 3559
660 Ga0207677_10070889 3300026023 Unclassified 2458
661 Ga0207677_10091874 3300026023 Bacteria 2209
662 Ga0207677_10229870 3300026023 Bacteria 1493
663 Ga0207703_10006688 3300026035 Bacteria 9197
664 Ga0207703_10009972 3300026035 Bacteria 7451
665 Ga0207703_10047849 3300026035 Bacteria 3449
666 Ga0207703_10135677 3300026035 Bacteria 2130
667 Ga0207639_10000191 3300026041 Bacteria 47375
668 Ga0207639_10032730 3300026041 Unclassified 3830
669 Ga0207639_10134485 3300026041 Bacteria 2051
670 Ga0207639_10212133 3300026041 Bacteria 1667
671 Ga0207678_10000620 3300026067 Bacteria 32501
672 Ga0207678_10006508 3300026067 Bacteria 10370
673 Ga0207678_10032951 3300026067 Bacteria 4515
674 Ga0207678_10034021 3300026067 Bacteria 4439
675 Ga0207678_10068148 3300026067 Bacteria 3054
676 Ga0207678_10217565 3300026067 Bacteria 1635
677 Ga0207708_10069836 3300026075 Bacteria 2689
678 Ga0207708_10121356 3300026075 Bacteria 2037
679 Ga0207702_10000458 3300026078 Bacteria 46107
680 Ga0207702_10001020 3300026078 Bacteria 28742
681 Ga0207702_10001136 3300026078 Bacteria 27202
682 Ga0207702_10003114 3300026078 Bacteria 15370
683 Ga0207702_10006562 3300026078 Bacteria 10009
684 Ga0207702_10008668 3300026078 Bacteria 8578
685 Ga0207702_10011681 3300026078 Bacteria 7313
686 Ga0207702_10024096 3300026078 Bacteria 5049
687 Ga0207702_10025127 3300026078 Bacteria 4942
688 Ga0207702_10042361 3300026078 Unclassified 3819
689 Ga0207702_10064135 3300026078 Bacteria 3143
690 Ga0207702_10146691 3300026078 Bacteria 2142
691 Ga0207702_10151081 3300026078 Bacteria 2112
692 Ga0207702_10275837 3300026078 Bacteria 1587
693 Ga0207702_10358077 3300026078 Bacteria 1398
694 Ga0207641_10001055 3300026088 Bacteria 27824
695 Ga0207641_10015901 3300026088 Bacteria 6162
696 Ga0207641_10036916 3300026088 Bacteria 4079
697 Ga0207641_10041831 3300026088 Bacteria 3842
698 Ga0207641_10063106 3300026088 Bacteria 3164
699 Ga0207648_10002171 3300026089 Bacteria 21320
700 Ga0207648_10010502 3300026089 Bacteria 8770
701 Ga0207648_10207569 3300026089 Bacteria 1738
702 Ga0207648_10314498 3300026089 Bacteria 1406
703 Ga0207676_10002318 3300026095 Bacteria 13658
704 Ga0207676_10006053 3300026095 Bacteria 8535
705 Ga0207676_10153633 3300026095 Bacteria 1985
706 Ga0207676_10288928 3300026095 Bacteria 1492
707 Ga0207676_10353952 3300026095 Bacteria 1359
708 Ga0207674_10000763 3300026116 Bacteria 42020
709 Ga0207674_10001893 3300026116 Bacteria 26626
710 Ga0207674_10001984 3300026116 Bacteria 25923
711 Ga0207674_10003886 3300026116 Bacteria 18190
712 Ga0207674_10071079 3300026116 Bacteria 3497
713 Ga0207674_10103405 3300026116 Bacteria 2827
714 Ga0207674_10131501 3300026116 Bacteria 2465
715 Ga0207675_100010959 3300026118 Bacteria 8491
716 Ga0207675_100016660 3300026118 Bacteria 6863
717 Ga0207675_100155027 3300026118 Bacteria 2182
718 Ga0207675_100169237 3300026118 Bacteria 2088
719 Ga0207683_10008453 3300026121 Bacteria 8810
720 Ga0207683_10044141 3300026121 Bacteria 3897
721 Ga0207683_10155916 3300026121 Bacteria 2063
722 Ga0207698_10000006 3300026142 Bacteria 291847
723 Ga0207698_10000249 3300026142 Bacteria 33102
724 Ga0207698_10004173 3300026142 Bacteria 8788
725 Ga0207698_10019954 3300026142 Bacteria 4603
726 Ga0207698_10047927 3300026142 Bacteria 3241
727 Ga0207698_10073906 3300026142 Bacteria 2716
728 Ga0207698_10149441 3300026142 Bacteria 2025
729 Ga0207698_10151120 3300026142 Bacteria 2016
730 Ga0209281_1000007 3300027111 Bacteria 938265
731 Ga0207428_10000595 3300027907 Bacteria 42731
732 Ga0207428_10025635 3300027907 Bacteria 4933
733 Ga0207428_10227543 3300027907 Bacteria 1396
734 Ga0265356_1000013 3300028017 Bacteria 28815
735 Ga0268266_10000660 3300028379 Bacteria 46709
736 Ga0268266_10005793 3300028379 Bacteria 11438
737 Ga0268266_10090876 3300028379 Bacteria 2676
738 Ga0268266_10170447 3300028379 Bacteria 1975
739 Ga0268266_10340179 3300028379 Bacteria 1408
740 Ga0268265_10006348 3300028380 Bacteria 8014
741 Ga0268265_10134848 3300028380 Bacteria 2058
742 Ga0268265_10168244 3300028380 Bacteria 1870
743 Ga0268265_10306015 3300028380 Bacteria 1433
744 Ga0268264_10001093 3300028381 Bacteria 26776
745 Ga0268264_10004380 3300028381 Bacteria 12050
746 Ga0268264_10028635 3300028381 Bacteria 4559
747 Ga0265337_1001683 3300028556 Bacteria 10731
748 Ga0265337_1006294 3300028556 Bacteria 4600
749 Ga0265337_1008518 3300028556 Bacteria 3725
750 Ga0265337_1013101 3300028556 Bacteria 2798
751 Ga0265319_1001494 3300028563 Bacteria 13918
752 Ga0265319_1042049 3300028563 Bacteria 1539
753 Ga0265334_10021022 3300028573 Bacteria 2667
754 Ga0307515_10068993 3300028794 Bacteria 4844
755 Ga0265338_10003616 3300028800 Bacteria 21554
756 Ga0265338_10005972 3300028800 Bacteria 15660
757 Ga0265338_10022889 3300028800 Bacteria 6447
758 Ga0265338_10029368 3300028800 Bacteria 5451
759 Ga0265338_10034737 3300028800 Bacteria 4865
760 Ga0265338_10212731 3300028800 Bacteria 1450
761 Ga0265762_1000831 3300030760 Bacteria 5497
762 Ga0265760_10000017 3300031090 Bacteria 89357
763 Ga0265760_10001830 3300031090 Bacteria 6243
764 Ga0265320_10000134 3300031240 Bacteria 63576
765 Ga0265320_10000847 3300031240 Bacteria 23118
766 Ga0265320_10001451 3300031240 Bacteria 17287
767 Ga0265320_10002229 3300031240 Bacteria 13594
768 Ga0265320_10005571 3300031240 Bacteria 8067
769 Ga0265320_10030138 3300031240 Bacteria 2801
770 Ga0265339_10010523 3300031249 Bacteria 5743
771 Ga0265339_10033067 3300031249 Bacteria 2915
772 Ga0265316_10077493 3300031344 Bacteria 2553
773 Ga0307408_100002421 3300031548 Bacteria 13124
774 Ga0307408_100050207 3300031548 Bacteria 2999
775 Ga0307408_100104768 3300031548 Bacteria 2161
776 Ga0265313_10009742 3300031595 Bacteria 6192
777 Ga0265313_10020913 3300031595 Bacteria 3594
778 Ga0307508_10000055 3300031616 Bacteria 126914
779 Ga0265314_10032624 3300031711 Bacteria 3829
780 Ga0307516_10077663 3300031730 Bacteria 3168
781 Ga0307405_10093468 3300031731 Bacteria 1998
782 Ga0307406_10015036 3300031901 Bacteria 4468
783 Ga0307407_10000097 3300031903 Bacteria 29578
784 Ga0307414_10000226 3300032004 Bacteria 37108
785 Ga0307414_10010123 3300032004 Bacteria 5453
786 Ga0307411_10034580 3300032005 Bacteria 3147
787 Ga0307411_10259336 3300032005 Bacteria 1372
788 Ga0307415_100054242 3300032126 Bacteria 2735
789 Ga0307510_10036648 3300033180 Bacteria 5457
790 Ga0316214_1002983 3300033545 Bacteria 2109
791 Ga0373926_0043744 3300035083 Bacteria 1603
792 Ga0373934_0000592 3300035086 Bacteria 12793
793 Ga0373944_0019989 3300035089 Bacteria 1925
794 Ga0373932_0039735 3300035112 Bacteria 1351
795 Ga0373954_0006455 3300035118 Bacteria 5115
796 Ga0373954_0109449 3300035118 Bacteria 1336
797 Ga0373956_0040058 3300035119 Bacteria 2077
798 Ga0373957_0028507 3300035120 Bacteria 2035
799 Ga0373943_0000669 3300035170 Bacteria 14898
800 Ga0373955_0061172 3300035172 Bacteria 2079
801 Ga0373931_0036185 3300035691 Bacteria 2572
802 Ga0373931_0088349 3300035691 Bacteria 1722
803 Ga0373935_0027635 3300035692 Bacteria 3507
804 Ga0373935_0083802 3300035692 Bacteria 2076
805 Ga0373927_0000282 3300035695 Bacteria 40021
806 Ga0373927_0047241 3300035695 Bacteria 2785
807 Ga0373933_0005449 3300035724 Bacteria 6926
808 Ga0373933_0008503 3300035724 Bacteria 5599
809 Ga0373947_0001632 3300035725 Bacteria 13760
810 Ga0373947_0080576 3300035725 Bacteria 2014
811 Ga0373937_0000419 3300036401 Bacteria 39684
812 Ga0373937_0020381 3300036401 Bacteria 5945
813 Ga0373937_0025917 3300036401 Bacteria 5296
814 Ga0373937_0266062 3300036401 Bacteria 1617
815 Ga0373925_0002387 3300037068 Bacteria 15061
816 Ga0373925_0016024 3300037068 Bacteria 5427
817 Ga0373925_0054878 3300037068 Bacteria 2981
818 Ga0373925_0080788 3300037068 Bacteria 2471
819 Ga0395900_0095002 3300037418 Bacteria 3063
820 Ga0395898_0261431 3300037466 Bacteria 1651
821 Ga0395905_0118676 3300037471 Bacteria 2486
822 Ga0395905_0126144 3300037471 Bacteria 2407
823 Ga0436365_0012252 3300039437 Bacteria 1824
824 Ga0436365_0375454 3300039437 Bacteria 5051
825 Ga0436365_1076298 3300039437 Bacteria 8501
826 Ga0436365_1710025 3300039437 Bacteria 8308
827 Ga0451853_3969147 3300041512 Bacteria 1179
828 Ga0439449_0002086 3300042007 Bacteria 7857
829 Ga0450894_012304 3300042131 Bacteria 1118
830 Ga0450908_003607 3300042184 Bacteria 3012
831 Ga0466966_0062685 3300044684 Bacteria 2344
832 Ga0466963_0004435 3300044694 Bacteria 8158
833 Ga0466963_0005862 3300044694 Bacteria 7239
834 Ga0466963_0054503 3300044694 Bacteria 2658
835 Ga0466964_0079416 3300044706 Bacteria 1405
836 Ga0466971_0125743 3300044719 Bacteria 1188
837 Ga0466957_0057753 3300044842 Bacteria 2376
838 Ga0466959_0136618 3300045049 Bacteria 1735
839 Ga0466959_0206565 3300045049 Bacteria 1366
840 Ga0451576_0015690 3300045051 Bacteria 8386
841 Ga0451576_0391735 3300045051 Bacteria 1456
842 Ga0466958_0074458 3300045836 Bacteria 2081
843 Ga0466967_0011559 3300045976 Bacteria 6697
844 Ga0495592_0000012 3300046454 Bacteria 154054
845 Ga0495592_0035706 3300046454 Bacteria 3745
846 Ga0495603_0111963 3300046455 Bacteria 1592
847 Ga0495629_0001765 3300046459 Bacteria 16956
848 Ga0495629_0014957 3300046459 Bacteria 5575
849 Ga0495629_0055591 3300046459 Bacteria 2767
850 Ga0495629_0104059 3300046459 Unclassified 1980
851 Ga0495629_0228410 3300046459 Unclassified 1283
852 Ga0495638_0015062 3300046460 Bacteria 5204
853 Ga0495651_0005962 3300046462 Bacteria 9295
854 Ga0495653_0010340 3300046463 Bacteria 7633
855 Ga0495653_0143967 3300046463 Bacteria 1673
856 Ga0495650_0000186 3300046471 Bacteria 136572
857 Ga0495580_0000182 3300046472 Bacteria 47252
858 Ga0495580_0001774 3300046472 Bacteria 18967
859 Ga0495580_0006470 3300046472 Bacteria 9535
860 Ga0495580_0035789 3300046472 Bacteria 3569
861 Ga0495580_0084070 3300046472 Bacteria 2217
862 Ga0495580_0103043 3300046472 Bacteria 1984
863 Ga0495580_0119072 3300046472 Bacteria 1833
864 Ga0495582_0001430 3300046473 Bacteria 13457
865 Ga0495582_0068026 3300046473 Bacteria 1969
866 Ga0495639_0002577 3300046475 Bacteria 7901
867 Ga0495639_0041717 3300046475 Bacteria 2068
868 Ga0495662_0002206 3300046476 Bacteria 9808
869 Ga0495662_0011784 3300046476 Bacteria 4273
870 Ga0495664_0001708 3300046477 Bacteria 11667
871 Ga0495594_0000696 3300046499 Bacteria 17306
872 Ga0495594_0006286 3300046499 Bacteria 6108
873 Ga0495594_0052251 3300046499 Bacteria 2250
874 Ga0495594_0076284 3300046499 Unclassified 1869
875 Ga0495583_0028942 3300046506 Bacteria 2716
876 Ga0495606_0043625 3300046507 Bacteria 2989
877 Ga0495628_0003611 3300046516 Bacteria 13837
878 Ga0495628_0028279 3300046516 Bacteria 4556
879 Ga0495628_0074023 3300046516 Bacteria 2654
880 Ga0495628_0188848 3300046516 Bacteria 1556
881 Ga0495630_0000366 3300046517 Bacteria 35779
882 Ga0495630_0005339 3300046517 Bacteria 9063
883 Ga0495630_0023229 3300046517 Bacteria 4583
884 Ga0495666_0004502 3300046526 Bacteria 7039
885 Ga0495666_0007965 3300046526 Bacteria 5308
886 Ga0495652_0057880 3300046529 Bacteria 3285
887 Ga0495652_0074086 3300046529 Bacteria 2832
888 Ga0495652_0113515 3300046529 Unclassified 2175
889 Ga0495652_0219874 3300046529 Bacteria 1428
890 Ga0495665_0001802 3300046531 Bacteria 11536
891 Ga0495640_0006287 3300046533 Bacteria 9405
892 Ga0495640_0011154 3300046533 Bacteria 6918
893 Ga0495640_0020710 3300046533 Bacteria 4836
894 Ga0495586_0000017 3300046535 Bacteria 116426
895 Ga0495586_0005165 3300046535 Bacteria 6989
896 Ga0495586_0007234 3300046535 Bacteria 5922
897 Ga0495587_0029818 3300046536 Bacteria 3311
898 Ga0495597_0000325 3300046542 Bacteria 43126
899 Ga0495645_0003809 3300046543 Bacteria 10254
900 Ga0495645_0010006 3300046543 Bacteria 6639
901 Ga0495645_0011659 3300046543 Bacteria 6189
902 Ga0495645_0088818 3300046543 Bacteria 2210
903 Ga0495645_0118054 3300046543 Bacteria 1871
904 Ga0495645_0158386 3300046543 Bacteria 1567
905 Ga0495622_0024995 3300046557 Bacteria 2789
906 Ga0495667_0000973 3300046559 Bacteria 18521
907 Ga0495668_0082572 3300046616 Unclassified 1763
908 Ga0495634_0001612 3300046642 Bacteria 19685
909 Ga0495625_0000315 3300046660 Bacteria 73951
910 Ga0495625_0028802 3300046660 Bacteria 4160
911 Ga0495625_0044852 3300046660 Bacteria 3199
912 Ga0495635_0014187 3300046663 Bacteria 5576
913 Ga0495635_0055728 3300046663 Bacteria 2723
914 Ga0495659_0041055 3300046664 Bacteria 1651
915 Ga0495588_0000083 3300046674 Bacteria 197018
916 Ga0495599_0001485 3300046678 Bacteria 13459
917 Ga0495599_0017236 3300046678 Bacteria 4489
918 Ga0495623_0018994 3300046679 Bacteria 4438
919 Ga0495623_0020095 3300046679 Bacteria 4318
920 Ga0495646_0004579 3300046680 Bacteria 8715
921 Ga0495646_0081423 3300046680 Unclassified 1886
922 Ga0495646_0144642 3300046680 Bacteria 1326
923 Ga0495647_0036151 3300046681 Bacteria 1858
924 Ga0495658_0015852 3300046683 Bacteria 3873
925 Ga0495669_0095438 3300046684 Bacteria 1377
926 Ga0495613_0004064 3300046689 Bacteria 10943
927 Ga0495613_0007905 3300046689 Bacteria 7911
928 Ga0495613_0009166 3300046689 Bacteria 7335
929 Ga0495613_0082030 3300046689 Bacteria 2342
930 Ga0495624_0012772 3300046690 Bacteria 5734
931 Ga0495624_0027095 3300046690 Unclassified 3755
932 Ga0495649_0004705 3300046694 Bacteria 8859
933 Ga0495600_0001541 3300046809 Bacteria 12810
934 Ga0495600_0077268 3300046809 Bacteria 2174
935 Ga0495600_0084830 3300046809 Bacteria 2067
936 Ga0495600_0201755 3300046809 Bacteria 1277
937 Ga0495581_0042259 3300047315 Unclassified 2638
938 Ga0495604_0042015 3300047317 Bacteria 3584
939 Ga0495604_0150525 3300047317 Bacteria 1654
940 Ga0495674_0001210 3300047319 Bacteria 24994
941 Ga0495674_0003962 3300047319 Bacteria 14359
942 Ga0495674_0006098 3300047319 Bacteria 11575
943 Ga0495674_0006874 3300047319 Bacteria 10887
944 Ga0495674_0010893 3300047319 Bacteria 8596
945 Ga0495674_0017519 3300047319 Bacteria 6668
946 Ga0495674_0029207 3300047319 Bacteria 5023
947 Ga0495674_0045977 3300047319 Bacteria 3876
948 Ga0495674_0049300 3300047319 Bacteria 3722
949 Ga0495674_0325647 3300047319 Bacteria 1251
950 Ga0495672_0000712 3300047320 Bacteria 36590
951 Ga0495672_0002235 3300047320 Bacteria 18011
952 Ga0495672_0017128 3300047320 Bacteria 4854
953 Ga0495672_0069866 3300047320 Bacteria 1992
954 Ga0495676_0001708 3300047321 Bacteria 19160
955 Ga0495680_0005586 3300047322 Bacteria 11794
956 Ga0495680_0057091 3300047322 Bacteria 3021
957 Ga0495680_0148895 3300047322 Bacteria 1708
958 Ga0495675_0003684 3300047444 Bacteria 9261
959 Ga0495675_0018679 3300047444 Unclassified 4403
960 Ga0495675_0109108 3300047444 Bacteria 1728
961 Ga0495677_0019329 3300047445 Bacteria 2471
962 Ga0495684_0004637 3300047471 Bacteria 10729
963 Ga0495684_0025455 3300047471 Bacteria 4547
964 Ga0495684_0067018 3300047471 Bacteria 2730
965 Ga0495684_0224538 3300047471 Bacteria 1376
966 Ga0495686_0000035 3300047472 Bacteria 314930
967 Ga0495686_0005823 3300047472 Bacteria 9614
968 Ga0495686_0006455 3300047472 Bacteria 8975
969 Ga0495593_0047426 3300047673 Bacteria 2285
970 Ga0495602_0028268 3300048088 Bacteria 5370
971 Ga0495602_0067819 3300048088 Bacteria 3067
972 Ga0495602_0248159 3300048088 Unclassified 1328
973 Ga0495614_0003389 3300048089 Bacteria 7132
974 Ga0495614_0012332 3300048089 Bacteria 3751
975 Ga0496101_0147738 3300048904 Bacteria 1796
976 Ga0496102_0003711 3300048905 Bacteria 12909
977 Ga0496102_0004321 3300048905 Bacteria 12017
978 Ga0496102_0083902 3300048905 Bacteria 2940
979 Ga0496103_0031296 3300048906 Bacteria 3241
980 Ga0496104_0005306 3300048907 Bacteria 11277
981 Ga0496104_0015296 3300048907 Bacteria 6947
982 Ga0496104_0122509 3300048907 Bacteria 2496
983 Ga0496104_0236110 3300048907 Bacteria 1740
984 Ga0496104_0236302 3300048907 Bacteria 1739
985 Ga0496105_0003138 3300048908 Bacteria 12167
986 Ga0496106_0016253 3300048909 Bacteria 5506
987 Ga0496107_0127085 3300048910 Bacteria 1881
988 Ga0496107_0328829 3300048910 Bacteria 1137
989 Ga0496109_0251165 3300048912 Bacteria 1665
990 Ga0496109_0268099 3300048912 Bacteria 1609
991 Ga0496110_0003657 3300048913 Bacteria 11830
992 Ga0496110_0405221 3300048913 Bacteria 1243
993 Ga0496111_0263126 3300048914 Bacteria 1280
994 Ga0496112_0001428 3300048915 Bacteria 18307
995 Ga0496112_0040443 3300048915 Bacteria 4558
996 Ga0496112_0049692 3300048915 Bacteria 4110
997 Ga0496112_0145292 3300048915 Bacteria 2340
998 Ga0496112_0172508 3300048915 Bacteria 2128
999 Ga0496112_0174301 3300048915 Bacteria 2116
1000 Ga0496112_0188100 3300048915 Bacteria 2028
1001 Ga0496112_0401129 3300048915 Unclassified 1311
1002 Ga0496112_0469516 3300048915 Bacteria 1195
1003 Ga0496113_0048323 3300048916 Bacteria 3165
1004 Ga0496115_0010377 3300048918 Bacteria 6959
1005 Ga0496115_0020040 3300048918 Bacteria 5153
1006 Ga0496115_0076522 3300048918 Bacteria 2720
1007 Ga0496115_0153907 3300048918 Bacteria 1899
1008 Ga0496117_0106576 3300048920 Bacteria 1758
1009 Ga0496121_0006704 3300048924 Bacteria 14148
1010 Ga0496125_0069121 3300048928 Bacteria 2773
1011 Ga0496126_0000091 3300048929 Bacteria 209427
1012 Ga0496126_0000767 3300048929 Bacteria 58096
1013 Ga0495682_0018391 3300049460 Bacteria 2632
1014 Ga0501032_0000027 3300049569 Bacteria 136304
1015 Ga0501032_0001332 3300049569 Bacteria 19702
1016 Ga0501032_0005178 3300049569 Bacteria 9717
1017 Ga0501033_0000002 3300049570 Bacteria 668574
1018 Ga0501033_0003561 3300049570 Bacteria 12735
1019 Ga0501033_0025247 3300049570 Bacteria 4476
1020 Ga0501034_0001001 3300049571 Bacteria 40495
1021 Ga0501036_0063880 3300049572 Bacteria 3117
1022 Ga0501036_0143417 3300049572 Bacteria 2015
1023 Ga0501037_0019522 3300049573 Bacteria 5000
1024 Ga0501038_0001520 3300049574 Bacteria 21371
1025 Ga0501038_0352441 3300049574 Bacteria 1146
1026 Ga0501040_0243783 3300049576 Bacteria 1282
1027 Ga0501043_0041393 3300049579 Bacteria 3620
1028 Ga0501046_0000265 3300049580 Bacteria 53355
1029 Ga0501046_0003292 3300049580 Bacteria 14841
1030 Ga0501047_0000409 3300049581 Bacteria 48120
1031 Ga0501047_0005823 3300049581 Bacteria 11601
1032 Ga0501047_0099360 3300049581 Bacteria 2789
1033 Ga0501047_0224983 3300049581 Bacteria 1731
1034 Ga0501047_0365730 3300049581 Bacteria 1278
1035 Ga0501070_0231494 3300049586 Bacteria 1514
1036 Ga0501072_0226195 3300049588 Bacteria 1491
1037 Ga0501073_0063218 3300049589 Bacteria 2582
1038 Ga0501073_0190096 3300049589 Bacteria 1421
1039 Ga0501076_0136603 3300049592 Bacteria 1991
1040 Ga0501076_0209646 3300049592 Bacteria 1592
1041 Ga0501077_0135674 3300049593 Bacteria 1561
1042 Ga0501080_0007661 3300049742 Bacteria 9764
1043 Ga0501080_0027972 3300049742 Bacteria 5243
1044 Ga0501080_0357412 3300049742 Bacteria 1318
1045 Ga0501083_0000836 3300049744 Bacteria 20240
1046 Ga0501083_0038931 3300049744 Bacteria 3230
1047 Ga0501035_0000475 3300049822 Bacteria 45010
1048 Ga0501044_0000080 3300049823 Bacteria 116837
1049 Ga0501044_0000704 3300049823 Bacteria 40368
1050 Ga0501044_0001313 3300049823 Bacteria 29303
1051 Ga0501044_0014025 3300049823 Bacteria 8652
1052 Ga0501044_0022872 3300049823 Bacteria 6656
1053 nmdc:mga03683_54875_c1 3300050489 Bacteria 1672
1054 nmdc:mga03n38_7367_c1 3300050490 Bacteria 3890
1055 nmdc:mga00v17_86930_c1 3300050491 Bacteria 1960
1056 nmdc:mga0k408_458_c1 3300050493 Bacteria 22385
1057 nmdc:mga04h51_4737_c1 3300050495 Bacteria 3411
1058 nmdc:mga05p37_113708_c1 3300050507 Bacteria 3328
1059 nmdc:mga05p37_409_c1 3300050507 Bacteria 46305
1060 nmdc:mga05p37_65263_c1 3300050507 Bacteria 4479
1061 nmdc:mga0qj67_45305_c1 3300050509 Bacteria 3471
1062 nmdc:mga06r32_101896_c1 3300050510 Bacteria 2818
1063 nmdc:mga06r32_144539_c1 3300050510 Bacteria 2356
1064 nmdc:mga08y16_442816_c1 3300050511 Bacteria 1326
1065 nmdc:mga08y16_49831_c1 3300050511 Bacteria 4382
1066 nmdc:mga08y16_66040_c1 3300050511 Unclassified 3776
1067 nmdc:mga08y16_7180_c1 3300050511 Bacteria 11689
1068 nmdc:mga08y16_8626_c1 3300050511 Bacteria 10689
1069 nmdc:mga0n895_3428_c1 3300050512 Bacteria 12792
1070 nmdc:mga0n895_43753_c1 3300050512 Bacteria 4364
1071 nmdc:mga0n895_9628_c1 3300050512 Bacteria 8466
1072 nmdc:mga0rr50_7752_c1 3300050513 Bacteria 6653
1073 nmdc:mga08x19_118171_c1 3300050514 Bacteria 1774
1074 nmdc:mga08x19_34938_c1 3300050514 Bacteria 3179
1075 nmdc:mga08x19_51588_c1 3300050514 Bacteria 2643
1076 nmdc:mga0a205_257287_c1 3300050515 Bacteria 1624
1077 Ga0495595_0072037 3300053084 Bacteria 1635
1078 Ga0500651_0000002 3300053093 Bacteria 476609
1079 Ga0500641_0008050 3300053096 Bacteria 3758
1080 Ga0500595_000036 3300053119 Bacteria 103200
1081 Ga0500595_019644 3300053119 Bacteria 2448
1082 Ga0500568_0002084 3300053139 Bacteria 12122
1083 Ga0500616_0000924 3300053153 Bacteria 32088
1084 Ga0500645_000688 3300053730 Bacteria 21110
1085 Ga0501084_0083699 3300054114 Bacteria 2678
1086 Ga0590071_026596 3300059421 Bacteria 1373
1087 Ga0501082_0035853 3300060353 Bacteria 4275
1088 Ga0530510_0181935 3300061734 Bacteria 1559

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025915 Ga0207693_10161948 Ga0207693_101619482 331
2 3300046809 Ga0495600_0201755 Ga0495600_0201755_208_1266 347
3 3300003320 rootH2_10268766 rootH2_102687662 349
4 3300025945 Ga0207679_10297206 Ga0207679_102972061 349
5 3300044719 Ga0466971_0125743 Ga0466971_0125743_16_1095 351
6 3300005329 Ga0070683_100068110 Ga0070683_1000681102 352
7 3300005338 Ga0068868_100075271 Ga0068868_1000752713 352
8 3300005435 Ga0070714_100000027 Ga0070714_10000002715 352
9 3300005436 Ga0070713_100079033 Ga0070713_1000790332 352
10 3300005458 Ga0070681_10000149 Ga0070681_1000014911 352
11 3300005563 Ga0068855_100000234 Ga0068855_10000023441 352
12 3300005614 Ga0068856_100000062 Ga0068856_10000006229 352
13 3300006237 Ga0097621_100000148 Ga0097621_10000014817 352
14 3300006358 Ga0068871_100000465 Ga0068871_1000004654 352
15 3300025912 Ga0207707_10014404 Ga0207707_100144044 352
16 3300025913 Ga0207695_10012755 Ga0207695_100127556 352
17 3300025916 Ga0207663_10243547 Ga0207663_102435472 352
18 3300025921 Ga0207652_10023765 Ga0207652_100237652 352
19 3300025944 Ga0207661_10048778 Ga0207661_100487782 352
20 3300026078 Ga0207702_10006562 Ga0207702_100065626 352
21 3300026142 Ga0207698_10019954 Ga0207698_100199543 352
22 3300042131 Ga0450894_012304 Ga0450894_012304_26_1084 352
23 3300046663 Ga0495635_0055728 Ga0495635_0055728_17_1075 352
24 3300048910 Ga0496107_0328829 Ga0496107_0328829_58_1116 352
25 3300048915 Ga0496112_0172508 Ga0496112_0172508_1040_2101 352
26 3300025942 Ga0207689_10095661 Ga0207689_100956614 355
27 3300046459 Ga0495629_0055591 Ga0495629_0055591_24_1112 355
28 3300005328 Ga0070676_10156917 Ga0070676_101569171 357
29 3300005329 Ga0070683_100009033 Ga0070683_1000090335 357
30 3300009174 Ga0105241_10018618 Ga0105241_100186183 357
31 3300013102 Ga0157371_10065256 Ga0157371_100652562 357
32 3300013296 Ga0157374_10000454 Ga0157374_100004542 357
33 3300013297 Ga0157378_10000009 Ga0157378_1000000933 357
34 3300013307 Ga0157372_10000140 Ga0157372_1000014050 357
35 3300035691 Ga0373931_0036185 Ga0373931_0036185_1441_2559 357
36 3300048915 Ga0496112_0145292 Ga0496112_0145292_957_2075 357
37 3300005344 Ga0070661_100108621 Ga0070661_1001086212 360
38 3300005434 Ga0070709_10052674 Ga0070709_100526742 360
39 3300005435 Ga0070714_100055781 Ga0070714_1000557812 360
40 3300005435 Ga0070714_100409118 Ga0070714_1004091181 360
41 3300005436 Ga0070713_100366177 Ga0070713_1003661771 360
42 3300005437 Ga0070710_10062584 Ga0070710_100625842 360
43 3300005458 Ga0070681_10143054 Ga0070681_101430541 360
44 3300005530 Ga0070679_100009893 Ga0070679_1000098932 360
45 3300005564 Ga0070664_100139417 Ga0070664_1001394172 360
46 3300005616 Ga0068852_100199805 Ga0068852_1001998052 360
47 3300005718 Ga0068866_10031134 Ga0068866_100311342 360
48 3300005843 Ga0068860_100192207 Ga0068860_1001922072 360
49 3300006175 Ga0070712_100022744 Ga0070712_1000227443 360
50 3300006852 Ga0075433_10040006 Ga0075433_100400062 360
51 3300006881 Ga0068865_100030922 Ga0068865_1000309222 360
52 3300006881 Ga0068865_100134808 Ga0068865_1001348081 360
53 3300009093 Ga0105240_10000590 Ga0105240_1000059032 360
54 3300009093 Ga0105240_10004970 Ga0105240_100049707 360
55 3300009093 Ga0105240_10007428 Ga0105240_100074284 360
56 3300009093 Ga0105240_10133724 Ga0105240_101337242 360
57 3300009098 Ga0105245_10006431 Ga0105245_100064317 360
58 3300009098 Ga0105245_10225636 Ga0105245_102256362 360
59 3300009174 Ga0105241_10002378 Ga0105241_1000237810 360
60 3300009174 Ga0105241_10004219 Ga0105241_100042199 360
61 3300009177 Ga0105248_10000410 Ga0105248_100004103 360
62 3300009177 Ga0105248_10001713 Ga0105248_1000171310 360
63 3300009545 Ga0105237_10001590 Ga0105237_1000159015 360
64 3300009545 Ga0105237_10207399 Ga0105237_102073992 360
65 3300009551 Ga0105238_10000491 Ga0105238_100004919 360
66 3300009551 Ga0105238_10000502 Ga0105238_1000050211 360
67 3300009551 Ga0105238_10000609 Ga0105238_100006092 360
68 3300010375 Ga0105239_10001077 Ga0105239_100010775 360
69 3300010375 Ga0105239_10271508 Ga0105239_102715082 360
70 3300013100 Ga0157373_10028847 Ga0157373_100288473 360
71 3300013100 Ga0157373_10050750 Ga0157373_100507503 360
72 3300013102 Ga0157371_10080205 Ga0157371_100802052 360
73 3300013105 Ga0157369_10000159 Ga0157369_1000015945 360
74 3300013105 Ga0157369_10001480 Ga0157369_100014803 360
75 3300013105 Ga0157369_10036629 Ga0157369_100366292 360
76 3300013105 Ga0157369_10098054 Ga0157369_100980542 360
77 3300013105 Ga0157369_10104987 Ga0157369_101049872 360
78 3300013296 Ga0157374_10000062 Ga0157374_1000006271 360
79 3300013296 Ga0157374_10034065 Ga0157374_100340652 360
80 3300013297 Ga0157378_10000345 Ga0157378_1000034528 360
81 3300013297 Ga0157378_10020738 Ga0157378_100207382 360
82 3300013297 Ga0157378_10037848 Ga0157378_100378482 360
83 3300013297 Ga0157378_10041753 Ga0157378_100417532 360
84 3300013297 Ga0157378_10043095 Ga0157378_100430952 360
85 3300013306 Ga0163162_10010214 Ga0163162_100102146 360
86 3300013306 Ga0163162_10550540 Ga0163162_105505401 360
87 3300013307 Ga0157372_10000845 Ga0157372_1000084522 360
88 3300013307 Ga0157372_10002792 Ga0157372_1000279211 360
89 3300013307 Ga0157372_10003387 Ga0157372_100033874 360
90 3300013307 Ga0157372_10003675 Ga0157372_100036752 360
91 3300013307 Ga0157372_10005454 Ga0157372_100054546 360
92 3300013307 Ga0157372_10308555 Ga0157372_103085551 360
93 3300013308 Ga0157375_10049155 Ga0157375_100491552 360
94 3300014325 Ga0163163_10083726 Ga0163163_100837262 360
95 3300014968 Ga0157379_10024598 Ga0157379_100245982 360
96 3300014969 Ga0157376_10001674 Ga0157376_100016749 360
97 3300025900 Ga0207710_10034641 Ga0207710_100346412 360
98 3300025911 Ga0207654_10063649 Ga0207654_100636492 360
99 3300025912 Ga0207707_10326655 Ga0207707_103266552 360
100 3300025914 Ga0207671_10046967 Ga0207671_100469673 360
101 3300025914 Ga0207671_10064106 Ga0207671_100641062 360
102 3300025915 Ga0207693_10065576 Ga0207693_100655762 360
103 3300025928 Ga0207700_10077224 Ga0207700_100772243 360
104 3300025934 Ga0207686_10039392 Ga0207686_100393922 360
105 3300025935 Ga0207709_10052774 Ga0207709_100527742 360
106 3300025936 Ga0207670_10208398 Ga0207670_102083982 360
107 3300025939 Ga0207665_10018379 Ga0207665_100183794 360
108 3300025981 Ga0207640_10038872 Ga0207640_100388722 360
109 3300026078 Ga0207702_10025127 Ga0207702_100251272 360
110 3300026078 Ga0207702_10042361 Ga0207702_100423612 360
111 3300026121 Ga0207683_10155916 Ga0207683_101559163 360
112 3300026142 Ga0207698_10151120 Ga0207698_101511202 360
113 3300028380 Ga0268265_10168244 Ga0268265_101682442 360
114 3300035112 Ga0373932_0039735 Ga0373932_0039735_219_1307 360
115 3300035691 Ga0373931_0088349 Ga0373931_0088349_46_1134 360
116 3300036401 Ga0373937_0025917 Ga0373937_0025917_667_1785 360
117 3300036401 Ga0373937_0266062 Ga0373937_0266062_377_1465 360
118 3300037068 Ga0373925_0080788 Ga0373925_0080788_856_1944 360
119 3300037418 Ga0395900_0095002 Ga0395900_0095002_499_1587 360
120 3300037466 Ga0395898_0261431 Ga0395898_0261431_487_1575 360
121 3300041512 Ga0451853_3969147 Ga0451853_3969147_11_1111 360
122 3300044694 Ga0466963_0005862 Ga0466963_0005862_2400_3491 360
123 3300044706 Ga0466964_0079416 Ga0466964_0079416_103_1194 360
124 3300044842 Ga0466957_0057753 Ga0466957_0057753_20_1111 360
125 3300045049 Ga0466959_0136618 Ga0466959_0136618_160_1251 360
126 3300045836 Ga0466958_0074458 Ga0466958_0074458_116_1207 360
127 3300046455 Ga0495603_0111963 Ga0495603_0111963_352_1440 360
128 3300046459 Ga0495629_0001765 Ga0495629_0001765_14783_15871 360
129 3300046459 Ga0495629_0014957 Ga0495629_0014957_2920_4008 360
130 3300046471 Ga0495650_0000186 Ga0495650_0000186_64273_65361 360
131 3300046472 Ga0495580_0001774 Ga0495580_0001774_8107_9195 360
132 3300046472 Ga0495580_0006470 Ga0495580_0006470_2668_3756 360
133 3300046472 Ga0495580_0103043 Ga0495580_0103043_399_1487 360
134 3300046499 Ga0495594_0000696 Ga0495594_0000696_8828_9916 360
135 3300046506 Ga0495583_0028942 Ga0495583_0028942_1343_2431 360
136 3300046516 Ga0495628_0188848 Ga0495628_0188848_211_1299 360
137 3300046529 Ga0495652_0057880 Ga0495652_0057880_747_1835 360
138 3300046543 Ga0495645_0011659 Ga0495645_0011659_170_1258 360
139 3300046557 Ga0495622_0024995 Ga0495622_0024995_698_1786 360
140 3300046616 Ga0495668_0082572 Ga0495668_0082572_67_1155 360
141 3300046660 Ga0495625_0000315 Ga0495625_0000315_41232_42320 360
142 3300046679 Ga0495623_0020095 Ga0495623_0020095_3188_4276 360
143 3300046680 Ga0495646_0144642 Ga0495646_0144642_10_1098 360
144 3300046683 Ga0495658_0015852 Ga0495658_0015852_127_1215 360
145 3300046689 Ga0495613_0004064 Ga0495613_0004064_4799_5887 360
146 3300046809 Ga0495600_0077268 Ga0495600_0077268_415_1503 360
147 3300046809 Ga0495600_0084830 Ga0495600_0084830_876_1964 360
148 3300047319 Ga0495674_0003962 Ga0495674_0003962_305_1393 360
149 3300047444 Ga0495675_0018679 Ga0495675_0018679_1593_2714 360
150 3300047471 Ga0495684_0067018 Ga0495684_0067018_673_1761 360
151 3300047472 Ga0495686_0006455 Ga0495686_0006455_7181_8269 360
152 3300048088 Ga0495602_0028268 Ga0495602_0028268_3429_4547 360
153 3300048088 Ga0495602_0248159 Ga0495602_0248159_19_1140 360
154 3300048089 Ga0495614_0012332 Ga0495614_0012332_1135_2223 360
155 3300048905 Ga0496102_0083902 Ga0496102_0083902_1429_2544 360
156 3300048907 Ga0496104_0015296 Ga0496104_0015296_1071_2159 360
157 3300048907 Ga0496104_0236110 Ga0496104_0236110_217_1305 360
158 3300048907 Ga0496104_0236302 Ga0496104_0236302_100_1215 360
159 3300048912 Ga0496109_0268099 Ga0496109_0268099_252_1367 360
160 3300048914 Ga0496111_0263126 Ga0496111_0263126_180_1268 360
161 3300048915 Ga0496112_0001428 Ga0496112_0001428_4023_5111 360
162 3300048915 Ga0496112_0040443 Ga0496112_0040443_1338_2453 360
163 3300048915 Ga0496112_0174301 Ga0496112_0174301_775_1890 360
164 3300048915 Ga0496112_0188100 Ga0496112_0188100_672_1760 360
165 3300048918 Ga0496115_0076522 Ga0496115_0076522_379_1467 360
166 3300048918 Ga0496115_0153907 Ga0496115_0153907_776_1864 360
167 3300049574 Ga0501038_0352441 Ga0501038_0352441_37_1131 360
168 3300049589 Ga0501073_0063218 Ga0501073_0063218_1294_2382 360
169 3300049589 Ga0501073_0190096 Ga0501073_0190096_150_1238 360
170 3300050514 nmdc:mga08x19_34938_c1 nmdc:mga08x19_34938_c1_134_1225 360
171 3300053084 Ga0495595_0072037 Ga0495595_0072037_483_1571 360
172 3300039437 Ga0436365_0375454 Ga0436365_0375454_785_1873 361
173 3300039437 Ga0436365_1076298 Ga0436365_1076298_5894_6982 361
174 3300046689 Ga0495613_0007905 Ga0495613_0007905_3506_4639 361
175 3300047319 Ga0495674_0325647 Ga0495674_0325647_105_1193 361
176 3300047471 Ga0495684_0224538 Ga0495684_0224538_263_1366 361
177 3300048915 Ga0496112_0401129 Ga0496112_0401129_172_1260 361
178 3300049742 Ga0501080_0357412 Ga0501080_0357412_83_1171 361
179 3300050511 nmdc:mga08y16_442816_c1 nmdc:mga08y16_442816_c1_20_1108 361
180 3300005347 Ga0070668_100076790 Ga0070668_1000767902 371
181 3300005614 Ga0068856_100018229 Ga0068856_1000182294 371
182 3300025919 Ga0207657_10008891 Ga0207657_100088917 371
183 3300026041 Ga0207639_10032730 Ga0207639_100327302 371
184 3300048913 Ga0496110_0003657 Ga0496110_0003657_7937_9061 374
185 3300006871 Ga0075434_100027321 Ga0075434_1000273213 378
186 3300009093 Ga0105240_10046652 Ga0105240_100466525 378
187 3300009553 Ga0105249_10065772 Ga0105249_100657722 378
188 3300013105 Ga0157369_10153338 Ga0157369_101533383 378
189 3300013307 Ga0157372_10167813 Ga0157372_101678132 378
190 3300048910 Ga0496107_0127085 Ga0496107_0127085_379_1521 378
191 3300048912 Ga0496109_0251165 Ga0496109_0251165_162_1304 378
192 3300048913 Ga0496110_0405221 Ga0496110_0405221_28_1170 378
193 3300048915 Ga0496112_0049692 Ga0496112_0049692_2871_4013 378
194 3300050512 nmdc:mga0n895_43753_c1 nmdc:mga0n895_43753_c1_1224_2366 378
195 3300006173 Ga0070716_100000711 Ga0070716_1000007117 379
196 3300006175 Ga0070712_100000038 Ga0070712_1000000387 379
197 3300025906 Ga0207699_10000549 Ga0207699_100005494 379
198 3300025913 Ga0207695_10089610 Ga0207695_100896103 379
199 3300025915 Ga0207693_10000058 Ga0207693_1000005844 379
200 3300025928 Ga0207700_10003116 Ga0207700_100031163 379
201 3300025939 Ga0207665_10003619 Ga0207665_100036197 379
202 3300050511 nmdc:mga08y16_66040_c1 nmdc:mga08y16_66040_c1_1612_2757 379
203 3300050509 nmdc:mga0qj67_45305_c1 nmdc:mga0qj67_45305_c1_595_1740 380
204 3300005347 Ga0070668_100023467 Ga0070668_1000234674 383
205 3300005354 Ga0070675_100062714 Ga0070675_1000627142 383
206 3300005364 Ga0070673_100104832 Ga0070673_1001048322 383
207 3300005615 Ga0070702_100080234 Ga0070702_1000802342 383
208 3300005618 Ga0068864_100321851 Ga0068864_1003218512 383
209 3300005843 Ga0068860_100131657 Ga0068860_1001316572 383
210 3300006237 Ga0097621_100113357 Ga0097621_1001133572 383
211 3300013296 Ga0157374_10011409 Ga0157374_100114097 383
212 3300013297 Ga0157378_10183479 Ga0157378_101834792 383
213 3300014969 Ga0157376_10028333 Ga0157376_100283332 383
214 3300025907 Ga0207645_10061558 Ga0207645_100615582 383
215 3300025914 Ga0207671_10037550 Ga0207671_100375501 383
216 3300025933 Ga0207706_10028125 Ga0207706_100281254 383
217 3300025949 Ga0207667_10255488 Ga0207667_102554882 383
218 3300025972 Ga0207668_10175087 Ga0207668_101750872 383
219 3300026041 Ga0207639_10212133 Ga0207639_102121332 383
220 3300026095 Ga0207676_10153633 Ga0207676_101536332 383
221 3300026121 Ga0207683_10008453 Ga0207683_100084535 383
222 3300046543 Ga0495645_0158386 Ga0495645_0158386_10_1182 383
223 3300025908 Ga0207643_10091232 Ga0207643_100912321 384
224 3300026023 Ga0207677_10019695 Ga0207677_100196952 384
225 iso_pu_bacteria 2884215851 2884216299 384
226 3300005334 Ga0068869_100003330 Ga0068869_1000033306 385
227 3300005338 Ga0068868_100000995 Ga0068868_1000009958 385
228 3300005458 Ga0070681_10019874 Ga0070681_100198744 385
229 3300005563 Ga0068855_100296330 Ga0068855_1002963302 385
230 3300005564 Ga0070664_100001824 Ga0070664_1000018249 385
231 3300005577 Ga0068857_100001376 Ga0068857_10000137611 385
232 3300005578 Ga0068854_100023685 Ga0068854_1000236854 385
233 3300005614 Ga0068856_100000179 Ga0068856_10000017917 385
234 3300005617 Ga0068859_100001235 Ga0068859_1000012356 385
235 3300005618 Ga0068864_100000129 Ga0068864_10000012953 385
236 3300005718 Ga0068866_10007078 Ga0068866_100070782 385
237 3300005842 Ga0068858_100006877 Ga0068858_1000068773 385
238 3300005843 Ga0068860_100031048 Ga0068860_1000310483 385
239 3300006931 Ga0097620_100001235 Ga0097620_1000012356 385
240 3300025899 Ga0207642_10004701 Ga0207642_100047013 385
241 3300025904 Ga0207647_10064903 Ga0207647_100649032 385
242 3300025907 Ga0207645_10084597 Ga0207645_100845972 385
243 3300025911 Ga0207654_10033871 Ga0207654_100338712 385
244 3300025912 Ga0207707_10020215 Ga0207707_100202154 385
245 3300025936 Ga0207670_10190809 Ga0207670_101908092 385
246 3300025942 Ga0207689_10021947 Ga0207689_100219474 385
247 3300025944 Ga0207661_10029779 Ga0207661_100297793 385
248 3300025945 Ga0207679_10032524 Ga0207679_100325243 385
249 3300025949 Ga0207667_10255066 Ga0207667_102550662 385
250 3300025981 Ga0207640_10005099 Ga0207640_100050992 385
251 3300026035 Ga0207703_10006688 Ga0207703_100066888 385
252 3300026078 Ga0207702_10011681 Ga0207702_100116813 385
253 3300026116 Ga0207674_10000763 Ga0207674_1000076312 385
254 3300028381 Ga0268264_10028635 Ga0268264_100286353 385
255 3300048915 Ga0496112_0469516 Ga0496112_0469516_28_1185 385
256 3300049571 Ga0501034_0001001 Ga0501034_0001001_15346_16518 386
257 3300049581 Ga0501047_0365730 Ga0501047_0365730_79_1251 386
258 3300049742 Ga0501080_0027972 Ga0501080_0027972_2638_3810 386
259 iso_pu_bacteria 2599185240 2599743996 386
260 iso_pu_bacteria 2599185355 2600206938 386
261 iso_pu_bacteria 2643221672 2644397335 386
262 iso_pu_bacteria 2675903129 2676742221 386
263 iso_pu_bacteria 2721755523 2722882510 386
264 iso_pu_bacteria 2751185846 2753566833 386
265 iso_pu_bacteria 2839138175 2839141233 386
266 iso_pu_bacteria 2870068957 2870074285 386
267 iso_pu_bacteria 2883087390 2883091151 386
268 iso_pu_bacteria 2928157003 2928161075 386
269 iso_pu_bacteria 2928163908 2928165988 386
270 iso_pu_bacteria 2945945610 2945947379 386
271 iso_pu_bacteria 2981990288 2981991258 386
272 iso_pu_bacteria 641736154 642413974 386
273 iso_pu_bacteria 8020938398 8020943693 386
274 iso_pu_bacteria 8020945358 8020950130 386
275 iso_pu_bacteria 8020953355 8020953728 386
276 3300006028 Ga0070717_10129014 Ga0070717_101290142 387
277 3300006051 Ga0075364_10006031 Ga0075364_100060312 387
278 3300006177 Ga0075362_10024906 Ga0075362_100249062 387
279 3300007076 Ga0075435_100034872 Ga0075435_1000348722 387
280 3300009551 Ga0105238_10121114 Ga0105238_101211142 387
281 3300027907 Ga0207428_10000595 Ga0207428_1000059521 387
282 3300054114 Ga0501084_0083699 Ga0501084_0083699_1349_2518 387
283 3300061734 Ga0530510_0181935 Ga0530510_0181935_230_1399 387
284 3300002155 JGI24033J26618_1000037 JGI24033J26618_10000379 388
285 3300002244 JGI24742J22300_10003287 JGI24742J22300_100032871 388
286 3300005289 Ga0065704_10091282 Ga0065704_100912822 388
287 3300005295 Ga0065707_10083153 Ga0065707_100831535 388
288 3300005327 Ga0070658_10003728 Ga0070658_100037286 388
289 3300005327 Ga0070658_10004063 Ga0070658_100040634 388
290 3300005327 Ga0070658_10062775 Ga0070658_100627753 388
291 3300005329 Ga0070683_100011056 Ga0070683_1000110563 388
292 3300005329 Ga0070683_100021235 Ga0070683_1000212353 388
293 3300005329 Ga0070683_100069940 Ga0070683_1000699402 388
294 3300005329 Ga0070683_100080234 Ga0070683_1000802342 388
295 3300005329 Ga0070683_100134495 Ga0070683_1001344952 388
296 3300005329 Ga0070683_100418765 Ga0070683_1004187651 388
297 3300005330 Ga0070690_100019999 Ga0070690_1000199993 388
298 3300005331 Ga0070670_100061559 Ga0070670_1000615591 388
299 3300005331 Ga0070670_100115718 Ga0070670_1001157182 388
300 3300005331 Ga0070670_100336729 Ga0070670_1003367291 388
301 3300005334 Ga0068869_100009877 Ga0068869_1000098774 388
302 3300005334 Ga0068869_100180815 Ga0068869_1001808152 388
303 3300005335 Ga0070666_10085756 Ga0070666_100857562 388
304 3300005336 Ga0070680_100028433 Ga0070680_1000284333 388
305 3300005336 Ga0070680_100110941 Ga0070680_1001109412 388
306 3300005336 Ga0070680_100221134 Ga0070680_1002211341 388
307 3300005336 Ga0070680_100330784 Ga0070680_1003307841 388
308 3300005337 Ga0070682_100188796 Ga0070682_1001887961 388
309 3300005338 Ga0068868_100036285 Ga0068868_1000362853 388
310 3300005339 Ga0070660_100021389 Ga0070660_1000213893 388
311 3300005339 Ga0070660_100102532 Ga0070660_1001025322 388
312 3300005339 Ga0070660_100142442 Ga0070660_1001424422 388
313 3300005339 Ga0070660_100154512 Ga0070660_1001545122 388
314 3300005344 Ga0070661_100000291 Ga0070661_10000029130 388
315 3300005344 Ga0070661_100005720 Ga0070661_1000057203 388
316 3300005344 Ga0070661_100006096 Ga0070661_1000060962 388
317 3300005344 Ga0070661_100041201 Ga0070661_1000412012 388
318 3300005344 Ga0070661_100053750 Ga0070661_1000537503 388
319 3300005347 Ga0070668_100166764 Ga0070668_1001667642 388
320 3300005353 Ga0070669_100041171 Ga0070669_1000411712 388
321 3300005354 Ga0070675_100004246 Ga0070675_1000042464 388
322 3300005365 Ga0070688_100021582 Ga0070688_1000215822 388
323 3300005366 Ga0070659_100017358 Ga0070659_1000173582 388
324 3300005367 Ga0070667_100104852 Ga0070667_1001048523 388
325 3300005367 Ga0070667_100169212 Ga0070667_1001692122 388
326 3300005367 Ga0070667_100243182 Ga0070667_1002431821 388
327 3300005434 Ga0070709_10000744 Ga0070709_100007444 388
328 3300005434 Ga0070709_10156950 Ga0070709_101569502 388
329 3300005435 Ga0070714_100008972 Ga0070714_1000089723 388
330 3300005436 Ga0070713_100000070 Ga0070713_10000007032 388
331 3300005436 Ga0070713_100001120 Ga0070713_1000011207 388
332 3300005436 Ga0070713_100005813 Ga0070713_1000058135 388
333 3300005436 Ga0070713_100006427 Ga0070713_1000064272 388
334 3300005437 Ga0070710_10054630 Ga0070710_100546301 388
335 3300005437 Ga0070710_10109345 Ga0070710_101093452 388
336 3300005439 Ga0070711_100000078 Ga0070711_10000007830 388
337 3300005439 Ga0070711_100001722 Ga0070711_1000017227 388
338 3300005444 Ga0070694_100220469 Ga0070694_1002204691 388
339 3300005445 Ga0070708_100047456 Ga0070708_1000474563 388
340 3300005456 Ga0070678_100311823 Ga0070678_1003118232 388
341 3300005458 Ga0070681_10009094 Ga0070681_100090948 388
342 3300005458 Ga0070681_10036358 Ga0070681_100363583 388
343 3300005458 Ga0070681_10117020 Ga0070681_101170202 388
344 3300005458 Ga0070681_10137801 Ga0070681_101378012 388
345 3300005458 Ga0070681_10140657 Ga0070681_101406572 388
346 3300005458 Ga0070681_10162661 Ga0070681_101626612 388
347 3300005458 Ga0070681_10172737 Ga0070681_101727372 388
348 3300005458 Ga0070681_10205948 Ga0070681_102059482 388
349 3300005459 Ga0068867_100075404 Ga0068867_1000754042 388
350 3300005459 Ga0068867_100087773 Ga0068867_1000877732 388
351 3300005467 Ga0070706_100001937 Ga0070706_1000019379 388
352 3300005468 Ga0070707_100336917 Ga0070707_1003369172 388
353 3300005471 Ga0070698_100382453 Ga0070698_1003824531 388
354 3300005530 Ga0070679_100010417 Ga0070679_1000104175 388
355 3300005530 Ga0070679_100015002 Ga0070679_1000150023 388
356 3300005530 Ga0070679_100015901 Ga0070679_1000159014 388
357 3300005530 Ga0070679_100063691 Ga0070679_1000636913 388
358 3300005530 Ga0070679_100093020 Ga0070679_1000930202 388
359 3300005530 Ga0070679_100119700 Ga0070679_1001197003 388
360 3300005530 Ga0070679_100164794 Ga0070679_1001647942 388
361 3300005535 Ga0070684_100001586 Ga0070684_1000015867 388
362 3300005535 Ga0070684_100004240 Ga0070684_1000042402 388
363 3300005535 Ga0070684_100038630 Ga0070684_1000386302 388
364 3300005536 Ga0070697_100000588 Ga0070697_10000058813 388
365 3300005539 Ga0068853_100000178 Ga0068853_10000017814 388
366 3300005539 Ga0068853_100031767 Ga0068853_1000317672 388
367 3300005539 Ga0068853_100062523 Ga0068853_1000625233 388
368 3300005539 Ga0068853_100297086 Ga0068853_1002970862 388
369 3300005543 Ga0070672_100007077 Ga0070672_1000070773 388
370 3300005544 Ga0070686_100152998 Ga0070686_1001529982 388
371 3300005546 Ga0070696_100134424 Ga0070696_1001344242 388
372 3300005547 Ga0070693_100040243 Ga0070693_1000402432 388
373 3300005548 Ga0070665_100030207 Ga0070665_1000302073 388
374 3300005563 Ga0068855_100000872 Ga0068855_10000087228 388
375 3300005563 Ga0068855_100006297 Ga0068855_1000062978 388
376 3300005563 Ga0068855_100020482 Ga0068855_1000204825 388
377 3300005563 Ga0068855_100020735 Ga0068855_1000207353 388
378 3300005563 Ga0068855_100039858 Ga0068855_1000398583 388
379 3300005563 Ga0068855_100071120 Ga0068855_1000711203 388
380 3300005563 Ga0068855_100097729 Ga0068855_1000977293 388
381 3300005563 Ga0068855_100121391 Ga0068855_1001213912 388
382 3300005563 Ga0068855_100159453 Ga0068855_1001594532 388
383 3300005563 Ga0068855_100251807 Ga0068855_1002518072 388
384 3300005564 Ga0070664_100115801 Ga0070664_1001158012 388
385 3300005564 Ga0070664_100250394 Ga0070664_1002503942 388
386 3300005577 Ga0068857_100030923 Ga0068857_1000309233 388
387 3300005577 Ga0068857_100094433 Ga0068857_1000944332 388
388 3300005578 Ga0068854_100002575 Ga0068854_1000025757 388
389 3300005578 Ga0068854_100008531 Ga0068854_1000085312 388
390 3300005578 Ga0068854_100016429 Ga0068854_1000164293 388
391 3300005578 Ga0068854_100101617 Ga0068854_1001016172 388
392 3300005578 Ga0068854_100109769 Ga0068854_1001097692 388
393 3300005614 Ga0068856_100000347 Ga0068856_1000003476 388
394 3300005614 Ga0068856_100000854 Ga0068856_10000085415 388
395 3300005614 Ga0068856_100001690 Ga0068856_1000016904 388
396 3300005614 Ga0068856_100015481 Ga0068856_1000154816 388
397 3300005614 Ga0068856_100019973 Ga0068856_1000199733 388
398 3300005614 Ga0068856_100052769 Ga0068856_1000527692 388
399 3300005614 Ga0068856_100119927 Ga0068856_1001199272 388
400 3300005616 Ga0068852_100000015 Ga0068852_10000001550 388
401 3300005616 Ga0068852_100000278 Ga0068852_10000027819 388
402 3300005616 Ga0068852_100006834 Ga0068852_1000068344 388
403 3300005616 Ga0068852_100080543 Ga0068852_1000805433 388
404 3300005616 Ga0068852_100166280 Ga0068852_1001662802 388
405 3300005617 Ga0068859_100005339 Ga0068859_1000053399 388
406 3300005617 Ga0068859_100032598 Ga0068859_1000325982 388
407 3300005617 Ga0068859_100050144 Ga0068859_1000501443 388
408 3300005617 Ga0068859_100285614 Ga0068859_1002856142 388
409 3300005618 Ga0068864_100014292 Ga0068864_1000142925 388
410 3300005618 Ga0068864_100028348 Ga0068864_1000283482 388
411 3300005718 Ga0068866_10006317 Ga0068866_100063172 388
412 3300005719 Ga0068861_100016641 Ga0068861_1000166414 388
413 3300005719 Ga0068861_100061316 Ga0068861_1000613162 388
414 3300005841 Ga0068863_100000941 Ga0068863_1000009413 388
415 3300005841 Ga0068863_100017867 Ga0068863_1000178673 388
416 3300005841 Ga0068863_100044093 Ga0068863_1000440932 388
417 3300005841 Ga0068863_100048934 Ga0068863_1000489342 388
418 3300005842 Ga0068858_100002951 Ga0068858_10000295112 388
419 3300005842 Ga0068858_100017770 Ga0068858_1000177702 388
420 3300005842 Ga0068858_100021020 Ga0068858_1000210202 388
421 3300005843 Ga0068860_100008454 Ga0068860_1000084543 388
422 3300005844 Ga0068862_100029668 Ga0068862_1000296684 388
423 3300005844 Ga0068862_100033743 Ga0068862_1000337432 388
424 3300005844 Ga0068862_100078281 Ga0068862_1000782812 388
425 3300005844 Ga0068862_100110110 Ga0068862_1001101102 388
426 3300006028 Ga0070717_10000016 Ga0070717_1000001673 388
427 3300006028 Ga0070717_10001262 Ga0070717_100012624 388
428 3300006028 Ga0070717_10008871 Ga0070717_100088714 388
429 3300006028 Ga0070717_10054607 Ga0070717_100546073 388
430 3300006028 Ga0070717_10069188 Ga0070717_100691882 388
431 3300006028 Ga0070717_10346191 Ga0070717_103461911 388
432 3300006038 Ga0075365_10180341 Ga0075365_101803411 388
433 3300006163 Ga0070715_10013806 Ga0070715_100138063 388
434 3300006173 Ga0070716_100007470 Ga0070716_1000074704 388
435 3300006173 Ga0070716_100008365 Ga0070716_1000083652 388
436 3300006175 Ga0070712_100000288 Ga0070712_10000028817 388
437 3300006175 Ga0070712_100000292 Ga0070712_1000002924 388
438 3300006175 Ga0070712_100015439 Ga0070712_1000154393 388
439 3300006175 Ga0070712_100070931 Ga0070712_1000709312 388
440 3300006195 Ga0075366_10022264 Ga0075366_100222642 388
441 3300006195 Ga0075366_10043177 Ga0075366_100431772 388
442 3300006195 Ga0075366_10122958 Ga0075366_101229582 388
443 3300006237 Ga0097621_100000709 Ga0097621_10000070914 388
444 3300006237 Ga0097621_100007133 Ga0097621_1000071332 388
445 3300006237 Ga0097621_100031210 Ga0097621_1000312103 388
446 3300006237 Ga0097621_100218106 Ga0097621_1002181062 388
447 3300006358 Ga0068871_100000049 Ga0068871_10000004951 388
448 3300006358 Ga0068871_100000439 Ga0068871_10000043921 388
449 3300006847 Ga0075431_100002684 Ga0075431_10000268411 388
450 3300006852 Ga0075433_10342043 Ga0075433_103420432 388
451 3300006871 Ga0075434_100000344 Ga0075434_1000003441 388
452 3300006871 Ga0075434_100004219 Ga0075434_1000042197 388
453 3300006871 Ga0075434_100034351 Ga0075434_1000343513 388
454 3300006881 Ga0068865_100016734 Ga0068865_1000167344 388
455 3300006914 Ga0075436_100040655 Ga0075436_1000406552 388
456 3300006931 Ga0097620_100005338 Ga0097620_1000053389 388
457 3300006931 Ga0097620_100032598 Ga0097620_1000325983 388
458 3300006931 Ga0097620_100050143 Ga0097620_1000501433 388
459 3300006931 Ga0097620_100285612 Ga0097620_1002856122 388
460 3300007076 Ga0075435_100007470 Ga0075435_1000074701 388
461 3300009093 Ga0105240_10000001 Ga0105240_1000000169 388
462 3300009093 Ga0105240_10000181 Ga0105240_1000018141 388
463 3300009093 Ga0105240_10000823 Ga0105240_1000082314 388
464 3300009093 Ga0105240_10008321 Ga0105240_1000832110 388
465 3300009093 Ga0105240_10076065 Ga0105240_100760653 388
466 3300009093 Ga0105240_10091111 Ga0105240_100911113 388
467 3300009093 Ga0105240_10205617 Ga0105240_102056172 388
468 3300009093 Ga0105240_10287979 Ga0105240_102879792 388
469 3300009094 Ga0111539_10001354 Ga0111539_1000135416 388
470 3300009094 Ga0111539_10005577 Ga0111539_1000557713 388
471 3300009098 Ga0105245_10003276 Ga0105245_100032769 388
472 3300009098 Ga0105245_10110320 Ga0105245_101103202 388
473 3300009098 Ga0105245_10208777 Ga0105245_102087771 388
474 3300009101 Ga0105247_10012672 Ga0105247_100126723 388
475 3300009101 Ga0105247_10042813 Ga0105247_100428132 388
476 3300009101 Ga0105247_10157268 Ga0105247_101572682 388
477 3300009147 Ga0114129_10029439 Ga0114129_100294392 388
478 3300009147 Ga0114129_10120618 Ga0114129_101206183 388
479 3300009148 Ga0105243_10004290 Ga0105243_100042904 388
480 3300009174 Ga0105241_10000074 Ga0105241_1000007451 388
481 3300009174 Ga0105241_10012484 Ga0105241_100124846 388
482 3300009174 Ga0105241_10040692 Ga0105241_100406922 388
483 3300009174 Ga0105241_10093290 Ga0105241_100932902 388
484 3300009174 Ga0105241_10106644 Ga0105241_101066442 388
485 3300009176 Ga0105242_10008739 Ga0105242_100087393 388
486 3300009176 Ga0105242_10017961 Ga0105242_100179612 388
487 3300009177 Ga0105248_10001285 Ga0105248_100012859 388
488 3300009177 Ga0105248_10020175 Ga0105248_100201752 388
489 3300009545 Ga0105237_10051350 Ga0105237_100513504 388
490 3300009545 Ga0105237_10108211 Ga0105237_101082112 388
491 3300009551 Ga0105238_10002379 Ga0105238_100023792 388
492 3300009551 Ga0105238_10003639 Ga0105238_100036393 388
493 3300009551 Ga0105238_10022506 Ga0105238_100225062 388
494 3300009551 Ga0105238_10026649 Ga0105238_100266496 388
495 3300009551 Ga0105238_10029170 Ga0105238_100291703 388
496 3300009551 Ga0105238_10038354 Ga0105238_100383543 388
497 3300009551 Ga0105238_10042995 Ga0105238_100429954 388
498 3300009551 Ga0105238_10259554 Ga0105238_102595542 388
499 3300009553 Ga0105249_10041183 Ga0105249_100411831 388
500 3300010375 Ga0105239_10012674 Ga0105239_100126747 388
501 3300010375 Ga0105239_10186670 Ga0105239_101866702 388
502 3300013102 Ga0157371_10148429 Ga0157371_101484291 388
503 3300013104 Ga0157370_10000007 Ga0157370_100000075 388
504 3300013104 Ga0157370_10076055 Ga0157370_100760552 388
505 3300013104 Ga0157370_10077180 Ga0157370_100771802 388
506 3300013105 Ga0157369_10000131 Ga0157369_1000013135 388
507 3300013105 Ga0157369_10000241 Ga0157369_1000024147 388
508 3300013105 Ga0157369_10004149 Ga0157369_100041496 388
509 3300013105 Ga0157369_10014148 Ga0157369_100141487 388
510 3300013105 Ga0157369_10018397 Ga0157369_100183976 388
511 3300013105 Ga0157369_10066048 Ga0157369_100660482 388
512 3300013105 Ga0157369_10108431 Ga0157369_101084312 388
513 3300013105 Ga0157369_10151829 Ga0157369_101518292 388
514 3300013105 Ga0157369_10236396 Ga0157369_102363962 388
515 3300013105 Ga0157369_10286091 Ga0157369_102860912 388
516 3300013105 Ga0157369_10298287 Ga0157369_102982871 388
517 3300013105 Ga0157369_10445242 Ga0157369_104452422 388
518 3300013296 Ga0157374_10002950 Ga0157374_1000295013 388
519 3300013296 Ga0157374_10030262 Ga0157374_100302624 388
520 3300013296 Ga0157374_10030866 Ga0157374_100308664 388
521 3300013296 Ga0157374_10150845 Ga0157374_101508452 388
522 3300013296 Ga0157374_10260396 Ga0157374_102603962 388
523 3300013297 Ga0157378_10000132 Ga0157378_1000013219 388
524 3300013297 Ga0157378_10000423 Ga0157378_1000042314 388
525 3300013297 Ga0157378_10072675 Ga0157378_100726753 388
526 3300013306 Ga0163162_10000119 Ga0163162_1000011929 388
527 3300013306 Ga0163162_10001981 Ga0163162_100019814 388
528 3300013306 Ga0163162_10008867 Ga0163162_100088674 388
529 3300013306 Ga0163162_10155447 Ga0163162_101554472 388
530 3300013306 Ga0163162_10262346 Ga0163162_102623462 388
531 3300013306 Ga0163162_10283849 Ga0163162_102838492 388
532 3300013307 Ga0157372_10000014 Ga0157372_10000014187 388
533 3300013307 Ga0157372_10012767 Ga0157372_100127673 388
534 3300013307 Ga0157372_10036028 Ga0157372_100360283 388
535 3300013307 Ga0157372_10074388 Ga0157372_100743883 388
536 3300013307 Ga0157372_10078927 Ga0157372_100789273 388
537 3300013307 Ga0157372_10093360 Ga0157372_100933603 388
538 3300013307 Ga0157372_10277145 Ga0157372_102771452 388
539 3300013307 Ga0157372_10402010 Ga0157372_104020102 388
540 3300013307 Ga0157372_10466457 Ga0157372_104664572 388
541 3300013308 Ga0157375_10031791 Ga0157375_100317913 388
542 3300013308 Ga0157375_10090265 Ga0157375_100902652 388
543 3300013308 Ga0157375_10289206 Ga0157375_102892062 388
544 3300014325 Ga0163163_10000742 Ga0163163_1000074210 388
545 3300014325 Ga0163163_10331824 Ga0163163_103318242 388
546 3300014326 Ga0157380_10056022 Ga0157380_100560223 388
547 3300014745 Ga0157377_10137890 Ga0157377_101378902 388
548 3300014968 Ga0157379_10063610 Ga0157379_100636103 388
549 3300014968 Ga0157379_10092734 Ga0157379_100927342 388
550 3300014968 Ga0157379_10123904 Ga0157379_101239042 388
551 3300014969 Ga0157376_10004505 Ga0157376_100045054 388
552 3300014969 Ga0157376_10018992 Ga0157376_100189924 388
553 3300014969 Ga0157376_10048210 Ga0157376_100482103 388
554 3300021384 Ga0213876_10010112 Ga0213876_100101124 388
555 3300022732 Ga0224569_100903 Ga0224569_1009032 388
556 3300022734 Ga0224571_101390 Ga0224571_1013902 388
557 3300025898 Ga0207692_10030403 Ga0207692_100304031 388
558 3300025899 Ga0207642_10062203 Ga0207642_100622032 388
559 3300025903 Ga0207680_10112375 Ga0207680_101123752 388
560 3300025904 Ga0207647_10006752 Ga0207647_100067524 388
561 3300025904 Ga0207647_10026076 Ga0207647_100260762 388
562 3300025906 Ga0207699_10045764 Ga0207699_100457642 388
563 3300025906 Ga0207699_10098933 Ga0207699_100989332 388
564 3300025907 Ga0207645_10009002 Ga0207645_100090023 388
565 3300025907 Ga0207645_10032081 Ga0207645_100320812 388
566 3300025909 Ga0207705_10003517 Ga0207705_100035173 388
567 3300025909 Ga0207705_10007192 Ga0207705_100071925 388
568 3300025909 Ga0207705_10037522 Ga0207705_100375222 388
569 3300025910 Ga0207684_10005804 Ga0207684_100058045 388
570 3300025911 Ga0207654_10000238 Ga0207654_100002388 388
571 3300025911 Ga0207654_10000316 Ga0207654_1000031616 388
572 3300025911 Ga0207654_10024895 Ga0207654_100248952 388
573 3300025911 Ga0207654_10094041 Ga0207654_100940412 388
574 3300025912 Ga0207707_10011358 Ga0207707_100113582 388
575 3300025912 Ga0207707_10075676 Ga0207707_100756762 388
576 3300025912 Ga0207707_10113505 Ga0207707_101135052 388
577 3300025913 Ga0207695_10000001 Ga0207695_1000000171 388
578 3300025913 Ga0207695_10000069 Ga0207695_10000069198 388
579 3300025913 Ga0207695_10000161 Ga0207695_1000016144 388
580 3300025913 Ga0207695_10000231 Ga0207695_10000231107 388
581 3300025913 Ga0207695_10000353 Ga0207695_1000035352 388
582 3300025913 Ga0207695_10000656 Ga0207695_1000065635 388
583 3300025913 Ga0207695_10022632 Ga0207695_100226323 388
584 3300025913 Ga0207695_10138701 Ga0207695_101387012 388
585 3300025913 Ga0207695_10220814 Ga0207695_102208142 388
586 3300025914 Ga0207671_10000302 Ga0207671_1000030214 388
587 3300025914 Ga0207671_10000893 Ga0207671_1000089315 388
588 3300025915 Ga0207693_10000012 Ga0207693_1000001268 388
589 3300025915 Ga0207693_10001160 Ga0207693_1000116011 388
590 3300025915 Ga0207693_10058286 Ga0207693_100582862 388
591 3300025916 Ga0207663_10000280 Ga0207663_1000028011 388
592 3300025916 Ga0207663_10003486 Ga0207663_100034865 388
593 3300025917 Ga0207660_10095265 Ga0207660_100952652 388
594 3300025917 Ga0207660_10291204 Ga0207660_102912041 388
595 3300025918 Ga0207662_10118827 Ga0207662_101188272 388
596 3300025919 Ga0207657_10005169 Ga0207657_100051694 388
597 3300025919 Ga0207657_10136934 Ga0207657_101369342 388
598 3300025920 Ga0207649_10002495 Ga0207649_100024954 388
599 3300025920 Ga0207649_10003157 Ga0207649_100031573 388
600 3300025920 Ga0207649_10003294 Ga0207649_100032947 388
601 3300025921 Ga0207652_10003056 Ga0207652_100030567 388
602 3300025921 Ga0207652_10025236 Ga0207652_100252362 388
603 3300025921 Ga0207652_10046960 Ga0207652_100469603 388
604 3300025921 Ga0207652_10120163 Ga0207652_101201632 388
605 3300025923 Ga0207681_10061011 Ga0207681_100610112 388
606 3300025924 Ga0207694_10000137 Ga0207694_1000013713 388
607 3300025924 Ga0207694_10002200 Ga0207694_100022009 388
608 3300025924 Ga0207694_10004080 Ga0207694_100040804 388
609 3300025924 Ga0207694_10004374 Ga0207694_100043749 388
610 3300025924 Ga0207694_10017121 Ga0207694_100171213 388
611 3300025924 Ga0207694_10020076 Ga0207694_100200761 388
612 3300025924 Ga0207694_10021206 Ga0207694_100212063 388
613 3300025924 Ga0207694_10103242 Ga0207694_101032422 388
614 3300025924 Ga0207694_10320855 Ga0207694_103208551 388
615 3300025925 Ga0207650_10084040 Ga0207650_100840402 388
616 3300025927 Ga0207687_10006501 Ga0207687_100065012 388
617 3300025927 Ga0207687_10014350 Ga0207687_100143503 388
618 3300025927 Ga0207687_10050439 Ga0207687_100504392 388
619 3300025928 Ga0207700_10002138 Ga0207700_100021384 388
620 3300025928 Ga0207700_10012980 Ga0207700_100129803 388
621 3300025928 Ga0207700_10017957 Ga0207700_100179572 388
622 3300025928 Ga0207700_10036822 Ga0207700_100368223 388
623 3300025929 Ga0207664_10000098 Ga0207664_1000009839 388
624 3300025929 Ga0207664_10007305 Ga0207664_100073055 388
625 3300025929 Ga0207664_10056761 Ga0207664_100567613 388
626 3300025929 Ga0207664_10092569 Ga0207664_100925692 388
627 3300025931 Ga0207644_10009960 Ga0207644_100099602 388
628 3300025932 Ga0207690_10067802 Ga0207690_100678022 388
629 3300025933 Ga0207706_10017424 Ga0207706_100174244 388
630 3300025934 Ga0207686_10018802 Ga0207686_100188023 388
631 3300025935 Ga0207709_10009883 Ga0207709_100098834 388
632 3300025935 Ga0207709_10081527 Ga0207709_100815272 388
633 3300025936 Ga0207670_10105454 Ga0207670_101054542 388
634 3300025939 Ga0207665_10005922 Ga0207665_100059223 388
635 3300025939 Ga0207665_10011313 Ga0207665_100113132 388
636 3300025940 Ga0207691_10028957 Ga0207691_100289571 388
637 3300025940 Ga0207691_10046834 Ga0207691_100468343 388
638 3300025941 Ga0207711_10000023 Ga0207711_10000023170 388
639 3300025941 Ga0207711_10003045 Ga0207711_100030453 388
640 3300025941 Ga0207711_10004445 Ga0207711_100044457 388
641 3300025941 Ga0207711_10007008 Ga0207711_100070084 388
642 3300025941 Ga0207711_10028858 Ga0207711_100288583 388
643 3300025941 Ga0207711_10130437 Ga0207711_101304373 388
644 3300025942 Ga0207689_10001606 Ga0207689_1000160616 388
645 3300025942 Ga0207689_10002614 Ga0207689_100026146 388
646 3300025942 Ga0207689_10014513 Ga0207689_100145134 388
647 3300025942 Ga0207689_10037071 Ga0207689_100370713 388
648 3300025942 Ga0207689_10054566 Ga0207689_100545662 388
649 3300025944 Ga0207661_10051469 Ga0207661_100514693 388
650 3300025944 Ga0207661_10057318 Ga0207661_100573181 388
651 3300025944 Ga0207661_10103666 Ga0207661_101036662 388
652 3300025945 Ga0207679_10026234 Ga0207679_100262344 388
653 3300025945 Ga0207679_10088123 Ga0207679_100881232 388
654 3300025945 Ga0207679_10120088 Ga0207679_101200882 388
655 3300025949 Ga0207667_10000809 Ga0207667_1000080918 388
656 3300025949 Ga0207667_10003556 Ga0207667_100035569 388
657 3300025949 Ga0207667_10008104 Ga0207667_100081042 388
658 3300025949 Ga0207667_10012826 Ga0207667_100128263 388
659 3300025949 Ga0207667_10018028 Ga0207667_100180284 388
660 3300025949 Ga0207667_10045259 Ga0207667_100452592 388
661 3300025949 Ga0207667_10051579 Ga0207667_100515793 388
662 3300025949 Ga0207667_10130458 Ga0207667_101304582 388
663 3300025949 Ga0207667_10144008 Ga0207667_101440082 388
664 3300025949 Ga0207667_10200301 Ga0207667_102003012 388
665 3300025949 Ga0207667_10236776 Ga0207667_102367762 388
666 3300025949 Ga0207667_10276114 Ga0207667_102761142 388
667 3300025960 Ga0207651_10297833 Ga0207651_102978331 388
668 3300025961 Ga0207712_10050293 Ga0207712_100502932 388
669 3300025972 Ga0207668_10005700 Ga0207668_100057004 388
670 3300025981 Ga0207640_10048138 Ga0207640_100481382 388
671 3300025981 Ga0207640_10080735 Ga0207640_100807352 388
672 3300025981 Ga0207640_10290825 Ga0207640_102908251 388
673 3300026023 Ga0207677_10001674 Ga0207677_100016742 388
674 3300026023 Ga0207677_10009196 Ga0207677_100091964 388
675 3300026023 Ga0207677_10027991 Ga0207677_100279913 388
676 3300026023 Ga0207677_10070889 Ga0207677_100708892 388
677 3300026023 Ga0207677_10229870 Ga0207677_102298702 388
678 3300026035 Ga0207703_10009972 Ga0207703_100099727 388
679 3300026035 Ga0207703_10047849 Ga0207703_100478493 388
680 3300026035 Ga0207703_10135677 Ga0207703_101356771 388
681 3300026041 Ga0207639_10000191 Ga0207639_1000019116 388
682 3300026041 Ga0207639_10134485 Ga0207639_101344852 388
683 3300026067 Ga0207678_10006508 Ga0207678_100065085 388
684 3300026067 Ga0207678_10032951 Ga0207678_100329513 388
685 3300026067 Ga0207678_10034021 Ga0207678_100340212 388
686 3300026067 Ga0207678_10068148 Ga0207678_100681482 388
687 3300026075 Ga0207708_10121356 Ga0207708_101213562 388
688 3300026078 Ga0207702_10000458 Ga0207702_1000045813 388
689 3300026078 Ga0207702_10001020 Ga0207702_1000102010 388
690 3300026078 Ga0207702_10001136 Ga0207702_1000113617 388
691 3300026078 Ga0207702_10003114 Ga0207702_1000311410 388
692 3300026078 Ga0207702_10024096 Ga0207702_100240963 388
693 3300026078 Ga0207702_10064135 Ga0207702_100641353 388
694 3300026078 Ga0207702_10146691 Ga0207702_101466912 388
695 3300026078 Ga0207702_10151081 Ga0207702_101510812 388
696 3300026078 Ga0207702_10275837 Ga0207702_102758371 388
697 3300026078 Ga0207702_10358077 Ga0207702_103580771 388
698 3300026088 Ga0207641_10001055 Ga0207641_1000105510 388
699 3300026088 Ga0207641_10036916 Ga0207641_100369163 388
700 3300026088 Ga0207641_10041831 Ga0207641_100418311 388
701 3300026088 Ga0207641_10063106 Ga0207641_100631062 388
702 3300026089 Ga0207648_10002171 Ga0207648_100021719 388
703 3300026089 Ga0207648_10010502 Ga0207648_100105027 388
704 3300026095 Ga0207676_10002318 Ga0207676_100023188 388
705 3300026095 Ga0207676_10006053 Ga0207676_100060533 388
706 3300026095 Ga0207676_10288928 Ga0207676_102889282 388
707 3300026116 Ga0207674_10001893 Ga0207674_1000189318 388
708 3300026116 Ga0207674_10001984 Ga0207674_1000198412 388
709 3300026116 Ga0207674_10003886 Ga0207674_100038868 388
710 3300026116 Ga0207674_10071079 Ga0207674_100710792 388
711 3300026116 Ga0207674_10103405 Ga0207674_101034052 388
712 3300026116 Ga0207674_10131501 Ga0207674_101315012 388
713 3300026118 Ga0207675_100010959 Ga0207675_1000109592 388
714 3300026118 Ga0207675_100016660 Ga0207675_1000166605 388
715 3300026118 Ga0207675_100155027 Ga0207675_1001550272 388
716 3300026118 Ga0207675_100169237 Ga0207675_1001692372 388
717 3300026121 Ga0207683_10044141 Ga0207683_100441412 388
718 3300026142 Ga0207698_10000006 Ga0207698_1000000678 388
719 3300026142 Ga0207698_10000249 Ga0207698_1000024911 388
720 3300026142 Ga0207698_10047927 Ga0207698_100479272 388
721 3300026142 Ga0207698_10073906 Ga0207698_100739062 388
722 3300026142 Ga0207698_10149441 Ga0207698_101494412 388
723 3300028017 Ga0265356_1000013 Ga0265356_100001313 388
724 3300028379 Ga0268266_10000660 Ga0268266_1000066030 388
725 3300028379 Ga0268266_10005793 Ga0268266_100057933 388
726 3300028379 Ga0268266_10090876 Ga0268266_100908762 388
727 3300028380 Ga0268265_10006348 Ga0268265_100063485 388
728 3300028381 Ga0268264_10001093 Ga0268264_100010933 388
729 3300028381 Ga0268264_10004380 Ga0268264_100043803 388
730 3300028556 Ga0265337_1001683 Ga0265337_10016835 388
731 3300028556 Ga0265337_1006294 Ga0265337_10062942 388
732 3300028556 Ga0265337_1008518 Ga0265337_10085182 388
733 3300028556 Ga0265337_1013101 Ga0265337_10131012 388
734 3300028563 Ga0265319_1001494 Ga0265319_10014943 388
735 3300028563 Ga0265319_1042049 Ga0265319_10420492 388
736 3300028573 Ga0265334_10021022 Ga0265334_100210223 388
737 3300028794 Ga0307515_10068993 Ga0307515_100689931 388
738 3300028800 Ga0265338_10003616 Ga0265338_1000361619 388
739 3300028800 Ga0265338_10005972 Ga0265338_100059724 388
740 3300028800 Ga0265338_10022889 Ga0265338_100228895 388
741 3300028800 Ga0265338_10029368 Ga0265338_100293683 388
742 3300028800 Ga0265338_10034737 Ga0265338_100347373 388
743 3300028800 Ga0265338_10212731 Ga0265338_102127312 388
744 3300030760 Ga0265762_1000831 Ga0265762_10008313 388
745 3300031090 Ga0265760_10000017 Ga0265760_1000001733 388
746 3300031090 Ga0265760_10001830 Ga0265760_100018306 388
747 3300031240 Ga0265320_10000134 Ga0265320_1000013444 388
748 3300031240 Ga0265320_10000847 Ga0265320_1000084716 388
749 3300031240 Ga0265320_10001451 Ga0265320_100014516 388
750 3300031240 Ga0265320_10002229 Ga0265320_100022296 388
751 3300031240 Ga0265320_10005571 Ga0265320_100055715 388
752 3300031240 Ga0265320_10030138 Ga0265320_100301383 388
753 3300031249 Ga0265339_10010523 Ga0265339_100105235 388
754 3300031249 Ga0265339_10033067 Ga0265339_100330672 388
755 3300031344 Ga0265316_10077493 Ga0265316_100774932 388
756 3300031548 Ga0307408_100050207 Ga0307408_1000502072 388
757 3300031595 Ga0265313_10009742 Ga0265313_100097424 388
758 3300031595 Ga0265313_10020913 Ga0265313_100209132 388
759 3300031616 Ga0307508_10000055 Ga0307508_1000005528 388
760 3300031711 Ga0265314_10032624 Ga0265314_100326243 388
761 3300031731 Ga0307405_10093468 Ga0307405_100934682 388
762 3300031903 Ga0307407_10000097 Ga0307407_1000009717 388
763 3300032004 Ga0307414_10000226 Ga0307414_1000022619 388
764 3300032005 Ga0307411_10034580 Ga0307411_100345802 388
765 3300032126 Ga0307415_100054242 Ga0307415_1000542423 388
766 3300033180 Ga0307510_10036648 Ga0307510_100366484 388
767 3300033545 Ga0316214_1002983 Ga0316214_10029832 388
768 3300035083 Ga0373926_0043744 Ga0373926_0043744_351_1523 388
769 3300035089 Ga0373944_0019989 Ga0373944_0019989_675_1847 388
770 3300035118 Ga0373954_0006455 Ga0373954_0006455_2964_4142 388
771 3300035119 Ga0373956_0040058 Ga0373956_0040058_25_1224 388
772 3300035170 Ga0373943_0000669 Ga0373943_0000669_1437_2609 388
773 3300035172 Ga0373955_0061172 Ga0373955_0061172_180_1352 388
774 3300035692 Ga0373935_0027635 Ga0373935_0027635_1281_2453 388
775 3300035692 Ga0373935_0083802 Ga0373935_0083802_808_1980 388
776 3300035695 Ga0373927_0000282 Ga0373927_0000282_8669_9841 388
777 3300035695 Ga0373927_0047241 Ga0373927_0047241_345_1517 388
778 3300035724 Ga0373933_0008503 Ga0373933_0008503_3827_5026 388
779 3300035725 Ga0373947_0001632 Ga0373947_0001632_2667_3839 388
780 3300035725 Ga0373947_0080576 Ga0373947_0080576_481_1653 388
781 3300036401 Ga0373937_0020381 Ga0373937_0020381_3884_5083 388
782 3300037068 Ga0373925_0002387 Ga0373925_0002387_1312_2484 388
783 3300037068 Ga0373925_0016024 Ga0373925_0016024_540_1712 388
784 3300037068 Ga0373925_0054878 Ga0373925_0054878_648_1823 388
785 3300037471 Ga0395905_0118676 Ga0395905_0118676_199_1377 388
786 3300037471 Ga0395905_0126144 Ga0395905_0126144_346_1518 388
787 3300039437 Ga0436365_0012252 Ga0436365_0012252_606_1781 388
788 3300039437 Ga0436365_1710025 Ga0436365_1710025_4179_5357 388
789 3300044684 Ga0466966_0062685 Ga0466966_0062685_951_2123 388
790 3300044694 Ga0466963_0004435 Ga0466963_0004435_4016_5188 388
791 3300044694 Ga0466963_0054503 Ga0466963_0054503_967_2139 388
792 3300045049 Ga0466959_0206565 Ga0466959_0206565_130_1302 388
793 3300045051 Ga0451576_0015690 Ga0451576_0015690_706_1878 388
794 3300045051 Ga0451576_0391735 Ga0451576_0391735_141_1313 388
795 3300045976 Ga0466967_0011559 Ga0466967_0011559_4943_6115 388
796 3300046454 Ga0495592_0000012 Ga0495592_0000012_151343_152521 388
797 3300046454 Ga0495592_0035706 Ga0495592_0035706_360_1532 388
798 3300046459 Ga0495629_0104059 Ga0495629_0104059_80_1252 388
799 3300046459 Ga0495629_0228410 Ga0495629_0228410_27_1205 388
800 3300046460 Ga0495638_0015062 Ga0495638_0015062_1007_2179 388
801 3300046462 Ga0495651_0005962 Ga0495651_0005962_1148_2320 388
802 3300046463 Ga0495653_0010340 Ga0495653_0010340_4658_5830 388
803 3300046472 Ga0495580_0000182 Ga0495580_0000182_33363_34535 388
804 3300046472 Ga0495580_0035789 Ga0495580_0035789_2303_3475 388
805 3300046472 Ga0495580_0084070 Ga0495580_0084070_148_1320 388
806 3300046472 Ga0495580_0119072 Ga0495580_0119072_142_1314 388
807 3300046473 Ga0495582_0001430 Ga0495582_0001430_11103_12275 388
808 3300046473 Ga0495582_0068026 Ga0495582_0068026_738_1931 388
809 3300046475 Ga0495639_0002577 Ga0495639_0002577_697_1869 388
810 3300046476 Ga0495662_0002206 Ga0495662_0002206_5789_6961 388
811 3300046476 Ga0495662_0011784 Ga0495662_0011784_2872_4050 388
812 3300046477 Ga0495664_0001708 Ga0495664_0001708_1210_2382 388
813 3300046499 Ga0495594_0006286 Ga0495594_0006286_1221_2393 388
814 3300046499 Ga0495594_0052251 Ga0495594_0052251_954_2132 388
815 3300046507 Ga0495606_0043625 Ga0495606_0043625_1611_2783 388
816 3300046516 Ga0495628_0003611 Ga0495628_0003611_11127_12305 388
817 3300046516 Ga0495628_0028279 Ga0495628_0028279_2529_3701 388
818 3300046517 Ga0495630_0000366 Ga0495630_0000366_17393_18565 388
819 3300046517 Ga0495630_0005339 Ga0495630_0005339_1241_2419 388
820 3300046517 Ga0495630_0023229 Ga0495630_0023229_3082_4260 388
821 3300046526 Ga0495666_0004502 Ga0495666_0004502_4696_5868 388
822 3300046526 Ga0495666_0007965 Ga0495666_0007965_2493_3665 388
823 3300046529 Ga0495652_0074086 Ga0495652_0074086_857_2029 388
824 3300046529 Ga0495652_0113515 Ga0495652_0113515_397_1575 388
825 3300046529 Ga0495652_0219874 Ga0495652_0219874_28_1212 388
826 3300046531 Ga0495665_0001802 Ga0495665_0001802_9158_10330 388
827 3300046533 Ga0495640_0006287 Ga0495640_0006287_5980_7152 388
828 3300046533 Ga0495640_0011154 Ga0495640_0011154_1531_2709 388
829 3300046533 Ga0495640_0020710 Ga0495640_0020710_2096_3268 388
830 3300046535 Ga0495586_0000017 Ga0495586_0000017_97857_99029 388
831 3300046535 Ga0495586_0005165 Ga0495586_0005165_5120_6292 388
832 3300046535 Ga0495586_0007234 Ga0495586_0007234_996_2174 388
833 3300046536 Ga0495587_0029818 Ga0495587_0029818_357_1529 388
834 3300046543 Ga0495645_0003809 Ga0495645_0003809_2224_3402 388
835 3300046543 Ga0495645_0010006 Ga0495645_0010006_4440_5612 388
836 3300046543 Ga0495645_0088818 Ga0495645_0088818_969_2141 388
837 3300046543 Ga0495645_0118054 Ga0495645_0118054_407_1579 388
838 3300046559 Ga0495667_0000973 Ga0495667_0000973_1556_2728 388
839 3300046642 Ga0495634_0001612 Ga0495634_0001612_16031_17203 388
840 3300046660 Ga0495625_0028802 Ga0495625_0028802_2477_3649 388
841 3300046660 Ga0495625_0044852 Ga0495625_0044852_770_1942 388
842 3300046663 Ga0495635_0014187 Ga0495635_0014187_598_1770 388
843 3300046664 Ga0495659_0041055 Ga0495659_0041055_412_1584 388
844 3300046674 Ga0495588_0000083 Ga0495588_0000083_123599_124777 388
845 3300046678 Ga0495599_0001485 Ga0495599_0001485_11239_12417 388
846 3300046678 Ga0495599_0017236 Ga0495599_0017236_635_1807 388
847 3300046679 Ga0495623_0018994 Ga0495623_0018994_2930_4102 388
848 3300046680 Ga0495646_0004579 Ga0495646_0004579_6309_7481 388
849 3300046680 Ga0495646_0081423 Ga0495646_0081423_538_1716 388
850 3300046681 Ga0495647_0036151 Ga0495647_0036151_47_1219 388
851 3300046684 Ga0495669_0095438 Ga0495669_0095438_103_1281 388
852 3300046689 Ga0495613_0009166 Ga0495613_0009166_1207_2379 388
853 3300046689 Ga0495613_0082030 Ga0495613_0082030_531_1703 388
854 3300046690 Ga0495624_0012772 Ga0495624_0012772_737_1909 388
855 3300046690 Ga0495624_0027095 Ga0495624_0027095_1134_2312 388
856 3300046694 Ga0495649_0004705 Ga0495649_0004705_6726_7898 388
857 3300046809 Ga0495600_0001541 Ga0495600_0001541_1232_2404 388
858 3300047315 Ga0495581_0042259 Ga0495581_0042259_729_1901 388
859 3300047317 Ga0495604_0042015 Ga0495604_0042015_856_2028 388
860 3300047319 Ga0495674_0001210 Ga0495674_0001210_6421_7593 388
861 3300047319 Ga0495674_0006874 Ga0495674_0006874_8255_9433 388
862 3300047319 Ga0495674_0010893 Ga0495674_0010893_4512_5684 388
863 3300047319 Ga0495674_0017519 Ga0495674_0017519_131_1309 388
864 3300047319 Ga0495674_0029207 Ga0495674_0029207_1672_2844 388
865 3300047319 Ga0495674_0045977 Ga0495674_0045977_360_1532 388
866 3300047319 Ga0495674_0049300 Ga0495674_0049300_2307_3479 388
867 3300047320 Ga0495672_0000712 Ga0495672_0000712_20158_21330 388
868 3300047320 Ga0495672_0002235 Ga0495672_0002235_13290_14468 388
869 3300047320 Ga0495672_0017128 Ga0495672_0017128_672_1844 388
870 3300047320 Ga0495672_0069866 Ga0495672_0069866_524_1696 388
871 3300047321 Ga0495676_0001708 Ga0495676_0001708_10304_11476 388
872 3300047322 Ga0495680_0005586 Ga0495680_0005586_1443_2615 388
873 3300047322 Ga0495680_0057091 Ga0495680_0057091_215_1387 388
874 3300047322 Ga0495680_0148895 Ga0495680_0148895_187_1365 388
875 3300047444 Ga0495675_0003684 Ga0495675_0003684_6971_8143 388
876 3300047445 Ga0495677_0019329 Ga0495677_0019329_1118_2290 388
877 3300047471 Ga0495684_0004637 Ga0495684_0004637_1615_2787 388
878 3300047471 Ga0495684_0025455 Ga0495684_0025455_727_1899 388
879 3300047472 Ga0495686_0000035 Ga0495686_0000035_107757_108929 388
880 3300047472 Ga0495686_0005823 Ga0495686_0005823_508_1680 388
881 3300047673 Ga0495593_0047426 Ga0495593_0047426_121_1293 388
882 3300048088 Ga0495602_0067819 Ga0495602_0067819_309_1481 388
883 3300048089 Ga0495614_0003389 Ga0495614_0003389_4772_5944 388
884 3300048904 Ga0496101_0147738 Ga0496101_0147738_129_1301 388
885 3300048905 Ga0496102_0003711 Ga0496102_0003711_2530_3702 388
886 3300048905 Ga0496102_0004321 Ga0496102_0004321_7418_8590 388
887 3300048906 Ga0496103_0031296 Ga0496103_0031296_1186_2358 388
888 3300048907 Ga0496104_0005306 Ga0496104_0005306_387_1559 388
889 3300048909 Ga0496106_0016253 Ga0496106_0016253_2163_3335 388
890 3300048918 Ga0496115_0020040 Ga0496115_0020040_2385_3557 388
891 3300048929 Ga0496126_0000091 Ga0496126_0000091_120029_121201 388
892 3300048929 Ga0496126_0000767 Ga0496126_0000767_25978_27150 388
893 3300049460 Ga0495682_0018391 Ga0495682_0018391_1142_2314 388
894 3300049569 Ga0501032_0000027 Ga0501032_0000027_53281_54459 388
895 3300049569 Ga0501032_0001332 Ga0501032_0001332_3721_4899 388
896 3300049569 Ga0501032_0005178 Ga0501032_0005178_6519_7691 388
897 3300049570 Ga0501033_0000002 Ga0501033_0000002_118916_120094 388
898 3300049570 Ga0501033_0003561 Ga0501033_0003561_10089_11267 388
899 3300049570 Ga0501033_0025247 Ga0501033_0025247_644_1816 388
900 3300049572 Ga0501036_0063880 Ga0501036_0063880_1868_3046 388
901 3300049573 Ga0501037_0019522 Ga0501037_0019522_270_1448 388
902 3300049574 Ga0501038_0001520 Ga0501038_0001520_384_1556 388
903 3300049579 Ga0501043_0041393 Ga0501043_0041393_2391_3569 388
904 3300049580 Ga0501046_0000265 Ga0501046_0000265_11597_12769 388
905 3300049580 Ga0501046_0003292 Ga0501046_0003292_824_2002 388
906 3300049581 Ga0501047_0000409 Ga0501047_0000409_14237_15409 388
907 3300049581 Ga0501047_0005823 Ga0501047_0005823_2641_3813 388
908 3300049581 Ga0501047_0099360 Ga0501047_0099360_238_1422 388
909 3300049581 Ga0501047_0224983 Ga0501047_0224983_391_1569 388
910 3300049586 Ga0501070_0231494 Ga0501070_0231494_38_1216 388
911 3300049588 Ga0501072_0226195 Ga0501072_0226195_193_1365 388
912 3300049592 Ga0501076_0136603 Ga0501076_0136603_787_1959 388
913 3300049742 Ga0501080_0007661 Ga0501080_0007661_400_1572 388
914 3300049744 Ga0501083_0000836 Ga0501083_0000836_1309_2487 388
915 3300049744 Ga0501083_0038931 Ga0501083_0038931_63_1241 388
916 3300049822 Ga0501035_0000475 Ga0501035_0000475_4104_5282 388
917 3300049823 Ga0501044_0000080 Ga0501044_0000080_4081_5259 388
918 3300049823 Ga0501044_0000704 Ga0501044_0000704_5415_6587 388
919 3300049823 Ga0501044_0014025 Ga0501044_0014025_7096_8268 388
920 3300049823 Ga0501044_0022872 Ga0501044_0022872_4989_6167 388
921 3300050489 nmdc:mga03683_54875_c1 nmdc:mga03683_54875_c1_118_1290 388
922 3300050493 nmdc:mga0k408_458_c1 nmdc:mga0k408_458_c1_7563_8735 388
923 3300050507 nmdc:mga05p37_113708_c1 nmdc:mga05p37_113708_c1_1512_2684 388
924 3300050510 nmdc:mga06r32_101896_c1 nmdc:mga06r32_101896_c1_1107_2279 388
925 3300050511 nmdc:mga08y16_7180_c1 nmdc:mga08y16_7180_c1_7388_8560 388
926 3300050511 nmdc:mga08y16_8626_c1 nmdc:mga08y16_8626_c1_157_1329 388
927 3300050512 nmdc:mga0n895_3428_c1 nmdc:mga0n895_3428_c1_7007_8179 388
928 3300050512 nmdc:mga0n895_9628_c1 nmdc:mga0n895_9628_c1_3576_4787 388
929 3300050513 nmdc:mga0rr50_7752_c1 nmdc:mga0rr50_7752_c1_3758_4930 388
930 3300050514 nmdc:mga08x19_118171_c1 nmdc:mga08x19_118171_c1_260_1471 388
931 3300050514 nmdc:mga08x19_51588_c1 nmdc:mga08x19_51588_c1_844_2016 388
932 3300050515 nmdc:mga0a205_257287_c1 nmdc:mga0a205_257287_c1_361_1533 388
933 3300053093 Ga0500651_0000002 Ga0500651_0000002_349779_350951 388
934 3300053096 Ga0500641_0008050 Ga0500641_0008050_2454_3626 388
935 3300053119 Ga0500595_000036 Ga0500595_000036_89102_90274 388
936 3300053119 Ga0500595_019644 Ga0500595_019644_772_1944 388
937 3300053139 Ga0500568_0002084 Ga0500568_0002084_2601_3893 388
938 3300053153 Ga0500616_0000924 Ga0500616_0000924_14317_15489 388
939 3300053730 Ga0500645_000688 Ga0500645_000688_16798_17970 388
940 3300059421 Ga0590071_026596 Ga0590071_026596_41_1213 388
941 3300005336 Ga0070680_100309797 Ga0070680_1003097971 389
942 3300005365 Ga0070688_100131208 Ga0070688_1001312082 389
943 3300005366 Ga0070659_100053246 Ga0070659_1000532462 389
944 3300005445 Ga0070708_100060194 Ga0070708_1000601942 389
945 3300005456 Ga0070678_100141492 Ga0070678_1001414922 389
946 3300005459 Ga0068867_100215325 Ga0068867_1002153251 389
947 3300005518 Ga0070699_100297796 Ga0070699_1002977961 389
948 3300005543 Ga0070672_100055899 Ga0070672_1000558992 389
949 3300005545 Ga0070695_100106166 Ga0070695_1001061661 389
950 3300005549 Ga0070704_100215646 Ga0070704_1002156462 389
951 3300005614 Ga0068856_100020628 Ga0068856_1000206283 389
952 3300005617 Ga0068859_100011501 Ga0068859_1000115016 389
953 3300005719 Ga0068861_100139575 Ga0068861_1001395752 389
954 3300005719 Ga0068861_100213341 Ga0068861_1002133412 389
955 3300005843 Ga0068860_100366019 Ga0068860_1003660192 389
956 3300005844 Ga0068862_100169510 Ga0068862_1001695102 389
957 3300005985 Ga0081539_10000517 Ga0081539_1000051724 389
958 3300006042 Ga0075368_10007517 Ga0075368_100075173 389
959 3300006178 Ga0075367_10036332 Ga0075367_100363322 389
960 3300006195 Ga0075366_10020182 Ga0075366_100201823 389
961 3300006237 Ga0097621_100007883 Ga0097621_1000078835 389
962 3300006846 Ga0075430_100065475 Ga0075430_1000654751 389
963 3300006846 Ga0075430_100095058 Ga0075430_1000950581 389
964 3300006847 Ga0075431_100188398 Ga0075431_1001883982 389
965 3300006880 Ga0075429_100026898 Ga0075429_1000268983 389
966 3300006931 Ga0097620_100011501 Ga0097620_1000115013 389
967 3300009093 Ga0105240_10021660 Ga0105240_100216604 389
968 3300009094 Ga0111539_10053834 Ga0111539_100538341 389
969 3300009147 Ga0114129_10135131 Ga0114129_101351312 389
970 3300009148 Ga0105243_10147216 Ga0105243_101472161 389
971 3300009553 Ga0105249_10072569 Ga0105249_100725692 389
972 3300011119 Ga0105246_10042087 Ga0105246_100420872 389
973 3300013102 Ga0157371_10096445 Ga0157371_100964452 389
974 3300013104 Ga0157370_10111620 Ga0157370_101116202 389
975 3300013105 Ga0157369_10009797 Ga0157369_100097975 389
976 3300013105 Ga0157369_10090059 Ga0157369_100900591 389
977 3300013296 Ga0157374_10001531 Ga0157374_1000153116 389
978 3300013296 Ga0157374_10006824 Ga0157374_100068243 389
979 3300013306 Ga0163162_10276925 Ga0163162_102769252 389
980 3300013308 Ga0157375_10170194 Ga0157375_101701942 389
981 3300014325 Ga0163163_10000034 Ga0163163_100000344 389
982 3300021384 Ga0213876_10066908 Ga0213876_100669082 389
983 3300025913 Ga0207695_10060464 Ga0207695_100604643 389
984 3300025936 Ga0207670_10132068 Ga0207670_101320682 389
985 3300025944 Ga0207661_10158259 Ga0207661_101582592 389
986 3300025945 Ga0207679_10139108 Ga0207679_101391082 389
987 3300025961 Ga0207712_10204551 Ga0207712_102045512 389
988 3300026067 Ga0207678_10217565 Ga0207678_102175651 389
989 3300026075 Ga0207708_10069836 Ga0207708_100698362 389
990 3300026078 Ga0207702_10008668 Ga0207702_100086683 389
991 3300026088 Ga0207641_10015901 Ga0207641_100159014 389
992 3300026089 Ga0207648_10207569 Ga0207648_102075692 389
993 3300026089 Ga0207648_10314498 Ga0207648_103144981 389
994 3300026095 Ga0207676_10353952 Ga0207676_103539522 389
995 3300027907 Ga0207428_10025635 Ga0207428_100256353 389
996 3300027907 Ga0207428_10227543 Ga0207428_102275431 389
997 3300028379 Ga0268266_10170447 Ga0268266_101704472 389
998 3300028379 Ga0268266_10340179 Ga0268266_103401792 389
999 3300028380 Ga0268265_10134848 Ga0268265_101348482 389
1000 3300028380 Ga0268265_10306015 Ga0268265_103060151 389
1001 3300032005 Ga0307411_10259336 Ga0307411_102593361 389
1002 3300035086 Ga0373934_0000592 Ga0373934_0000592_1478_2671 389
1003 3300035118 Ga0373954_0109449 Ga0373954_0109449_27_1220 389
1004 3300035120 Ga0373957_0028507 Ga0373957_0028507_98_1291 389
1005 3300035724 Ga0373933_0005449 Ga0373933_0005449_11_1204 389
1006 3300036401 Ga0373937_0000419 Ga0373937_0000419_13161_14354 389
1007 3300042184 Ga0450908_003607 Ga0450908_003607_979_2166 389
1008 3300046463 Ga0495653_0143967 Ga0495653_0143967_44_1216 389
1009 3300046475 Ga0495639_0041717 Ga0495639_0041717_418_1590 389
1010 3300046499 Ga0495594_0076284 Ga0495594_0076284_645_1817 389
1011 3300046516 Ga0495628_0074023 Ga0495628_0074023_1106_2278 389
1012 3300047317 Ga0495604_0150525 Ga0495604_0150525_35_1207 389
1013 3300047319 Ga0495674_0006098 Ga0495674_0006098_5876_7048 389
1014 3300047444 Ga0495675_0109108 Ga0495675_0109108_117_1289 389
1015 3300048918 Ga0496115_0010377 Ga0496115_0010377_3917_5089 389
1016 3300049572 Ga0501036_0143417 Ga0501036_0143417_236_1408 389
1017 3300049576 Ga0501040_0243783 Ga0501040_0243783_19_1191 389
1018 3300049593 Ga0501077_0135674 Ga0501077_0135674_290_1462 389
1019 3300049823 Ga0501044_0001313 Ga0501044_0001313_12954_14126 389
1020 3300050491 nmdc:mga00v17_86930_c1 nmdc:mga00v17_86930_c1_522_1709 389
1021 3300050495 nmdc:mga04h51_4737_c1 nmdc:mga04h51_4737_c1_1911_3098 389
1022 3300050507 nmdc:mga05p37_409_c1 nmdc:mga05p37_409_c1_20623_21804 389
1023 3300050507 nmdc:mga05p37_65263_c1 nmdc:mga05p37_65263_c1_986_2158 389
1024 3300050510 nmdc:mga06r32_144539_c1 nmdc:mga06r32_144539_c1_635_1810 389
1025 3300050511 nmdc:mga08y16_49831_c1 nmdc:mga08y16_49831_c1_1377_2549 389
1026 3300060353 Ga0501082_0035853 Ga0501082_0035853_1032_2204 389
1027 3300001979 JGI24740J21852_10009447 JGI24740J21852_100094472 390
1028 3300003758 Ga0055532_1000113 Ga0055532_100011341 390
1029 3300003760 Ga0055527_1000242 Ga0055527_10002427 390
1030 3300003761 Ga0055535_1000099 Ga0055535_100009942 390
1031 3300003762 Ga0055542_1000135 Ga0055542_100013552 390
1032 3300003763 Ga0055529_1000115 Ga0055529_100011567 390
1033 3300003781 Ga0055536_1001612 Ga0055536_10016123 390
1034 3300003790 Ga0055528_1007543 Ga0055528_10075432 390
1035 3300003791 Ga0055530_10004685 Ga0055530_100046855 390
1036 3300003792 Ga0055540_1000397 Ga0055540_100039722 390
1037 3300003794 Ga0055531_10000503 Ga0055531_1000050322 390
1038 3300005327 Ga0070658_10096057 Ga0070658_100960572 390
1039 3300005336 Ga0070680_100225313 Ga0070680_1002253131 390
1040 3300005338 Ga0068868_100132870 Ga0068868_1001328702 390
1041 3300005339 Ga0070660_100000020 Ga0070660_10000002030 390
1042 3300005344 Ga0070661_100044521 Ga0070661_1000445212 390
1043 3300005366 Ga0070659_100000047 Ga0070659_10000004730 390
1044 3300005367 Ga0070667_100024223 Ga0070667_1000242234 390
1045 3300005455 Ga0070663_100000758 Ga0070663_1000007585 390
1046 3300005456 Ga0070678_100191780 Ga0070678_1001917802 390
1047 3300005457 Ga0070662_100238744 Ga0070662_1002387441 390
1048 3300005535 Ga0070684_100297393 Ga0070684_1002973931 390
1049 3300005564 Ga0070664_100260781 Ga0070664_1002607811 390
1050 3300006195 Ga0075366_10013447 Ga0075366_100134472 390
1051 3300006195 Ga0075366_10104505 Ga0075366_101045052 390
1052 3300006946 Ga0079104_1000002 Ga0079104_100000239 390
1053 3300009092 Ga0105250_10004011 Ga0105250_100040116 390
1054 3300009093 Ga0105240_10195882 Ga0105240_101958822 390
1055 3300009148 Ga0105243_10058881 Ga0105243_100588813 390
1056 3300009551 Ga0105238_10033676 Ga0105238_100336764 390
1057 3300009551 Ga0105238_10118203 Ga0105238_101182032 390
1058 3300013100 Ga0157373_10039234 Ga0157373_100392342 390
1059 3300013306 Ga0163162_10006734 Ga0163162_100067342 390
1060 3300013307 Ga0157372_10071569 Ga0157372_100715692 390
1061 3300014326 Ga0157380_10033039 Ga0157380_100330393 390
1062 3300014497 Ga0182008_10002237 Ga0182008_100022375 390
1063 3300015262 Ga0182007_10001509 Ga0182007_100015099 390
1064 3300015265 Ga0182005_1006357 Ga0182005_10063573 390
1065 3300017792 Ga0163161_10029674 Ga0163161_100296743 390
1066 3300025228 Ga0209672_100086 Ga0209672_10008678 390
1067 3300025229 Ga0209147_100148 Ga0209147_10014841 390
1068 3300025242 Ga0209258_100114 Ga0209258_10011453 390
1069 3300025254 Ga0209148_1000115 Ga0209148_100011553 390
1070 3300025272 Ga0209455_1000109 Ga0209455_100010953 390
1071 3300025273 Ga0209673_1000101 Ga0209673_100010181 390
1072 3300025292 Ga0209676_1000375 Ga0209676_100037570 390
1073 3300025295 Ga0209564_1006316 Ga0209564_10063163 390
1074 3300025298 Ga0209050_1000717 Ga0209050_10007174 390
1075 3300025303 Ga0209051_1000112 Ga0209051_100011264 390
1076 3300025304 Ga0209257_1000290 Ga0209257_100029073 390
1077 3300025711 Ga0207696_1015474 Ga0207696_10154742 390
1078 3300025904 Ga0207647_10007077 Ga0207647_100070776 390
1079 3300025909 Ga0207705_10063074 Ga0207705_100630742 390
1080 3300025913 Ga0207695_10000368 Ga0207695_1000036884 390
1081 3300025913 Ga0207695_10061723 Ga0207695_100617232 390
1082 3300025914 Ga0207671_10029582 Ga0207671_100295822 390
1083 3300025919 Ga0207657_10000390 Ga0207657_1000039030 390
1084 3300025924 Ga0207694_10148383 Ga0207694_101483832 390
1085 3300025932 Ga0207690_10000037 Ga0207690_1000003775 390
1086 3300025935 Ga0207709_10000015 Ga0207709_1000001538 390
1087 3300025949 Ga0207667_10061750 Ga0207667_100617502 390
1088 3300026023 Ga0207677_10091874 Ga0207677_100918742 390
1089 3300026067 Ga0207678_10000620 Ga0207678_1000062011 390
1090 3300026142 Ga0207698_10004173 Ga0207698_100041739 390
1091 3300027111 Ga0209281_1000007 Ga0209281_1000007258 390
1092 3300031548 Ga0307408_100002421 Ga0307408_10000242111 390
1093 3300031548 Ga0307408_100104768 Ga0307408_1001047682 390
1094 3300031730 Ga0307516_10077663 Ga0307516_100776632 390
1095 3300031901 Ga0307406_10015036 Ga0307406_100150364 390
1096 3300032004 Ga0307414_10010123 Ga0307414_100101234 390
1097 3300042007 Ga0439449_0002086 Ga0439449_0002086_1335_2507 390
1098 3300046542 Ga0495597_0000325 Ga0495597_0000325_31704_32876 390
1099 3300048907 Ga0496104_0122509 Ga0496104_0122509_395_1663 390
1100 3300048908 Ga0496105_0003138 Ga0496105_0003138_4202_5374 390
1101 3300048916 Ga0496113_0048323 Ga0496113_0048323_267_1535 390
1102 3300048920 Ga0496117_0106576 Ga0496117_0106576_413_1681 390
1103 3300048924 Ga0496121_0006704 Ga0496121_0006704_7671_8939 390
1104 3300048928 Ga0496125_0069121 Ga0496125_0069121_235_1503 390
1105 3300049592 Ga0501076_0209646 Ga0501076_0209646_152_1324 390
1106 3300050490 nmdc:mga03n38_7367_c1 nmdc:mga03n38_7367_c1_385_1557 390

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

200

422

0.96

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

66

179

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3stp-assembly1.cif.gz_A crystal structure of a putative galactonate dehydratase 0.9868 1 385
3stp-assembly1.cif.gz_A crystal structure of a putative galactonate dehydratase 0.9843 1 385
3ssz-assembly1.cif.gz_A the crystal structure of mandelate racemase/muconate lactonizing enzyme from rhodobacteraceae bacterium 0.975 2 385
3sqs-assembly1.cif.gz_A crystal structure of a putative mandelate racemase/muconate lactonizing protein from dinoroseobacter shibae dfl 12 0.9676 2 385
3ssz-assembly1.cif.gz_A the crystal structure of mandelate racemase/muconate lactonizing enzyme from rhodobacteraceae bacterium 0.9674 2 385
ID Description Score Start End Superfamily
3sszA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9847 129 374 3.20.20.120
3sszA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.973 129 374 3.20.20.120
3sszA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9583 2 128 3.30.390.10
af_P77215_158_345_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9424 137 331 3.30.390.10
af_P77215_158_345_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9376 137 331 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A381UYH1-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein 0.9916 42 363 GO:0000287
GO:0016052
GO:0050032
AF-A0A3A1VP46-F1-model_v4 deleted 0.9914 264 385
AF-A0A382GLP6-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme N-terminal domain-containing protein 0.9892 1 226 GO:0000287
GO:0016052
GO:0016836
AF-A0A6L7S653-F1-model_v4 L-rhamnonate dehydratase 0.9873 103 385 GO:0000287
GO:0016052
GO:0016836
AF-A0A6L8I1S3-F1-model_v4 L-rhamnonate dehydratase 0.9847 2 306 GO:0000287
GO:0016052
GO:0016836

Feature Viewer

pLDDT pTM Quality
94.64 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map