F490163
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1106 | 402 | 1088 | 386 |
Family's Representative Sequence
| Representative Sequence | 3300053139|Ga0500568_0002084|Ga0500568_0002084_2601_3893 |
| Length | 430 |
| Sequence | VSDDSDHRAGVITDSANNACITVAAGSGFTNGFTINPGPRMKITEIRTRVVQWRGKTVPLPPHFCTNPMDLLSLPQASMSTFTFHGWLIVEVFTDQGIVGVGNAALSPQVTKEVIDRYLAPLLIGHDPWDLEFLWQHMYRKTMAFGRKGIGMVAISAVDIALWDVLGKAAKQPCYRLLGGRTKSRVPVYASRLYSVPLDQLASEAARYKSEGYKAMKLRFGWGPVDGAEGMRKNLDLVRTVRETVGDGIDVMADAYMGWTLDYAKRMLPLLEPFNLRWLEEPVIPDDIQGYAQLKAYGRVPIAGGEHEFTLFGAHDLLQARAVDYLQVDINRVGGLTAARKISALAEAHQVPVIPHAGQMHNYHLVMASLNSPMAEHFPIVDVEVGNELFWYIFDGEPKAVDGHIDLDENKPGLGLTINEDKLREFEVTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 2 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 3 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 4 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 5 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 6 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 7 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 8 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 9 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 10 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 11 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 12 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 13 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 14 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 95 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 150 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 151 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 222 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 228 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 230 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 237 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 247 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 248 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 249 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 250 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 256 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 261 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 266 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 267 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 268 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 269 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 270 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 271 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 272 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 273 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 274 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 275 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 276 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 279 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 280 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 281 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 347 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 348 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 349 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 350 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 351 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 352 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 353 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 354 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 355 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 376 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 377 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 378 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 379 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 380 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 390 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 391 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 392 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 393 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 394 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 395 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 397 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 399 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 400 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 401 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 402 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.1 |
| Metatranscriptomes | 0.27 |
| Isolates | 1.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.98 |
| Nodule | 0.18 |
| Rhizoplane | 3.25 |
| Rhizosphere | 90.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10009447 | 3300001979 | Bacteria | 3818 |
| 2 | JGI24033J26618_1000037 | 3300002155 | Bacteria | 19323 |
| 3 | JGI24742J22300_10003287 | 3300002244 | Bacteria | 2619 |
| 4 | rootH2_10268766 | 3300003320 | Bacteria | 2490 |
| 5 | Ga0055532_1000113 | 3300003758 | Bacteria | 86629 |
| 6 | Ga0055527_1000242 | 3300003760 | Bacteria | 33845 |
| 7 | Ga0055535_1000099 | 3300003761 | Bacteria | 93955 |
| 8 | Ga0055542_1000135 | 3300003762 | Bacteria | 93970 |
| 9 | Ga0055529_1000115 | 3300003763 | Bacteria | 118392 |
| 10 | Ga0055536_1001612 | 3300003781 | Bacteria | 13466 |
| 11 | Ga0055528_1007543 | 3300003790 | Bacteria | 4796 |
| 12 | Ga0055530_10004685 | 3300003791 | Bacteria | 6936 |
| 13 | Ga0055540_1000397 | 3300003792 | Bacteria | 35727 |
| 14 | Ga0055531_10000503 | 3300003794 | Bacteria | 35727 |
| 15 | Ga0065704_10091282 | 3300005289 | Bacteria | 2727 |
| 16 | Ga0065707_10083153 | 3300005295 | Bacteria | 10180 |
| 17 | Ga0070658_10003728 | 3300005327 | Bacteria | 12466 |
| 18 | Ga0070658_10004063 | 3300005327 | Bacteria | 11996 |
| 19 | Ga0070658_10062775 | 3300005327 | Bacteria | 3028 |
| 20 | Ga0070658_10096057 | 3300005327 | Bacteria | 2446 |
| 21 | Ga0070676_10156917 | 3300005328 | Bacteria | 1461 |
| 22 | Ga0070683_100009033 | 3300005329 | Bacteria | 8505 |
| 23 | Ga0070683_100011056 | 3300005329 | Bacteria | 7781 |
| 24 | Ga0070683_100021235 | 3300005329 | Bacteria | 5792 |
| 25 | Ga0070683_100068110 | 3300005329 | Bacteria | 3316 |
| 26 | Ga0070683_100069940 | 3300005329 | Bacteria | 3273 |
| 27 | Ga0070683_100080234 | 3300005329 | Unclassified | 3055 |
| 28 | Ga0070683_100134495 | 3300005329 | Bacteria | 2341 |
| 29 | Ga0070683_100418765 | 3300005329 | Unclassified | 1278 |
| 30 | Ga0070690_100019999 | 3300005330 | Bacteria | 4074 |
| 31 | Ga0070670_100061559 | 3300005331 | Bacteria | 3222 |
| 32 | Ga0070670_100115718 | 3300005331 | Bacteria | 2312 |
| 33 | Ga0070670_100336729 | 3300005331 | Bacteria | 1324 |
| 34 | Ga0068869_100003330 | 3300005334 | Bacteria | 9817 |
| 35 | Ga0068869_100009877 | 3300005334 | Bacteria | 6198 |
| 36 | Ga0068869_100180815 | 3300005334 | Unclassified | 1653 |
| 37 | Ga0070666_10085756 | 3300005335 | Unclassified | 2157 |
| 38 | Ga0070680_100028433 | 3300005336 | Bacteria | 4484 |
| 39 | Ga0070680_100110941 | 3300005336 | Bacteria | 2283 |
| 40 | Ga0070680_100221134 | 3300005336 | Bacteria | 1598 |
| 41 | Ga0070680_100225313 | 3300005336 | Bacteria | 1583 |
| 42 | Ga0070680_100309797 | 3300005336 | Eukaryota | 1339 |
| 43 | Ga0070680_100330784 | 3300005336 | Bacteria | 1294 |
| 44 | Ga0070682_100188796 | 3300005337 | Bacteria | 1445 |
| 45 | Ga0068868_100000995 | 3300005338 | Bacteria | 19323 |
| 46 | Ga0068868_100036285 | 3300005338 | Unclassified | 3815 |
| 47 | Ga0068868_100075271 | 3300005338 | Bacteria | 2698 |
| 48 | Ga0068868_100132870 | 3300005338 | Bacteria | 2038 |
| 49 | Ga0070660_100000020 | 3300005339 | Bacteria | 98286 |
| 50 | Ga0070660_100021389 | 3300005339 | Bacteria | 4770 |
| 51 | Ga0070660_100102532 | 3300005339 | Bacteria | 2268 |
| 52 | Ga0070660_100142442 | 3300005339 | Bacteria | 1924 |
| 53 | Ga0070660_100154512 | 3300005339 | Bacteria | 1847 |
| 54 | Ga0070661_100000291 | 3300005344 | Bacteria | 40590 |
| 55 | Ga0070661_100005720 | 3300005344 | Bacteria | 8567 |
| 56 | Ga0070661_100006096 | 3300005344 | Bacteria | 8299 |
| 57 | Ga0070661_100041201 | 3300005344 | Bacteria | 3370 |
| 58 | Ga0070661_100044521 | 3300005344 | Bacteria | 3242 |
| 59 | Ga0070661_100053750 | 3300005344 | Bacteria | 2948 |
| 60 | Ga0070661_100108621 | 3300005344 | Bacteria | 2070 |
| 61 | Ga0070668_100023467 | 3300005347 | Bacteria | 4666 |
| 62 | Ga0070668_100076790 | 3300005347 | Bacteria | 2610 |
| 63 | Ga0070668_100166764 | 3300005347 | Bacteria | 1790 |
| 64 | Ga0070669_100041171 | 3300005353 | Bacteria | 3360 |
| 65 | Ga0070675_100004246 | 3300005354 | Bacteria | 10905 |
| 66 | Ga0070675_100062714 | 3300005354 | Bacteria | 3071 |
| 67 | Ga0070673_100104832 | 3300005364 | Bacteria | 2335 |
| 68 | Ga0070688_100021582 | 3300005365 | Bacteria | 3762 |
| 69 | Ga0070688_100131208 | 3300005365 | Bacteria | 1691 |
| 70 | Ga0070659_100000047 | 3300005366 | Bacteria | 98286 |
| 71 | Ga0070659_100017358 | 3300005366 | Bacteria | 5414 |
| 72 | Ga0070659_100053246 | 3300005366 | Bacteria | 3185 |
| 73 | Ga0070667_100024223 | 3300005367 | Bacteria | 5042 |
| 74 | Ga0070667_100104852 | 3300005367 | Bacteria | 2446 |
| 75 | Ga0070667_100169212 | 3300005367 | Bacteria | 1928 |
| 76 | Ga0070667_100243182 | 3300005367 | Bacteria | 1607 |
| 77 | Ga0070709_10000744 | 3300005434 | Bacteria | 18437 |
| 78 | Ga0070709_10052674 | 3300005434 | Bacteria | 2559 |
| 79 | Ga0070709_10156950 | 3300005434 | Bacteria | 1578 |
| 80 | Ga0070714_100000027 | 3300005435 | Bacteria | 141750 |
| 81 | Ga0070714_100008972 | 3300005435 | Bacteria | 7828 |
| 82 | Ga0070714_100055781 | 3300005435 | Bacteria | 3378 |
| 83 | Ga0070714_100409118 | 3300005435 | Bacteria | 1284 |
| 84 | Ga0070713_100000070 | 3300005436 | Bacteria | 64658 |
| 85 | Ga0070713_100001120 | 3300005436 | Bacteria | 17094 |
| 86 | Ga0070713_100005813 | 3300005436 | Bacteria | 8478 |
| 87 | Ga0070713_100006427 | 3300005436 | Bacteria | 8147 |
| 88 | Ga0070713_100079033 | 3300005436 | Bacteria | 2801 |
| 89 | Ga0070713_100366177 | 3300005436 | Bacteria | 1340 |
| 90 | Ga0070710_10054630 | 3300005437 | Bacteria | 2254 |
| 91 | Ga0070710_10062584 | 3300005437 | Bacteria | 2123 |
| 92 | Ga0070710_10109345 | 3300005437 | Bacteria | 1658 |
| 93 | Ga0070711_100000078 | 3300005439 | Bacteria | 54188 |
| 94 | Ga0070711_100001722 | 3300005439 | Bacteria | 12135 |
| 95 | Ga0070694_100220469 | 3300005444 | Bacteria | 1422 |
| 96 | Ga0070708_100047456 | 3300005445 | Bacteria | 3794 |
| 97 | Ga0070708_100060194 | 3300005445 | Bacteria | 3389 |
| 98 | Ga0070663_100000758 | 3300005455 | Bacteria | 17506 |
| 99 | Ga0070678_100141492 | 3300005456 | Bacteria | 1926 |
| 100 | Ga0070678_100191780 | 3300005456 | Bacteria | 1680 |
| 101 | Ga0070678_100311823 | 3300005456 | Bacteria | 1341 |
| 102 | Ga0070662_100238744 | 3300005457 | Bacteria | 1457 |
| 103 | Ga0070681_10000149 | 3300005458 | Bacteria | 53023 |
| 104 | Ga0070681_10009094 | 3300005458 | Bacteria | 9761 |
| 105 | Ga0070681_10019874 | 3300005458 | Bacteria | 6729 |
| 106 | Ga0070681_10036358 | 3300005458 | Bacteria | 4945 |
| 107 | Ga0070681_10117020 | 3300005458 | Bacteria | 2602 |
| 108 | Ga0070681_10137801 | 3300005458 | Bacteria | 2370 |
| 109 | Ga0070681_10140657 | 3300005458 | Bacteria | 2343 |
| 110 | Ga0070681_10143054 | 3300005458 | Bacteria | 2321 |
| 111 | Ga0070681_10162661 | 3300005458 | Bacteria | 2156 |
| 112 | Ga0070681_10172737 | 3300005458 | Bacteria | 2083 |
| 113 | Ga0070681_10205948 | 3300005458 | Bacteria | 1884 |
| 114 | Ga0068867_100075404 | 3300005459 | Bacteria | 2530 |
| 115 | Ga0068867_100087773 | 3300005459 | Bacteria | 2356 |
| 116 | Ga0068867_100215325 | 3300005459 | Bacteria | 1545 |
| 117 | Ga0070706_100001937 | 3300005467 | Bacteria | 21337 |
| 118 | Ga0070707_100336917 | 3300005468 | Bacteria | 1466 |
| 119 | Ga0070698_100382453 | 3300005471 | Bacteria | 1340 |
| 120 | Ga0070699_100297796 | 3300005518 | Bacteria | 1447 |
| 121 | Ga0070679_100009893 | 3300005530 | Bacteria | 9023 |
| 122 | Ga0070679_100010417 | 3300005530 | Bacteria | 8819 |
| 123 | Ga0070679_100015002 | 3300005530 | Bacteria | 7445 |
| 124 | Ga0070679_100015901 | 3300005530 | Bacteria | 7242 |
| 125 | Ga0070679_100063691 | 3300005530 | Bacteria | 3675 |
| 126 | Ga0070679_100093020 | 3300005530 | Bacteria | 3003 |
| 127 | Ga0070679_100119700 | 3300005530 | Bacteria | 2618 |
| 128 | Ga0070679_100164794 | 3300005530 | Bacteria | 2190 |
| 129 | Ga0070684_100001586 | 3300005535 | Bacteria | 16405 |
| 130 | Ga0070684_100004240 | 3300005535 | Bacteria | 10865 |
| 131 | Ga0070684_100038630 | 3300005535 | Bacteria | 4102 |
| 132 | Ga0070684_100297393 | 3300005535 | Bacteria | 1481 |
| 133 | Ga0070697_100000588 | 3300005536 | Bacteria | 27480 |
| 134 | Ga0068853_100000178 | 3300005539 | Bacteria | 44364 |
| 135 | Ga0068853_100031767 | 3300005539 | Bacteria | 4468 |
| 136 | Ga0068853_100062523 | 3300005539 | Bacteria | 3222 |
| 137 | Ga0068853_100297086 | 3300005539 | Bacteria | 1492 |
| 138 | Ga0070672_100007077 | 3300005543 | Bacteria | 7587 |
| 139 | Ga0070672_100055899 | 3300005543 | Bacteria | 3093 |
| 140 | Ga0070686_100152998 | 3300005544 | Bacteria | 1617 |
| 141 | Ga0070695_100106166 | 3300005545 | Bacteria | 1899 |
| 142 | Ga0070696_100134424 | 3300005546 | Bacteria | 1802 |
| 143 | Ga0070693_100040243 | 3300005547 | Unclassified | 2623 |
| 144 | Ga0070665_100030207 | 3300005548 | Bacteria | 5454 |
| 145 | Ga0070704_100215646 | 3300005549 | Bacteria | 1558 |
| 146 | Ga0068855_100000234 | 3300005563 | Bacteria | 70713 |
| 147 | Ga0068855_100000872 | 3300005563 | Bacteria | 37469 |
| 148 | Ga0068855_100006297 | 3300005563 | Bacteria | 14465 |
| 149 | Ga0068855_100020482 | 3300005563 | Bacteria | 7930 |
| 150 | Ga0068855_100020735 | 3300005563 | Bacteria | 7883 |
| 151 | Ga0068855_100039858 | 3300005563 | Bacteria | 5576 |
| 152 | Ga0068855_100071120 | 3300005563 | Bacteria | 4046 |
| 153 | Ga0068855_100097729 | 3300005563 | Unclassified | 3382 |
| 154 | Ga0068855_100121391 | 3300005563 | Bacteria | 2991 |
| 155 | Ga0068855_100159453 | 3300005563 | Bacteria | 2562 |
| 156 | Ga0068855_100251807 | 3300005563 | Unclassified | 1970 |
| 157 | Ga0068855_100296330 | 3300005563 | Bacteria | 1792 |
| 158 | Ga0070664_100001824 | 3300005564 | Bacteria | 17055 |
| 159 | Ga0070664_100115801 | 3300005564 | Bacteria | 2343 |
| 160 | Ga0070664_100139417 | 3300005564 | Bacteria | 2134 |
| 161 | Ga0070664_100250394 | 3300005564 | Unclassified | 1592 |
| 162 | Ga0070664_100260781 | 3300005564 | Bacteria | 1559 |
| 163 | Ga0068857_100001376 | 3300005577 | Bacteria | 19181 |
| 164 | Ga0068857_100030923 | 3300005577 | Bacteria | 4730 |
| 165 | Ga0068857_100094433 | 3300005577 | Bacteria | 2678 |
| 166 | Ga0068854_100002575 | 3300005578 | Bacteria | 11232 |
| 167 | Ga0068854_100008531 | 3300005578 | Bacteria | 6594 |
| 168 | Ga0068854_100016429 | 3300005578 | Bacteria | 4934 |
| 169 | Ga0068854_100023685 | 3300005578 | Unclassified | 4196 |
| 170 | Ga0068854_100101617 | 3300005578 | Unclassified | 2156 |
| 171 | Ga0068854_100109769 | 3300005578 | Bacteria | 2079 |
| 172 | Ga0068856_100000062 | 3300005614 | Bacteria | 100769 |
| 173 | Ga0068856_100000179 | 3300005614 | Bacteria | 66149 |
| 174 | Ga0068856_100000347 | 3300005614 | Bacteria | 50484 |
| 175 | Ga0068856_100000854 | 3300005614 | Bacteria | 32765 |
| 176 | Ga0068856_100001690 | 3300005614 | Bacteria | 23070 |
| 177 | Ga0068856_100015481 | 3300005614 | Bacteria | 7370 |
| 178 | Ga0068856_100018229 | 3300005614 | Bacteria | 6805 |
| 179 | Ga0068856_100019973 | 3300005614 | Bacteria | 6503 |
| 180 | Ga0068856_100020628 | 3300005614 | Bacteria | 6403 |
| 181 | Ga0068856_100052769 | 3300005614 | Bacteria | 4010 |
| 182 | Ga0068856_100119927 | 3300005614 | Bacteria | 2632 |
| 183 | Ga0070702_100080234 | 3300005615 | Bacteria | 1952 |
| 184 | Ga0068852_100000015 | 3300005616 | Bacteria | 134085 |
| 185 | Ga0068852_100000278 | 3300005616 | Bacteria | 34197 |
| 186 | Ga0068852_100006834 | 3300005616 | Bacteria | 8287 |
| 187 | Ga0068852_100080543 | 3300005616 | Bacteria | 2887 |
| 188 | Ga0068852_100166280 | 3300005616 | Bacteria | 2064 |
| 189 | Ga0068852_100199805 | 3300005616 | Bacteria | 1891 |
| 190 | Ga0068859_100001235 | 3300005617 | Bacteria | 26117 |
| 191 | Ga0068859_100005339 | 3300005617 | Bacteria | 13075 |
| 192 | Ga0068859_100011501 | 3300005617 | Bacteria | 8897 |
| 193 | Ga0068859_100032598 | 3300005617 | Bacteria | 5233 |
| 194 | Ga0068859_100050144 | 3300005617 | Bacteria | 4193 |
| 195 | Ga0068859_100285614 | 3300005617 | Bacteria | 1743 |
| 196 | Ga0068864_100000129 | 3300005618 | Bacteria | 73206 |
| 197 | Ga0068864_100014292 | 3300005618 | Bacteria | 6594 |
| 198 | Ga0068864_100028348 | 3300005618 | Plasmid | 4731 |
| 199 | Ga0068864_100321851 | 3300005618 | Bacteria | 1452 |
| 200 | Ga0068866_10006317 | 3300005718 | Bacteria | 4932 |
| 201 | Ga0068866_10007078 | 3300005718 | Bacteria | 4689 |
| 202 | Ga0068866_10031134 | 3300005718 | Bacteria | 2567 |
| 203 | Ga0068861_100016641 | 3300005719 | Bacteria | 5207 |
| 204 | Ga0068861_100061316 | 3300005719 | Bacteria | 2886 |
| 205 | Ga0068861_100139575 | 3300005719 | Bacteria | 1977 |
| 206 | Ga0068861_100213341 | 3300005719 | Bacteria | 1627 |
| 207 | Ga0068863_100000941 | 3300005841 | Bacteria | 29222 |
| 208 | Ga0068863_100017867 | 3300005841 | Bacteria | 6786 |
| 209 | Ga0068863_100044093 | 3300005841 | Bacteria | 4234 |
| 210 | Ga0068863_100048934 | 3300005841 | Bacteria | 4008 |
| 211 | Ga0068858_100002951 | 3300005842 | Bacteria | 17096 |
| 212 | Ga0068858_100006877 | 3300005842 | Bacteria | 11055 |
| 213 | Ga0068858_100017770 | 3300005842 | Bacteria | 6660 |
| 214 | Ga0068858_100021020 | 3300005842 | Bacteria | 6097 |
| 215 | Ga0068860_100008454 | 3300005843 | Bacteria | 10253 |
| 216 | Ga0068860_100031048 | 3300005843 | Bacteria | 5137 |
| 217 | Ga0068860_100131657 | 3300005843 | Bacteria | 2400 |
| 218 | Ga0068860_100192207 | 3300005843 | Bacteria | 1975 |
| 219 | Ga0068860_100366019 | 3300005843 | Bacteria | 1421 |
| 220 | Ga0068862_100029668 | 3300005844 | Bacteria | 4609 |
| 221 | Ga0068862_100033743 | 3300005844 | Bacteria | 4328 |
| 222 | Ga0068862_100078281 | 3300005844 | Bacteria | 2864 |
| 223 | Ga0068862_100110110 | 3300005844 | Bacteria | 2417 |
| 224 | Ga0068862_100169510 | 3300005844 | Bacteria | 1954 |
| 225 | Ga0081539_10000517 | 3300005985 | Bacteria | 80413 |
| 226 | Ga0070717_10000016 | 3300006028 | Bacteria | 205932 |
| 227 | Ga0070717_10001262 | 3300006028 | Bacteria | 17276 |
| 228 | Ga0070717_10008871 | 3300006028 | Bacteria | 7530 |
| 229 | Ga0070717_10054607 | 3300006028 | Unclassified | 3294 |
| 230 | Ga0070717_10069188 | 3300006028 | Bacteria | 2939 |
| 231 | Ga0070717_10129014 | 3300006028 | Bacteria | 2173 |
| 232 | Ga0070717_10346191 | 3300006028 | Bacteria | 1328 |
| 233 | Ga0075365_10180341 | 3300006038 | Bacteria | 1476 |
| 234 | Ga0075368_10007517 | 3300006042 | Bacteria | 3845 |
| 235 | Ga0075364_10006031 | 3300006051 | Bacteria | 7090 |
| 236 | Ga0070715_10013806 | 3300006163 | Unclassified | 2976 |
| 237 | Ga0070716_100000711 | 3300006173 | Bacteria | 14216 |
| 238 | Ga0070716_100007470 | 3300006173 | Bacteria | 5386 |
| 239 | Ga0070716_100008365 | 3300006173 | Bacteria | 5132 |
| 240 | Ga0070712_100000038 | 3300006175 | Bacteria | 67408 |
| 241 | Ga0070712_100000288 | 3300006175 | Bacteria | 28406 |
| 242 | Ga0070712_100000292 | 3300006175 | Bacteria | 28152 |
| 243 | Ga0070712_100015439 | 3300006175 | Bacteria | 4921 |
| 244 | Ga0070712_100022744 | 3300006175 | Bacteria | 4133 |
| 245 | Ga0070712_100070931 | 3300006175 | Bacteria | 2491 |
| 246 | Ga0075362_10024906 | 3300006177 | Bacteria | 2541 |
| 247 | Ga0075367_10036332 | 3300006178 | Bacteria | 2856 |
| 248 | Ga0075366_10013447 | 3300006195 | Bacteria | 4660 |
| 249 | Ga0075366_10020182 | 3300006195 | Bacteria | 3863 |
| 250 | Ga0075366_10022264 | 3300006195 | Bacteria | 3685 |
| 251 | Ga0075366_10043177 | 3300006195 | Bacteria | 2670 |
| 252 | Ga0075366_10104505 | 3300006195 | Bacteria | 1702 |
| 253 | Ga0075366_10122958 | 3300006195 | Bacteria | 1564 |
| 254 | Ga0097621_100000148 | 3300006237 | Bacteria | 42932 |
| 255 | Ga0097621_100000709 | 3300006237 | Bacteria | 23392 |
| 256 | Ga0097621_100007133 | 3300006237 | Bacteria | 7966 |
| 257 | Ga0097621_100007883 | 3300006237 | Bacteria | 7639 |
| 258 | Ga0097621_100031210 | 3300006237 | Unclassified | 4227 |
| 259 | Ga0097621_100113357 | 3300006237 | Bacteria | 2293 |
| 260 | Ga0097621_100218106 | 3300006237 | Bacteria | 1661 |
| 261 | Ga0068871_100000049 | 3300006358 | Bacteria | 65954 |
| 262 | Ga0068871_100000439 | 3300006358 | Bacteria | 28672 |
| 263 | Ga0068871_100000465 | 3300006358 | Bacteria | 27859 |
| 264 | Ga0075430_100065475 | 3300006846 | Bacteria | 3053 |
| 265 | Ga0075430_100095058 | 3300006846 | Bacteria | 2491 |
| 266 | Ga0075431_100002684 | 3300006847 | Bacteria | 17243 |
| 267 | Ga0075431_100188398 | 3300006847 | Bacteria | 2114 |
| 268 | Ga0075433_10040006 | 3300006852 | Bacteria | 4056 |
| 269 | Ga0075433_10342043 | 3300006852 | Bacteria | 1322 |
| 270 | Ga0075434_100000344 | 3300006871 | Bacteria | 33535 |
| 271 | Ga0075434_100004219 | 3300006871 | Bacteria | 12887 |
| 272 | Ga0075434_100027321 | 3300006871 | Bacteria | 5602 |
| 273 | Ga0075434_100034351 | 3300006871 | Bacteria | 5007 |
| 274 | Ga0075429_100026898 | 3300006880 | Bacteria | 4994 |
| 275 | Ga0068865_100016734 | 3300006881 | Bacteria | 4699 |
| 276 | Ga0068865_100030922 | 3300006881 | Bacteria | 3565 |
| 277 | Ga0068865_100134808 | 3300006881 | Bacteria | 1854 |
| 278 | Ga0075436_100040655 | 3300006914 | Bacteria | 3208 |
| 279 | Ga0097620_100001235 | 3300006931 | Bacteria | 26117 |
| 280 | Ga0097620_100005338 | 3300006931 | Bacteria | 13075 |
| 281 | Ga0097620_100011501 | 3300006931 | Bacteria | 8897 |
| 282 | Ga0097620_100032598 | 3300006931 | Bacteria | 5233 |
| 283 | Ga0097620_100050143 | 3300006931 | Bacteria | 4193 |
| 284 | Ga0097620_100285612 | 3300006931 | Bacteria | 1743 |
| 285 | Ga0079104_1000002 | 3300006946 | Bacteria | 514469 |
| 286 | Ga0075435_100007470 | 3300007076 | Bacteria | 7792 |
| 287 | Ga0075435_100034872 | 3300007076 | Bacteria | 3990 |
| 288 | Ga0105250_10004011 | 3300009092 | Bacteria | 6862 |
| 289 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 290 | Ga0105240_10000181 | 3300009093 | Bacteria | 128067 |
| 291 | Ga0105240_10000590 | 3300009093 | Bacteria | 67365 |
| 292 | Ga0105240_10000823 | 3300009093 | Bacteria | 56298 |
| 293 | Ga0105240_10004970 | 3300009093 | Bacteria | 19979 |
| 294 | Ga0105240_10007428 | 3300009093 | Bacteria | 15922 |
| 295 | Ga0105240_10008321 | 3300009093 | Bacteria | 14846 |
| 296 | Ga0105240_10021660 | 3300009093 | Bacteria | 8545 |
| 297 | Ga0105240_10046652 | 3300009093 | Bacteria | 5489 |
| 298 | Ga0105240_10076065 | 3300009093 | Bacteria | 4140 |
| 299 | Ga0105240_10091111 | 3300009093 | Bacteria | 3726 |
| 300 | Ga0105240_10133724 | 3300009093 | Bacteria | 2972 |
| 301 | Ga0105240_10195882 | 3300009093 | Bacteria | 2372 |
| 302 | Ga0105240_10205617 | 3300009093 | Bacteria | 2305 |
| 303 | Ga0105240_10287979 | 3300009093 | Unclassified | 1884 |
| 304 | Ga0111539_10001354 | 3300009094 | Bacteria | 32628 |
| 305 | Ga0111539_10005577 | 3300009094 | Bacteria | 16274 |
| 306 | Ga0111539_10053834 | 3300009094 | Bacteria | 4791 |
| 307 | Ga0105245_10003276 | 3300009098 | Bacteria | 14530 |
| 308 | Ga0105245_10006431 | 3300009098 | Bacteria | 10342 |
| 309 | Ga0105245_10110320 | 3300009098 | Bacteria | 2558 |
| 310 | Ga0105245_10208777 | 3300009098 | Bacteria | 1879 |
| 311 | Ga0105245_10225636 | 3300009098 | Bacteria | 1810 |
| 312 | Ga0105247_10012672 | 3300009101 | Bacteria | 5058 |
| 313 | Ga0105247_10042813 | 3300009101 | Bacteria | 2774 |
| 314 | Ga0105247_10157268 | 3300009101 | Bacteria | 1502 |
| 315 | Ga0114129_10029439 | 3300009147 | Bacteria | 7779 |
| 316 | Ga0114129_10120618 | 3300009147 | Bacteria | 3610 |
| 317 | Ga0114129_10135131 | 3300009147 | Bacteria | 3384 |
| 318 | Ga0105243_10004290 | 3300009148 | Bacteria | 11290 |
| 319 | Ga0105243_10058881 | 3300009148 | Bacteria | 3063 |
| 320 | Ga0105243_10147216 | 3300009148 | Bacteria | 2016 |
| 321 | Ga0105241_10000074 | 3300009174 | Bacteria | 75523 |
| 322 | Ga0105241_10002378 | 3300009174 | Bacteria | 14132 |
| 323 | Ga0105241_10004219 | 3300009174 | Bacteria | 10613 |
| 324 | Ga0105241_10012484 | 3300009174 | Bacteria | 6228 |
| 325 | Ga0105241_10018618 | 3300009174 | Bacteria | 5110 |
| 326 | Ga0105241_10040692 | 3300009174 | Bacteria | 3509 |
| 327 | Ga0105241_10093290 | 3300009174 | Bacteria | 2379 |
| 328 | Ga0105241_10106644 | 3300009174 | Bacteria | 2236 |
| 329 | Ga0105242_10008739 | 3300009176 | Bacteria | 7772 |
| 330 | Ga0105242_10017961 | 3300009176 | Bacteria | 5525 |
| 331 | Ga0105248_10000410 | 3300009177 | Bacteria | 49815 |
| 332 | Ga0105248_10001285 | 3300009177 | Bacteria | 28003 |
| 333 | Ga0105248_10001713 | 3300009177 | Bacteria | 24377 |
| 334 | Ga0105248_10020175 | 3300009177 | Bacteria | 7383 |
| 335 | Ga0105237_10001590 | 3300009545 | Bacteria | 29558 |
| 336 | Ga0105237_10051350 | 3300009545 | Bacteria | 4141 |
| 337 | Ga0105237_10108211 | 3300009545 | Bacteria | 2772 |
| 338 | Ga0105237_10207399 | 3300009545 | Bacteria | 1960 |
| 339 | Ga0105238_10000491 | 3300009551 | Bacteria | 41568 |
| 340 | Ga0105238_10000502 | 3300009551 | Bacteria | 41185 |
| 341 | Ga0105238_10000609 | 3300009551 | Bacteria | 37550 |
| 342 | Ga0105238_10002379 | 3300009551 | Bacteria | 18883 |
| 343 | Ga0105238_10003639 | 3300009551 | Bacteria | 15369 |
| 344 | Ga0105238_10022506 | 3300009551 | Bacteria | 6424 |
| 345 | Ga0105238_10026649 | 3300009551 | Bacteria | 5893 |
| 346 | Ga0105238_10029170 | 3300009551 | Bacteria | 5621 |
| 347 | Ga0105238_10033676 | 3300009551 | Bacteria | 5212 |
| 348 | Ga0105238_10038354 | 3300009551 | Bacteria | 4866 |
| 349 | Ga0105238_10042995 | 3300009551 | Bacteria | 4573 |
| 350 | Ga0105238_10118203 | 3300009551 | Bacteria | 2631 |
| 351 | Ga0105238_10121114 | 3300009551 | Unclassified | 2596 |
| 352 | Ga0105238_10259554 | 3300009551 | Bacteria | 1717 |
| 353 | Ga0105249_10041183 | 3300009553 | Bacteria | 4198 |
| 354 | Ga0105249_10065772 | 3300009553 | Bacteria | 3336 |
| 355 | Ga0105249_10072569 | 3300009553 | Bacteria | 3182 |
| 356 | Ga0105239_10001077 | 3300010375 | Bacteria | 37901 |
| 357 | Ga0105239_10012674 | 3300010375 | Bacteria | 9380 |
| 358 | Ga0105239_10186670 | 3300010375 | Bacteria | 2320 |
| 359 | Ga0105239_10271508 | 3300010375 | Bacteria | 1907 |
| 360 | Ga0105246_10042087 | 3300011119 | Bacteria | 3092 |
| 361 | Ga0157373_10028847 | 3300013100 | Unclassified | 4002 |
| 362 | Ga0157373_10039234 | 3300013100 | Bacteria | 3391 |
| 363 | Ga0157373_10050750 | 3300013100 | Unclassified | 2954 |
| 364 | Ga0157371_10065256 | 3300013102 | Bacteria | 2578 |
| 365 | Ga0157371_10080205 | 3300013102 | Unclassified | 2311 |
| 366 | Ga0157371_10096445 | 3300013102 | Bacteria | 2096 |
| 367 | Ga0157371_10148429 | 3300013102 | Bacteria | 1672 |
| 368 | Ga0157370_10000007 | 3300013104 | Bacteria | 246747 |
| 369 | Ga0157370_10076055 | 3300013104 | Unclassified | 3164 |
| 370 | Ga0157370_10077180 | 3300013104 | Bacteria | 3138 |
| 371 | Ga0157370_10111620 | 3300013104 | Bacteria | 2556 |
| 372 | Ga0157369_10000131 | 3300013105 | Bacteria | 107900 |
| 373 | Ga0157369_10000159 | 3300013105 | Bacteria | 95759 |
| 374 | Ga0157369_10000241 | 3300013105 | Bacteria | 75794 |
| 375 | Ga0157369_10001480 | 3300013105 | Bacteria | 28802 |
| 376 | Ga0157369_10004149 | 3300013105 | Bacteria | 17163 |
| 377 | Ga0157369_10009797 | 3300013105 | Bacteria | 10961 |
| 378 | Ga0157369_10014148 | 3300013105 | Bacteria | 9015 |
| 379 | Ga0157369_10018397 | 3300013105 | Bacteria | 7835 |
| 380 | Ga0157369_10036629 | 3300013105 | Bacteria | 5373 |
| 381 | Ga0157369_10066048 | 3300013105 | Bacteria | 3892 |
| 382 | Ga0157369_10090059 | 3300013105 | Bacteria | 3275 |
| 383 | Ga0157369_10098054 | 3300013105 | Bacteria | 3126 |
| 384 | Ga0157369_10104987 | 3300013105 | Unclassified | 3008 |
| 385 | Ga0157369_10108431 | 3300013105 | Unclassified | 2953 |
| 386 | Ga0157369_10151829 | 3300013105 | Bacteria | 2448 |
| 387 | Ga0157369_10153338 | 3300013105 | Bacteria | 2435 |
| 388 | Ga0157369_10236396 | 3300013105 | Bacteria | 1909 |
| 389 | Ga0157369_10286091 | 3300013105 | Bacteria | 1717 |
| 390 | Ga0157369_10298287 | 3300013105 | Bacteria | 1677 |
| 391 | Ga0157369_10445242 | 3300013105 | Bacteria | 1341 |
| 392 | Ga0157374_10000062 | 3300013296 | Bacteria | 112028 |
| 393 | Ga0157374_10000454 | 3300013296 | Bacteria | 37339 |
| 394 | Ga0157374_10001531 | 3300013296 | Bacteria | 19467 |
| 395 | Ga0157374_10002950 | 3300013296 | Bacteria | 14245 |
| 396 | Ga0157374_10006824 | 3300013296 | Bacteria | 9711 |
| 397 | Ga0157374_10011409 | 3300013296 | Bacteria | 7691 |
| 398 | Ga0157374_10030262 | 3300013296 | Bacteria | 4912 |
| 399 | Ga0157374_10030866 | 3300013296 | Bacteria | 4867 |
| 400 | Ga0157374_10034065 | 3300013296 | Bacteria | 4649 |
| 401 | Ga0157374_10150845 | 3300013296 | Bacteria | 2260 |
| 402 | Ga0157374_10260396 | 3300013296 | Bacteria | 1708 |
| 403 | Ga0157378_10000009 | 3300013297 | Bacteria | 161557 |
| 404 | Ga0157378_10000132 | 3300013297 | Bacteria | 71918 |
| 405 | Ga0157378_10000345 | 3300013297 | Bacteria | 45724 |
| 406 | Ga0157378_10000423 | 3300013297 | Bacteria | 41434 |
| 407 | Ga0157378_10020738 | 3300013297 | Bacteria | 5780 |
| 408 | Ga0157378_10037848 | 3300013297 | Bacteria | 4275 |
| 409 | Ga0157378_10041753 | 3300013297 | Bacteria | 4069 |
| 410 | Ga0157378_10043095 | 3300013297 | Bacteria | 4006 |
| 411 | Ga0157378_10072675 | 3300013297 | Bacteria | 3091 |
| 412 | Ga0157378_10183479 | 3300013297 | Bacteria | 1970 |
| 413 | Ga0163162_10000119 | 3300013306 | Bacteria | 69465 |
| 414 | Ga0163162_10001981 | 3300013306 | Bacteria | 19234 |
| 415 | Ga0163162_10006734 | 3300013306 | Bacteria | 11149 |
| 416 | Ga0163162_10008867 | 3300013306 | Bacteria | 9779 |
| 417 | Ga0163162_10010214 | 3300013306 | Bacteria | 9122 |
| 418 | Ga0163162_10155447 | 3300013306 | Unclassified | 2407 |
| 419 | Ga0163162_10262346 | 3300013306 | Bacteria | 1859 |
| 420 | Ga0163162_10276925 | 3300013306 | Bacteria | 1810 |
| 421 | Ga0163162_10283849 | 3300013306 | Bacteria | 1787 |
| 422 | Ga0163162_10550540 | 3300013306 | Bacteria | 1282 |
| 423 | Ga0157372_10000014 | 3300013307 | Bacteria | 241589 |
| 424 | Ga0157372_10000140 | 3300013307 | Bacteria | 79310 |
| 425 | Ga0157372_10000845 | 3300013307 | Bacteria | 33235 |
| 426 | Ga0157372_10002792 | 3300013307 | Bacteria | 18873 |
| 427 | Ga0157372_10003387 | 3300013307 | Bacteria | 17201 |
| 428 | Ga0157372_10003675 | 3300013307 | Bacteria | 16495 |
| 429 | Ga0157372_10005454 | 3300013307 | Bacteria | 13518 |
| 430 | Ga0157372_10012767 | 3300013307 | Bacteria | 8950 |
| 431 | Ga0157372_10036028 | 3300013307 | Bacteria | 5451 |
| 432 | Ga0157372_10071569 | 3300013307 | Bacteria | 3905 |
| 433 | Ga0157372_10074388 | 3300013307 | Bacteria | 3831 |
| 434 | Ga0157372_10078927 | 3300013307 | Bacteria | 3721 |
| 435 | Ga0157372_10093360 | 3300013307 | Unclassified | 3425 |
| 436 | Ga0157372_10167813 | 3300013307 | Bacteria | 2539 |
| 437 | Ga0157372_10277145 | 3300013307 | Bacteria | 1950 |
| 438 | Ga0157372_10308555 | 3300013307 | Bacteria | 1841 |
| 439 | Ga0157372_10402010 | 3300013307 | Unclassified | 1596 |
| 440 | Ga0157372_10466457 | 3300013307 | Bacteria | 1472 |
| 441 | Ga0157375_10031791 | 3300013308 | Bacteria | 4997 |
| 442 | Ga0157375_10049155 | 3300013308 | Bacteria | 4131 |
| 443 | Ga0157375_10090265 | 3300013308 | Bacteria | 3122 |
| 444 | Ga0157375_10170194 | 3300013308 | Bacteria | 2325 |
| 445 | Ga0157375_10289206 | 3300013308 | Bacteria | 1802 |
| 446 | Ga0163163_10000034 | 3300014325 | Bacteria | 161820 |
| 447 | Ga0163163_10000742 | 3300014325 | Bacteria | 27758 |
| 448 | Ga0163163_10083726 | 3300014325 | Bacteria | 3195 |
| 449 | Ga0163163_10331824 | 3300014325 | Bacteria | 1576 |
| 450 | Ga0157380_10033039 | 3300014326 | Bacteria | 3983 |
| 451 | Ga0157380_10056022 | 3300014326 | Bacteria | 3133 |
| 452 | Ga0182008_10002237 | 3300014497 | Bacteria | 12236 |
| 453 | Ga0157377_10137890 | 3300014745 | Bacteria | 1496 |
| 454 | Ga0157379_10024598 | 3300014968 | Bacteria | 5346 |
| 455 | Ga0157379_10063610 | 3300014968 | Plasmid | 3298 |
| 456 | Ga0157379_10092734 | 3300014968 | Bacteria | 2709 |
| 457 | Ga0157379_10123904 | 3300014968 | Bacteria | 2325 |
| 458 | Ga0157376_10001674 | 3300014969 | Bacteria | 14724 |
| 459 | Ga0157376_10004505 | 3300014969 | Bacteria | 9709 |
| 460 | Ga0157376_10018992 | 3300014969 | Bacteria | 5286 |
| 461 | Ga0157376_10028333 | 3300014969 | Bacteria | 4451 |
| 462 | Ga0157376_10048210 | 3300014969 | Bacteria | 3521 |
| 463 | Ga0182007_10001509 | 3300015262 | Bacteria | 12423 |
| 464 | Ga0182005_1006357 | 3300015265 | Bacteria | 3621 |
| 465 | Ga0163161_10029674 | 3300017792 | Bacteria | 3888 |
| 466 | Ga0213876_10010112 | 3300021384 | Bacteria | 5070 |
| 467 | Ga0213876_10066908 | 3300021384 | Bacteria | 1897 |
| 468 | Ga0224569_100903 | 3300022732 | Unclassified | 2525 |
| 469 | Ga0224571_101390 | 3300022734 | Unclassified | 1510 |
| 470 | Ga0209672_100086 | 3300025228 | Bacteria | 128901 |
| 471 | Ga0209147_100148 | 3300025229 | Bacteria | 103421 |
| 472 | Ga0209258_100114 | 3300025242 | Bacteria | 191036 |
| 473 | Ga0209148_1000115 | 3300025254 | Bacteria | 191036 |
| 474 | Ga0209455_1000109 | 3300025272 | Bacteria | 191036 |
| 475 | Ga0209673_1000101 | 3300025273 | Bacteria | 190230 |
| 476 | Ga0209676_1000375 | 3300025292 | Bacteria | 82420 |
| 477 | Ga0209564_1006316 | 3300025295 | Bacteria | 6443 |
| 478 | Ga0209050_1000717 | 3300025298 | Bacteria | 48623 |
| 479 | Ga0209051_1000112 | 3300025303 | Bacteria | 152667 |
| 480 | Ga0209257_1000290 | 3300025304 | Bacteria | 110826 |
| 481 | Ga0207696_1015474 | 3300025711 | Bacteria | 2585 |
| 482 | Ga0207692_10030403 | 3300025898 | Bacteria | 2576 |
| 483 | Ga0207642_10004701 | 3300025899 | Bacteria | 4411 |
| 484 | Ga0207642_10062203 | 3300025899 | Unclassified | 1740 |
| 485 | Ga0207710_10034641 | 3300025900 | Bacteria | 2220 |
| 486 | Ga0207680_10112375 | 3300025903 | Unclassified | 1769 |
| 487 | Ga0207647_10006752 | 3300025904 | Bacteria | 8328 |
| 488 | Ga0207647_10007077 | 3300025904 | Bacteria | 8137 |
| 489 | Ga0207647_10026076 | 3300025904 | Bacteria | 3827 |
| 490 | Ga0207647_10064903 | 3300025904 | Bacteria | 2217 |
| 491 | Ga0207699_10000549 | 3300025906 | Bacteria | 18507 |
| 492 | Ga0207699_10045764 | 3300025906 | Bacteria | 2556 |
| 493 | Ga0207699_10098933 | 3300025906 | Bacteria | 1846 |
| 494 | Ga0207645_10009002 | 3300025907 | Bacteria | 6929 |
| 495 | Ga0207645_10032081 | 3300025907 | Bacteria | 3377 |
| 496 | Ga0207645_10061558 | 3300025907 | Bacteria | 2398 |
| 497 | Ga0207645_10084597 | 3300025907 | Bacteria | 2036 |
| 498 | Ga0207643_10091232 | 3300025908 | Bacteria | 1777 |
| 499 | Ga0207705_10003517 | 3300025909 | Bacteria | 11934 |
| 500 | Ga0207705_10007192 | 3300025909 | Bacteria | 8199 |
| 501 | Ga0207705_10037522 | 3300025909 | Bacteria | 3468 |
| 502 | Ga0207705_10063074 | 3300025909 | Bacteria | 2677 |
| 503 | Ga0207684_10005804 | 3300025910 | Bacteria | 11319 |
| 504 | Ga0207654_10000238 | 3300025911 | Bacteria | 33415 |
| 505 | Ga0207654_10000316 | 3300025911 | Bacteria | 29044 |
| 506 | Ga0207654_10024895 | 3300025911 | Bacteria | 3223 |
| 507 | Ga0207654_10033871 | 3300025911 | Bacteria | 2834 |
| 508 | Ga0207654_10063649 | 3300025911 | Bacteria | 2166 |
| 509 | Ga0207654_10094041 | 3300025911 | Bacteria | 1834 |
| 510 | Ga0207707_10011358 | 3300025912 | Bacteria | 7754 |
| 511 | Ga0207707_10014404 | 3300025912 | Bacteria | 6887 |
| 512 | Ga0207707_10020215 | 3300025912 | Bacteria | 5814 |
| 513 | Ga0207707_10075676 | 3300025912 | Bacteria | 2937 |
| 514 | Ga0207707_10113505 | 3300025912 | Bacteria | 2368 |
| 515 | Ga0207707_10326655 | 3300025912 | Bacteria | 1324 |
| 516 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 517 | Ga0207695_10000069 | 3300025913 | Bacteria | 319955 |
| 518 | Ga0207695_10000161 | 3300025913 | Bacteria | 199839 |
| 519 | Ga0207695_10000231 | 3300025913 | Bacteria | 148736 |
| 520 | Ga0207695_10000353 | 3300025913 | Bacteria | 105514 |
| 521 | Ga0207695_10000368 | 3300025913 | Bacteria | 103176 |
| 522 | Ga0207695_10000656 | 3300025913 | Bacteria | 68421 |
| 523 | Ga0207695_10012755 | 3300025913 | Bacteria | 10061 |
| 524 | Ga0207695_10022632 | 3300025913 | Bacteria | 7125 |
| 525 | Ga0207695_10060464 | 3300025913 | Bacteria | 3921 |
| 526 | Ga0207695_10061723 | 3300025913 | Bacteria | 3873 |
| 527 | Ga0207695_10089610 | 3300025913 | Unclassified | 3093 |
| 528 | Ga0207695_10138701 | 3300025913 | Bacteria | 2383 |
| 529 | Ga0207695_10220814 | 3300025913 | Unclassified | 1802 |
| 530 | Ga0207671_10000302 | 3300025914 | Bacteria | 72902 |
| 531 | Ga0207671_10000893 | 3300025914 | Bacteria | 37726 |
| 532 | Ga0207671_10029582 | 3300025914 | Bacteria | 4090 |
| 533 | Ga0207671_10037550 | 3300025914 | Bacteria | 3592 |
| 534 | Ga0207671_10046967 | 3300025914 | Unclassified | 3195 |
| 535 | Ga0207671_10064106 | 3300025914 | Bacteria | 2732 |
| 536 | Ga0207693_10000012 | 3300025915 | Bacteria | 154708 |
| 537 | Ga0207693_10000058 | 3300025915 | Bacteria | 94726 |
| 538 | Ga0207693_10001160 | 3300025915 | Bacteria | 23505 |
| 539 | Ga0207693_10058286 | 3300025915 | Bacteria | 3026 |
| 540 | Ga0207693_10065576 | 3300025915 | Bacteria | 2844 |
| 541 | Ga0207693_10161948 | 3300025915 | Bacteria | 1760 |
| 542 | Ga0207663_10000280 | 3300025916 | Bacteria | 22295 |
| 543 | Ga0207663_10003486 | 3300025916 | Bacteria | 7701 |
| 544 | Ga0207663_10243547 | 3300025916 | Bacteria | 1320 |
| 545 | Ga0207660_10095265 | 3300025917 | Bacteria | 2214 |
| 546 | Ga0207660_10291204 | 3300025917 | Bacteria | 1298 |
| 547 | Ga0207662_10118827 | 3300025918 | Bacteria | 1656 |
| 548 | Ga0207657_10000390 | 3300025919 | Bacteria | 46278 |
| 549 | Ga0207657_10005169 | 3300025919 | Bacteria | 13686 |
| 550 | Ga0207657_10008891 | 3300025919 | Bacteria | 10157 |
| 551 | Ga0207657_10136934 | 3300025919 | Bacteria | 2003 |
| 552 | Ga0207649_10002495 | 3300025920 | Bacteria | 10286 |
| 553 | Ga0207649_10003157 | 3300025920 | Bacteria | 9042 |
| 554 | Ga0207649_10003294 | 3300025920 | Bacteria | 8838 |
| 555 | Ga0207652_10003056 | 3300025921 | Bacteria | 13968 |
| 556 | Ga0207652_10023765 | 3300025921 | Bacteria | 5081 |
| 557 | Ga0207652_10025236 | 3300025921 | Bacteria | 4939 |
| 558 | Ga0207652_10046960 | 3300025921 | Bacteria | 3687 |
| 559 | Ga0207652_10120163 | 3300025921 | Bacteria | 2337 |
| 560 | Ga0207681_10061011 | 3300025923 | Bacteria | 2591 |
| 561 | Ga0207694_10000137 | 3300025924 | Bacteria | 74746 |
| 562 | Ga0207694_10002200 | 3300025924 | Bacteria | 16018 |
| 563 | Ga0207694_10004080 | 3300025924 | Bacteria | 11483 |
| 564 | Ga0207694_10004374 | 3300025924 | Bacteria | 11032 |
| 565 | Ga0207694_10017121 | 3300025924 | Bacteria | 5476 |
| 566 | Ga0207694_10020076 | 3300025924 | Bacteria | 5053 |
| 567 | Ga0207694_10021206 | 3300025924 | Bacteria | 4921 |
| 568 | Ga0207694_10103242 | 3300025924 | Unclassified | 2261 |
| 569 | Ga0207694_10148383 | 3300025924 | Bacteria | 1889 |
| 570 | Ga0207694_10320855 | 3300025924 | Unclassified | 1278 |
| 571 | Ga0207650_10084040 | 3300025925 | Bacteria | 2419 |
| 572 | Ga0207687_10006501 | 3300025927 | Bacteria | 7720 |
| 573 | Ga0207687_10014350 | 3300025927 | Bacteria | 5183 |
| 574 | Ga0207687_10050439 | 3300025927 | Bacteria | 2896 |
| 575 | Ga0207700_10002138 | 3300025928 | Bacteria | 11308 |
| 576 | Ga0207700_10003116 | 3300025928 | Bacteria | 9583 |
| 577 | Ga0207700_10012980 | 3300025928 | Bacteria | 5398 |
| 578 | Ga0207700_10017957 | 3300025928 | Bacteria | 4738 |
| 579 | Ga0207700_10036822 | 3300025928 | Bacteria | 3538 |
| 580 | Ga0207700_10077224 | 3300025928 | Bacteria | 2586 |
| 581 | Ga0207664_10000098 | 3300025929 | Bacteria | 80444 |
| 582 | Ga0207664_10007305 | 3300025929 | Bacteria | 7660 |
| 583 | Ga0207664_10056761 | 3300025929 | Bacteria | 3111 |
| 584 | Ga0207664_10092569 | 3300025929 | Bacteria | 2481 |
| 585 | Ga0207644_10009960 | 3300025931 | Bacteria | 6255 |
| 586 | Ga0207690_10000037 | 3300025932 | Bacteria | 142658 |
| 587 | Ga0207690_10067802 | 3300025932 | Bacteria | 2449 |
| 588 | Ga0207706_10017424 | 3300025933 | Bacteria | 6470 |
| 589 | Ga0207706_10028125 | 3300025933 | Bacteria | 5022 |
| 590 | Ga0207686_10018802 | 3300025934 | Unclassified | 3918 |
| 591 | Ga0207686_10039392 | 3300025934 | Bacteria | 2867 |
| 592 | Ga0207709_10000015 | 3300025935 | Bacteria | 493221 |
| 593 | Ga0207709_10009883 | 3300025935 | Bacteria | 5254 |
| 594 | Ga0207709_10052774 | 3300025935 | Bacteria | 2499 |
| 595 | Ga0207709_10081527 | 3300025935 | Bacteria | 2086 |
| 596 | Ga0207670_10105454 | 3300025936 | Bacteria | 2020 |
| 597 | Ga0207670_10132068 | 3300025936 | Bacteria | 1831 |
| 598 | Ga0207670_10190809 | 3300025936 | Bacteria | 1550 |
| 599 | Ga0207670_10208398 | 3300025936 | Bacteria | 1489 |
| 600 | Ga0207665_10003619 | 3300025939 | Bacteria | 10327 |
| 601 | Ga0207665_10005922 | 3300025939 | Bacteria | 8138 |
| 602 | Ga0207665_10011313 | 3300025939 | Bacteria | 5858 |
| 603 | Ga0207665_10018379 | 3300025939 | Bacteria | 4594 |
| 604 | Ga0207691_10028957 | 3300025940 | Bacteria | 5183 |
| 605 | Ga0207691_10046834 | 3300025940 | Bacteria | 3971 |
| 606 | Ga0207711_10000023 | 3300025941 | Bacteria | 327296 |
| 607 | Ga0207711_10003045 | 3300025941 | Bacteria | 14653 |
| 608 | Ga0207711_10004445 | 3300025941 | Bacteria | 11949 |
| 609 | Ga0207711_10007008 | 3300025941 | Bacteria | 9454 |
| 610 | Ga0207711_10028858 | 3300025941 | Bacteria | 4674 |
| 611 | Ga0207711_10130437 | 3300025941 | Bacteria | 2253 |
| 612 | Ga0207689_10001606 | 3300025942 | Bacteria | 21385 |
| 613 | Ga0207689_10002614 | 3300025942 | Bacteria | 16674 |
| 614 | Ga0207689_10014513 | 3300025942 | Bacteria | 6701 |
| 615 | Ga0207689_10021947 | 3300025942 | Bacteria | 5369 |
| 616 | Ga0207689_10037071 | 3300025942 | Bacteria | 4046 |
| 617 | Ga0207689_10054566 | 3300025942 | Bacteria | 3291 |
| 618 | Ga0207689_10095661 | 3300025942 | Bacteria | 2439 |
| 619 | Ga0207661_10029779 | 3300025944 | Bacteria | 4196 |
| 620 | Ga0207661_10048778 | 3300025944 | Bacteria | 3367 |
| 621 | Ga0207661_10051469 | 3300025944 | Bacteria | 3286 |
| 622 | Ga0207661_10057318 | 3300025944 | Bacteria | 3132 |
| 623 | Ga0207661_10103666 | 3300025944 | Bacteria | 2394 |
| 624 | Ga0207661_10158259 | 3300025944 | Bacteria | 1964 |
| 625 | Ga0207679_10026234 | 3300025945 | Bacteria | 4017 |
| 626 | Ga0207679_10032524 | 3300025945 | Bacteria | 3662 |
| 627 | Ga0207679_10088123 | 3300025945 | Bacteria | 2392 |
| 628 | Ga0207679_10120088 | 3300025945 | Bacteria | 2091 |
| 629 | Ga0207679_10139108 | 3300025945 | Bacteria | 1960 |
| 630 | Ga0207679_10297206 | 3300025945 | Bacteria | 1390 |
| 631 | Ga0207667_10000809 | 3300025949 | Bacteria | 40616 |
| 632 | Ga0207667_10003556 | 3300025949 | Bacteria | 19267 |
| 633 | Ga0207667_10008104 | 3300025949 | Bacteria | 12522 |
| 634 | Ga0207667_10012826 | 3300025949 | Bacteria | 9630 |
| 635 | Ga0207667_10018028 | 3300025949 | Bacteria | 7929 |
| 636 | Ga0207667_10045259 | 3300025949 | Bacteria | 4662 |
| 637 | Ga0207667_10051579 | 3300025949 | Bacteria | 4336 |
| 638 | Ga0207667_10061750 | 3300025949 | Bacteria | 3920 |
| 639 | Ga0207667_10130458 | 3300025949 | Bacteria | 2589 |
| 640 | Ga0207667_10144008 | 3300025949 | Bacteria | 2454 |
| 641 | Ga0207667_10200301 | 3300025949 | Bacteria | 2048 |
| 642 | Ga0207667_10236776 | 3300025949 | Unclassified | 1869 |
| 643 | Ga0207667_10255066 | 3300025949 | Bacteria | 1794 |
| 644 | Ga0207667_10255488 | 3300025949 | Bacteria | 1792 |
| 645 | Ga0207667_10276114 | 3300025949 | Bacteria | 1718 |
| 646 | Ga0207651_10297833 | 3300025960 | Bacteria | 1340 |
| 647 | Ga0207712_10050293 | 3300025961 | Bacteria | 2909 |
| 648 | Ga0207712_10204551 | 3300025961 | Bacteria | 1568 |
| 649 | Ga0207668_10005700 | 3300025972 | Bacteria | 7338 |
| 650 | Ga0207668_10175087 | 3300025972 | Bacteria | 1687 |
| 651 | Ga0207640_10005099 | 3300025981 | Bacteria | 7142 |
| 652 | Ga0207640_10038872 | 3300025981 | Bacteria | 3006 |
| 653 | Ga0207640_10048138 | 3300025981 | Unclassified | 2754 |
| 654 | Ga0207640_10080735 | 3300025981 | Unclassified | 2221 |
| 655 | Ga0207640_10290825 | 3300025981 | Bacteria | 1288 |
| 656 | Ga0207677_10001674 | 3300026023 | Bacteria | 11740 |
| 657 | Ga0207677_10009196 | 3300026023 | Bacteria | 5549 |
| 658 | Ga0207677_10019695 | 3300026023 | Bacteria | 4081 |
| 659 | Ga0207677_10027991 | 3300026023 | Bacteria | 3559 |
| 660 | Ga0207677_10070889 | 3300026023 | Unclassified | 2458 |
| 661 | Ga0207677_10091874 | 3300026023 | Bacteria | 2209 |
| 662 | Ga0207677_10229870 | 3300026023 | Bacteria | 1493 |
| 663 | Ga0207703_10006688 | 3300026035 | Bacteria | 9197 |
| 664 | Ga0207703_10009972 | 3300026035 | Bacteria | 7451 |
| 665 | Ga0207703_10047849 | 3300026035 | Bacteria | 3449 |
| 666 | Ga0207703_10135677 | 3300026035 | Bacteria | 2130 |
| 667 | Ga0207639_10000191 | 3300026041 | Bacteria | 47375 |
| 668 | Ga0207639_10032730 | 3300026041 | Unclassified | 3830 |
| 669 | Ga0207639_10134485 | 3300026041 | Bacteria | 2051 |
| 670 | Ga0207639_10212133 | 3300026041 | Bacteria | 1667 |
| 671 | Ga0207678_10000620 | 3300026067 | Bacteria | 32501 |
| 672 | Ga0207678_10006508 | 3300026067 | Bacteria | 10370 |
| 673 | Ga0207678_10032951 | 3300026067 | Bacteria | 4515 |
| 674 | Ga0207678_10034021 | 3300026067 | Bacteria | 4439 |
| 675 | Ga0207678_10068148 | 3300026067 | Bacteria | 3054 |
| 676 | Ga0207678_10217565 | 3300026067 | Bacteria | 1635 |
| 677 | Ga0207708_10069836 | 3300026075 | Bacteria | 2689 |
| 678 | Ga0207708_10121356 | 3300026075 | Bacteria | 2037 |
| 679 | Ga0207702_10000458 | 3300026078 | Bacteria | 46107 |
| 680 | Ga0207702_10001020 | 3300026078 | Bacteria | 28742 |
| 681 | Ga0207702_10001136 | 3300026078 | Bacteria | 27202 |
| 682 | Ga0207702_10003114 | 3300026078 | Bacteria | 15370 |
| 683 | Ga0207702_10006562 | 3300026078 | Bacteria | 10009 |
| 684 | Ga0207702_10008668 | 3300026078 | Bacteria | 8578 |
| 685 | Ga0207702_10011681 | 3300026078 | Bacteria | 7313 |
| 686 | Ga0207702_10024096 | 3300026078 | Bacteria | 5049 |
| 687 | Ga0207702_10025127 | 3300026078 | Bacteria | 4942 |
| 688 | Ga0207702_10042361 | 3300026078 | Unclassified | 3819 |
| 689 | Ga0207702_10064135 | 3300026078 | Bacteria | 3143 |
| 690 | Ga0207702_10146691 | 3300026078 | Bacteria | 2142 |
| 691 | Ga0207702_10151081 | 3300026078 | Bacteria | 2112 |
| 692 | Ga0207702_10275837 | 3300026078 | Bacteria | 1587 |
| 693 | Ga0207702_10358077 | 3300026078 | Bacteria | 1398 |
| 694 | Ga0207641_10001055 | 3300026088 | Bacteria | 27824 |
| 695 | Ga0207641_10015901 | 3300026088 | Bacteria | 6162 |
| 696 | Ga0207641_10036916 | 3300026088 | Bacteria | 4079 |
| 697 | Ga0207641_10041831 | 3300026088 | Bacteria | 3842 |
| 698 | Ga0207641_10063106 | 3300026088 | Bacteria | 3164 |
| 699 | Ga0207648_10002171 | 3300026089 | Bacteria | 21320 |
| 700 | Ga0207648_10010502 | 3300026089 | Bacteria | 8770 |
| 701 | Ga0207648_10207569 | 3300026089 | Bacteria | 1738 |
| 702 | Ga0207648_10314498 | 3300026089 | Bacteria | 1406 |
| 703 | Ga0207676_10002318 | 3300026095 | Bacteria | 13658 |
| 704 | Ga0207676_10006053 | 3300026095 | Bacteria | 8535 |
| 705 | Ga0207676_10153633 | 3300026095 | Bacteria | 1985 |
| 706 | Ga0207676_10288928 | 3300026095 | Bacteria | 1492 |
| 707 | Ga0207676_10353952 | 3300026095 | Bacteria | 1359 |
| 708 | Ga0207674_10000763 | 3300026116 | Bacteria | 42020 |
| 709 | Ga0207674_10001893 | 3300026116 | Bacteria | 26626 |
| 710 | Ga0207674_10001984 | 3300026116 | Bacteria | 25923 |
| 711 | Ga0207674_10003886 | 3300026116 | Bacteria | 18190 |
| 712 | Ga0207674_10071079 | 3300026116 | Bacteria | 3497 |
| 713 | Ga0207674_10103405 | 3300026116 | Bacteria | 2827 |
| 714 | Ga0207674_10131501 | 3300026116 | Bacteria | 2465 |
| 715 | Ga0207675_100010959 | 3300026118 | Bacteria | 8491 |
| 716 | Ga0207675_100016660 | 3300026118 | Bacteria | 6863 |
| 717 | Ga0207675_100155027 | 3300026118 | Bacteria | 2182 |
| 718 | Ga0207675_100169237 | 3300026118 | Bacteria | 2088 |
| 719 | Ga0207683_10008453 | 3300026121 | Bacteria | 8810 |
| 720 | Ga0207683_10044141 | 3300026121 | Bacteria | 3897 |
| 721 | Ga0207683_10155916 | 3300026121 | Bacteria | 2063 |
| 722 | Ga0207698_10000006 | 3300026142 | Bacteria | 291847 |
| 723 | Ga0207698_10000249 | 3300026142 | Bacteria | 33102 |
| 724 | Ga0207698_10004173 | 3300026142 | Bacteria | 8788 |
| 725 | Ga0207698_10019954 | 3300026142 | Bacteria | 4603 |
| 726 | Ga0207698_10047927 | 3300026142 | Bacteria | 3241 |
| 727 | Ga0207698_10073906 | 3300026142 | Bacteria | 2716 |
| 728 | Ga0207698_10149441 | 3300026142 | Bacteria | 2025 |
| 729 | Ga0207698_10151120 | 3300026142 | Bacteria | 2016 |
| 730 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 731 | Ga0207428_10000595 | 3300027907 | Bacteria | 42731 |
| 732 | Ga0207428_10025635 | 3300027907 | Bacteria | 4933 |
| 733 | Ga0207428_10227543 | 3300027907 | Bacteria | 1396 |
| 734 | Ga0265356_1000013 | 3300028017 | Bacteria | 28815 |
| 735 | Ga0268266_10000660 | 3300028379 | Bacteria | 46709 |
| 736 | Ga0268266_10005793 | 3300028379 | Bacteria | 11438 |
| 737 | Ga0268266_10090876 | 3300028379 | Bacteria | 2676 |
| 738 | Ga0268266_10170447 | 3300028379 | Bacteria | 1975 |
| 739 | Ga0268266_10340179 | 3300028379 | Bacteria | 1408 |
| 740 | Ga0268265_10006348 | 3300028380 | Bacteria | 8014 |
| 741 | Ga0268265_10134848 | 3300028380 | Bacteria | 2058 |
| 742 | Ga0268265_10168244 | 3300028380 | Bacteria | 1870 |
| 743 | Ga0268265_10306015 | 3300028380 | Bacteria | 1433 |
| 744 | Ga0268264_10001093 | 3300028381 | Bacteria | 26776 |
| 745 | Ga0268264_10004380 | 3300028381 | Bacteria | 12050 |
| 746 | Ga0268264_10028635 | 3300028381 | Bacteria | 4559 |
| 747 | Ga0265337_1001683 | 3300028556 | Bacteria | 10731 |
| 748 | Ga0265337_1006294 | 3300028556 | Bacteria | 4600 |
| 749 | Ga0265337_1008518 | 3300028556 | Bacteria | 3725 |
| 750 | Ga0265337_1013101 | 3300028556 | Bacteria | 2798 |
| 751 | Ga0265319_1001494 | 3300028563 | Bacteria | 13918 |
| 752 | Ga0265319_1042049 | 3300028563 | Bacteria | 1539 |
| 753 | Ga0265334_10021022 | 3300028573 | Bacteria | 2667 |
| 754 | Ga0307515_10068993 | 3300028794 | Bacteria | 4844 |
| 755 | Ga0265338_10003616 | 3300028800 | Bacteria | 21554 |
| 756 | Ga0265338_10005972 | 3300028800 | Bacteria | 15660 |
| 757 | Ga0265338_10022889 | 3300028800 | Bacteria | 6447 |
| 758 | Ga0265338_10029368 | 3300028800 | Bacteria | 5451 |
| 759 | Ga0265338_10034737 | 3300028800 | Bacteria | 4865 |
| 760 | Ga0265338_10212731 | 3300028800 | Bacteria | 1450 |
| 761 | Ga0265762_1000831 | 3300030760 | Bacteria | 5497 |
| 762 | Ga0265760_10000017 | 3300031090 | Bacteria | 89357 |
| 763 | Ga0265760_10001830 | 3300031090 | Bacteria | 6243 |
| 764 | Ga0265320_10000134 | 3300031240 | Bacteria | 63576 |
| 765 | Ga0265320_10000847 | 3300031240 | Bacteria | 23118 |
| 766 | Ga0265320_10001451 | 3300031240 | Bacteria | 17287 |
| 767 | Ga0265320_10002229 | 3300031240 | Bacteria | 13594 |
| 768 | Ga0265320_10005571 | 3300031240 | Bacteria | 8067 |
| 769 | Ga0265320_10030138 | 3300031240 | Bacteria | 2801 |
| 770 | Ga0265339_10010523 | 3300031249 | Bacteria | 5743 |
| 771 | Ga0265339_10033067 | 3300031249 | Bacteria | 2915 |
| 772 | Ga0265316_10077493 | 3300031344 | Bacteria | 2553 |
| 773 | Ga0307408_100002421 | 3300031548 | Bacteria | 13124 |
| 774 | Ga0307408_100050207 | 3300031548 | Bacteria | 2999 |
| 775 | Ga0307408_100104768 | 3300031548 | Bacteria | 2161 |
| 776 | Ga0265313_10009742 | 3300031595 | Bacteria | 6192 |
| 777 | Ga0265313_10020913 | 3300031595 | Bacteria | 3594 |
| 778 | Ga0307508_10000055 | 3300031616 | Bacteria | 126914 |
| 779 | Ga0265314_10032624 | 3300031711 | Bacteria | 3829 |
| 780 | Ga0307516_10077663 | 3300031730 | Bacteria | 3168 |
| 781 | Ga0307405_10093468 | 3300031731 | Bacteria | 1998 |
| 782 | Ga0307406_10015036 | 3300031901 | Bacteria | 4468 |
| 783 | Ga0307407_10000097 | 3300031903 | Bacteria | 29578 |
| 784 | Ga0307414_10000226 | 3300032004 | Bacteria | 37108 |
| 785 | Ga0307414_10010123 | 3300032004 | Bacteria | 5453 |
| 786 | Ga0307411_10034580 | 3300032005 | Bacteria | 3147 |
| 787 | Ga0307411_10259336 | 3300032005 | Bacteria | 1372 |
| 788 | Ga0307415_100054242 | 3300032126 | Bacteria | 2735 |
| 789 | Ga0307510_10036648 | 3300033180 | Bacteria | 5457 |
| 790 | Ga0316214_1002983 | 3300033545 | Bacteria | 2109 |
| 791 | Ga0373926_0043744 | 3300035083 | Bacteria | 1603 |
| 792 | Ga0373934_0000592 | 3300035086 | Bacteria | 12793 |
| 793 | Ga0373944_0019989 | 3300035089 | Bacteria | 1925 |
| 794 | Ga0373932_0039735 | 3300035112 | Bacteria | 1351 |
| 795 | Ga0373954_0006455 | 3300035118 | Bacteria | 5115 |
| 796 | Ga0373954_0109449 | 3300035118 | Bacteria | 1336 |
| 797 | Ga0373956_0040058 | 3300035119 | Bacteria | 2077 |
| 798 | Ga0373957_0028507 | 3300035120 | Bacteria | 2035 |
| 799 | Ga0373943_0000669 | 3300035170 | Bacteria | 14898 |
| 800 | Ga0373955_0061172 | 3300035172 | Bacteria | 2079 |
| 801 | Ga0373931_0036185 | 3300035691 | Bacteria | 2572 |
| 802 | Ga0373931_0088349 | 3300035691 | Bacteria | 1722 |
| 803 | Ga0373935_0027635 | 3300035692 | Bacteria | 3507 |
| 804 | Ga0373935_0083802 | 3300035692 | Bacteria | 2076 |
| 805 | Ga0373927_0000282 | 3300035695 | Bacteria | 40021 |
| 806 | Ga0373927_0047241 | 3300035695 | Bacteria | 2785 |
| 807 | Ga0373933_0005449 | 3300035724 | Bacteria | 6926 |
| 808 | Ga0373933_0008503 | 3300035724 | Bacteria | 5599 |
| 809 | Ga0373947_0001632 | 3300035725 | Bacteria | 13760 |
| 810 | Ga0373947_0080576 | 3300035725 | Bacteria | 2014 |
| 811 | Ga0373937_0000419 | 3300036401 | Bacteria | 39684 |
| 812 | Ga0373937_0020381 | 3300036401 | Bacteria | 5945 |
| 813 | Ga0373937_0025917 | 3300036401 | Bacteria | 5296 |
| 814 | Ga0373937_0266062 | 3300036401 | Bacteria | 1617 |
| 815 | Ga0373925_0002387 | 3300037068 | Bacteria | 15061 |
| 816 | Ga0373925_0016024 | 3300037068 | Bacteria | 5427 |
| 817 | Ga0373925_0054878 | 3300037068 | Bacteria | 2981 |
| 818 | Ga0373925_0080788 | 3300037068 | Bacteria | 2471 |
| 819 | Ga0395900_0095002 | 3300037418 | Bacteria | 3063 |
| 820 | Ga0395898_0261431 | 3300037466 | Bacteria | 1651 |
| 821 | Ga0395905_0118676 | 3300037471 | Bacteria | 2486 |
| 822 | Ga0395905_0126144 | 3300037471 | Bacteria | 2407 |
| 823 | Ga0436365_0012252 | 3300039437 | Bacteria | 1824 |
| 824 | Ga0436365_0375454 | 3300039437 | Bacteria | 5051 |
| 825 | Ga0436365_1076298 | 3300039437 | Bacteria | 8501 |
| 826 | Ga0436365_1710025 | 3300039437 | Bacteria | 8308 |
| 827 | Ga0451853_3969147 | 3300041512 | Bacteria | 1179 |
| 828 | Ga0439449_0002086 | 3300042007 | Bacteria | 7857 |
| 829 | Ga0450894_012304 | 3300042131 | Bacteria | 1118 |
| 830 | Ga0450908_003607 | 3300042184 | Bacteria | 3012 |
| 831 | Ga0466966_0062685 | 3300044684 | Bacteria | 2344 |
| 832 | Ga0466963_0004435 | 3300044694 | Bacteria | 8158 |
| 833 | Ga0466963_0005862 | 3300044694 | Bacteria | 7239 |
| 834 | Ga0466963_0054503 | 3300044694 | Bacteria | 2658 |
| 835 | Ga0466964_0079416 | 3300044706 | Bacteria | 1405 |
| 836 | Ga0466971_0125743 | 3300044719 | Bacteria | 1188 |
| 837 | Ga0466957_0057753 | 3300044842 | Bacteria | 2376 |
| 838 | Ga0466959_0136618 | 3300045049 | Bacteria | 1735 |
| 839 | Ga0466959_0206565 | 3300045049 | Bacteria | 1366 |
| 840 | Ga0451576_0015690 | 3300045051 | Bacteria | 8386 |
| 841 | Ga0451576_0391735 | 3300045051 | Bacteria | 1456 |
| 842 | Ga0466958_0074458 | 3300045836 | Bacteria | 2081 |
| 843 | Ga0466967_0011559 | 3300045976 | Bacteria | 6697 |
| 844 | Ga0495592_0000012 | 3300046454 | Bacteria | 154054 |
| 845 | Ga0495592_0035706 | 3300046454 | Bacteria | 3745 |
| 846 | Ga0495603_0111963 | 3300046455 | Bacteria | 1592 |
| 847 | Ga0495629_0001765 | 3300046459 | Bacteria | 16956 |
| 848 | Ga0495629_0014957 | 3300046459 | Bacteria | 5575 |
| 849 | Ga0495629_0055591 | 3300046459 | Bacteria | 2767 |
| 850 | Ga0495629_0104059 | 3300046459 | Unclassified | 1980 |
| 851 | Ga0495629_0228410 | 3300046459 | Unclassified | 1283 |
| 852 | Ga0495638_0015062 | 3300046460 | Bacteria | 5204 |
| 853 | Ga0495651_0005962 | 3300046462 | Bacteria | 9295 |
| 854 | Ga0495653_0010340 | 3300046463 | Bacteria | 7633 |
| 855 | Ga0495653_0143967 | 3300046463 | Bacteria | 1673 |
| 856 | Ga0495650_0000186 | 3300046471 | Bacteria | 136572 |
| 857 | Ga0495580_0000182 | 3300046472 | Bacteria | 47252 |
| 858 | Ga0495580_0001774 | 3300046472 | Bacteria | 18967 |
| 859 | Ga0495580_0006470 | 3300046472 | Bacteria | 9535 |
| 860 | Ga0495580_0035789 | 3300046472 | Bacteria | 3569 |
| 861 | Ga0495580_0084070 | 3300046472 | Bacteria | 2217 |
| 862 | Ga0495580_0103043 | 3300046472 | Bacteria | 1984 |
| 863 | Ga0495580_0119072 | 3300046472 | Bacteria | 1833 |
| 864 | Ga0495582_0001430 | 3300046473 | Bacteria | 13457 |
| 865 | Ga0495582_0068026 | 3300046473 | Bacteria | 1969 |
| 866 | Ga0495639_0002577 | 3300046475 | Bacteria | 7901 |
| 867 | Ga0495639_0041717 | 3300046475 | Bacteria | 2068 |
| 868 | Ga0495662_0002206 | 3300046476 | Bacteria | 9808 |
| 869 | Ga0495662_0011784 | 3300046476 | Bacteria | 4273 |
| 870 | Ga0495664_0001708 | 3300046477 | Bacteria | 11667 |
| 871 | Ga0495594_0000696 | 3300046499 | Bacteria | 17306 |
| 872 | Ga0495594_0006286 | 3300046499 | Bacteria | 6108 |
| 873 | Ga0495594_0052251 | 3300046499 | Bacteria | 2250 |
| 874 | Ga0495594_0076284 | 3300046499 | Unclassified | 1869 |
| 875 | Ga0495583_0028942 | 3300046506 | Bacteria | 2716 |
| 876 | Ga0495606_0043625 | 3300046507 | Bacteria | 2989 |
| 877 | Ga0495628_0003611 | 3300046516 | Bacteria | 13837 |
| 878 | Ga0495628_0028279 | 3300046516 | Bacteria | 4556 |
| 879 | Ga0495628_0074023 | 3300046516 | Bacteria | 2654 |
| 880 | Ga0495628_0188848 | 3300046516 | Bacteria | 1556 |
| 881 | Ga0495630_0000366 | 3300046517 | Bacteria | 35779 |
| 882 | Ga0495630_0005339 | 3300046517 | Bacteria | 9063 |
| 883 | Ga0495630_0023229 | 3300046517 | Bacteria | 4583 |
| 884 | Ga0495666_0004502 | 3300046526 | Bacteria | 7039 |
| 885 | Ga0495666_0007965 | 3300046526 | Bacteria | 5308 |
| 886 | Ga0495652_0057880 | 3300046529 | Bacteria | 3285 |
| 887 | Ga0495652_0074086 | 3300046529 | Bacteria | 2832 |
| 888 | Ga0495652_0113515 | 3300046529 | Unclassified | 2175 |
| 889 | Ga0495652_0219874 | 3300046529 | Bacteria | 1428 |
| 890 | Ga0495665_0001802 | 3300046531 | Bacteria | 11536 |
| 891 | Ga0495640_0006287 | 3300046533 | Bacteria | 9405 |
| 892 | Ga0495640_0011154 | 3300046533 | Bacteria | 6918 |
| 893 | Ga0495640_0020710 | 3300046533 | Bacteria | 4836 |
| 894 | Ga0495586_0000017 | 3300046535 | Bacteria | 116426 |
| 895 | Ga0495586_0005165 | 3300046535 | Bacteria | 6989 |
| 896 | Ga0495586_0007234 | 3300046535 | Bacteria | 5922 |
| 897 | Ga0495587_0029818 | 3300046536 | Bacteria | 3311 |
| 898 | Ga0495597_0000325 | 3300046542 | Bacteria | 43126 |
| 899 | Ga0495645_0003809 | 3300046543 | Bacteria | 10254 |
| 900 | Ga0495645_0010006 | 3300046543 | Bacteria | 6639 |
| 901 | Ga0495645_0011659 | 3300046543 | Bacteria | 6189 |
| 902 | Ga0495645_0088818 | 3300046543 | Bacteria | 2210 |
| 903 | Ga0495645_0118054 | 3300046543 | Bacteria | 1871 |
| 904 | Ga0495645_0158386 | 3300046543 | Bacteria | 1567 |
| 905 | Ga0495622_0024995 | 3300046557 | Bacteria | 2789 |
| 906 | Ga0495667_0000973 | 3300046559 | Bacteria | 18521 |
| 907 | Ga0495668_0082572 | 3300046616 | Unclassified | 1763 |
| 908 | Ga0495634_0001612 | 3300046642 | Bacteria | 19685 |
| 909 | Ga0495625_0000315 | 3300046660 | Bacteria | 73951 |
| 910 | Ga0495625_0028802 | 3300046660 | Bacteria | 4160 |
| 911 | Ga0495625_0044852 | 3300046660 | Bacteria | 3199 |
| 912 | Ga0495635_0014187 | 3300046663 | Bacteria | 5576 |
| 913 | Ga0495635_0055728 | 3300046663 | Bacteria | 2723 |
| 914 | Ga0495659_0041055 | 3300046664 | Bacteria | 1651 |
| 915 | Ga0495588_0000083 | 3300046674 | Bacteria | 197018 |
| 916 | Ga0495599_0001485 | 3300046678 | Bacteria | 13459 |
| 917 | Ga0495599_0017236 | 3300046678 | Bacteria | 4489 |
| 918 | Ga0495623_0018994 | 3300046679 | Bacteria | 4438 |
| 919 | Ga0495623_0020095 | 3300046679 | Bacteria | 4318 |
| 920 | Ga0495646_0004579 | 3300046680 | Bacteria | 8715 |
| 921 | Ga0495646_0081423 | 3300046680 | Unclassified | 1886 |
| 922 | Ga0495646_0144642 | 3300046680 | Bacteria | 1326 |
| 923 | Ga0495647_0036151 | 3300046681 | Bacteria | 1858 |
| 924 | Ga0495658_0015852 | 3300046683 | Bacteria | 3873 |
| 925 | Ga0495669_0095438 | 3300046684 | Bacteria | 1377 |
| 926 | Ga0495613_0004064 | 3300046689 | Bacteria | 10943 |
| 927 | Ga0495613_0007905 | 3300046689 | Bacteria | 7911 |
| 928 | Ga0495613_0009166 | 3300046689 | Bacteria | 7335 |
| 929 | Ga0495613_0082030 | 3300046689 | Bacteria | 2342 |
| 930 | Ga0495624_0012772 | 3300046690 | Bacteria | 5734 |
| 931 | Ga0495624_0027095 | 3300046690 | Unclassified | 3755 |
| 932 | Ga0495649_0004705 | 3300046694 | Bacteria | 8859 |
| 933 | Ga0495600_0001541 | 3300046809 | Bacteria | 12810 |
| 934 | Ga0495600_0077268 | 3300046809 | Bacteria | 2174 |
| 935 | Ga0495600_0084830 | 3300046809 | Bacteria | 2067 |
| 936 | Ga0495600_0201755 | 3300046809 | Bacteria | 1277 |
| 937 | Ga0495581_0042259 | 3300047315 | Unclassified | 2638 |
| 938 | Ga0495604_0042015 | 3300047317 | Bacteria | 3584 |
| 939 | Ga0495604_0150525 | 3300047317 | Bacteria | 1654 |
| 940 | Ga0495674_0001210 | 3300047319 | Bacteria | 24994 |
| 941 | Ga0495674_0003962 | 3300047319 | Bacteria | 14359 |
| 942 | Ga0495674_0006098 | 3300047319 | Bacteria | 11575 |
| 943 | Ga0495674_0006874 | 3300047319 | Bacteria | 10887 |
| 944 | Ga0495674_0010893 | 3300047319 | Bacteria | 8596 |
| 945 | Ga0495674_0017519 | 3300047319 | Bacteria | 6668 |
| 946 | Ga0495674_0029207 | 3300047319 | Bacteria | 5023 |
| 947 | Ga0495674_0045977 | 3300047319 | Bacteria | 3876 |
| 948 | Ga0495674_0049300 | 3300047319 | Bacteria | 3722 |
| 949 | Ga0495674_0325647 | 3300047319 | Bacteria | 1251 |
| 950 | Ga0495672_0000712 | 3300047320 | Bacteria | 36590 |
| 951 | Ga0495672_0002235 | 3300047320 | Bacteria | 18011 |
| 952 | Ga0495672_0017128 | 3300047320 | Bacteria | 4854 |
| 953 | Ga0495672_0069866 | 3300047320 | Bacteria | 1992 |
| 954 | Ga0495676_0001708 | 3300047321 | Bacteria | 19160 |
| 955 | Ga0495680_0005586 | 3300047322 | Bacteria | 11794 |
| 956 | Ga0495680_0057091 | 3300047322 | Bacteria | 3021 |
| 957 | Ga0495680_0148895 | 3300047322 | Bacteria | 1708 |
| 958 | Ga0495675_0003684 | 3300047444 | Bacteria | 9261 |
| 959 | Ga0495675_0018679 | 3300047444 | Unclassified | 4403 |
| 960 | Ga0495675_0109108 | 3300047444 | Bacteria | 1728 |
| 961 | Ga0495677_0019329 | 3300047445 | Bacteria | 2471 |
| 962 | Ga0495684_0004637 | 3300047471 | Bacteria | 10729 |
| 963 | Ga0495684_0025455 | 3300047471 | Bacteria | 4547 |
| 964 | Ga0495684_0067018 | 3300047471 | Bacteria | 2730 |
| 965 | Ga0495684_0224538 | 3300047471 | Bacteria | 1376 |
| 966 | Ga0495686_0000035 | 3300047472 | Bacteria | 314930 |
| 967 | Ga0495686_0005823 | 3300047472 | Bacteria | 9614 |
| 968 | Ga0495686_0006455 | 3300047472 | Bacteria | 8975 |
| 969 | Ga0495593_0047426 | 3300047673 | Bacteria | 2285 |
| 970 | Ga0495602_0028268 | 3300048088 | Bacteria | 5370 |
| 971 | Ga0495602_0067819 | 3300048088 | Bacteria | 3067 |
| 972 | Ga0495602_0248159 | 3300048088 | Unclassified | 1328 |
| 973 | Ga0495614_0003389 | 3300048089 | Bacteria | 7132 |
| 974 | Ga0495614_0012332 | 3300048089 | Bacteria | 3751 |
| 975 | Ga0496101_0147738 | 3300048904 | Bacteria | 1796 |
| 976 | Ga0496102_0003711 | 3300048905 | Bacteria | 12909 |
| 977 | Ga0496102_0004321 | 3300048905 | Bacteria | 12017 |
| 978 | Ga0496102_0083902 | 3300048905 | Bacteria | 2940 |
| 979 | Ga0496103_0031296 | 3300048906 | Bacteria | 3241 |
| 980 | Ga0496104_0005306 | 3300048907 | Bacteria | 11277 |
| 981 | Ga0496104_0015296 | 3300048907 | Bacteria | 6947 |
| 982 | Ga0496104_0122509 | 3300048907 | Bacteria | 2496 |
| 983 | Ga0496104_0236110 | 3300048907 | Bacteria | 1740 |
| 984 | Ga0496104_0236302 | 3300048907 | Bacteria | 1739 |
| 985 | Ga0496105_0003138 | 3300048908 | Bacteria | 12167 |
| 986 | Ga0496106_0016253 | 3300048909 | Bacteria | 5506 |
| 987 | Ga0496107_0127085 | 3300048910 | Bacteria | 1881 |
| 988 | Ga0496107_0328829 | 3300048910 | Bacteria | 1137 |
| 989 | Ga0496109_0251165 | 3300048912 | Bacteria | 1665 |
| 990 | Ga0496109_0268099 | 3300048912 | Bacteria | 1609 |
| 991 | Ga0496110_0003657 | 3300048913 | Bacteria | 11830 |
| 992 | Ga0496110_0405221 | 3300048913 | Bacteria | 1243 |
| 993 | Ga0496111_0263126 | 3300048914 | Bacteria | 1280 |
| 994 | Ga0496112_0001428 | 3300048915 | Bacteria | 18307 |
| 995 | Ga0496112_0040443 | 3300048915 | Bacteria | 4558 |
| 996 | Ga0496112_0049692 | 3300048915 | Bacteria | 4110 |
| 997 | Ga0496112_0145292 | 3300048915 | Bacteria | 2340 |
| 998 | Ga0496112_0172508 | 3300048915 | Bacteria | 2128 |
| 999 | Ga0496112_0174301 | 3300048915 | Bacteria | 2116 |
| 1000 | Ga0496112_0188100 | 3300048915 | Bacteria | 2028 |
| 1001 | Ga0496112_0401129 | 3300048915 | Unclassified | 1311 |
| 1002 | Ga0496112_0469516 | 3300048915 | Bacteria | 1195 |
| 1003 | Ga0496113_0048323 | 3300048916 | Bacteria | 3165 |
| 1004 | Ga0496115_0010377 | 3300048918 | Bacteria | 6959 |
| 1005 | Ga0496115_0020040 | 3300048918 | Bacteria | 5153 |
| 1006 | Ga0496115_0076522 | 3300048918 | Bacteria | 2720 |
| 1007 | Ga0496115_0153907 | 3300048918 | Bacteria | 1899 |
| 1008 | Ga0496117_0106576 | 3300048920 | Bacteria | 1758 |
| 1009 | Ga0496121_0006704 | 3300048924 | Bacteria | 14148 |
| 1010 | Ga0496125_0069121 | 3300048928 | Bacteria | 2773 |
| 1011 | Ga0496126_0000091 | 3300048929 | Bacteria | 209427 |
| 1012 | Ga0496126_0000767 | 3300048929 | Bacteria | 58096 |
| 1013 | Ga0495682_0018391 | 3300049460 | Bacteria | 2632 |
| 1014 | Ga0501032_0000027 | 3300049569 | Bacteria | 136304 |
| 1015 | Ga0501032_0001332 | 3300049569 | Bacteria | 19702 |
| 1016 | Ga0501032_0005178 | 3300049569 | Bacteria | 9717 |
| 1017 | Ga0501033_0000002 | 3300049570 | Bacteria | 668574 |
| 1018 | Ga0501033_0003561 | 3300049570 | Bacteria | 12735 |
| 1019 | Ga0501033_0025247 | 3300049570 | Bacteria | 4476 |
| 1020 | Ga0501034_0001001 | 3300049571 | Bacteria | 40495 |
| 1021 | Ga0501036_0063880 | 3300049572 | Bacteria | 3117 |
| 1022 | Ga0501036_0143417 | 3300049572 | Bacteria | 2015 |
| 1023 | Ga0501037_0019522 | 3300049573 | Bacteria | 5000 |
| 1024 | Ga0501038_0001520 | 3300049574 | Bacteria | 21371 |
| 1025 | Ga0501038_0352441 | 3300049574 | Bacteria | 1146 |
| 1026 | Ga0501040_0243783 | 3300049576 | Bacteria | 1282 |
| 1027 | Ga0501043_0041393 | 3300049579 | Bacteria | 3620 |
| 1028 | Ga0501046_0000265 | 3300049580 | Bacteria | 53355 |
| 1029 | Ga0501046_0003292 | 3300049580 | Bacteria | 14841 |
| 1030 | Ga0501047_0000409 | 3300049581 | Bacteria | 48120 |
| 1031 | Ga0501047_0005823 | 3300049581 | Bacteria | 11601 |
| 1032 | Ga0501047_0099360 | 3300049581 | Bacteria | 2789 |
| 1033 | Ga0501047_0224983 | 3300049581 | Bacteria | 1731 |
| 1034 | Ga0501047_0365730 | 3300049581 | Bacteria | 1278 |
| 1035 | Ga0501070_0231494 | 3300049586 | Bacteria | 1514 |
| 1036 | Ga0501072_0226195 | 3300049588 | Bacteria | 1491 |
| 1037 | Ga0501073_0063218 | 3300049589 | Bacteria | 2582 |
| 1038 | Ga0501073_0190096 | 3300049589 | Bacteria | 1421 |
| 1039 | Ga0501076_0136603 | 3300049592 | Bacteria | 1991 |
| 1040 | Ga0501076_0209646 | 3300049592 | Bacteria | 1592 |
| 1041 | Ga0501077_0135674 | 3300049593 | Bacteria | 1561 |
| 1042 | Ga0501080_0007661 | 3300049742 | Bacteria | 9764 |
| 1043 | Ga0501080_0027972 | 3300049742 | Bacteria | 5243 |
| 1044 | Ga0501080_0357412 | 3300049742 | Bacteria | 1318 |
| 1045 | Ga0501083_0000836 | 3300049744 | Bacteria | 20240 |
| 1046 | Ga0501083_0038931 | 3300049744 | Bacteria | 3230 |
| 1047 | Ga0501035_0000475 | 3300049822 | Bacteria | 45010 |
| 1048 | Ga0501044_0000080 | 3300049823 | Bacteria | 116837 |
| 1049 | Ga0501044_0000704 | 3300049823 | Bacteria | 40368 |
| 1050 | Ga0501044_0001313 | 3300049823 | Bacteria | 29303 |
| 1051 | Ga0501044_0014025 | 3300049823 | Bacteria | 8652 |
| 1052 | Ga0501044_0022872 | 3300049823 | Bacteria | 6656 |
| 1053 | nmdc:mga03683_54875_c1 | 3300050489 | Bacteria | 1672 |
| 1054 | nmdc:mga03n38_7367_c1 | 3300050490 | Bacteria | 3890 |
| 1055 | nmdc:mga00v17_86930_c1 | 3300050491 | Bacteria | 1960 |
| 1056 | nmdc:mga0k408_458_c1 | 3300050493 | Bacteria | 22385 |
| 1057 | nmdc:mga04h51_4737_c1 | 3300050495 | Bacteria | 3411 |
| 1058 | nmdc:mga05p37_113708_c1 | 3300050507 | Bacteria | 3328 |
| 1059 | nmdc:mga05p37_409_c1 | 3300050507 | Bacteria | 46305 |
| 1060 | nmdc:mga05p37_65263_c1 | 3300050507 | Bacteria | 4479 |
| 1061 | nmdc:mga0qj67_45305_c1 | 3300050509 | Bacteria | 3471 |
| 1062 | nmdc:mga06r32_101896_c1 | 3300050510 | Bacteria | 2818 |
| 1063 | nmdc:mga06r32_144539_c1 | 3300050510 | Bacteria | 2356 |
| 1064 | nmdc:mga08y16_442816_c1 | 3300050511 | Bacteria | 1326 |
| 1065 | nmdc:mga08y16_49831_c1 | 3300050511 | Bacteria | 4382 |
| 1066 | nmdc:mga08y16_66040_c1 | 3300050511 | Unclassified | 3776 |
| 1067 | nmdc:mga08y16_7180_c1 | 3300050511 | Bacteria | 11689 |
| 1068 | nmdc:mga08y16_8626_c1 | 3300050511 | Bacteria | 10689 |
| 1069 | nmdc:mga0n895_3428_c1 | 3300050512 | Bacteria | 12792 |
| 1070 | nmdc:mga0n895_43753_c1 | 3300050512 | Bacteria | 4364 |
| 1071 | nmdc:mga0n895_9628_c1 | 3300050512 | Bacteria | 8466 |
| 1072 | nmdc:mga0rr50_7752_c1 | 3300050513 | Bacteria | 6653 |
| 1073 | nmdc:mga08x19_118171_c1 | 3300050514 | Bacteria | 1774 |
| 1074 | nmdc:mga08x19_34938_c1 | 3300050514 | Bacteria | 3179 |
| 1075 | nmdc:mga08x19_51588_c1 | 3300050514 | Bacteria | 2643 |
| 1076 | nmdc:mga0a205_257287_c1 | 3300050515 | Bacteria | 1624 |
| 1077 | Ga0495595_0072037 | 3300053084 | Bacteria | 1635 |
| 1078 | Ga0500651_0000002 | 3300053093 | Bacteria | 476609 |
| 1079 | Ga0500641_0008050 | 3300053096 | Bacteria | 3758 |
| 1080 | Ga0500595_000036 | 3300053119 | Bacteria | 103200 |
| 1081 | Ga0500595_019644 | 3300053119 | Bacteria | 2448 |
| 1082 | Ga0500568_0002084 | 3300053139 | Bacteria | 12122 |
| 1083 | Ga0500616_0000924 | 3300053153 | Bacteria | 32088 |
| 1084 | Ga0500645_000688 | 3300053730 | Bacteria | 21110 |
| 1085 | Ga0501084_0083699 | 3300054114 | Bacteria | 2678 |
| 1086 | Ga0590071_026596 | 3300059421 | Bacteria | 1373 |
| 1087 | Ga0501082_0035853 | 3300060353 | Bacteria | 4275 |
| 1088 | Ga0530510_0181935 | 3300061734 | Bacteria | 1559 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025915 | Ga0207693_10161948 | Ga0207693_101619482 | 331 |
| 2 | 3300046809 | Ga0495600_0201755 | Ga0495600_0201755_208_1266 | 347 |
| 3 | 3300003320 | rootH2_10268766 | rootH2_102687662 | 349 |
| 4 | 3300025945 | Ga0207679_10297206 | Ga0207679_102972061 | 349 |
| 5 | 3300044719 | Ga0466971_0125743 | Ga0466971_0125743_16_1095 | 351 |
| 6 | 3300005329 | Ga0070683_100068110 | Ga0070683_1000681102 | 352 |
| 7 | 3300005338 | Ga0068868_100075271 | Ga0068868_1000752713 | 352 |
| 8 | 3300005435 | Ga0070714_100000027 | Ga0070714_10000002715 | 352 |
| 9 | 3300005436 | Ga0070713_100079033 | Ga0070713_1000790332 | 352 |
| 10 | 3300005458 | Ga0070681_10000149 | Ga0070681_1000014911 | 352 |
| 11 | 3300005563 | Ga0068855_100000234 | Ga0068855_10000023441 | 352 |
| 12 | 3300005614 | Ga0068856_100000062 | Ga0068856_10000006229 | 352 |
| 13 | 3300006237 | Ga0097621_100000148 | Ga0097621_10000014817 | 352 |
| 14 | 3300006358 | Ga0068871_100000465 | Ga0068871_1000004654 | 352 |
| 15 | 3300025912 | Ga0207707_10014404 | Ga0207707_100144044 | 352 |
| 16 | 3300025913 | Ga0207695_10012755 | Ga0207695_100127556 | 352 |
| 17 | 3300025916 | Ga0207663_10243547 | Ga0207663_102435472 | 352 |
| 18 | 3300025921 | Ga0207652_10023765 | Ga0207652_100237652 | 352 |
| 19 | 3300025944 | Ga0207661_10048778 | Ga0207661_100487782 | 352 |
| 20 | 3300026078 | Ga0207702_10006562 | Ga0207702_100065626 | 352 |
| 21 | 3300026142 | Ga0207698_10019954 | Ga0207698_100199543 | 352 |
| 22 | 3300042131 | Ga0450894_012304 | Ga0450894_012304_26_1084 | 352 |
| 23 | 3300046663 | Ga0495635_0055728 | Ga0495635_0055728_17_1075 | 352 |
| 24 | 3300048910 | Ga0496107_0328829 | Ga0496107_0328829_58_1116 | 352 |
| 25 | 3300048915 | Ga0496112_0172508 | Ga0496112_0172508_1040_2101 | 352 |
| 26 | 3300025942 | Ga0207689_10095661 | Ga0207689_100956614 | 355 |
| 27 | 3300046459 | Ga0495629_0055591 | Ga0495629_0055591_24_1112 | 355 |
| 28 | 3300005328 | Ga0070676_10156917 | Ga0070676_101569171 | 357 |
| 29 | 3300005329 | Ga0070683_100009033 | Ga0070683_1000090335 | 357 |
| 30 | 3300009174 | Ga0105241_10018618 | Ga0105241_100186183 | 357 |
| 31 | 3300013102 | Ga0157371_10065256 | Ga0157371_100652562 | 357 |
| 32 | 3300013296 | Ga0157374_10000454 | Ga0157374_100004542 | 357 |
| 33 | 3300013297 | Ga0157378_10000009 | Ga0157378_1000000933 | 357 |
| 34 | 3300013307 | Ga0157372_10000140 | Ga0157372_1000014050 | 357 |
| 35 | 3300035691 | Ga0373931_0036185 | Ga0373931_0036185_1441_2559 | 357 |
| 36 | 3300048915 | Ga0496112_0145292 | Ga0496112_0145292_957_2075 | 357 |
| 37 | 3300005344 | Ga0070661_100108621 | Ga0070661_1001086212 | 360 |
| 38 | 3300005434 | Ga0070709_10052674 | Ga0070709_100526742 | 360 |
| 39 | 3300005435 | Ga0070714_100055781 | Ga0070714_1000557812 | 360 |
| 40 | 3300005435 | Ga0070714_100409118 | Ga0070714_1004091181 | 360 |
| 41 | 3300005436 | Ga0070713_100366177 | Ga0070713_1003661771 | 360 |
| 42 | 3300005437 | Ga0070710_10062584 | Ga0070710_100625842 | 360 |
| 43 | 3300005458 | Ga0070681_10143054 | Ga0070681_101430541 | 360 |
| 44 | 3300005530 | Ga0070679_100009893 | Ga0070679_1000098932 | 360 |
| 45 | 3300005564 | Ga0070664_100139417 | Ga0070664_1001394172 | 360 |
| 46 | 3300005616 | Ga0068852_100199805 | Ga0068852_1001998052 | 360 |
| 47 | 3300005718 | Ga0068866_10031134 | Ga0068866_100311342 | 360 |
| 48 | 3300005843 | Ga0068860_100192207 | Ga0068860_1001922072 | 360 |
| 49 | 3300006175 | Ga0070712_100022744 | Ga0070712_1000227443 | 360 |
| 50 | 3300006852 | Ga0075433_10040006 | Ga0075433_100400062 | 360 |
| 51 | 3300006881 | Ga0068865_100030922 | Ga0068865_1000309222 | 360 |
| 52 | 3300006881 | Ga0068865_100134808 | Ga0068865_1001348081 | 360 |
| 53 | 3300009093 | Ga0105240_10000590 | Ga0105240_1000059032 | 360 |
| 54 | 3300009093 | Ga0105240_10004970 | Ga0105240_100049707 | 360 |
| 55 | 3300009093 | Ga0105240_10007428 | Ga0105240_100074284 | 360 |
| 56 | 3300009093 | Ga0105240_10133724 | Ga0105240_101337242 | 360 |
| 57 | 3300009098 | Ga0105245_10006431 | Ga0105245_100064317 | 360 |
| 58 | 3300009098 | Ga0105245_10225636 | Ga0105245_102256362 | 360 |
| 59 | 3300009174 | Ga0105241_10002378 | Ga0105241_1000237810 | 360 |
| 60 | 3300009174 | Ga0105241_10004219 | Ga0105241_100042199 | 360 |
| 61 | 3300009177 | Ga0105248_10000410 | Ga0105248_100004103 | 360 |
| 62 | 3300009177 | Ga0105248_10001713 | Ga0105248_1000171310 | 360 |
| 63 | 3300009545 | Ga0105237_10001590 | Ga0105237_1000159015 | 360 |
| 64 | 3300009545 | Ga0105237_10207399 | Ga0105237_102073992 | 360 |
| 65 | 3300009551 | Ga0105238_10000491 | Ga0105238_100004919 | 360 |
| 66 | 3300009551 | Ga0105238_10000502 | Ga0105238_1000050211 | 360 |
| 67 | 3300009551 | Ga0105238_10000609 | Ga0105238_100006092 | 360 |
| 68 | 3300010375 | Ga0105239_10001077 | Ga0105239_100010775 | 360 |
| 69 | 3300010375 | Ga0105239_10271508 | Ga0105239_102715082 | 360 |
| 70 | 3300013100 | Ga0157373_10028847 | Ga0157373_100288473 | 360 |
| 71 | 3300013100 | Ga0157373_10050750 | Ga0157373_100507503 | 360 |
| 72 | 3300013102 | Ga0157371_10080205 | Ga0157371_100802052 | 360 |
| 73 | 3300013105 | Ga0157369_10000159 | Ga0157369_1000015945 | 360 |
| 74 | 3300013105 | Ga0157369_10001480 | Ga0157369_100014803 | 360 |
| 75 | 3300013105 | Ga0157369_10036629 | Ga0157369_100366292 | 360 |
| 76 | 3300013105 | Ga0157369_10098054 | Ga0157369_100980542 | 360 |
| 77 | 3300013105 | Ga0157369_10104987 | Ga0157369_101049872 | 360 |
| 78 | 3300013296 | Ga0157374_10000062 | Ga0157374_1000006271 | 360 |
| 79 | 3300013296 | Ga0157374_10034065 | Ga0157374_100340652 | 360 |
| 80 | 3300013297 | Ga0157378_10000345 | Ga0157378_1000034528 | 360 |
| 81 | 3300013297 | Ga0157378_10020738 | Ga0157378_100207382 | 360 |
| 82 | 3300013297 | Ga0157378_10037848 | Ga0157378_100378482 | 360 |
| 83 | 3300013297 | Ga0157378_10041753 | Ga0157378_100417532 | 360 |
| 84 | 3300013297 | Ga0157378_10043095 | Ga0157378_100430952 | 360 |
| 85 | 3300013306 | Ga0163162_10010214 | Ga0163162_100102146 | 360 |
| 86 | 3300013306 | Ga0163162_10550540 | Ga0163162_105505401 | 360 |
| 87 | 3300013307 | Ga0157372_10000845 | Ga0157372_1000084522 | 360 |
| 88 | 3300013307 | Ga0157372_10002792 | Ga0157372_1000279211 | 360 |
| 89 | 3300013307 | Ga0157372_10003387 | Ga0157372_100033874 | 360 |
| 90 | 3300013307 | Ga0157372_10003675 | Ga0157372_100036752 | 360 |
| 91 | 3300013307 | Ga0157372_10005454 | Ga0157372_100054546 | 360 |
| 92 | 3300013307 | Ga0157372_10308555 | Ga0157372_103085551 | 360 |
| 93 | 3300013308 | Ga0157375_10049155 | Ga0157375_100491552 | 360 |
| 94 | 3300014325 | Ga0163163_10083726 | Ga0163163_100837262 | 360 |
| 95 | 3300014968 | Ga0157379_10024598 | Ga0157379_100245982 | 360 |
| 96 | 3300014969 | Ga0157376_10001674 | Ga0157376_100016749 | 360 |
| 97 | 3300025900 | Ga0207710_10034641 | Ga0207710_100346412 | 360 |
| 98 | 3300025911 | Ga0207654_10063649 | Ga0207654_100636492 | 360 |
| 99 | 3300025912 | Ga0207707_10326655 | Ga0207707_103266552 | 360 |
| 100 | 3300025914 | Ga0207671_10046967 | Ga0207671_100469673 | 360 |
| 101 | 3300025914 | Ga0207671_10064106 | Ga0207671_100641062 | 360 |
| 102 | 3300025915 | Ga0207693_10065576 | Ga0207693_100655762 | 360 |
| 103 | 3300025928 | Ga0207700_10077224 | Ga0207700_100772243 | 360 |
| 104 | 3300025934 | Ga0207686_10039392 | Ga0207686_100393922 | 360 |
| 105 | 3300025935 | Ga0207709_10052774 | Ga0207709_100527742 | 360 |
| 106 | 3300025936 | Ga0207670_10208398 | Ga0207670_102083982 | 360 |
| 107 | 3300025939 | Ga0207665_10018379 | Ga0207665_100183794 | 360 |
| 108 | 3300025981 | Ga0207640_10038872 | Ga0207640_100388722 | 360 |
| 109 | 3300026078 | Ga0207702_10025127 | Ga0207702_100251272 | 360 |
| 110 | 3300026078 | Ga0207702_10042361 | Ga0207702_100423612 | 360 |
| 111 | 3300026121 | Ga0207683_10155916 | Ga0207683_101559163 | 360 |
| 112 | 3300026142 | Ga0207698_10151120 | Ga0207698_101511202 | 360 |
| 113 | 3300028380 | Ga0268265_10168244 | Ga0268265_101682442 | 360 |
| 114 | 3300035112 | Ga0373932_0039735 | Ga0373932_0039735_219_1307 | 360 |
| 115 | 3300035691 | Ga0373931_0088349 | Ga0373931_0088349_46_1134 | 360 |
| 116 | 3300036401 | Ga0373937_0025917 | Ga0373937_0025917_667_1785 | 360 |
| 117 | 3300036401 | Ga0373937_0266062 | Ga0373937_0266062_377_1465 | 360 |
| 118 | 3300037068 | Ga0373925_0080788 | Ga0373925_0080788_856_1944 | 360 |
| 119 | 3300037418 | Ga0395900_0095002 | Ga0395900_0095002_499_1587 | 360 |
| 120 | 3300037466 | Ga0395898_0261431 | Ga0395898_0261431_487_1575 | 360 |
| 121 | 3300041512 | Ga0451853_3969147 | Ga0451853_3969147_11_1111 | 360 |
| 122 | 3300044694 | Ga0466963_0005862 | Ga0466963_0005862_2400_3491 | 360 |
| 123 | 3300044706 | Ga0466964_0079416 | Ga0466964_0079416_103_1194 | 360 |
| 124 | 3300044842 | Ga0466957_0057753 | Ga0466957_0057753_20_1111 | 360 |
| 125 | 3300045049 | Ga0466959_0136618 | Ga0466959_0136618_160_1251 | 360 |
| 126 | 3300045836 | Ga0466958_0074458 | Ga0466958_0074458_116_1207 | 360 |
| 127 | 3300046455 | Ga0495603_0111963 | Ga0495603_0111963_352_1440 | 360 |
| 128 | 3300046459 | Ga0495629_0001765 | Ga0495629_0001765_14783_15871 | 360 |
| 129 | 3300046459 | Ga0495629_0014957 | Ga0495629_0014957_2920_4008 | 360 |
| 130 | 3300046471 | Ga0495650_0000186 | Ga0495650_0000186_64273_65361 | 360 |
| 131 | 3300046472 | Ga0495580_0001774 | Ga0495580_0001774_8107_9195 | 360 |
| 132 | 3300046472 | Ga0495580_0006470 | Ga0495580_0006470_2668_3756 | 360 |
| 133 | 3300046472 | Ga0495580_0103043 | Ga0495580_0103043_399_1487 | 360 |
| 134 | 3300046499 | Ga0495594_0000696 | Ga0495594_0000696_8828_9916 | 360 |
| 135 | 3300046506 | Ga0495583_0028942 | Ga0495583_0028942_1343_2431 | 360 |
| 136 | 3300046516 | Ga0495628_0188848 | Ga0495628_0188848_211_1299 | 360 |
| 137 | 3300046529 | Ga0495652_0057880 | Ga0495652_0057880_747_1835 | 360 |
| 138 | 3300046543 | Ga0495645_0011659 | Ga0495645_0011659_170_1258 | 360 |
| 139 | 3300046557 | Ga0495622_0024995 | Ga0495622_0024995_698_1786 | 360 |
| 140 | 3300046616 | Ga0495668_0082572 | Ga0495668_0082572_67_1155 | 360 |
| 141 | 3300046660 | Ga0495625_0000315 | Ga0495625_0000315_41232_42320 | 360 |
| 142 | 3300046679 | Ga0495623_0020095 | Ga0495623_0020095_3188_4276 | 360 |
| 143 | 3300046680 | Ga0495646_0144642 | Ga0495646_0144642_10_1098 | 360 |
| 144 | 3300046683 | Ga0495658_0015852 | Ga0495658_0015852_127_1215 | 360 |
| 145 | 3300046689 | Ga0495613_0004064 | Ga0495613_0004064_4799_5887 | 360 |
| 146 | 3300046809 | Ga0495600_0077268 | Ga0495600_0077268_415_1503 | 360 |
| 147 | 3300046809 | Ga0495600_0084830 | Ga0495600_0084830_876_1964 | 360 |
| 148 | 3300047319 | Ga0495674_0003962 | Ga0495674_0003962_305_1393 | 360 |
| 149 | 3300047444 | Ga0495675_0018679 | Ga0495675_0018679_1593_2714 | 360 |
| 150 | 3300047471 | Ga0495684_0067018 | Ga0495684_0067018_673_1761 | 360 |
| 151 | 3300047472 | Ga0495686_0006455 | Ga0495686_0006455_7181_8269 | 360 |
| 152 | 3300048088 | Ga0495602_0028268 | Ga0495602_0028268_3429_4547 | 360 |
| 153 | 3300048088 | Ga0495602_0248159 | Ga0495602_0248159_19_1140 | 360 |
| 154 | 3300048089 | Ga0495614_0012332 | Ga0495614_0012332_1135_2223 | 360 |
| 155 | 3300048905 | Ga0496102_0083902 | Ga0496102_0083902_1429_2544 | 360 |
| 156 | 3300048907 | Ga0496104_0015296 | Ga0496104_0015296_1071_2159 | 360 |
| 157 | 3300048907 | Ga0496104_0236110 | Ga0496104_0236110_217_1305 | 360 |
| 158 | 3300048907 | Ga0496104_0236302 | Ga0496104_0236302_100_1215 | 360 |
| 159 | 3300048912 | Ga0496109_0268099 | Ga0496109_0268099_252_1367 | 360 |
| 160 | 3300048914 | Ga0496111_0263126 | Ga0496111_0263126_180_1268 | 360 |
| 161 | 3300048915 | Ga0496112_0001428 | Ga0496112_0001428_4023_5111 | 360 |
| 162 | 3300048915 | Ga0496112_0040443 | Ga0496112_0040443_1338_2453 | 360 |
| 163 | 3300048915 | Ga0496112_0174301 | Ga0496112_0174301_775_1890 | 360 |
| 164 | 3300048915 | Ga0496112_0188100 | Ga0496112_0188100_672_1760 | 360 |
| 165 | 3300048918 | Ga0496115_0076522 | Ga0496115_0076522_379_1467 | 360 |
| 166 | 3300048918 | Ga0496115_0153907 | Ga0496115_0153907_776_1864 | 360 |
| 167 | 3300049574 | Ga0501038_0352441 | Ga0501038_0352441_37_1131 | 360 |
| 168 | 3300049589 | Ga0501073_0063218 | Ga0501073_0063218_1294_2382 | 360 |
| 169 | 3300049589 | Ga0501073_0190096 | Ga0501073_0190096_150_1238 | 360 |
| 170 | 3300050514 | nmdc:mga08x19_34938_c1 | nmdc:mga08x19_34938_c1_134_1225 | 360 |
| 171 | 3300053084 | Ga0495595_0072037 | Ga0495595_0072037_483_1571 | 360 |
| 172 | 3300039437 | Ga0436365_0375454 | Ga0436365_0375454_785_1873 | 361 |
| 173 | 3300039437 | Ga0436365_1076298 | Ga0436365_1076298_5894_6982 | 361 |
| 174 | 3300046689 | Ga0495613_0007905 | Ga0495613_0007905_3506_4639 | 361 |
| 175 | 3300047319 | Ga0495674_0325647 | Ga0495674_0325647_105_1193 | 361 |
| 176 | 3300047471 | Ga0495684_0224538 | Ga0495684_0224538_263_1366 | 361 |
| 177 | 3300048915 | Ga0496112_0401129 | Ga0496112_0401129_172_1260 | 361 |
| 178 | 3300049742 | Ga0501080_0357412 | Ga0501080_0357412_83_1171 | 361 |
| 179 | 3300050511 | nmdc:mga08y16_442816_c1 | nmdc:mga08y16_442816_c1_20_1108 | 361 |
| 180 | 3300005347 | Ga0070668_100076790 | Ga0070668_1000767902 | 371 |
| 181 | 3300005614 | Ga0068856_100018229 | Ga0068856_1000182294 | 371 |
| 182 | 3300025919 | Ga0207657_10008891 | Ga0207657_100088917 | 371 |
| 183 | 3300026041 | Ga0207639_10032730 | Ga0207639_100327302 | 371 |
| 184 | 3300048913 | Ga0496110_0003657 | Ga0496110_0003657_7937_9061 | 374 |
| 185 | 3300006871 | Ga0075434_100027321 | Ga0075434_1000273213 | 378 |
| 186 | 3300009093 | Ga0105240_10046652 | Ga0105240_100466525 | 378 |
| 187 | 3300009553 | Ga0105249_10065772 | Ga0105249_100657722 | 378 |
| 188 | 3300013105 | Ga0157369_10153338 | Ga0157369_101533383 | 378 |
| 189 | 3300013307 | Ga0157372_10167813 | Ga0157372_101678132 | 378 |
| 190 | 3300048910 | Ga0496107_0127085 | Ga0496107_0127085_379_1521 | 378 |
| 191 | 3300048912 | Ga0496109_0251165 | Ga0496109_0251165_162_1304 | 378 |
| 192 | 3300048913 | Ga0496110_0405221 | Ga0496110_0405221_28_1170 | 378 |
| 193 | 3300048915 | Ga0496112_0049692 | Ga0496112_0049692_2871_4013 | 378 |
| 194 | 3300050512 | nmdc:mga0n895_43753_c1 | nmdc:mga0n895_43753_c1_1224_2366 | 378 |
| 195 | 3300006173 | Ga0070716_100000711 | Ga0070716_1000007117 | 379 |
| 196 | 3300006175 | Ga0070712_100000038 | Ga0070712_1000000387 | 379 |
| 197 | 3300025906 | Ga0207699_10000549 | Ga0207699_100005494 | 379 |
| 198 | 3300025913 | Ga0207695_10089610 | Ga0207695_100896103 | 379 |
| 199 | 3300025915 | Ga0207693_10000058 | Ga0207693_1000005844 | 379 |
| 200 | 3300025928 | Ga0207700_10003116 | Ga0207700_100031163 | 379 |
| 201 | 3300025939 | Ga0207665_10003619 | Ga0207665_100036197 | 379 |
| 202 | 3300050511 | nmdc:mga08y16_66040_c1 | nmdc:mga08y16_66040_c1_1612_2757 | 379 |
| 203 | 3300050509 | nmdc:mga0qj67_45305_c1 | nmdc:mga0qj67_45305_c1_595_1740 | 380 |
| 204 | 3300005347 | Ga0070668_100023467 | Ga0070668_1000234674 | 383 |
| 205 | 3300005354 | Ga0070675_100062714 | Ga0070675_1000627142 | 383 |
| 206 | 3300005364 | Ga0070673_100104832 | Ga0070673_1001048322 | 383 |
| 207 | 3300005615 | Ga0070702_100080234 | Ga0070702_1000802342 | 383 |
| 208 | 3300005618 | Ga0068864_100321851 | Ga0068864_1003218512 | 383 |
| 209 | 3300005843 | Ga0068860_100131657 | Ga0068860_1001316572 | 383 |
| 210 | 3300006237 | Ga0097621_100113357 | Ga0097621_1001133572 | 383 |
| 211 | 3300013296 | Ga0157374_10011409 | Ga0157374_100114097 | 383 |
| 212 | 3300013297 | Ga0157378_10183479 | Ga0157378_101834792 | 383 |
| 213 | 3300014969 | Ga0157376_10028333 | Ga0157376_100283332 | 383 |
| 214 | 3300025907 | Ga0207645_10061558 | Ga0207645_100615582 | 383 |
| 215 | 3300025914 | Ga0207671_10037550 | Ga0207671_100375501 | 383 |
| 216 | 3300025933 | Ga0207706_10028125 | Ga0207706_100281254 | 383 |
| 217 | 3300025949 | Ga0207667_10255488 | Ga0207667_102554882 | 383 |
| 218 | 3300025972 | Ga0207668_10175087 | Ga0207668_101750872 | 383 |
| 219 | 3300026041 | Ga0207639_10212133 | Ga0207639_102121332 | 383 |
| 220 | 3300026095 | Ga0207676_10153633 | Ga0207676_101536332 | 383 |
| 221 | 3300026121 | Ga0207683_10008453 | Ga0207683_100084535 | 383 |
| 222 | 3300046543 | Ga0495645_0158386 | Ga0495645_0158386_10_1182 | 383 |
| 223 | 3300025908 | Ga0207643_10091232 | Ga0207643_100912321 | 384 |
| 224 | 3300026023 | Ga0207677_10019695 | Ga0207677_100196952 | 384 |
| 225 | iso_pu_bacteria | 2884215851 | 2884216299 | 384 |
| 226 | 3300005334 | Ga0068869_100003330 | Ga0068869_1000033306 | 385 |
| 227 | 3300005338 | Ga0068868_100000995 | Ga0068868_1000009958 | 385 |
| 228 | 3300005458 | Ga0070681_10019874 | Ga0070681_100198744 | 385 |
| 229 | 3300005563 | Ga0068855_100296330 | Ga0068855_1002963302 | 385 |
| 230 | 3300005564 | Ga0070664_100001824 | Ga0070664_1000018249 | 385 |
| 231 | 3300005577 | Ga0068857_100001376 | Ga0068857_10000137611 | 385 |
| 232 | 3300005578 | Ga0068854_100023685 | Ga0068854_1000236854 | 385 |
| 233 | 3300005614 | Ga0068856_100000179 | Ga0068856_10000017917 | 385 |
| 234 | 3300005617 | Ga0068859_100001235 | Ga0068859_1000012356 | 385 |
| 235 | 3300005618 | Ga0068864_100000129 | Ga0068864_10000012953 | 385 |
| 236 | 3300005718 | Ga0068866_10007078 | Ga0068866_100070782 | 385 |
| 237 | 3300005842 | Ga0068858_100006877 | Ga0068858_1000068773 | 385 |
| 238 | 3300005843 | Ga0068860_100031048 | Ga0068860_1000310483 | 385 |
| 239 | 3300006931 | Ga0097620_100001235 | Ga0097620_1000012356 | 385 |
| 240 | 3300025899 | Ga0207642_10004701 | Ga0207642_100047013 | 385 |
| 241 | 3300025904 | Ga0207647_10064903 | Ga0207647_100649032 | 385 |
| 242 | 3300025907 | Ga0207645_10084597 | Ga0207645_100845972 | 385 |
| 243 | 3300025911 | Ga0207654_10033871 | Ga0207654_100338712 | 385 |
| 244 | 3300025912 | Ga0207707_10020215 | Ga0207707_100202154 | 385 |
| 245 | 3300025936 | Ga0207670_10190809 | Ga0207670_101908092 | 385 |
| 246 | 3300025942 | Ga0207689_10021947 | Ga0207689_100219474 | 385 |
| 247 | 3300025944 | Ga0207661_10029779 | Ga0207661_100297793 | 385 |
| 248 | 3300025945 | Ga0207679_10032524 | Ga0207679_100325243 | 385 |
| 249 | 3300025949 | Ga0207667_10255066 | Ga0207667_102550662 | 385 |
| 250 | 3300025981 | Ga0207640_10005099 | Ga0207640_100050992 | 385 |
| 251 | 3300026035 | Ga0207703_10006688 | Ga0207703_100066888 | 385 |
| 252 | 3300026078 | Ga0207702_10011681 | Ga0207702_100116813 | 385 |
| 253 | 3300026116 | Ga0207674_10000763 | Ga0207674_1000076312 | 385 |
| 254 | 3300028381 | Ga0268264_10028635 | Ga0268264_100286353 | 385 |
| 255 | 3300048915 | Ga0496112_0469516 | Ga0496112_0469516_28_1185 | 385 |
| 256 | 3300049571 | Ga0501034_0001001 | Ga0501034_0001001_15346_16518 | 386 |
| 257 | 3300049581 | Ga0501047_0365730 | Ga0501047_0365730_79_1251 | 386 |
| 258 | 3300049742 | Ga0501080_0027972 | Ga0501080_0027972_2638_3810 | 386 |
| 259 | iso_pu_bacteria | 2599185240 | 2599743996 | 386 |
| 260 | iso_pu_bacteria | 2599185355 | 2600206938 | 386 |
| 261 | iso_pu_bacteria | 2643221672 | 2644397335 | 386 |
| 262 | iso_pu_bacteria | 2675903129 | 2676742221 | 386 |
| 263 | iso_pu_bacteria | 2721755523 | 2722882510 | 386 |
| 264 | iso_pu_bacteria | 2751185846 | 2753566833 | 386 |
| 265 | iso_pu_bacteria | 2839138175 | 2839141233 | 386 |
| 266 | iso_pu_bacteria | 2870068957 | 2870074285 | 386 |
| 267 | iso_pu_bacteria | 2883087390 | 2883091151 | 386 |
| 268 | iso_pu_bacteria | 2928157003 | 2928161075 | 386 |
| 269 | iso_pu_bacteria | 2928163908 | 2928165988 | 386 |
| 270 | iso_pu_bacteria | 2945945610 | 2945947379 | 386 |
| 271 | iso_pu_bacteria | 2981990288 | 2981991258 | 386 |
| 272 | iso_pu_bacteria | 641736154 | 642413974 | 386 |
| 273 | iso_pu_bacteria | 8020938398 | 8020943693 | 386 |
| 274 | iso_pu_bacteria | 8020945358 | 8020950130 | 386 |
| 275 | iso_pu_bacteria | 8020953355 | 8020953728 | 386 |
| 276 | 3300006028 | Ga0070717_10129014 | Ga0070717_101290142 | 387 |
| 277 | 3300006051 | Ga0075364_10006031 | Ga0075364_100060312 | 387 |
| 278 | 3300006177 | Ga0075362_10024906 | Ga0075362_100249062 | 387 |
| 279 | 3300007076 | Ga0075435_100034872 | Ga0075435_1000348722 | 387 |
| 280 | 3300009551 | Ga0105238_10121114 | Ga0105238_101211142 | 387 |
| 281 | 3300027907 | Ga0207428_10000595 | Ga0207428_1000059521 | 387 |
| 282 | 3300054114 | Ga0501084_0083699 | Ga0501084_0083699_1349_2518 | 387 |
| 283 | 3300061734 | Ga0530510_0181935 | Ga0530510_0181935_230_1399 | 387 |
| 284 | 3300002155 | JGI24033J26618_1000037 | JGI24033J26618_10000379 | 388 |
| 285 | 3300002244 | JGI24742J22300_10003287 | JGI24742J22300_100032871 | 388 |
| 286 | 3300005289 | Ga0065704_10091282 | Ga0065704_100912822 | 388 |
| 287 | 3300005295 | Ga0065707_10083153 | Ga0065707_100831535 | 388 |
| 288 | 3300005327 | Ga0070658_10003728 | Ga0070658_100037286 | 388 |
| 289 | 3300005327 | Ga0070658_10004063 | Ga0070658_100040634 | 388 |
| 290 | 3300005327 | Ga0070658_10062775 | Ga0070658_100627753 | 388 |
| 291 | 3300005329 | Ga0070683_100011056 | Ga0070683_1000110563 | 388 |
| 292 | 3300005329 | Ga0070683_100021235 | Ga0070683_1000212353 | 388 |
| 293 | 3300005329 | Ga0070683_100069940 | Ga0070683_1000699402 | 388 |
| 294 | 3300005329 | Ga0070683_100080234 | Ga0070683_1000802342 | 388 |
| 295 | 3300005329 | Ga0070683_100134495 | Ga0070683_1001344952 | 388 |
| 296 | 3300005329 | Ga0070683_100418765 | Ga0070683_1004187651 | 388 |
| 297 | 3300005330 | Ga0070690_100019999 | Ga0070690_1000199993 | 388 |
| 298 | 3300005331 | Ga0070670_100061559 | Ga0070670_1000615591 | 388 |
| 299 | 3300005331 | Ga0070670_100115718 | Ga0070670_1001157182 | 388 |
| 300 | 3300005331 | Ga0070670_100336729 | Ga0070670_1003367291 | 388 |
| 301 | 3300005334 | Ga0068869_100009877 | Ga0068869_1000098774 | 388 |
| 302 | 3300005334 | Ga0068869_100180815 | Ga0068869_1001808152 | 388 |
| 303 | 3300005335 | Ga0070666_10085756 | Ga0070666_100857562 | 388 |
| 304 | 3300005336 | Ga0070680_100028433 | Ga0070680_1000284333 | 388 |
| 305 | 3300005336 | Ga0070680_100110941 | Ga0070680_1001109412 | 388 |
| 306 | 3300005336 | Ga0070680_100221134 | Ga0070680_1002211341 | 388 |
| 307 | 3300005336 | Ga0070680_100330784 | Ga0070680_1003307841 | 388 |
| 308 | 3300005337 | Ga0070682_100188796 | Ga0070682_1001887961 | 388 |
| 309 | 3300005338 | Ga0068868_100036285 | Ga0068868_1000362853 | 388 |
| 310 | 3300005339 | Ga0070660_100021389 | Ga0070660_1000213893 | 388 |
| 311 | 3300005339 | Ga0070660_100102532 | Ga0070660_1001025322 | 388 |
| 312 | 3300005339 | Ga0070660_100142442 | Ga0070660_1001424422 | 388 |
| 313 | 3300005339 | Ga0070660_100154512 | Ga0070660_1001545122 | 388 |
| 314 | 3300005344 | Ga0070661_100000291 | Ga0070661_10000029130 | 388 |
| 315 | 3300005344 | Ga0070661_100005720 | Ga0070661_1000057203 | 388 |
| 316 | 3300005344 | Ga0070661_100006096 | Ga0070661_1000060962 | 388 |
| 317 | 3300005344 | Ga0070661_100041201 | Ga0070661_1000412012 | 388 |
| 318 | 3300005344 | Ga0070661_100053750 | Ga0070661_1000537503 | 388 |
| 319 | 3300005347 | Ga0070668_100166764 | Ga0070668_1001667642 | 388 |
| 320 | 3300005353 | Ga0070669_100041171 | Ga0070669_1000411712 | 388 |
| 321 | 3300005354 | Ga0070675_100004246 | Ga0070675_1000042464 | 388 |
| 322 | 3300005365 | Ga0070688_100021582 | Ga0070688_1000215822 | 388 |
| 323 | 3300005366 | Ga0070659_100017358 | Ga0070659_1000173582 | 388 |
| 324 | 3300005367 | Ga0070667_100104852 | Ga0070667_1001048523 | 388 |
| 325 | 3300005367 | Ga0070667_100169212 | Ga0070667_1001692122 | 388 |
| 326 | 3300005367 | Ga0070667_100243182 | Ga0070667_1002431821 | 388 |
| 327 | 3300005434 | Ga0070709_10000744 | Ga0070709_100007444 | 388 |
| 328 | 3300005434 | Ga0070709_10156950 | Ga0070709_101569502 | 388 |
| 329 | 3300005435 | Ga0070714_100008972 | Ga0070714_1000089723 | 388 |
| 330 | 3300005436 | Ga0070713_100000070 | Ga0070713_10000007032 | 388 |
| 331 | 3300005436 | Ga0070713_100001120 | Ga0070713_1000011207 | 388 |
| 332 | 3300005436 | Ga0070713_100005813 | Ga0070713_1000058135 | 388 |
| 333 | 3300005436 | Ga0070713_100006427 | Ga0070713_1000064272 | 388 |
| 334 | 3300005437 | Ga0070710_10054630 | Ga0070710_100546301 | 388 |
| 335 | 3300005437 | Ga0070710_10109345 | Ga0070710_101093452 | 388 |
| 336 | 3300005439 | Ga0070711_100000078 | Ga0070711_10000007830 | 388 |
| 337 | 3300005439 | Ga0070711_100001722 | Ga0070711_1000017227 | 388 |
| 338 | 3300005444 | Ga0070694_100220469 | Ga0070694_1002204691 | 388 |
| 339 | 3300005445 | Ga0070708_100047456 | Ga0070708_1000474563 | 388 |
| 340 | 3300005456 | Ga0070678_100311823 | Ga0070678_1003118232 | 388 |
| 341 | 3300005458 | Ga0070681_10009094 | Ga0070681_100090948 | 388 |
| 342 | 3300005458 | Ga0070681_10036358 | Ga0070681_100363583 | 388 |
| 343 | 3300005458 | Ga0070681_10117020 | Ga0070681_101170202 | 388 |
| 344 | 3300005458 | Ga0070681_10137801 | Ga0070681_101378012 | 388 |
| 345 | 3300005458 | Ga0070681_10140657 | Ga0070681_101406572 | 388 |
| 346 | 3300005458 | Ga0070681_10162661 | Ga0070681_101626612 | 388 |
| 347 | 3300005458 | Ga0070681_10172737 | Ga0070681_101727372 | 388 |
| 348 | 3300005458 | Ga0070681_10205948 | Ga0070681_102059482 | 388 |
| 349 | 3300005459 | Ga0068867_100075404 | Ga0068867_1000754042 | 388 |
| 350 | 3300005459 | Ga0068867_100087773 | Ga0068867_1000877732 | 388 |
| 351 | 3300005467 | Ga0070706_100001937 | Ga0070706_1000019379 | 388 |
| 352 | 3300005468 | Ga0070707_100336917 | Ga0070707_1003369172 | 388 |
| 353 | 3300005471 | Ga0070698_100382453 | Ga0070698_1003824531 | 388 |
| 354 | 3300005530 | Ga0070679_100010417 | Ga0070679_1000104175 | 388 |
| 355 | 3300005530 | Ga0070679_100015002 | Ga0070679_1000150023 | 388 |
| 356 | 3300005530 | Ga0070679_100015901 | Ga0070679_1000159014 | 388 |
| 357 | 3300005530 | Ga0070679_100063691 | Ga0070679_1000636913 | 388 |
| 358 | 3300005530 | Ga0070679_100093020 | Ga0070679_1000930202 | 388 |
| 359 | 3300005530 | Ga0070679_100119700 | Ga0070679_1001197003 | 388 |
| 360 | 3300005530 | Ga0070679_100164794 | Ga0070679_1001647942 | 388 |
| 361 | 3300005535 | Ga0070684_100001586 | Ga0070684_1000015867 | 388 |
| 362 | 3300005535 | Ga0070684_100004240 | Ga0070684_1000042402 | 388 |
| 363 | 3300005535 | Ga0070684_100038630 | Ga0070684_1000386302 | 388 |
| 364 | 3300005536 | Ga0070697_100000588 | Ga0070697_10000058813 | 388 |
| 365 | 3300005539 | Ga0068853_100000178 | Ga0068853_10000017814 | 388 |
| 366 | 3300005539 | Ga0068853_100031767 | Ga0068853_1000317672 | 388 |
| 367 | 3300005539 | Ga0068853_100062523 | Ga0068853_1000625233 | 388 |
| 368 | 3300005539 | Ga0068853_100297086 | Ga0068853_1002970862 | 388 |
| 369 | 3300005543 | Ga0070672_100007077 | Ga0070672_1000070773 | 388 |
| 370 | 3300005544 | Ga0070686_100152998 | Ga0070686_1001529982 | 388 |
| 371 | 3300005546 | Ga0070696_100134424 | Ga0070696_1001344242 | 388 |
| 372 | 3300005547 | Ga0070693_100040243 | Ga0070693_1000402432 | 388 |
| 373 | 3300005548 | Ga0070665_100030207 | Ga0070665_1000302073 | 388 |
| 374 | 3300005563 | Ga0068855_100000872 | Ga0068855_10000087228 | 388 |
| 375 | 3300005563 | Ga0068855_100006297 | Ga0068855_1000062978 | 388 |
| 376 | 3300005563 | Ga0068855_100020482 | Ga0068855_1000204825 | 388 |
| 377 | 3300005563 | Ga0068855_100020735 | Ga0068855_1000207353 | 388 |
| 378 | 3300005563 | Ga0068855_100039858 | Ga0068855_1000398583 | 388 |
| 379 | 3300005563 | Ga0068855_100071120 | Ga0068855_1000711203 | 388 |
| 380 | 3300005563 | Ga0068855_100097729 | Ga0068855_1000977293 | 388 |
| 381 | 3300005563 | Ga0068855_100121391 | Ga0068855_1001213912 | 388 |
| 382 | 3300005563 | Ga0068855_100159453 | Ga0068855_1001594532 | 388 |
| 383 | 3300005563 | Ga0068855_100251807 | Ga0068855_1002518072 | 388 |
| 384 | 3300005564 | Ga0070664_100115801 | Ga0070664_1001158012 | 388 |
| 385 | 3300005564 | Ga0070664_100250394 | Ga0070664_1002503942 | 388 |
| 386 | 3300005577 | Ga0068857_100030923 | Ga0068857_1000309233 | 388 |
| 387 | 3300005577 | Ga0068857_100094433 | Ga0068857_1000944332 | 388 |
| 388 | 3300005578 | Ga0068854_100002575 | Ga0068854_1000025757 | 388 |
| 389 | 3300005578 | Ga0068854_100008531 | Ga0068854_1000085312 | 388 |
| 390 | 3300005578 | Ga0068854_100016429 | Ga0068854_1000164293 | 388 |
| 391 | 3300005578 | Ga0068854_100101617 | Ga0068854_1001016172 | 388 |
| 392 | 3300005578 | Ga0068854_100109769 | Ga0068854_1001097692 | 388 |
| 393 | 3300005614 | Ga0068856_100000347 | Ga0068856_1000003476 | 388 |
| 394 | 3300005614 | Ga0068856_100000854 | Ga0068856_10000085415 | 388 |
| 395 | 3300005614 | Ga0068856_100001690 | Ga0068856_1000016904 | 388 |
| 396 | 3300005614 | Ga0068856_100015481 | Ga0068856_1000154816 | 388 |
| 397 | 3300005614 | Ga0068856_100019973 | Ga0068856_1000199733 | 388 |
| 398 | 3300005614 | Ga0068856_100052769 | Ga0068856_1000527692 | 388 |
| 399 | 3300005614 | Ga0068856_100119927 | Ga0068856_1001199272 | 388 |
| 400 | 3300005616 | Ga0068852_100000015 | Ga0068852_10000001550 | 388 |
| 401 | 3300005616 | Ga0068852_100000278 | Ga0068852_10000027819 | 388 |
| 402 | 3300005616 | Ga0068852_100006834 | Ga0068852_1000068344 | 388 |
| 403 | 3300005616 | Ga0068852_100080543 | Ga0068852_1000805433 | 388 |
| 404 | 3300005616 | Ga0068852_100166280 | Ga0068852_1001662802 | 388 |
| 405 | 3300005617 | Ga0068859_100005339 | Ga0068859_1000053399 | 388 |
| 406 | 3300005617 | Ga0068859_100032598 | Ga0068859_1000325982 | 388 |
| 407 | 3300005617 | Ga0068859_100050144 | Ga0068859_1000501443 | 388 |
| 408 | 3300005617 | Ga0068859_100285614 | Ga0068859_1002856142 | 388 |
| 409 | 3300005618 | Ga0068864_100014292 | Ga0068864_1000142925 | 388 |
| 410 | 3300005618 | Ga0068864_100028348 | Ga0068864_1000283482 | 388 |
| 411 | 3300005718 | Ga0068866_10006317 | Ga0068866_100063172 | 388 |
| 412 | 3300005719 | Ga0068861_100016641 | Ga0068861_1000166414 | 388 |
| 413 | 3300005719 | Ga0068861_100061316 | Ga0068861_1000613162 | 388 |
| 414 | 3300005841 | Ga0068863_100000941 | Ga0068863_1000009413 | 388 |
| 415 | 3300005841 | Ga0068863_100017867 | Ga0068863_1000178673 | 388 |
| 416 | 3300005841 | Ga0068863_100044093 | Ga0068863_1000440932 | 388 |
| 417 | 3300005841 | Ga0068863_100048934 | Ga0068863_1000489342 | 388 |
| 418 | 3300005842 | Ga0068858_100002951 | Ga0068858_10000295112 | 388 |
| 419 | 3300005842 | Ga0068858_100017770 | Ga0068858_1000177702 | 388 |
| 420 | 3300005842 | Ga0068858_100021020 | Ga0068858_1000210202 | 388 |
| 421 | 3300005843 | Ga0068860_100008454 | Ga0068860_1000084543 | 388 |
| 422 | 3300005844 | Ga0068862_100029668 | Ga0068862_1000296684 | 388 |
| 423 | 3300005844 | Ga0068862_100033743 | Ga0068862_1000337432 | 388 |
| 424 | 3300005844 | Ga0068862_100078281 | Ga0068862_1000782812 | 388 |
| 425 | 3300005844 | Ga0068862_100110110 | Ga0068862_1001101102 | 388 |
| 426 | 3300006028 | Ga0070717_10000016 | Ga0070717_1000001673 | 388 |
| 427 | 3300006028 | Ga0070717_10001262 | Ga0070717_100012624 | 388 |
| 428 | 3300006028 | Ga0070717_10008871 | Ga0070717_100088714 | 388 |
| 429 | 3300006028 | Ga0070717_10054607 | Ga0070717_100546073 | 388 |
| 430 | 3300006028 | Ga0070717_10069188 | Ga0070717_100691882 | 388 |
| 431 | 3300006028 | Ga0070717_10346191 | Ga0070717_103461911 | 388 |
| 432 | 3300006038 | Ga0075365_10180341 | Ga0075365_101803411 | 388 |
| 433 | 3300006163 | Ga0070715_10013806 | Ga0070715_100138063 | 388 |
| 434 | 3300006173 | Ga0070716_100007470 | Ga0070716_1000074704 | 388 |
| 435 | 3300006173 | Ga0070716_100008365 | Ga0070716_1000083652 | 388 |
| 436 | 3300006175 | Ga0070712_100000288 | Ga0070712_10000028817 | 388 |
| 437 | 3300006175 | Ga0070712_100000292 | Ga0070712_1000002924 | 388 |
| 438 | 3300006175 | Ga0070712_100015439 | Ga0070712_1000154393 | 388 |
| 439 | 3300006175 | Ga0070712_100070931 | Ga0070712_1000709312 | 388 |
| 440 | 3300006195 | Ga0075366_10022264 | Ga0075366_100222642 | 388 |
| 441 | 3300006195 | Ga0075366_10043177 | Ga0075366_100431772 | 388 |
| 442 | 3300006195 | Ga0075366_10122958 | Ga0075366_101229582 | 388 |
| 443 | 3300006237 | Ga0097621_100000709 | Ga0097621_10000070914 | 388 |
| 444 | 3300006237 | Ga0097621_100007133 | Ga0097621_1000071332 | 388 |
| 445 | 3300006237 | Ga0097621_100031210 | Ga0097621_1000312103 | 388 |
| 446 | 3300006237 | Ga0097621_100218106 | Ga0097621_1002181062 | 388 |
| 447 | 3300006358 | Ga0068871_100000049 | Ga0068871_10000004951 | 388 |
| 448 | 3300006358 | Ga0068871_100000439 | Ga0068871_10000043921 | 388 |
| 449 | 3300006847 | Ga0075431_100002684 | Ga0075431_10000268411 | 388 |
| 450 | 3300006852 | Ga0075433_10342043 | Ga0075433_103420432 | 388 |
| 451 | 3300006871 | Ga0075434_100000344 | Ga0075434_1000003441 | 388 |
| 452 | 3300006871 | Ga0075434_100004219 | Ga0075434_1000042197 | 388 |
| 453 | 3300006871 | Ga0075434_100034351 | Ga0075434_1000343513 | 388 |
| 454 | 3300006881 | Ga0068865_100016734 | Ga0068865_1000167344 | 388 |
| 455 | 3300006914 | Ga0075436_100040655 | Ga0075436_1000406552 | 388 |
| 456 | 3300006931 | Ga0097620_100005338 | Ga0097620_1000053389 | 388 |
| 457 | 3300006931 | Ga0097620_100032598 | Ga0097620_1000325983 | 388 |
| 458 | 3300006931 | Ga0097620_100050143 | Ga0097620_1000501433 | 388 |
| 459 | 3300006931 | Ga0097620_100285612 | Ga0097620_1002856122 | 388 |
| 460 | 3300007076 | Ga0075435_100007470 | Ga0075435_1000074701 | 388 |
| 461 | 3300009093 | Ga0105240_10000001 | Ga0105240_1000000169 | 388 |
| 462 | 3300009093 | Ga0105240_10000181 | Ga0105240_1000018141 | 388 |
| 463 | 3300009093 | Ga0105240_10000823 | Ga0105240_1000082314 | 388 |
| 464 | 3300009093 | Ga0105240_10008321 | Ga0105240_1000832110 | 388 |
| 465 | 3300009093 | Ga0105240_10076065 | Ga0105240_100760653 | 388 |
| 466 | 3300009093 | Ga0105240_10091111 | Ga0105240_100911113 | 388 |
| 467 | 3300009093 | Ga0105240_10205617 | Ga0105240_102056172 | 388 |
| 468 | 3300009093 | Ga0105240_10287979 | Ga0105240_102879792 | 388 |
| 469 | 3300009094 | Ga0111539_10001354 | Ga0111539_1000135416 | 388 |
| 470 | 3300009094 | Ga0111539_10005577 | Ga0111539_1000557713 | 388 |
| 471 | 3300009098 | Ga0105245_10003276 | Ga0105245_100032769 | 388 |
| 472 | 3300009098 | Ga0105245_10110320 | Ga0105245_101103202 | 388 |
| 473 | 3300009098 | Ga0105245_10208777 | Ga0105245_102087771 | 388 |
| 474 | 3300009101 | Ga0105247_10012672 | Ga0105247_100126723 | 388 |
| 475 | 3300009101 | Ga0105247_10042813 | Ga0105247_100428132 | 388 |
| 476 | 3300009101 | Ga0105247_10157268 | Ga0105247_101572682 | 388 |
| 477 | 3300009147 | Ga0114129_10029439 | Ga0114129_100294392 | 388 |
| 478 | 3300009147 | Ga0114129_10120618 | Ga0114129_101206183 | 388 |
| 479 | 3300009148 | Ga0105243_10004290 | Ga0105243_100042904 | 388 |
| 480 | 3300009174 | Ga0105241_10000074 | Ga0105241_1000007451 | 388 |
| 481 | 3300009174 | Ga0105241_10012484 | Ga0105241_100124846 | 388 |
| 482 | 3300009174 | Ga0105241_10040692 | Ga0105241_100406922 | 388 |
| 483 | 3300009174 | Ga0105241_10093290 | Ga0105241_100932902 | 388 |
| 484 | 3300009174 | Ga0105241_10106644 | Ga0105241_101066442 | 388 |
| 485 | 3300009176 | Ga0105242_10008739 | Ga0105242_100087393 | 388 |
| 486 | 3300009176 | Ga0105242_10017961 | Ga0105242_100179612 | 388 |
| 487 | 3300009177 | Ga0105248_10001285 | Ga0105248_100012859 | 388 |
| 488 | 3300009177 | Ga0105248_10020175 | Ga0105248_100201752 | 388 |
| 489 | 3300009545 | Ga0105237_10051350 | Ga0105237_100513504 | 388 |
| 490 | 3300009545 | Ga0105237_10108211 | Ga0105237_101082112 | 388 |
| 491 | 3300009551 | Ga0105238_10002379 | Ga0105238_100023792 | 388 |
| 492 | 3300009551 | Ga0105238_10003639 | Ga0105238_100036393 | 388 |
| 493 | 3300009551 | Ga0105238_10022506 | Ga0105238_100225062 | 388 |
| 494 | 3300009551 | Ga0105238_10026649 | Ga0105238_100266496 | 388 |
| 495 | 3300009551 | Ga0105238_10029170 | Ga0105238_100291703 | 388 |
| 496 | 3300009551 | Ga0105238_10038354 | Ga0105238_100383543 | 388 |
| 497 | 3300009551 | Ga0105238_10042995 | Ga0105238_100429954 | 388 |
| 498 | 3300009551 | Ga0105238_10259554 | Ga0105238_102595542 | 388 |
| 499 | 3300009553 | Ga0105249_10041183 | Ga0105249_100411831 | 388 |
| 500 | 3300010375 | Ga0105239_10012674 | Ga0105239_100126747 | 388 |
| 501 | 3300010375 | Ga0105239_10186670 | Ga0105239_101866702 | 388 |
| 502 | 3300013102 | Ga0157371_10148429 | Ga0157371_101484291 | 388 |
| 503 | 3300013104 | Ga0157370_10000007 | Ga0157370_100000075 | 388 |
| 504 | 3300013104 | Ga0157370_10076055 | Ga0157370_100760552 | 388 |
| 505 | 3300013104 | Ga0157370_10077180 | Ga0157370_100771802 | 388 |
| 506 | 3300013105 | Ga0157369_10000131 | Ga0157369_1000013135 | 388 |
| 507 | 3300013105 | Ga0157369_10000241 | Ga0157369_1000024147 | 388 |
| 508 | 3300013105 | Ga0157369_10004149 | Ga0157369_100041496 | 388 |
| 509 | 3300013105 | Ga0157369_10014148 | Ga0157369_100141487 | 388 |
| 510 | 3300013105 | Ga0157369_10018397 | Ga0157369_100183976 | 388 |
| 511 | 3300013105 | Ga0157369_10066048 | Ga0157369_100660482 | 388 |
| 512 | 3300013105 | Ga0157369_10108431 | Ga0157369_101084312 | 388 |
| 513 | 3300013105 | Ga0157369_10151829 | Ga0157369_101518292 | 388 |
| 514 | 3300013105 | Ga0157369_10236396 | Ga0157369_102363962 | 388 |
| 515 | 3300013105 | Ga0157369_10286091 | Ga0157369_102860912 | 388 |
| 516 | 3300013105 | Ga0157369_10298287 | Ga0157369_102982871 | 388 |
| 517 | 3300013105 | Ga0157369_10445242 | Ga0157369_104452422 | 388 |
| 518 | 3300013296 | Ga0157374_10002950 | Ga0157374_1000295013 | 388 |
| 519 | 3300013296 | Ga0157374_10030262 | Ga0157374_100302624 | 388 |
| 520 | 3300013296 | Ga0157374_10030866 | Ga0157374_100308664 | 388 |
| 521 | 3300013296 | Ga0157374_10150845 | Ga0157374_101508452 | 388 |
| 522 | 3300013296 | Ga0157374_10260396 | Ga0157374_102603962 | 388 |
| 523 | 3300013297 | Ga0157378_10000132 | Ga0157378_1000013219 | 388 |
| 524 | 3300013297 | Ga0157378_10000423 | Ga0157378_1000042314 | 388 |
| 525 | 3300013297 | Ga0157378_10072675 | Ga0157378_100726753 | 388 |
| 526 | 3300013306 | Ga0163162_10000119 | Ga0163162_1000011929 | 388 |
| 527 | 3300013306 | Ga0163162_10001981 | Ga0163162_100019814 | 388 |
| 528 | 3300013306 | Ga0163162_10008867 | Ga0163162_100088674 | 388 |
| 529 | 3300013306 | Ga0163162_10155447 | Ga0163162_101554472 | 388 |
| 530 | 3300013306 | Ga0163162_10262346 | Ga0163162_102623462 | 388 |
| 531 | 3300013306 | Ga0163162_10283849 | Ga0163162_102838492 | 388 |
| 532 | 3300013307 | Ga0157372_10000014 | Ga0157372_10000014187 | 388 |
| 533 | 3300013307 | Ga0157372_10012767 | Ga0157372_100127673 | 388 |
| 534 | 3300013307 | Ga0157372_10036028 | Ga0157372_100360283 | 388 |
| 535 | 3300013307 | Ga0157372_10074388 | Ga0157372_100743883 | 388 |
| 536 | 3300013307 | Ga0157372_10078927 | Ga0157372_100789273 | 388 |
| 537 | 3300013307 | Ga0157372_10093360 | Ga0157372_100933603 | 388 |
| 538 | 3300013307 | Ga0157372_10277145 | Ga0157372_102771452 | 388 |
| 539 | 3300013307 | Ga0157372_10402010 | Ga0157372_104020102 | 388 |
| 540 | 3300013307 | Ga0157372_10466457 | Ga0157372_104664572 | 388 |
| 541 | 3300013308 | Ga0157375_10031791 | Ga0157375_100317913 | 388 |
| 542 | 3300013308 | Ga0157375_10090265 | Ga0157375_100902652 | 388 |
| 543 | 3300013308 | Ga0157375_10289206 | Ga0157375_102892062 | 388 |
| 544 | 3300014325 | Ga0163163_10000742 | Ga0163163_1000074210 | 388 |
| 545 | 3300014325 | Ga0163163_10331824 | Ga0163163_103318242 | 388 |
| 546 | 3300014326 | Ga0157380_10056022 | Ga0157380_100560223 | 388 |
| 547 | 3300014745 | Ga0157377_10137890 | Ga0157377_101378902 | 388 |
| 548 | 3300014968 | Ga0157379_10063610 | Ga0157379_100636103 | 388 |
| 549 | 3300014968 | Ga0157379_10092734 | Ga0157379_100927342 | 388 |
| 550 | 3300014968 | Ga0157379_10123904 | Ga0157379_101239042 | 388 |
| 551 | 3300014969 | Ga0157376_10004505 | Ga0157376_100045054 | 388 |
| 552 | 3300014969 | Ga0157376_10018992 | Ga0157376_100189924 | 388 |
| 553 | 3300014969 | Ga0157376_10048210 | Ga0157376_100482103 | 388 |
| 554 | 3300021384 | Ga0213876_10010112 | Ga0213876_100101124 | 388 |
| 555 | 3300022732 | Ga0224569_100903 | Ga0224569_1009032 | 388 |
| 556 | 3300022734 | Ga0224571_101390 | Ga0224571_1013902 | 388 |
| 557 | 3300025898 | Ga0207692_10030403 | Ga0207692_100304031 | 388 |
| 558 | 3300025899 | Ga0207642_10062203 | Ga0207642_100622032 | 388 |
| 559 | 3300025903 | Ga0207680_10112375 | Ga0207680_101123752 | 388 |
| 560 | 3300025904 | Ga0207647_10006752 | Ga0207647_100067524 | 388 |
| 561 | 3300025904 | Ga0207647_10026076 | Ga0207647_100260762 | 388 |
| 562 | 3300025906 | Ga0207699_10045764 | Ga0207699_100457642 | 388 |
| 563 | 3300025906 | Ga0207699_10098933 | Ga0207699_100989332 | 388 |
| 564 | 3300025907 | Ga0207645_10009002 | Ga0207645_100090023 | 388 |
| 565 | 3300025907 | Ga0207645_10032081 | Ga0207645_100320812 | 388 |
| 566 | 3300025909 | Ga0207705_10003517 | Ga0207705_100035173 | 388 |
| 567 | 3300025909 | Ga0207705_10007192 | Ga0207705_100071925 | 388 |
| 568 | 3300025909 | Ga0207705_10037522 | Ga0207705_100375222 | 388 |
| 569 | 3300025910 | Ga0207684_10005804 | Ga0207684_100058045 | 388 |
| 570 | 3300025911 | Ga0207654_10000238 | Ga0207654_100002388 | 388 |
| 571 | 3300025911 | Ga0207654_10000316 | Ga0207654_1000031616 | 388 |
| 572 | 3300025911 | Ga0207654_10024895 | Ga0207654_100248952 | 388 |
| 573 | 3300025911 | Ga0207654_10094041 | Ga0207654_100940412 | 388 |
| 574 | 3300025912 | Ga0207707_10011358 | Ga0207707_100113582 | 388 |
| 575 | 3300025912 | Ga0207707_10075676 | Ga0207707_100756762 | 388 |
| 576 | 3300025912 | Ga0207707_10113505 | Ga0207707_101135052 | 388 |
| 577 | 3300025913 | Ga0207695_10000001 | Ga0207695_1000000171 | 388 |
| 578 | 3300025913 | Ga0207695_10000069 | Ga0207695_10000069198 | 388 |
| 579 | 3300025913 | Ga0207695_10000161 | Ga0207695_1000016144 | 388 |
| 580 | 3300025913 | Ga0207695_10000231 | Ga0207695_10000231107 | 388 |
| 581 | 3300025913 | Ga0207695_10000353 | Ga0207695_1000035352 | 388 |
| 582 | 3300025913 | Ga0207695_10000656 | Ga0207695_1000065635 | 388 |
| 583 | 3300025913 | Ga0207695_10022632 | Ga0207695_100226323 | 388 |
| 584 | 3300025913 | Ga0207695_10138701 | Ga0207695_101387012 | 388 |
| 585 | 3300025913 | Ga0207695_10220814 | Ga0207695_102208142 | 388 |
| 586 | 3300025914 | Ga0207671_10000302 | Ga0207671_1000030214 | 388 |
| 587 | 3300025914 | Ga0207671_10000893 | Ga0207671_1000089315 | 388 |
| 588 | 3300025915 | Ga0207693_10000012 | Ga0207693_1000001268 | 388 |
| 589 | 3300025915 | Ga0207693_10001160 | Ga0207693_1000116011 | 388 |
| 590 | 3300025915 | Ga0207693_10058286 | Ga0207693_100582862 | 388 |
| 591 | 3300025916 | Ga0207663_10000280 | Ga0207663_1000028011 | 388 |
| 592 | 3300025916 | Ga0207663_10003486 | Ga0207663_100034865 | 388 |
| 593 | 3300025917 | Ga0207660_10095265 | Ga0207660_100952652 | 388 |
| 594 | 3300025917 | Ga0207660_10291204 | Ga0207660_102912041 | 388 |
| 595 | 3300025918 | Ga0207662_10118827 | Ga0207662_101188272 | 388 |
| 596 | 3300025919 | Ga0207657_10005169 | Ga0207657_100051694 | 388 |
| 597 | 3300025919 | Ga0207657_10136934 | Ga0207657_101369342 | 388 |
| 598 | 3300025920 | Ga0207649_10002495 | Ga0207649_100024954 | 388 |
| 599 | 3300025920 | Ga0207649_10003157 | Ga0207649_100031573 | 388 |
| 600 | 3300025920 | Ga0207649_10003294 | Ga0207649_100032947 | 388 |
| 601 | 3300025921 | Ga0207652_10003056 | Ga0207652_100030567 | 388 |
| 602 | 3300025921 | Ga0207652_10025236 | Ga0207652_100252362 | 388 |
| 603 | 3300025921 | Ga0207652_10046960 | Ga0207652_100469603 | 388 |
| 604 | 3300025921 | Ga0207652_10120163 | Ga0207652_101201632 | 388 |
| 605 | 3300025923 | Ga0207681_10061011 | Ga0207681_100610112 | 388 |
| 606 | 3300025924 | Ga0207694_10000137 | Ga0207694_1000013713 | 388 |
| 607 | 3300025924 | Ga0207694_10002200 | Ga0207694_100022009 | 388 |
| 608 | 3300025924 | Ga0207694_10004080 | Ga0207694_100040804 | 388 |
| 609 | 3300025924 | Ga0207694_10004374 | Ga0207694_100043749 | 388 |
| 610 | 3300025924 | Ga0207694_10017121 | Ga0207694_100171213 | 388 |
| 611 | 3300025924 | Ga0207694_10020076 | Ga0207694_100200761 | 388 |
| 612 | 3300025924 | Ga0207694_10021206 | Ga0207694_100212063 | 388 |
| 613 | 3300025924 | Ga0207694_10103242 | Ga0207694_101032422 | 388 |
| 614 | 3300025924 | Ga0207694_10320855 | Ga0207694_103208551 | 388 |
| 615 | 3300025925 | Ga0207650_10084040 | Ga0207650_100840402 | 388 |
| 616 | 3300025927 | Ga0207687_10006501 | Ga0207687_100065012 | 388 |
| 617 | 3300025927 | Ga0207687_10014350 | Ga0207687_100143503 | 388 |
| 618 | 3300025927 | Ga0207687_10050439 | Ga0207687_100504392 | 388 |
| 619 | 3300025928 | Ga0207700_10002138 | Ga0207700_100021384 | 388 |
| 620 | 3300025928 | Ga0207700_10012980 | Ga0207700_100129803 | 388 |
| 621 | 3300025928 | Ga0207700_10017957 | Ga0207700_100179572 | 388 |
| 622 | 3300025928 | Ga0207700_10036822 | Ga0207700_100368223 | 388 |
| 623 | 3300025929 | Ga0207664_10000098 | Ga0207664_1000009839 | 388 |
| 624 | 3300025929 | Ga0207664_10007305 | Ga0207664_100073055 | 388 |
| 625 | 3300025929 | Ga0207664_10056761 | Ga0207664_100567613 | 388 |
| 626 | 3300025929 | Ga0207664_10092569 | Ga0207664_100925692 | 388 |
| 627 | 3300025931 | Ga0207644_10009960 | Ga0207644_100099602 | 388 |
| 628 | 3300025932 | Ga0207690_10067802 | Ga0207690_100678022 | 388 |
| 629 | 3300025933 | Ga0207706_10017424 | Ga0207706_100174244 | 388 |
| 630 | 3300025934 | Ga0207686_10018802 | Ga0207686_100188023 | 388 |
| 631 | 3300025935 | Ga0207709_10009883 | Ga0207709_100098834 | 388 |
| 632 | 3300025935 | Ga0207709_10081527 | Ga0207709_100815272 | 388 |
| 633 | 3300025936 | Ga0207670_10105454 | Ga0207670_101054542 | 388 |
| 634 | 3300025939 | Ga0207665_10005922 | Ga0207665_100059223 | 388 |
| 635 | 3300025939 | Ga0207665_10011313 | Ga0207665_100113132 | 388 |
| 636 | 3300025940 | Ga0207691_10028957 | Ga0207691_100289571 | 388 |
| 637 | 3300025940 | Ga0207691_10046834 | Ga0207691_100468343 | 388 |
| 638 | 3300025941 | Ga0207711_10000023 | Ga0207711_10000023170 | 388 |
| 639 | 3300025941 | Ga0207711_10003045 | Ga0207711_100030453 | 388 |
| 640 | 3300025941 | Ga0207711_10004445 | Ga0207711_100044457 | 388 |
| 641 | 3300025941 | Ga0207711_10007008 | Ga0207711_100070084 | 388 |
| 642 | 3300025941 | Ga0207711_10028858 | Ga0207711_100288583 | 388 |
| 643 | 3300025941 | Ga0207711_10130437 | Ga0207711_101304373 | 388 |
| 644 | 3300025942 | Ga0207689_10001606 | Ga0207689_1000160616 | 388 |
| 645 | 3300025942 | Ga0207689_10002614 | Ga0207689_100026146 | 388 |
| 646 | 3300025942 | Ga0207689_10014513 | Ga0207689_100145134 | 388 |
| 647 | 3300025942 | Ga0207689_10037071 | Ga0207689_100370713 | 388 |
| 648 | 3300025942 | Ga0207689_10054566 | Ga0207689_100545662 | 388 |
| 649 | 3300025944 | Ga0207661_10051469 | Ga0207661_100514693 | 388 |
| 650 | 3300025944 | Ga0207661_10057318 | Ga0207661_100573181 | 388 |
| 651 | 3300025944 | Ga0207661_10103666 | Ga0207661_101036662 | 388 |
| 652 | 3300025945 | Ga0207679_10026234 | Ga0207679_100262344 | 388 |
| 653 | 3300025945 | Ga0207679_10088123 | Ga0207679_100881232 | 388 |
| 654 | 3300025945 | Ga0207679_10120088 | Ga0207679_101200882 | 388 |
| 655 | 3300025949 | Ga0207667_10000809 | Ga0207667_1000080918 | 388 |
| 656 | 3300025949 | Ga0207667_10003556 | Ga0207667_100035569 | 388 |
| 657 | 3300025949 | Ga0207667_10008104 | Ga0207667_100081042 | 388 |
| 658 | 3300025949 | Ga0207667_10012826 | Ga0207667_100128263 | 388 |
| 659 | 3300025949 | Ga0207667_10018028 | Ga0207667_100180284 | 388 |
| 660 | 3300025949 | Ga0207667_10045259 | Ga0207667_100452592 | 388 |
| 661 | 3300025949 | Ga0207667_10051579 | Ga0207667_100515793 | 388 |
| 662 | 3300025949 | Ga0207667_10130458 | Ga0207667_101304582 | 388 |
| 663 | 3300025949 | Ga0207667_10144008 | Ga0207667_101440082 | 388 |
| 664 | 3300025949 | Ga0207667_10200301 | Ga0207667_102003012 | 388 |
| 665 | 3300025949 | Ga0207667_10236776 | Ga0207667_102367762 | 388 |
| 666 | 3300025949 | Ga0207667_10276114 | Ga0207667_102761142 | 388 |
| 667 | 3300025960 | Ga0207651_10297833 | Ga0207651_102978331 | 388 |
| 668 | 3300025961 | Ga0207712_10050293 | Ga0207712_100502932 | 388 |
| 669 | 3300025972 | Ga0207668_10005700 | Ga0207668_100057004 | 388 |
| 670 | 3300025981 | Ga0207640_10048138 | Ga0207640_100481382 | 388 |
| 671 | 3300025981 | Ga0207640_10080735 | Ga0207640_100807352 | 388 |
| 672 | 3300025981 | Ga0207640_10290825 | Ga0207640_102908251 | 388 |
| 673 | 3300026023 | Ga0207677_10001674 | Ga0207677_100016742 | 388 |
| 674 | 3300026023 | Ga0207677_10009196 | Ga0207677_100091964 | 388 |
| 675 | 3300026023 | Ga0207677_10027991 | Ga0207677_100279913 | 388 |
| 676 | 3300026023 | Ga0207677_10070889 | Ga0207677_100708892 | 388 |
| 677 | 3300026023 | Ga0207677_10229870 | Ga0207677_102298702 | 388 |
| 678 | 3300026035 | Ga0207703_10009972 | Ga0207703_100099727 | 388 |
| 679 | 3300026035 | Ga0207703_10047849 | Ga0207703_100478493 | 388 |
| 680 | 3300026035 | Ga0207703_10135677 | Ga0207703_101356771 | 388 |
| 681 | 3300026041 | Ga0207639_10000191 | Ga0207639_1000019116 | 388 |
| 682 | 3300026041 | Ga0207639_10134485 | Ga0207639_101344852 | 388 |
| 683 | 3300026067 | Ga0207678_10006508 | Ga0207678_100065085 | 388 |
| 684 | 3300026067 | Ga0207678_10032951 | Ga0207678_100329513 | 388 |
| 685 | 3300026067 | Ga0207678_10034021 | Ga0207678_100340212 | 388 |
| 686 | 3300026067 | Ga0207678_10068148 | Ga0207678_100681482 | 388 |
| 687 | 3300026075 | Ga0207708_10121356 | Ga0207708_101213562 | 388 |
| 688 | 3300026078 | Ga0207702_10000458 | Ga0207702_1000045813 | 388 |
| 689 | 3300026078 | Ga0207702_10001020 | Ga0207702_1000102010 | 388 |
| 690 | 3300026078 | Ga0207702_10001136 | Ga0207702_1000113617 | 388 |
| 691 | 3300026078 | Ga0207702_10003114 | Ga0207702_1000311410 | 388 |
| 692 | 3300026078 | Ga0207702_10024096 | Ga0207702_100240963 | 388 |
| 693 | 3300026078 | Ga0207702_10064135 | Ga0207702_100641353 | 388 |
| 694 | 3300026078 | Ga0207702_10146691 | Ga0207702_101466912 | 388 |
| 695 | 3300026078 | Ga0207702_10151081 | Ga0207702_101510812 | 388 |
| 696 | 3300026078 | Ga0207702_10275837 | Ga0207702_102758371 | 388 |
| 697 | 3300026078 | Ga0207702_10358077 | Ga0207702_103580771 | 388 |
| 698 | 3300026088 | Ga0207641_10001055 | Ga0207641_1000105510 | 388 |
| 699 | 3300026088 | Ga0207641_10036916 | Ga0207641_100369163 | 388 |
| 700 | 3300026088 | Ga0207641_10041831 | Ga0207641_100418311 | 388 |
| 701 | 3300026088 | Ga0207641_10063106 | Ga0207641_100631062 | 388 |
| 702 | 3300026089 | Ga0207648_10002171 | Ga0207648_100021719 | 388 |
| 703 | 3300026089 | Ga0207648_10010502 | Ga0207648_100105027 | 388 |
| 704 | 3300026095 | Ga0207676_10002318 | Ga0207676_100023188 | 388 |
| 705 | 3300026095 | Ga0207676_10006053 | Ga0207676_100060533 | 388 |
| 706 | 3300026095 | Ga0207676_10288928 | Ga0207676_102889282 | 388 |
| 707 | 3300026116 | Ga0207674_10001893 | Ga0207674_1000189318 | 388 |
| 708 | 3300026116 | Ga0207674_10001984 | Ga0207674_1000198412 | 388 |
| 709 | 3300026116 | Ga0207674_10003886 | Ga0207674_100038868 | 388 |
| 710 | 3300026116 | Ga0207674_10071079 | Ga0207674_100710792 | 388 |
| 711 | 3300026116 | Ga0207674_10103405 | Ga0207674_101034052 | 388 |
| 712 | 3300026116 | Ga0207674_10131501 | Ga0207674_101315012 | 388 |
| 713 | 3300026118 | Ga0207675_100010959 | Ga0207675_1000109592 | 388 |
| 714 | 3300026118 | Ga0207675_100016660 | Ga0207675_1000166605 | 388 |
| 715 | 3300026118 | Ga0207675_100155027 | Ga0207675_1001550272 | 388 |
| 716 | 3300026118 | Ga0207675_100169237 | Ga0207675_1001692372 | 388 |
| 717 | 3300026121 | Ga0207683_10044141 | Ga0207683_100441412 | 388 |
| 718 | 3300026142 | Ga0207698_10000006 | Ga0207698_1000000678 | 388 |
| 719 | 3300026142 | Ga0207698_10000249 | Ga0207698_1000024911 | 388 |
| 720 | 3300026142 | Ga0207698_10047927 | Ga0207698_100479272 | 388 |
| 721 | 3300026142 | Ga0207698_10073906 | Ga0207698_100739062 | 388 |
| 722 | 3300026142 | Ga0207698_10149441 | Ga0207698_101494412 | 388 |
| 723 | 3300028017 | Ga0265356_1000013 | Ga0265356_100001313 | 388 |
| 724 | 3300028379 | Ga0268266_10000660 | Ga0268266_1000066030 | 388 |
| 725 | 3300028379 | Ga0268266_10005793 | Ga0268266_100057933 | 388 |
| 726 | 3300028379 | Ga0268266_10090876 | Ga0268266_100908762 | 388 |
| 727 | 3300028380 | Ga0268265_10006348 | Ga0268265_100063485 | 388 |
| 728 | 3300028381 | Ga0268264_10001093 | Ga0268264_100010933 | 388 |
| 729 | 3300028381 | Ga0268264_10004380 | Ga0268264_100043803 | 388 |
| 730 | 3300028556 | Ga0265337_1001683 | Ga0265337_10016835 | 388 |
| 731 | 3300028556 | Ga0265337_1006294 | Ga0265337_10062942 | 388 |
| 732 | 3300028556 | Ga0265337_1008518 | Ga0265337_10085182 | 388 |
| 733 | 3300028556 | Ga0265337_1013101 | Ga0265337_10131012 | 388 |
| 734 | 3300028563 | Ga0265319_1001494 | Ga0265319_10014943 | 388 |
| 735 | 3300028563 | Ga0265319_1042049 | Ga0265319_10420492 | 388 |
| 736 | 3300028573 | Ga0265334_10021022 | Ga0265334_100210223 | 388 |
| 737 | 3300028794 | Ga0307515_10068993 | Ga0307515_100689931 | 388 |
| 738 | 3300028800 | Ga0265338_10003616 | Ga0265338_1000361619 | 388 |
| 739 | 3300028800 | Ga0265338_10005972 | Ga0265338_100059724 | 388 |
| 740 | 3300028800 | Ga0265338_10022889 | Ga0265338_100228895 | 388 |
| 741 | 3300028800 | Ga0265338_10029368 | Ga0265338_100293683 | 388 |
| 742 | 3300028800 | Ga0265338_10034737 | Ga0265338_100347373 | 388 |
| 743 | 3300028800 | Ga0265338_10212731 | Ga0265338_102127312 | 388 |
| 744 | 3300030760 | Ga0265762_1000831 | Ga0265762_10008313 | 388 |
| 745 | 3300031090 | Ga0265760_10000017 | Ga0265760_1000001733 | 388 |
| 746 | 3300031090 | Ga0265760_10001830 | Ga0265760_100018306 | 388 |
| 747 | 3300031240 | Ga0265320_10000134 | Ga0265320_1000013444 | 388 |
| 748 | 3300031240 | Ga0265320_10000847 | Ga0265320_1000084716 | 388 |
| 749 | 3300031240 | Ga0265320_10001451 | Ga0265320_100014516 | 388 |
| 750 | 3300031240 | Ga0265320_10002229 | Ga0265320_100022296 | 388 |
| 751 | 3300031240 | Ga0265320_10005571 | Ga0265320_100055715 | 388 |
| 752 | 3300031240 | Ga0265320_10030138 | Ga0265320_100301383 | 388 |
| 753 | 3300031249 | Ga0265339_10010523 | Ga0265339_100105235 | 388 |
| 754 | 3300031249 | Ga0265339_10033067 | Ga0265339_100330672 | 388 |
| 755 | 3300031344 | Ga0265316_10077493 | Ga0265316_100774932 | 388 |
| 756 | 3300031548 | Ga0307408_100050207 | Ga0307408_1000502072 | 388 |
| 757 | 3300031595 | Ga0265313_10009742 | Ga0265313_100097424 | 388 |
| 758 | 3300031595 | Ga0265313_10020913 | Ga0265313_100209132 | 388 |
| 759 | 3300031616 | Ga0307508_10000055 | Ga0307508_1000005528 | 388 |
| 760 | 3300031711 | Ga0265314_10032624 | Ga0265314_100326243 | 388 |
| 761 | 3300031731 | Ga0307405_10093468 | Ga0307405_100934682 | 388 |
| 762 | 3300031903 | Ga0307407_10000097 | Ga0307407_1000009717 | 388 |
| 763 | 3300032004 | Ga0307414_10000226 | Ga0307414_1000022619 | 388 |
| 764 | 3300032005 | Ga0307411_10034580 | Ga0307411_100345802 | 388 |
| 765 | 3300032126 | Ga0307415_100054242 | Ga0307415_1000542423 | 388 |
| 766 | 3300033180 | Ga0307510_10036648 | Ga0307510_100366484 | 388 |
| 767 | 3300033545 | Ga0316214_1002983 | Ga0316214_10029832 | 388 |
| 768 | 3300035083 | Ga0373926_0043744 | Ga0373926_0043744_351_1523 | 388 |
| 769 | 3300035089 | Ga0373944_0019989 | Ga0373944_0019989_675_1847 | 388 |
| 770 | 3300035118 | Ga0373954_0006455 | Ga0373954_0006455_2964_4142 | 388 |
| 771 | 3300035119 | Ga0373956_0040058 | Ga0373956_0040058_25_1224 | 388 |
| 772 | 3300035170 | Ga0373943_0000669 | Ga0373943_0000669_1437_2609 | 388 |
| 773 | 3300035172 | Ga0373955_0061172 | Ga0373955_0061172_180_1352 | 388 |
| 774 | 3300035692 | Ga0373935_0027635 | Ga0373935_0027635_1281_2453 | 388 |
| 775 | 3300035692 | Ga0373935_0083802 | Ga0373935_0083802_808_1980 | 388 |
| 776 | 3300035695 | Ga0373927_0000282 | Ga0373927_0000282_8669_9841 | 388 |
| 777 | 3300035695 | Ga0373927_0047241 | Ga0373927_0047241_345_1517 | 388 |
| 778 | 3300035724 | Ga0373933_0008503 | Ga0373933_0008503_3827_5026 | 388 |
| 779 | 3300035725 | Ga0373947_0001632 | Ga0373947_0001632_2667_3839 | 388 |
| 780 | 3300035725 | Ga0373947_0080576 | Ga0373947_0080576_481_1653 | 388 |
| 781 | 3300036401 | Ga0373937_0020381 | Ga0373937_0020381_3884_5083 | 388 |
| 782 | 3300037068 | Ga0373925_0002387 | Ga0373925_0002387_1312_2484 | 388 |
| 783 | 3300037068 | Ga0373925_0016024 | Ga0373925_0016024_540_1712 | 388 |
| 784 | 3300037068 | Ga0373925_0054878 | Ga0373925_0054878_648_1823 | 388 |
| 785 | 3300037471 | Ga0395905_0118676 | Ga0395905_0118676_199_1377 | 388 |
| 786 | 3300037471 | Ga0395905_0126144 | Ga0395905_0126144_346_1518 | 388 |
| 787 | 3300039437 | Ga0436365_0012252 | Ga0436365_0012252_606_1781 | 388 |
| 788 | 3300039437 | Ga0436365_1710025 | Ga0436365_1710025_4179_5357 | 388 |
| 789 | 3300044684 | Ga0466966_0062685 | Ga0466966_0062685_951_2123 | 388 |
| 790 | 3300044694 | Ga0466963_0004435 | Ga0466963_0004435_4016_5188 | 388 |
| 791 | 3300044694 | Ga0466963_0054503 | Ga0466963_0054503_967_2139 | 388 |
| 792 | 3300045049 | Ga0466959_0206565 | Ga0466959_0206565_130_1302 | 388 |
| 793 | 3300045051 | Ga0451576_0015690 | Ga0451576_0015690_706_1878 | 388 |
| 794 | 3300045051 | Ga0451576_0391735 | Ga0451576_0391735_141_1313 | 388 |
| 795 | 3300045976 | Ga0466967_0011559 | Ga0466967_0011559_4943_6115 | 388 |
| 796 | 3300046454 | Ga0495592_0000012 | Ga0495592_0000012_151343_152521 | 388 |
| 797 | 3300046454 | Ga0495592_0035706 | Ga0495592_0035706_360_1532 | 388 |
| 798 | 3300046459 | Ga0495629_0104059 | Ga0495629_0104059_80_1252 | 388 |
| 799 | 3300046459 | Ga0495629_0228410 | Ga0495629_0228410_27_1205 | 388 |
| 800 | 3300046460 | Ga0495638_0015062 | Ga0495638_0015062_1007_2179 | 388 |
| 801 | 3300046462 | Ga0495651_0005962 | Ga0495651_0005962_1148_2320 | 388 |
| 802 | 3300046463 | Ga0495653_0010340 | Ga0495653_0010340_4658_5830 | 388 |
| 803 | 3300046472 | Ga0495580_0000182 | Ga0495580_0000182_33363_34535 | 388 |
| 804 | 3300046472 | Ga0495580_0035789 | Ga0495580_0035789_2303_3475 | 388 |
| 805 | 3300046472 | Ga0495580_0084070 | Ga0495580_0084070_148_1320 | 388 |
| 806 | 3300046472 | Ga0495580_0119072 | Ga0495580_0119072_142_1314 | 388 |
| 807 | 3300046473 | Ga0495582_0001430 | Ga0495582_0001430_11103_12275 | 388 |
| 808 | 3300046473 | Ga0495582_0068026 | Ga0495582_0068026_738_1931 | 388 |
| 809 | 3300046475 | Ga0495639_0002577 | Ga0495639_0002577_697_1869 | 388 |
| 810 | 3300046476 | Ga0495662_0002206 | Ga0495662_0002206_5789_6961 | 388 |
| 811 | 3300046476 | Ga0495662_0011784 | Ga0495662_0011784_2872_4050 | 388 |
| 812 | 3300046477 | Ga0495664_0001708 | Ga0495664_0001708_1210_2382 | 388 |
| 813 | 3300046499 | Ga0495594_0006286 | Ga0495594_0006286_1221_2393 | 388 |
| 814 | 3300046499 | Ga0495594_0052251 | Ga0495594_0052251_954_2132 | 388 |
| 815 | 3300046507 | Ga0495606_0043625 | Ga0495606_0043625_1611_2783 | 388 |
| 816 | 3300046516 | Ga0495628_0003611 | Ga0495628_0003611_11127_12305 | 388 |
| 817 | 3300046516 | Ga0495628_0028279 | Ga0495628_0028279_2529_3701 | 388 |
| 818 | 3300046517 | Ga0495630_0000366 | Ga0495630_0000366_17393_18565 | 388 |
| 819 | 3300046517 | Ga0495630_0005339 | Ga0495630_0005339_1241_2419 | 388 |
| 820 | 3300046517 | Ga0495630_0023229 | Ga0495630_0023229_3082_4260 | 388 |
| 821 | 3300046526 | Ga0495666_0004502 | Ga0495666_0004502_4696_5868 | 388 |
| 822 | 3300046526 | Ga0495666_0007965 | Ga0495666_0007965_2493_3665 | 388 |
| 823 | 3300046529 | Ga0495652_0074086 | Ga0495652_0074086_857_2029 | 388 |
| 824 | 3300046529 | Ga0495652_0113515 | Ga0495652_0113515_397_1575 | 388 |
| 825 | 3300046529 | Ga0495652_0219874 | Ga0495652_0219874_28_1212 | 388 |
| 826 | 3300046531 | Ga0495665_0001802 | Ga0495665_0001802_9158_10330 | 388 |
| 827 | 3300046533 | Ga0495640_0006287 | Ga0495640_0006287_5980_7152 | 388 |
| 828 | 3300046533 | Ga0495640_0011154 | Ga0495640_0011154_1531_2709 | 388 |
| 829 | 3300046533 | Ga0495640_0020710 | Ga0495640_0020710_2096_3268 | 388 |
| 830 | 3300046535 | Ga0495586_0000017 | Ga0495586_0000017_97857_99029 | 388 |
| 831 | 3300046535 | Ga0495586_0005165 | Ga0495586_0005165_5120_6292 | 388 |
| 832 | 3300046535 | Ga0495586_0007234 | Ga0495586_0007234_996_2174 | 388 |
| 833 | 3300046536 | Ga0495587_0029818 | Ga0495587_0029818_357_1529 | 388 |
| 834 | 3300046543 | Ga0495645_0003809 | Ga0495645_0003809_2224_3402 | 388 |
| 835 | 3300046543 | Ga0495645_0010006 | Ga0495645_0010006_4440_5612 | 388 |
| 836 | 3300046543 | Ga0495645_0088818 | Ga0495645_0088818_969_2141 | 388 |
| 837 | 3300046543 | Ga0495645_0118054 | Ga0495645_0118054_407_1579 | 388 |
| 838 | 3300046559 | Ga0495667_0000973 | Ga0495667_0000973_1556_2728 | 388 |
| 839 | 3300046642 | Ga0495634_0001612 | Ga0495634_0001612_16031_17203 | 388 |
| 840 | 3300046660 | Ga0495625_0028802 | Ga0495625_0028802_2477_3649 | 388 |
| 841 | 3300046660 | Ga0495625_0044852 | Ga0495625_0044852_770_1942 | 388 |
| 842 | 3300046663 | Ga0495635_0014187 | Ga0495635_0014187_598_1770 | 388 |
| 843 | 3300046664 | Ga0495659_0041055 | Ga0495659_0041055_412_1584 | 388 |
| 844 | 3300046674 | Ga0495588_0000083 | Ga0495588_0000083_123599_124777 | 388 |
| 845 | 3300046678 | Ga0495599_0001485 | Ga0495599_0001485_11239_12417 | 388 |
| 846 | 3300046678 | Ga0495599_0017236 | Ga0495599_0017236_635_1807 | 388 |
| 847 | 3300046679 | Ga0495623_0018994 | Ga0495623_0018994_2930_4102 | 388 |
| 848 | 3300046680 | Ga0495646_0004579 | Ga0495646_0004579_6309_7481 | 388 |
| 849 | 3300046680 | Ga0495646_0081423 | Ga0495646_0081423_538_1716 | 388 |
| 850 | 3300046681 | Ga0495647_0036151 | Ga0495647_0036151_47_1219 | 388 |
| 851 | 3300046684 | Ga0495669_0095438 | Ga0495669_0095438_103_1281 | 388 |
| 852 | 3300046689 | Ga0495613_0009166 | Ga0495613_0009166_1207_2379 | 388 |
| 853 | 3300046689 | Ga0495613_0082030 | Ga0495613_0082030_531_1703 | 388 |
| 854 | 3300046690 | Ga0495624_0012772 | Ga0495624_0012772_737_1909 | 388 |
| 855 | 3300046690 | Ga0495624_0027095 | Ga0495624_0027095_1134_2312 | 388 |
| 856 | 3300046694 | Ga0495649_0004705 | Ga0495649_0004705_6726_7898 | 388 |
| 857 | 3300046809 | Ga0495600_0001541 | Ga0495600_0001541_1232_2404 | 388 |
| 858 | 3300047315 | Ga0495581_0042259 | Ga0495581_0042259_729_1901 | 388 |
| 859 | 3300047317 | Ga0495604_0042015 | Ga0495604_0042015_856_2028 | 388 |
| 860 | 3300047319 | Ga0495674_0001210 | Ga0495674_0001210_6421_7593 | 388 |
| 861 | 3300047319 | Ga0495674_0006874 | Ga0495674_0006874_8255_9433 | 388 |
| 862 | 3300047319 | Ga0495674_0010893 | Ga0495674_0010893_4512_5684 | 388 |
| 863 | 3300047319 | Ga0495674_0017519 | Ga0495674_0017519_131_1309 | 388 |
| 864 | 3300047319 | Ga0495674_0029207 | Ga0495674_0029207_1672_2844 | 388 |
| 865 | 3300047319 | Ga0495674_0045977 | Ga0495674_0045977_360_1532 | 388 |
| 866 | 3300047319 | Ga0495674_0049300 | Ga0495674_0049300_2307_3479 | 388 |
| 867 | 3300047320 | Ga0495672_0000712 | Ga0495672_0000712_20158_21330 | 388 |
| 868 | 3300047320 | Ga0495672_0002235 | Ga0495672_0002235_13290_14468 | 388 |
| 869 | 3300047320 | Ga0495672_0017128 | Ga0495672_0017128_672_1844 | 388 |
| 870 | 3300047320 | Ga0495672_0069866 | Ga0495672_0069866_524_1696 | 388 |
| 871 | 3300047321 | Ga0495676_0001708 | Ga0495676_0001708_10304_11476 | 388 |
| 872 | 3300047322 | Ga0495680_0005586 | Ga0495680_0005586_1443_2615 | 388 |
| 873 | 3300047322 | Ga0495680_0057091 | Ga0495680_0057091_215_1387 | 388 |
| 874 | 3300047322 | Ga0495680_0148895 | Ga0495680_0148895_187_1365 | 388 |
| 875 | 3300047444 | Ga0495675_0003684 | Ga0495675_0003684_6971_8143 | 388 |
| 876 | 3300047445 | Ga0495677_0019329 | Ga0495677_0019329_1118_2290 | 388 |
| 877 | 3300047471 | Ga0495684_0004637 | Ga0495684_0004637_1615_2787 | 388 |
| 878 | 3300047471 | Ga0495684_0025455 | Ga0495684_0025455_727_1899 | 388 |
| 879 | 3300047472 | Ga0495686_0000035 | Ga0495686_0000035_107757_108929 | 388 |
| 880 | 3300047472 | Ga0495686_0005823 | Ga0495686_0005823_508_1680 | 388 |
| 881 | 3300047673 | Ga0495593_0047426 | Ga0495593_0047426_121_1293 | 388 |
| 882 | 3300048088 | Ga0495602_0067819 | Ga0495602_0067819_309_1481 | 388 |
| 883 | 3300048089 | Ga0495614_0003389 | Ga0495614_0003389_4772_5944 | 388 |
| 884 | 3300048904 | Ga0496101_0147738 | Ga0496101_0147738_129_1301 | 388 |
| 885 | 3300048905 | Ga0496102_0003711 | Ga0496102_0003711_2530_3702 | 388 |
| 886 | 3300048905 | Ga0496102_0004321 | Ga0496102_0004321_7418_8590 | 388 |
| 887 | 3300048906 | Ga0496103_0031296 | Ga0496103_0031296_1186_2358 | 388 |
| 888 | 3300048907 | Ga0496104_0005306 | Ga0496104_0005306_387_1559 | 388 |
| 889 | 3300048909 | Ga0496106_0016253 | Ga0496106_0016253_2163_3335 | 388 |
| 890 | 3300048918 | Ga0496115_0020040 | Ga0496115_0020040_2385_3557 | 388 |
| 891 | 3300048929 | Ga0496126_0000091 | Ga0496126_0000091_120029_121201 | 388 |
| 892 | 3300048929 | Ga0496126_0000767 | Ga0496126_0000767_25978_27150 | 388 |
| 893 | 3300049460 | Ga0495682_0018391 | Ga0495682_0018391_1142_2314 | 388 |
| 894 | 3300049569 | Ga0501032_0000027 | Ga0501032_0000027_53281_54459 | 388 |
| 895 | 3300049569 | Ga0501032_0001332 | Ga0501032_0001332_3721_4899 | 388 |
| 896 | 3300049569 | Ga0501032_0005178 | Ga0501032_0005178_6519_7691 | 388 |
| 897 | 3300049570 | Ga0501033_0000002 | Ga0501033_0000002_118916_120094 | 388 |
| 898 | 3300049570 | Ga0501033_0003561 | Ga0501033_0003561_10089_11267 | 388 |
| 899 | 3300049570 | Ga0501033_0025247 | Ga0501033_0025247_644_1816 | 388 |
| 900 | 3300049572 | Ga0501036_0063880 | Ga0501036_0063880_1868_3046 | 388 |
| 901 | 3300049573 | Ga0501037_0019522 | Ga0501037_0019522_270_1448 | 388 |
| 902 | 3300049574 | Ga0501038_0001520 | Ga0501038_0001520_384_1556 | 388 |
| 903 | 3300049579 | Ga0501043_0041393 | Ga0501043_0041393_2391_3569 | 388 |
| 904 | 3300049580 | Ga0501046_0000265 | Ga0501046_0000265_11597_12769 | 388 |
| 905 | 3300049580 | Ga0501046_0003292 | Ga0501046_0003292_824_2002 | 388 |
| 906 | 3300049581 | Ga0501047_0000409 | Ga0501047_0000409_14237_15409 | 388 |
| 907 | 3300049581 | Ga0501047_0005823 | Ga0501047_0005823_2641_3813 | 388 |
| 908 | 3300049581 | Ga0501047_0099360 | Ga0501047_0099360_238_1422 | 388 |
| 909 | 3300049581 | Ga0501047_0224983 | Ga0501047_0224983_391_1569 | 388 |
| 910 | 3300049586 | Ga0501070_0231494 | Ga0501070_0231494_38_1216 | 388 |
| 911 | 3300049588 | Ga0501072_0226195 | Ga0501072_0226195_193_1365 | 388 |
| 912 | 3300049592 | Ga0501076_0136603 | Ga0501076_0136603_787_1959 | 388 |
| 913 | 3300049742 | Ga0501080_0007661 | Ga0501080_0007661_400_1572 | 388 |
| 914 | 3300049744 | Ga0501083_0000836 | Ga0501083_0000836_1309_2487 | 388 |
| 915 | 3300049744 | Ga0501083_0038931 | Ga0501083_0038931_63_1241 | 388 |
| 916 | 3300049822 | Ga0501035_0000475 | Ga0501035_0000475_4104_5282 | 388 |
| 917 | 3300049823 | Ga0501044_0000080 | Ga0501044_0000080_4081_5259 | 388 |
| 918 | 3300049823 | Ga0501044_0000704 | Ga0501044_0000704_5415_6587 | 388 |
| 919 | 3300049823 | Ga0501044_0014025 | Ga0501044_0014025_7096_8268 | 388 |
| 920 | 3300049823 | Ga0501044_0022872 | Ga0501044_0022872_4989_6167 | 388 |
| 921 | 3300050489 | nmdc:mga03683_54875_c1 | nmdc:mga03683_54875_c1_118_1290 | 388 |
| 922 | 3300050493 | nmdc:mga0k408_458_c1 | nmdc:mga0k408_458_c1_7563_8735 | 388 |
| 923 | 3300050507 | nmdc:mga05p37_113708_c1 | nmdc:mga05p37_113708_c1_1512_2684 | 388 |
| 924 | 3300050510 | nmdc:mga06r32_101896_c1 | nmdc:mga06r32_101896_c1_1107_2279 | 388 |
| 925 | 3300050511 | nmdc:mga08y16_7180_c1 | nmdc:mga08y16_7180_c1_7388_8560 | 388 |
| 926 | 3300050511 | nmdc:mga08y16_8626_c1 | nmdc:mga08y16_8626_c1_157_1329 | 388 |
| 927 | 3300050512 | nmdc:mga0n895_3428_c1 | nmdc:mga0n895_3428_c1_7007_8179 | 388 |
| 928 | 3300050512 | nmdc:mga0n895_9628_c1 | nmdc:mga0n895_9628_c1_3576_4787 | 388 |
| 929 | 3300050513 | nmdc:mga0rr50_7752_c1 | nmdc:mga0rr50_7752_c1_3758_4930 | 388 |
| 930 | 3300050514 | nmdc:mga08x19_118171_c1 | nmdc:mga08x19_118171_c1_260_1471 | 388 |
| 931 | 3300050514 | nmdc:mga08x19_51588_c1 | nmdc:mga08x19_51588_c1_844_2016 | 388 |
| 932 | 3300050515 | nmdc:mga0a205_257287_c1 | nmdc:mga0a205_257287_c1_361_1533 | 388 |
| 933 | 3300053093 | Ga0500651_0000002 | Ga0500651_0000002_349779_350951 | 388 |
| 934 | 3300053096 | Ga0500641_0008050 | Ga0500641_0008050_2454_3626 | 388 |
| 935 | 3300053119 | Ga0500595_000036 | Ga0500595_000036_89102_90274 | 388 |
| 936 | 3300053119 | Ga0500595_019644 | Ga0500595_019644_772_1944 | 388 |
| 937 | 3300053139 | Ga0500568_0002084 | Ga0500568_0002084_2601_3893 | 388 |
| 938 | 3300053153 | Ga0500616_0000924 | Ga0500616_0000924_14317_15489 | 388 |
| 939 | 3300053730 | Ga0500645_000688 | Ga0500645_000688_16798_17970 | 388 |
| 940 | 3300059421 | Ga0590071_026596 | Ga0590071_026596_41_1213 | 388 |
| 941 | 3300005336 | Ga0070680_100309797 | Ga0070680_1003097971 | 389 |
| 942 | 3300005365 | Ga0070688_100131208 | Ga0070688_1001312082 | 389 |
| 943 | 3300005366 | Ga0070659_100053246 | Ga0070659_1000532462 | 389 |
| 944 | 3300005445 | Ga0070708_100060194 | Ga0070708_1000601942 | 389 |
| 945 | 3300005456 | Ga0070678_100141492 | Ga0070678_1001414922 | 389 |
| 946 | 3300005459 | Ga0068867_100215325 | Ga0068867_1002153251 | 389 |
| 947 | 3300005518 | Ga0070699_100297796 | Ga0070699_1002977961 | 389 |
| 948 | 3300005543 | Ga0070672_100055899 | Ga0070672_1000558992 | 389 |
| 949 | 3300005545 | Ga0070695_100106166 | Ga0070695_1001061661 | 389 |
| 950 | 3300005549 | Ga0070704_100215646 | Ga0070704_1002156462 | 389 |
| 951 | 3300005614 | Ga0068856_100020628 | Ga0068856_1000206283 | 389 |
| 952 | 3300005617 | Ga0068859_100011501 | Ga0068859_1000115016 | 389 |
| 953 | 3300005719 | Ga0068861_100139575 | Ga0068861_1001395752 | 389 |
| 954 | 3300005719 | Ga0068861_100213341 | Ga0068861_1002133412 | 389 |
| 955 | 3300005843 | Ga0068860_100366019 | Ga0068860_1003660192 | 389 |
| 956 | 3300005844 | Ga0068862_100169510 | Ga0068862_1001695102 | 389 |
| 957 | 3300005985 | Ga0081539_10000517 | Ga0081539_1000051724 | 389 |
| 958 | 3300006042 | Ga0075368_10007517 | Ga0075368_100075173 | 389 |
| 959 | 3300006178 | Ga0075367_10036332 | Ga0075367_100363322 | 389 |
| 960 | 3300006195 | Ga0075366_10020182 | Ga0075366_100201823 | 389 |
| 961 | 3300006237 | Ga0097621_100007883 | Ga0097621_1000078835 | 389 |
| 962 | 3300006846 | Ga0075430_100065475 | Ga0075430_1000654751 | 389 |
| 963 | 3300006846 | Ga0075430_100095058 | Ga0075430_1000950581 | 389 |
| 964 | 3300006847 | Ga0075431_100188398 | Ga0075431_1001883982 | 389 |
| 965 | 3300006880 | Ga0075429_100026898 | Ga0075429_1000268983 | 389 |
| 966 | 3300006931 | Ga0097620_100011501 | Ga0097620_1000115013 | 389 |
| 967 | 3300009093 | Ga0105240_10021660 | Ga0105240_100216604 | 389 |
| 968 | 3300009094 | Ga0111539_10053834 | Ga0111539_100538341 | 389 |
| 969 | 3300009147 | Ga0114129_10135131 | Ga0114129_101351312 | 389 |
| 970 | 3300009148 | Ga0105243_10147216 | Ga0105243_101472161 | 389 |
| 971 | 3300009553 | Ga0105249_10072569 | Ga0105249_100725692 | 389 |
| 972 | 3300011119 | Ga0105246_10042087 | Ga0105246_100420872 | 389 |
| 973 | 3300013102 | Ga0157371_10096445 | Ga0157371_100964452 | 389 |
| 974 | 3300013104 | Ga0157370_10111620 | Ga0157370_101116202 | 389 |
| 975 | 3300013105 | Ga0157369_10009797 | Ga0157369_100097975 | 389 |
| 976 | 3300013105 | Ga0157369_10090059 | Ga0157369_100900591 | 389 |
| 977 | 3300013296 | Ga0157374_10001531 | Ga0157374_1000153116 | 389 |
| 978 | 3300013296 | Ga0157374_10006824 | Ga0157374_100068243 | 389 |
| 979 | 3300013306 | Ga0163162_10276925 | Ga0163162_102769252 | 389 |
| 980 | 3300013308 | Ga0157375_10170194 | Ga0157375_101701942 | 389 |
| 981 | 3300014325 | Ga0163163_10000034 | Ga0163163_100000344 | 389 |
| 982 | 3300021384 | Ga0213876_10066908 | Ga0213876_100669082 | 389 |
| 983 | 3300025913 | Ga0207695_10060464 | Ga0207695_100604643 | 389 |
| 984 | 3300025936 | Ga0207670_10132068 | Ga0207670_101320682 | 389 |
| 985 | 3300025944 | Ga0207661_10158259 | Ga0207661_101582592 | 389 |
| 986 | 3300025945 | Ga0207679_10139108 | Ga0207679_101391082 | 389 |
| 987 | 3300025961 | Ga0207712_10204551 | Ga0207712_102045512 | 389 |
| 988 | 3300026067 | Ga0207678_10217565 | Ga0207678_102175651 | 389 |
| 989 | 3300026075 | Ga0207708_10069836 | Ga0207708_100698362 | 389 |
| 990 | 3300026078 | Ga0207702_10008668 | Ga0207702_100086683 | 389 |
| 991 | 3300026088 | Ga0207641_10015901 | Ga0207641_100159014 | 389 |
| 992 | 3300026089 | Ga0207648_10207569 | Ga0207648_102075692 | 389 |
| 993 | 3300026089 | Ga0207648_10314498 | Ga0207648_103144981 | 389 |
| 994 | 3300026095 | Ga0207676_10353952 | Ga0207676_103539522 | 389 |
| 995 | 3300027907 | Ga0207428_10025635 | Ga0207428_100256353 | 389 |
| 996 | 3300027907 | Ga0207428_10227543 | Ga0207428_102275431 | 389 |
| 997 | 3300028379 | Ga0268266_10170447 | Ga0268266_101704472 | 389 |
| 998 | 3300028379 | Ga0268266_10340179 | Ga0268266_103401792 | 389 |
| 999 | 3300028380 | Ga0268265_10134848 | Ga0268265_101348482 | 389 |
| 1000 | 3300028380 | Ga0268265_10306015 | Ga0268265_103060151 | 389 |
| 1001 | 3300032005 | Ga0307411_10259336 | Ga0307411_102593361 | 389 |
| 1002 | 3300035086 | Ga0373934_0000592 | Ga0373934_0000592_1478_2671 | 389 |
| 1003 | 3300035118 | Ga0373954_0109449 | Ga0373954_0109449_27_1220 | 389 |
| 1004 | 3300035120 | Ga0373957_0028507 | Ga0373957_0028507_98_1291 | 389 |
| 1005 | 3300035724 | Ga0373933_0005449 | Ga0373933_0005449_11_1204 | 389 |
| 1006 | 3300036401 | Ga0373937_0000419 | Ga0373937_0000419_13161_14354 | 389 |
| 1007 | 3300042184 | Ga0450908_003607 | Ga0450908_003607_979_2166 | 389 |
| 1008 | 3300046463 | Ga0495653_0143967 | Ga0495653_0143967_44_1216 | 389 |
| 1009 | 3300046475 | Ga0495639_0041717 | Ga0495639_0041717_418_1590 | 389 |
| 1010 | 3300046499 | Ga0495594_0076284 | Ga0495594_0076284_645_1817 | 389 |
| 1011 | 3300046516 | Ga0495628_0074023 | Ga0495628_0074023_1106_2278 | 389 |
| 1012 | 3300047317 | Ga0495604_0150525 | Ga0495604_0150525_35_1207 | 389 |
| 1013 | 3300047319 | Ga0495674_0006098 | Ga0495674_0006098_5876_7048 | 389 |
| 1014 | 3300047444 | Ga0495675_0109108 | Ga0495675_0109108_117_1289 | 389 |
| 1015 | 3300048918 | Ga0496115_0010377 | Ga0496115_0010377_3917_5089 | 389 |
| 1016 | 3300049572 | Ga0501036_0143417 | Ga0501036_0143417_236_1408 | 389 |
| 1017 | 3300049576 | Ga0501040_0243783 | Ga0501040_0243783_19_1191 | 389 |
| 1018 | 3300049593 | Ga0501077_0135674 | Ga0501077_0135674_290_1462 | 389 |
| 1019 | 3300049823 | Ga0501044_0001313 | Ga0501044_0001313_12954_14126 | 389 |
| 1020 | 3300050491 | nmdc:mga00v17_86930_c1 | nmdc:mga00v17_86930_c1_522_1709 | 389 |
| 1021 | 3300050495 | nmdc:mga04h51_4737_c1 | nmdc:mga04h51_4737_c1_1911_3098 | 389 |
| 1022 | 3300050507 | nmdc:mga05p37_409_c1 | nmdc:mga05p37_409_c1_20623_21804 | 389 |
| 1023 | 3300050507 | nmdc:mga05p37_65263_c1 | nmdc:mga05p37_65263_c1_986_2158 | 389 |
| 1024 | 3300050510 | nmdc:mga06r32_144539_c1 | nmdc:mga06r32_144539_c1_635_1810 | 389 |
| 1025 | 3300050511 | nmdc:mga08y16_49831_c1 | nmdc:mga08y16_49831_c1_1377_2549 | 389 |
| 1026 | 3300060353 | Ga0501082_0035853 | Ga0501082_0035853_1032_2204 | 389 |
| 1027 | 3300001979 | JGI24740J21852_10009447 | JGI24740J21852_100094472 | 390 |
| 1028 | 3300003758 | Ga0055532_1000113 | Ga0055532_100011341 | 390 |
| 1029 | 3300003760 | Ga0055527_1000242 | Ga0055527_10002427 | 390 |
| 1030 | 3300003761 | Ga0055535_1000099 | Ga0055535_100009942 | 390 |
| 1031 | 3300003762 | Ga0055542_1000135 | Ga0055542_100013552 | 390 |
| 1032 | 3300003763 | Ga0055529_1000115 | Ga0055529_100011567 | 390 |
| 1033 | 3300003781 | Ga0055536_1001612 | Ga0055536_10016123 | 390 |
| 1034 | 3300003790 | Ga0055528_1007543 | Ga0055528_10075432 | 390 |
| 1035 | 3300003791 | Ga0055530_10004685 | Ga0055530_100046855 | 390 |
| 1036 | 3300003792 | Ga0055540_1000397 | Ga0055540_100039722 | 390 |
| 1037 | 3300003794 | Ga0055531_10000503 | Ga0055531_1000050322 | 390 |
| 1038 | 3300005327 | Ga0070658_10096057 | Ga0070658_100960572 | 390 |
| 1039 | 3300005336 | Ga0070680_100225313 | Ga0070680_1002253131 | 390 |
| 1040 | 3300005338 | Ga0068868_100132870 | Ga0068868_1001328702 | 390 |
| 1041 | 3300005339 | Ga0070660_100000020 | Ga0070660_10000002030 | 390 |
| 1042 | 3300005344 | Ga0070661_100044521 | Ga0070661_1000445212 | 390 |
| 1043 | 3300005366 | Ga0070659_100000047 | Ga0070659_10000004730 | 390 |
| 1044 | 3300005367 | Ga0070667_100024223 | Ga0070667_1000242234 | 390 |
| 1045 | 3300005455 | Ga0070663_100000758 | Ga0070663_1000007585 | 390 |
| 1046 | 3300005456 | Ga0070678_100191780 | Ga0070678_1001917802 | 390 |
| 1047 | 3300005457 | Ga0070662_100238744 | Ga0070662_1002387441 | 390 |
| 1048 | 3300005535 | Ga0070684_100297393 | Ga0070684_1002973931 | 390 |
| 1049 | 3300005564 | Ga0070664_100260781 | Ga0070664_1002607811 | 390 |
| 1050 | 3300006195 | Ga0075366_10013447 | Ga0075366_100134472 | 390 |
| 1051 | 3300006195 | Ga0075366_10104505 | Ga0075366_101045052 | 390 |
| 1052 | 3300006946 | Ga0079104_1000002 | Ga0079104_100000239 | 390 |
| 1053 | 3300009092 | Ga0105250_10004011 | Ga0105250_100040116 | 390 |
| 1054 | 3300009093 | Ga0105240_10195882 | Ga0105240_101958822 | 390 |
| 1055 | 3300009148 | Ga0105243_10058881 | Ga0105243_100588813 | 390 |
| 1056 | 3300009551 | Ga0105238_10033676 | Ga0105238_100336764 | 390 |
| 1057 | 3300009551 | Ga0105238_10118203 | Ga0105238_101182032 | 390 |
| 1058 | 3300013100 | Ga0157373_10039234 | Ga0157373_100392342 | 390 |
| 1059 | 3300013306 | Ga0163162_10006734 | Ga0163162_100067342 | 390 |
| 1060 | 3300013307 | Ga0157372_10071569 | Ga0157372_100715692 | 390 |
| 1061 | 3300014326 | Ga0157380_10033039 | Ga0157380_100330393 | 390 |
| 1062 | 3300014497 | Ga0182008_10002237 | Ga0182008_100022375 | 390 |
| 1063 | 3300015262 | Ga0182007_10001509 | Ga0182007_100015099 | 390 |
| 1064 | 3300015265 | Ga0182005_1006357 | Ga0182005_10063573 | 390 |
| 1065 | 3300017792 | Ga0163161_10029674 | Ga0163161_100296743 | 390 |
| 1066 | 3300025228 | Ga0209672_100086 | Ga0209672_10008678 | 390 |
| 1067 | 3300025229 | Ga0209147_100148 | Ga0209147_10014841 | 390 |
| 1068 | 3300025242 | Ga0209258_100114 | Ga0209258_10011453 | 390 |
| 1069 | 3300025254 | Ga0209148_1000115 | Ga0209148_100011553 | 390 |
| 1070 | 3300025272 | Ga0209455_1000109 | Ga0209455_100010953 | 390 |
| 1071 | 3300025273 | Ga0209673_1000101 | Ga0209673_100010181 | 390 |
| 1072 | 3300025292 | Ga0209676_1000375 | Ga0209676_100037570 | 390 |
| 1073 | 3300025295 | Ga0209564_1006316 | Ga0209564_10063163 | 390 |
| 1074 | 3300025298 | Ga0209050_1000717 | Ga0209050_10007174 | 390 |
| 1075 | 3300025303 | Ga0209051_1000112 | Ga0209051_100011264 | 390 |
| 1076 | 3300025304 | Ga0209257_1000290 | Ga0209257_100029073 | 390 |
| 1077 | 3300025711 | Ga0207696_1015474 | Ga0207696_10154742 | 390 |
| 1078 | 3300025904 | Ga0207647_10007077 | Ga0207647_100070776 | 390 |
| 1079 | 3300025909 | Ga0207705_10063074 | Ga0207705_100630742 | 390 |
| 1080 | 3300025913 | Ga0207695_10000368 | Ga0207695_1000036884 | 390 |
| 1081 | 3300025913 | Ga0207695_10061723 | Ga0207695_100617232 | 390 |
| 1082 | 3300025914 | Ga0207671_10029582 | Ga0207671_100295822 | 390 |
| 1083 | 3300025919 | Ga0207657_10000390 | Ga0207657_1000039030 | 390 |
| 1084 | 3300025924 | Ga0207694_10148383 | Ga0207694_101483832 | 390 |
| 1085 | 3300025932 | Ga0207690_10000037 | Ga0207690_1000003775 | 390 |
| 1086 | 3300025935 | Ga0207709_10000015 | Ga0207709_1000001538 | 390 |
| 1087 | 3300025949 | Ga0207667_10061750 | Ga0207667_100617502 | 390 |
| 1088 | 3300026023 | Ga0207677_10091874 | Ga0207677_100918742 | 390 |
| 1089 | 3300026067 | Ga0207678_10000620 | Ga0207678_1000062011 | 390 |
| 1090 | 3300026142 | Ga0207698_10004173 | Ga0207698_100041739 | 390 |
| 1091 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007258 | 390 |
| 1092 | 3300031548 | Ga0307408_100002421 | Ga0307408_10000242111 | 390 |
| 1093 | 3300031548 | Ga0307408_100104768 | Ga0307408_1001047682 | 390 |
| 1094 | 3300031730 | Ga0307516_10077663 | Ga0307516_100776632 | 390 |
| 1095 | 3300031901 | Ga0307406_10015036 | Ga0307406_100150364 | 390 |
| 1096 | 3300032004 | Ga0307414_10010123 | Ga0307414_100101234 | 390 |
| 1097 | 3300042007 | Ga0439449_0002086 | Ga0439449_0002086_1335_2507 | 390 |
| 1098 | 3300046542 | Ga0495597_0000325 | Ga0495597_0000325_31704_32876 | 390 |
| 1099 | 3300048907 | Ga0496104_0122509 | Ga0496104_0122509_395_1663 | 390 |
| 1100 | 3300048908 | Ga0496105_0003138 | Ga0496105_0003138_4202_5374 | 390 |
| 1101 | 3300048916 | Ga0496113_0048323 | Ga0496113_0048323_267_1535 | 390 |
| 1102 | 3300048920 | Ga0496117_0106576 | Ga0496117_0106576_413_1681 | 390 |
| 1103 | 3300048924 | Ga0496121_0006704 | Ga0496121_0006704_7671_8939 | 390 |
| 1104 | 3300048928 | Ga0496125_0069121 | Ga0496125_0069121_235_1503 | 390 |
| 1105 | 3300049592 | Ga0501076_0209646 | Ga0501076_0209646_152_1324 | 390 |
| 1106 | 3300050490 | nmdc:mga03n38_7367_c1 | nmdc:mga03n38_7367_c1_385_1557 | 390 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3stp-assembly1.cif.gz_A | crystal structure of a putative galactonate dehydratase | 0.9868 | 1 | 385 |
| 3stp-assembly1.cif.gz_A | crystal structure of a putative galactonate dehydratase | 0.9843 | 1 | 385 |
| 3ssz-assembly1.cif.gz_A | the crystal structure of mandelate racemase/muconate lactonizing enzyme from rhodobacteraceae bacterium | 0.975 | 2 | 385 |
| 3sqs-assembly1.cif.gz_A | crystal structure of a putative mandelate racemase/muconate lactonizing protein from dinoroseobacter shibae dfl 12 | 0.9676 | 2 | 385 |
| 3ssz-assembly1.cif.gz_A | the crystal structure of mandelate racemase/muconate lactonizing enzyme from rhodobacteraceae bacterium | 0.9674 | 2 | 385 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3sszA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9847 | 129 | 374 | 3.20.20.120 |
| 3sszA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.973 | 129 | 374 | 3.20.20.120 |
| 3sszA01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9583 | 2 | 128 | 3.30.390.10 |
| af_P77215_158_345_3.30.390.10 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9424 | 137 | 331 | 3.30.390.10 |
| af_P77215_158_345_3.30.390.10 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9376 | 137 | 331 | 3.30.390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A381UYH1-F1-model_v4 | Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein | 0.9916 | 42 | 363 |
GO:0000287
GO:0016052 GO:0050032 |
| AF-A0A3A1VP46-F1-model_v4 | deleted | 0.9914 | 264 | 385 |
|
| AF-A0A382GLP6-F1-model_v4 | Mandelate racemase/muconate lactonizing enzyme N-terminal domain-containing protein | 0.9892 | 1 | 226 |
GO:0000287
GO:0016052 GO:0016836 |
| AF-A0A6L7S653-F1-model_v4 | L-rhamnonate dehydratase | 0.9873 | 103 | 385 |
GO:0000287
GO:0016052 GO:0016836 |
| AF-A0A6L8I1S3-F1-model_v4 | L-rhamnonate dehydratase | 0.9847 | 2 | 306 |
GO:0000287
GO:0016052 GO:0016836 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar