F489596

General Info

Members Datasets Scaffolds Average Seq Length
1077 408 897 198

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10079604|Ga0065704_100796044
Length 198
Sequence MLAPWQPLLEWWFGWGTSPQAVADEMSTLWFGKHHDAEAQALFGDLVEHALTGGLEEWQQSPQGWLGLLILLDQLPRMIYRDTPRAFEGDRRAQVVAMQGLQKGWDYQLLPIQRVFVLLVLEHAEVLDWQNLCVERYQMLLDEQPEANRRLFEGFLDYAEQHQRVIARFGRFPHRNLMLERPSTSEEMDFLLEPGSRF

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231006 Pseudomonas sp. GM17 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231008 Pseudomonas sp. GM21 Isolate Nodule
8 2511231010 Pseudomonas sp. GM25 Isolate Nodule
9 2511231011 Pseudomonas sp. GM30 Isolate Nodule
10 2511231012 Pseudomonas sp. GM33 Isolate Nodule
11 2511231014 Pseudomonas sp. GM48 Isolate Nodule
12 2511231015 Pseudomonas sp. GM49 Isolate Nodule
13 2511231016 Pseudomonas sp. GM50 Isolate Nodule
14 2511231017 Pseudomonas sp. GM55 Isolate Nodule
15 2511231018 Pseudomonas sp. GM60 Isolate Nodule
16 2511231019 Pseudomonas sp. GM67 Isolate Nodule
17 2511231020 Pseudomonas sp. GM74 Isolate Nodule
18 2511231021 Pseudomonas sp. GM78 Isolate Nodule
19 2511231022 Pseudomonas sp. GM79 Isolate Nodule
20 2511231023 Pseudomonas sp. GM80 Isolate Nodule
21 2511231031 Pseudomonas sp. GM16 Isolate Nodule
22 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
23 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
24 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
25 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
26 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
27 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
28 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
29 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
30 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
31 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
32 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
33 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
34 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
35 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
36 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
37 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
38 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
39 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
40 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
41 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
42 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
43 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
44 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
45 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
46 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
47 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
48 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
49 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
50 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
51 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
52 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
53 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
54 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
55 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
56 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
57 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
58 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
59 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
60 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
61 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
62 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
63 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
64 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
65 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
66 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
67 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
68 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
69 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
70 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
71 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
72 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
73 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
74 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
75 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
76 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
77 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
78 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
79 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
80 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
81 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
82 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
83 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
84 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
85 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
86 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
87 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
88 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
89 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
90 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
91 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
92 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
93 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
94 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
95 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
96 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
97 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
98 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
99 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
100 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
101 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
102 2773857670 Pseudomonas sp. 478 Isolate Unclassified
103 2773857673 Pseudomonas sp. 443 Isolate Unclassified
104 2784132063 Pseudomonas sp. 424 Isolate Unclassified
105 2784132072 Pseudomonas sp. 460 Isolate Unclassified
106 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
107 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
108 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
109 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
110 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
111 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
112 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
113 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
114 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
115 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
116 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
117 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
118 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
119 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
120 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
121 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
122 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
123 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
124 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
125 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
126 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
127 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
128 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
129 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
130 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
131 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
132 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
133 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
134 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
135 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
136 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
137 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
138 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
139 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
140 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
141 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
142 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
143 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
144 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
145 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
146 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
147 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
148 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
149 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
150 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
151 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
152 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
153 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
154 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
155 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
156 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
157 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
158 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
159 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
160 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
161 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
162 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
163 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
164 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
165 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
166 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
167 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
168 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
169 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
170 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
171 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
172 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
173 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
174 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
175 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
176 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
177 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
178 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
179 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
180 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
181 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
182 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
183 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
184 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
185 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
186 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
187 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
188 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
189 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
190 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
191 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
192 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
193 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
194 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
195 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
196 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
197 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
198 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
199 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
200 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
201 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
202 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
203 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
204 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
205 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
206 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
207 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
208 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
209 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
212 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
213 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
214 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
226 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
227 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
232 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
233 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
234 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
235 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
236 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
237 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
248 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
249 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
250 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
251 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
252 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
253 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
254 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
255 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
256 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
257 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
258 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
259 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
260 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
261 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
262 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
263 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
264 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
265 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
266 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
267 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
268 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
269 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
270 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
271 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
272 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
273 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
274 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
275 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
276 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
277 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
278 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
279 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
280 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
281 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
282 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
283 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
284 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
285 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
288 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
289 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
290 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
291 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
296 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
299 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
300 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
301 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
302 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
303 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
304 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
305 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
306 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
307 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
308 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
309 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
310 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
311 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
314 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
315 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
316 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
317 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
318 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
319 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
320 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
321 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
322 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
323 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
324 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
325 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
326 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
327 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
328 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
329 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
330 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
331 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
332 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
333 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
334 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
335 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
336 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
337 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
338 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
339 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
340 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
341 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
342 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
343 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
344 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
345 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
348 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
349 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
350 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
351 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
352 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
353 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
354 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
355 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
356 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
357 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
358 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
359 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
360 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
361 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
362 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
363 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
369 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
370 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
371 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
372 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
373 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
374 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
375 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
376 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
377 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
378 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
379 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
380 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
381 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
382 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
383 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
384 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
385 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
388 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
389 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
390 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
391 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
392 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
393 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
394 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
395 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
396 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
397 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
398 8052494512 Pseudomonas putida LD6 Isolate Unclassified
399 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
400 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
401 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
402 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
403 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
404 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
405 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
406 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
407 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
408 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.29
Metatranscriptomes 0
Isolates 16.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.74
Nodule 2.88
Rhizoplane 6.78
Rhizosphere 75.21
Stem 0
Stem Tuber 0
Unclassified 10.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_52 2124908027 Bacteria 34043
2 SwRhRL2b_contig_1475603 2162886007 Bacteria 952
3 MRS1b_contig_2669205 2162886011 Bacteria 2215
4 JGI25162J39368_1000129 3300002737 Bacteria 83712
5 JGI25163J39215_1001408 3300002771 Bacteria 4027
6 JGI25163J39215_1001444 3300002771 Bacteria 3909
7 JGI25164J39214_1000076 3300002772 Bacteria 95821
8 JGI25164J39214_1000101 3300002772 Bacteria 83715
9 JGI25165J46597_1000150 3300003214 Bacteria 115430
10 JGI25165J46597_1000180 3300003214 Bacteria 95821
11 Ga0055536_1000312 3300003781 Bacteria 36538
12 Ga0055536_1003306 3300003781 Bacteria 8724
13 Ga0055536_1021229 3300003781 Bacteria 1977
14 Ga0055530_10000404 3300003791 Bacteria 38699
15 Ga0055530_10003582 3300003791 Bacteria 8724
16 Ga0055530_10003672 3300003791 Bacteria 8572
17 Ga0055540_1000339 3300003792 Bacteria 40092
18 Ga0055540_1002883 3300003792 Bacteria 8724
19 Ga0055540_1002945 3300003792 Bacteria 8563
20 Ga0055531_10000238 3300003794 Bacteria 60414
21 Ga0065714_10002970 3300005288 Bacteria 9705
22 Ga0065714_10009649 3300005288 Bacteria 3854
23 Ga0065714_10013965 3300005288 Bacteria 1968
24 Ga0065714_10065496 3300005288 Bacteria 9739
25 Ga0065714_10105677 3300005288 Bacteria 1562
26 Ga0065714_10236865 3300005288 Bacteria 799
27 Ga0065704_10071810 3300005289 Bacteria 9874
28 Ga0065704_10079604 3300005289 Bacteria 4119
29 Ga0065704_10132020 3300005289 Bacteria 1616
30 Ga0065704_10252860 3300005289 Bacteria 985
31 Ga0065704_10336932 3300005289 Bacteria 829
32 Ga0065712_10011023 3300005290 Bacteria 1890
33 Ga0070669_100000233 3300005353 Bacteria 46639
34 Ga0070662_100050060 3300005457 Bacteria 3013
35 Ga0070665_100851998 3300005548 Bacteria 924
36 Ga0075364_10382202 3300006051 Bacteria 960
37 Ga0075364_10435456 3300006051 Bacteria 896
38 Ga0075432_10001952 3300006058 Bacteria 6850
39 Ga0075432_10061096 3300006058 Bacteria 1341
40 Ga0075432_10074320 3300006058 Bacteria 1224
41 Ga0075432_10133939 3300006058 Bacteria 940
42 Ga0075362_10170789 3300006177 Bacteria 1050
43 Ga0075436_100070423 3300006914 Bacteria 2418
44 Ga0075436_100403642 3300006914 Bacteria 990
45 Ga0099823_1007118 3300006944 Bacteria 11327
46 Ga0099823_1088359 3300006944 Bacteria 1089
47 Ga0079104_1000423 3300006946 Bacteria 48297
48 Ga0079104_1001202 3300006946 Bacteria 18420
49 Ga0079104_1082988 3300006946 Bacteria 657
50 Ga0099826_10031348 3300006948 Bacteria 3847
51 Ga0105251_10057788 3300009011 Bacteria 1833
52 Ga0105251_10065668 3300009011 Bacteria 1698
53 Ga0105251_10209644 3300009011 Bacteria 877
54 Ga0105244_10008644 3300009036 Bacteria 6342
55 Ga0105244_10009518 3300009036 Bacteria 5968
56 Ga0105244_10009952 3300009036 Bacteria 5797
57 Ga0105244_10013527 3300009036 Bacteria 4764
58 Ga0105244_10016561 3300009036 Bacteria 4195
59 Ga0105244_10039366 3300009036 Bacteria 2461
60 Ga0105244_10072826 3300009036 Bacteria 1711
61 Ga0105244_10087337 3300009036 Bacteria 1537
62 Ga0105244_10093106 3300009036 Bacteria 1480
63 Ga0105244_10221878 3300009036 Bacteria 886
64 Ga0105250_10001638 3300009092 Bacteria 11927
65 Ga0105250_10018379 3300009092 Bacteria 2832
66 Ga0105250_10028488 3300009092 Bacteria 2249
67 Ga0105250_10053860 3300009092 Bacteria 1614
68 Ga0105250_10105964 3300009092 Bacteria 1149
69 Ga0105250_10170766 3300009092 Bacteria 910
70 Ga0105243_10000299 3300009148 Bacteria 54796
71 Ga0105243_10001887 3300009148 Bacteria 17864
72 Ga0105243_10047304 3300009148 Bacteria 3386
73 Ga0105243_10137242 3300009148 Bacteria 2082
74 Ga0105242_10328437 3300009176 Bacteria 1405
75 Ga0105242_11163892 3300009176 Bacteria 789
76 Ga0105246_10002004 3300011119 Bacteria 12297
77 Ga0105246_10101845 3300011119 Bacteria 2093
78 Ga0157345_1001666 3300012498 Bacteria 1559
79 Ga0157347_1031758 3300012502 Bacteria 664
80 Ga0157373_10000945 3300013100 Bacteria 22511
81 Ga0157373_10147580 3300013100 Bacteria 1654
82 Ga0157373_10177542 3300013100 Bacteria 1499
83 Ga0157371_10004002 3300013102 Bacteria 13059
84 Ga0157371_10005478 3300013102 Bacteria 10690
85 Ga0157371_10012849 3300013102 Bacteria 6377
86 Ga0157371_10304475 3300013102 Bacteria 1154
87 Ga0157371_10361784 3300013102 Bacteria 1057
88 Ga0157371_10623606 3300013102 Bacteria 803
89 Ga0157370_10023954 3300013104 Bacteria 6052
90 Ga0157370_10056033 3300013104 Bacteria 3753
91 Ga0157370_10112108 3300013104 Bacteria 2550
92 Ga0157370_10265443 3300013104 Bacteria 1586
93 Ga0157370_10526386 3300013104 Bacteria 1085
94 Ga0157370_10559520 3300013104 Bacteria 1048
95 Ga0157369_10068916 3300013105 Bacteria 3801
96 Ga0157369_10108625 3300013105 Bacteria 2950
97 Ga0157369_10538158 3300013105 Bacteria 1208
98 Ga0157369_10643160 3300013105 Bacteria 1094
99 Ga0163162_10023363 3300013306 Bacteria 6102
100 Ga0163162_10313239 3300013306 Bacteria 1702
101 Ga0157372_10105826 3300013307 Bacteria 3218
102 Ga0182008_10003739 3300014497 Bacteria 9067
103 Ga0182008_10007470 3300014497 Bacteria 6031
104 Ga0182008_10008836 3300014497 Bacteria 5468
105 Ga0182008_10023268 3300014497 Bacteria 3167
106 Ga0182008_10026929 3300014497 Bacteria 2914
107 Ga0182008_10046317 3300014497 Bacteria 2162
108 Ga0182008_10084800 3300014497 Bacteria 1560
109 Ga0182008_10207141 3300014497 Bacteria 999
110 Ga0182008_10365040 3300014497 Bacteria 769
111 Ga0182006_1000753 3300015261 Bacteria 22122
112 Ga0182006_1005124 3300015261 Bacteria 6297
113 Ga0182006_1020800 3300015261 Bacteria 2745
114 Ga0182006_1026552 3300015261 Bacteria 2369
115 Ga0182006_1044318 3300015261 Bacteria 1735
116 Ga0182006_1058122 3300015261 Bacteria 1468
117 Ga0182007_10001061 3300015262 Bacteria 14989
118 Ga0182007_10040384 3300015262 Bacteria 1558
119 Ga0182007_10057015 3300015262 Bacteria 1282
120 Ga0182007_10136843 3300015262 Bacteria 827
121 Ga0182005_1002918 3300015265 Bacteria 5939
122 Ga0182005_1021781 3300015265 Bacteria 1757
123 Ga0182005_1023237 3300015265 Bacteria 1696
124 Ga0182005_1036292 3300015265 Bacteria 1340
125 Ga0163161_10016885 3300017792 Bacteria 5102
126 Ga0163161_10029907 3300017792 Bacteria 3873
127 Ga0163161_10036066 3300017792 Bacteria 3541
128 Ga0163161_10151877 3300017792 Bacteria 1760
129 Ga0163161_10708586 3300017792 Bacteria 839
130 Ga0209760_100080 3300025207 Bacteria 77279
131 Ga0209760_100159 3300025207 Bacteria 40609
132 Ga0209563_102899 3300025230 Bacteria 3712
133 Ga0207427_100014 3300025231 Bacteria 561361
134 Ga0207427_100016 3300025231 Bacteria 538697
135 Ga0209437_100011 3300025233 Bacteria 818520
136 Ga0209437_100016 3300025233 Bacteria 710118
137 Ga0209233_1000019 3300025261 Bacteria 818520
138 Ga0209233_1000036 3300025261 Bacteria 561361
139 Ga0209675_1007415 3300025291 Bacteria 4210
140 Ga0209676_1000025 3300025292 Bacteria 577569
141 Ga0209676_1000032 3300025292 Bacteria 469558
142 Ga0209676_1000208 3300025292 Bacteria 130879
143 Ga0209676_1000519 3300025292 Bacteria 60439
144 Ga0209676_1008270 3300025292 Bacteria 4673
145 Ga0209676_1011363 3300025292 Bacteria 3598
146 Ga0209050_1000025 3300025298 Bacteria 528225
147 Ga0209050_1000028 3300025298 Bacteria 477133
148 Ga0209050_1000381 3300025298 Bacteria 83623
149 Ga0209050_1004298 3300025298 Bacteria 9733
150 Ga0209051_1000026 3300025303 Bacteria 413311
151 Ga0209051_1000039 3300025303 Bacteria 319632
152 Ga0209051_1000047 3300025303 Bacteria 293227
153 Ga0209051_1000080 3300025303 Bacteria 199694
154 Ga0209257_1000034 3300025304 Bacteria 662719
155 Ga0209257_1025113 3300025304 Bacteria 2044
156 Ga0207696_1000057 3300025711 Bacteria 249404
157 Ga0207696_1000074 3300025711 Bacteria 215333
158 Ga0207696_1001528 3300025711 Bacteria 12402
159 Ga0207696_1001618 3300025711 Bacteria 11910
160 Ga0207696_1001785 3300025711 Bacteria 11107
161 Ga0207696_1012979 3300025711 Bacteria 2925
162 Ga0207696_1021497 3300025711 Bacteria 2065
163 Ga0207696_1024317 3300025711 Bacteria 1901
164 Ga0207655_1001007 3300025728 Bacteria 28675
165 Ga0207655_1001190 3300025728 Bacteria 25175
166 Ga0207655_1001386 3300025728 Bacteria 22646
167 Ga0207655_1002635 3300025728 Bacteria 14206
168 Ga0207655_1004551 3300025728 Bacteria 9772
169 Ga0207655_1008767 3300025728 Bacteria 6367
170 Ga0207655_1008967 3300025728 Bacteria 6273
171 Ga0207655_1009044 3300025728 Bacteria 6237
172 Ga0207655_1014720 3300025728 Bacteria 4400
173 Ga0207655_1025214 3300025728 Bacteria 2892
174 Ga0207655_1029864 3300025728 Bacteria 2544
175 Ga0207655_1030573 3300025728 Bacteria 2502
176 Ga0207655_1042014 3300025728 Bacteria 1952
177 Ga0207655_1158757 3300025728 Bacteria 709
178 Ga0207713_1002649 3300025735 Bacteria 12860
179 Ga0207713_1002650 3300025735 Bacteria 12853
180 Ga0207713_1008684 3300025735 Bacteria 5807
181 Ga0207713_1015567 3300025735 Bacteria 3897
182 Ga0207713_1018900 3300025735 Bacteria 3394
183 Ga0207713_1020907 3300025735 Bacteria 3152
184 Ga0207713_1035758 3300025735 Bacteria 2140
185 Ga0207713_1036589 3300025735 Bacteria 2104
186 Ga0207713_1036810 3300025735 Bacteria 2095
187 Ga0207713_1041267 3300025735 Bacteria 1927
188 Ga0207713_1048553 3300025735 Bacteria 1708
189 Ga0207713_1152342 3300025735 Bacteria 745
190 Ga0207681_10003730 3300025923 Bacteria 9469
191 Ga0207706_10150088 3300025933 Bacteria 2050
192 Ga0207686_10240835 3300025934 Bacteria 1316
193 Ga0207686_10693268 3300025934 Bacteria 809
194 Ga0207709_10000451 3300025935 Bacteria 38328
195 Ga0207709_10001143 3300025935 Bacteria 19344
196 Ga0207709_10014819 3300025935 Bacteria 4310
197 Ga0207709_10235104 3300025935 Bacteria 1330
198 Ga0209281_1000026 3300027111 Bacteria 465877
199 Ga0209281_1000033 3300027111 Bacteria 383539
200 Ga0209281_1008220 3300027111 Bacteria 2553
201 Ga0209281_1037826 3300027111 Bacteria 827
202 Ga0209281_1039692 3300027111 Bacteria 798
203 Ga0209389_1000190 3300027296 Bacteria 46313
204 Ga0209389_1073805 3300027296 Bacteria 1800
205 Ga0209371_1000630 3300027312 Bacteria 31210
206 Ga0209371_1057069 3300027312 Bacteria 729
207 Ga0209999_1035782 3300027543 Bacteria 926
208 Ga0207428_10068561 3300027907 Bacteria 2790
209 Ga0207428_10086363 3300027907 Bacteria 2442
210 Ga0207428_10173455 3300027907 Bacteria 1632
211 Ga0207428_10188003 3300027907 Bacteria 1558
212 Ga0207428_10461898 3300027907 Bacteria 925
213 Ga0268266_10010145 3300028379 Bacteria 8256
214 Ga0268266_10051944 3300028379 Bacteria 3519
215 Ga0268256_1000273 3300030500 Bacteria 53445
216 Ga0268256_1063969 3300030500 Bacteria 729
217 Ga0307511_10145036 3300030521 Bacteria 1382
218 Ga0316177_1034781 3300030731 Bacteria 1906
219 Ga0316177_1094337 3300030731 Bacteria 753
220 Ga0314311_1075429 3300030733 Bacteria 7772
221 Ga0316179_1046502 3300030734 Bacteria 2906
222 Ga0316178_1102168 3300030735 Bacteria 42019
223 Ga0316181_1032700 3300030744 Bacteria 1561
224 Ga0316181_1121023 3300030744 Bacteria 6205
225 Ga0307408_100000002 3300031548 Bacteria 827227
226 Ga0307408_100012498 3300031548 Bacteria 5627
227 Ga0307408_100235261 3300031548 Bacteria 1502
228 Ga0307408_100247501 3300031548 Bacteria 1468
229 Ga0307408_100270026 3300031548 Bacteria 1411
230 Ga0307408_100473090 3300031548 Bacteria 1091
231 Ga0307516_10150724 3300031730 Bacteria 2086
232 Ga0307405_10008242 3300031731 Bacteria 5270
233 Ga0307405_10208162 3300031731 Bacteria 1426
234 Ga0307405_11060458 3300031731 Bacteria 694
235 Ga0307406_10075207 3300031901 Bacteria 2227
236 Ga0307406_10449820 3300031901 Bacteria 1033
237 Ga0307412_10019210 3300031911 Bacteria 4132
238 Ga0307412_10022176 3300031911 Bacteria 3889
239 Ga0307412_10074041 3300031911 Bacteria 2332
240 Ga0307412_10383636 3300031911 Bacteria 1138
241 Ga0307409_100098675 3300031995 Bacteria 2416
242 Ga0307416_100603663 3300032002 Bacteria 1177
243 Ga0307416_100732095 3300032002 Bacteria 1080
244 Ga0307414_10026090 3300032004 Bacteria 3755
245 Ga0307414_10180202 3300032004 Bacteria 1698
246 Ga0307411_10017361 3300032005 Bacteria 4098
247 Ga0307411_10020058 3300032005 Bacteria 3878
248 Ga0307411_10269808 3300032005 Bacteria 1348
249 Ga0307510_10062849 3300033180 Bacteria 3788
250 Ga0237819_01489 3300038705 Bacteria 6005
251 Ga0439436_0023073 3300041404 Bacteria 1841
252 Ga0439438_001802 3300041405 Bacteria 9402
253 Ga0439438_003654 3300041405 Bacteria 6145
254 Ga0439438_004828 3300041405 Bacteria 5080
255 Ga0439438_005738 3300041405 Bacteria 4514
256 Ga0439438_016022 3300041405 Bacteria 2188
257 Ga0439438_016104 3300041405 Bacteria 2180
258 Ga0439438_018083 3300041405 Bacteria 2014
259 Ga0439438_036906 3300041405 Bacteria 1279
260 Ga0439438_091702 3300041405 Bacteria 739
261 Ga0439447_002676 3300041407 Bacteria 6451
262 Ga0439447_003145 3300041407 Bacteria 5885
263 Ga0439447_004670 3300041407 Bacteria 4667
264 Ga0439447_023317 3300041407 Bacteria 1614
265 Ga0439447_023670 3300041407 Bacteria 1597
266 Ga0439447_034585 3300041407 Bacteria 1255
267 Ga0439447_037076 3300041407 Bacteria 1202
268 Ga0439447_040885 3300041407 Bacteria 1130
269 Ga0439466_0001279 3300041411 Bacteria 9786
270 Ga0439466_0002609 3300041411 Bacteria 7054
271 Ga0439466_0007307 3300041411 Bacteria 4183
272 Ga0439466_0012672 3300041411 Bacteria 3099
273 Ga0439466_0017279 3300041411 Bacteria 2600
274 Ga0439466_0019640 3300041411 Bacteria 2417
275 Ga0439466_0019683 3300041411 Bacteria 2414
276 Ga0439466_0034938 3300041411 Bacteria 1702
277 Ga0439466_0045757 3300041411 Bacteria 1446
278 Ga0439466_0067547 3300041411 Bacteria 1143
279 Ga0439465_0049967 3300041413 Bacteria 1367
280 Ga0439465_0159963 3300041413 Bacteria 807
281 Ga0451841_0662075 3300041498 Bacteria 947
282 Ga0439442_065256 3300042002 Bacteria 773
283 Ga0439445_0024078 3300042004 Bacteria 1545
284 Ga0439432_000595 3300042006 Bacteria 13598
285 Ga0439432_000775 3300042006 Bacteria 11997
286 Ga0439432_006348 3300042006 Bacteria 4229
287 Ga0439432_013395 3300042006 Bacteria 2789
288 Ga0439432_103675 3300042006 Bacteria 849
289 Ga0439451_000219 3300042009 Bacteria 10960
290 Ga0439451_002362 3300042009 Bacteria 3820
291 Ga0439451_021435 3300042009 Bacteria 1303
292 Ga0439451_029436 3300042009 Bacteria 1105
293 Ga0439451_036052 3300042009 Bacteria 994
294 Ga0439451_054542 3300042009 Bacteria 800
295 Ga0439452_000786 3300042010 Bacteria 15052
296 Ga0439452_000858 3300042010 Bacteria 14069
297 Ga0439452_000882 3300042010 Bacteria 13826
298 Ga0439452_002364 3300042010 Bacteria 7004
299 Ga0439452_003489 3300042010 Bacteria 5498
300 Ga0439452_007333 3300042010 Bacteria 3384
301 Ga0439452_019195 3300042010 Bacteria 1811
302 Ga0439452_053247 3300042010 Bacteria 921
303 Ga0439456_001434 3300042013 Bacteria 4790
304 Ga0439456_013110 3300042013 Bacteria 1723
305 Ga0439456_034888 3300042013 Bacteria 1084
306 Ga0439456_037733 3300042013 Bacteria 1043
307 Ga0439456_103814 3300042013 Bacteria 644
308 Ga0439463_000059 3300042016 Bacteria 23483
309 Ga0439463_000975 3300042016 Bacteria 7795
310 Ga0439463_023114 3300042016 Bacteria 1557
311 Ga0439463_024566 3300042016 Bacteria 1510
312 Ga0439463_039072 3300042016 Bacteria 1205
313 Ga0450911_000355 3300042115 Bacteria 15573
314 Ga0450911_008084 3300042115 Bacteria 1506
315 Ga0450919_003787 3300042121 Bacteria 1876
316 Ga0450922_002212 3300042124 Bacteria 1840
317 Ga0450922_013753 3300042124 Bacteria 793
318 Ga0450923_000363 3300042125 Bacteria 4730
319 Ga0450923_027521 3300042125 Bacteria 1143
320 Ga0450900_010246 3300042136 Bacteria 1199
321 Ga0450902_006084 3300042137 Bacteria 1840
322 Ga0450902_007993 3300042137 Bacteria 1644
323 Ga0450902_013193 3300042137 Bacteria 1330
324 Ga0450902_019776 3300042137 Bacteria 1109
325 Ga0450902_023966 3300042137 Bacteria 1014
326 Ga0450903_014745 3300042138 Bacteria 1235
327 Ga0450904_001666 3300042139 Bacteria 2980
328 Ga0450904_009174 3300042139 Bacteria 975
329 Ga0450904_014253 3300042139 Bacteria 792
330 Ga0450905_002901 3300042142 Bacteria 2231
331 Ga0450905_034651 3300042142 Bacteria 788
332 Ga0450906_014183 3300042145 Bacteria 1461
333 Ga0450906_035512 3300042145 Bacteria 879
334 Ga0450907_000751 3300042146 Bacteria 8228
335 Ga0450907_005713 3300042146 Bacteria 2094
336 Ga0450907_005795 3300042146 Bacteria 2077
337 Ga0450910_012410 3300042147 Bacteria 1231
338 Ga0450910_020715 3300042147 Bacteria 992
339 Ga0439446_0000081 3300042156 Bacteria 15751
340 Ga0439446_0009359 3300042156 Bacteria 2622
341 Ga0439446_0065059 3300042156 Bacteria 1108
342 Ga0450908_014825 3300042184 Bacteria 1398
343 Ga0450908_018726 3300042184 Bacteria 1222
344 Ga0450909_014786 3300042185 Bacteria 1149
345 Ga0439434_0001340 3300042435 Bacteria 7096
346 Ga0439434_0013350 3300042435 Bacteria 2438
347 Ga0439464_0000180 3300042439 Bacteria 10873
348 Ga0439464_0014826 3300042439 Bacteria 2099
349 Ga0439460_0007942 3300042461 Bacteria 2669
350 Ga0439460_0026436 3300042461 Bacteria 1623
351 Ga0450918_035818 3300042531 Bacteria 883
352 Ga0450893_0011986 3300042532 Bacteria 1436
353 Ga0450901_001588 3300042533 Bacteria 2570
354 Ga0439440_0019024 3300042993 Bacteria 1527
355 Ga0439440_0024970 3300042993 Bacteria 1373
356 Ga0439440_0054586 3300042993 Bacteria 1006
357 Ga0495617_000455 3300046452 Bacteria 22035
358 Ga0495617_008242 3300046452 Bacteria 3596
359 Ga0495617_010516 3300046452 Bacteria 3170
360 Ga0495617_018854 3300046452 Bacteria 2334
361 Ga0495617_027193 3300046452 Bacteria 1925
362 Ga0495617_037441 3300046452 Bacteria 1624
363 Ga0495617_037529 3300046452 Bacteria 1622
364 Ga0495617_052407 3300046452 Bacteria 1355
365 Ga0495627_005394 3300046453 Bacteria 5160
366 Ga0495627_025389 3300046453 Bacteria 1922
367 Ga0495627_045176 3300046453 Bacteria 1342
368 Ga0495627_052872 3300046453 Bacteria 1217
369 Ga0495603_0069851 3300046455 Bacteria 2065
370 Ga0495603_0200734 3300046455 Bacteria 1152
371 Ga0495603_0328673 3300046455 Bacteria 877
372 Ga0495603_0336349 3300046455 Bacteria 866
373 Ga0495590_0003662 3300046457 Bacteria 6255
374 Ga0495590_0005324 3300046457 Bacteria 5109
375 Ga0495590_0035972 3300046457 Bacteria 1728
376 Ga0495590_0043579 3300046457 Bacteria 1564
377 Ga0495590_0072389 3300046457 Bacteria 1210
378 Ga0495590_0154541 3300046457 Bacteria 832
379 Ga0495590_0222446 3300046457 Bacteria 697
380 Ga0495590_0224123 3300046457 Bacteria 695
381 Ga0495591_000668 3300046458 Bacteria 25300
382 Ga0495591_002443 3300046458 Bacteria 10336
383 Ga0495591_004511 3300046458 Bacteria 6779
384 Ga0495591_009614 3300046458 Bacteria 3824
385 Ga0495591_011156 3300046458 Bacteria 3421
386 Ga0495591_019077 3300046458 Bacteria 2306
387 Ga0495591_027027 3300046458 Bacteria 1774
388 Ga0495591_029507 3300046458 Bacteria 1665
389 Ga0495591_044350 3300046458 Bacteria 1246
390 Ga0495591_049763 3300046458 Bacteria 1150
391 Ga0495591_055672 3300046458 Bacteria 1065
392 Ga0495591_082483 3300046458 Bacteria 817
393 Ga0495591_096415 3300046458 Bacteria 737
394 Ga0495629_0123644 3300046459 Bacteria 1802
395 Ga0495638_0012439 3300046460 Bacteria 5834
396 Ga0495638_0028218 3300046460 Bacteria 3625
397 Ga0495638_0035196 3300046460 Bacteria 3193
398 Ga0495638_0061880 3300046460 Bacteria 2311
399 Ga0495638_0068844 3300046460 Bacteria 2169
400 Ga0495638_0084640 3300046460 Bacteria 1919
401 Ga0495638_0095065 3300046460 Bacteria 1790
402 Ga0495638_0098972 3300046460 Bacteria 1746
403 Ga0495638_0115535 3300046460 Bacteria 1590
404 Ga0495638_0162267 3300046460 Bacteria 1288
405 Ga0495638_0196748 3300046460 Bacteria 1140
406 Ga0495638_0258099 3300046460 Bacteria 957
407 Ga0495638_0440320 3300046460 Bacteria 667
408 Ga0495650_0000718 3300046471 Bacteria 42025
409 Ga0495650_0009711 3300046471 Bacteria 5451
410 Ga0495650_0025619 3300046471 Bacteria 2759
411 Ga0495650_0035372 3300046471 Bacteria 2199
412 Ga0495650_0037040 3300046471 Bacteria 2127
413 Ga0495650_0058180 3300046471 Bacteria 1561
414 Ga0495650_0070280 3300046471 Bacteria 1375
415 Ga0495650_0090063 3300046471 Bacteria 1168
416 Ga0495650_0139875 3300046471 Bacteria 876
417 Ga0495650_0187509 3300046471 Bacteria 724
418 Ga0495582_0051045 3300046473 Bacteria 2280
419 Ga0495605_0005176 3300046474 Bacteria 7598
420 Ga0495605_0009136 3300046474 Bacteria 5576
421 Ga0495605_0034883 3300046474 Bacteria 2544
422 Ga0495605_0039788 3300046474 Bacteria 2353
423 Ga0495605_0062241 3300046474 Bacteria 1783
424 Ga0495605_0104383 3300046474 Bacteria 1299
425 Ga0495605_0111678 3300046474 Bacteria 1246
426 Ga0495605_0203645 3300046474 Bacteria 861
427 Ga0495605_0235409 3300046474 Bacteria 787
428 Ga0495639_0001263 3300046475 Bacteria 11392
429 Ga0495639_0023584 3300046475 Bacteria 2706
430 Ga0495639_0088834 3300046475 Bacteria 1447
431 Ga0495584_0003386 3300046491 Bacteria 8802
432 Ga0495584_0007989 3300046491 Bacteria 5498
433 Ga0495584_0009605 3300046491 Bacteria 4983
434 Ga0495584_0009780 3300046491 Bacteria 4932
435 Ga0495584_0012470 3300046491 Bacteria 4338
436 Ga0495584_0016376 3300046491 Bacteria 3780
437 Ga0495584_0026970 3300046491 Bacteria 2910
438 Ga0495584_0052857 3300046491 Bacteria 2044
439 Ga0495584_0065932 3300046491 Bacteria 1821
440 Ga0495584_0085372 3300046491 Bacteria 1590
441 Ga0495584_0286103 3300046491 Bacteria 837
442 Ga0495584_0409651 3300046491 Bacteria 689
443 Ga0495585_0005619 3300046492 Bacteria 7875
444 Ga0495585_0006088 3300046492 Bacteria 7538
445 Ga0495585_0010425 3300046492 Bacteria 5531
446 Ga0495585_0069938 3300046492 Bacteria 1915
447 Ga0495585_0079002 3300046492 Bacteria 1784
448 Ga0495585_0094044 3300046492 Bacteria 1611
449 Ga0495585_0126753 3300046492 Bacteria 1346
450 Ga0495585_0134730 3300046492 Bacteria 1297
451 Ga0495585_0321566 3300046492 Bacteria 756
452 Ga0495594_0135885 3300046499 Bacteria 1393
453 Ga0495594_0149148 3300046499 Bacteria 1327
454 Ga0495594_0278278 3300046499 Bacteria 953
455 Ga0495596_0000545 3300046500 Bacteria 23624
456 Ga0495596_0009976 3300046500 Bacteria 4156
457 Ga0495607_0002719 3300046501 Bacteria 14112
458 Ga0495607_0004529 3300046501 Bacteria 10203
459 Ga0495607_0011725 3300046501 Bacteria 5816
460 Ga0495607_0021554 3300046501 Bacteria 4053
461 Ga0495607_0027707 3300046501 Bacteria 3500
462 Ga0495607_0054926 3300046501 Bacteria 2293
463 Ga0495607_0112956 3300046501 Bacteria 1437
464 Ga0495607_0114085 3300046501 Bacteria 1428
465 Ga0495607_0160168 3300046501 Bacteria 1144
466 Ga0495607_0162951 3300046501 Bacteria 1131
467 Ga0495583_0004153 3300046506 Bacteria 10584
468 Ga0495583_0004386 3300046506 Bacteria 10129
469 Ga0495583_0005841 3300046506 Bacteria 8210
470 Ga0495583_0081461 3300046506 Bacteria 1405
471 Ga0495583_0129364 3300046506 Bacteria 1057
472 Ga0495606_0000447 3300046507 Bacteria 67335
473 Ga0495606_0013954 3300046507 Bacteria 6302
474 Ga0495606_0016616 3300046507 Bacteria 5601
475 Ga0495606_0047624 3300046507 Bacteria 2824
476 Ga0495606_0052345 3300046507 Bacteria 2655
477 Ga0495606_0066377 3300046507 Bacteria 2288
478 Ga0495610_0011082 3300046512 Bacteria 5536
479 Ga0495610_0015733 3300046512 Bacteria 4385
480 Ga0495610_0016575 3300046512 Bacteria 4234
481 Ga0495610_0028275 3300046512 Bacteria 2967
482 Ga0495610_0028769 3300046512 Bacteria 2935
483 Ga0495610_0091376 3300046512 Bacteria 1379
484 Ga0495610_0242977 3300046512 Bacteria 717
485 Ga0495616_0008264 3300046513 Bacteria 6177
486 Ga0495616_0044744 3300046513 Bacteria 2244
487 Ga0495616_0065538 3300046513 Bacteria 1769
488 Ga0495616_0095772 3300046513 Bacteria 1398
489 Ga0495616_0097330 3300046513 Bacteria 1384
490 Ga0495616_0154822 3300046513 Bacteria 1034
491 Ga0495616_0207843 3300046513 Bacteria 857
492 Ga0495620_0000146 3300046515 Bacteria 57888
493 Ga0495620_0001025 3300046515 Bacteria 17183
494 Ga0495620_0007957 3300046515 Bacteria 5716
495 Ga0495620_0011678 3300046515 Bacteria 4570
496 Ga0495620_0033790 3300046515 Bacteria 2317
497 Ga0495620_0084459 3300046515 Bacteria 1280
498 Ga0495620_0148426 3300046515 Bacteria 914
499 Ga0495628_0110833 3300046516 Bacteria 2111
500 Ga0495628_0623214 3300046516 Bacteria 768
501 Ga0495630_0251400 3300046517 Bacteria 1350
502 Ga0495630_0259542 3300046517 Bacteria 1327
503 Ga0495631_0001255 3300046518 Bacteria 15676
504 Ga0495631_0002798 3300046518 Bacteria 9679
505 Ga0495631_0019223 3300046518 Bacteria 3205
506 Ga0495631_0053416 3300046518 Bacteria 1763
507 Ga0495631_0134440 3300046518 Bacteria 1062
508 Ga0495631_0220987 3300046518 Bacteria 808
509 Ga0495632_0000599 3300046519 Bacteria 33406
510 Ga0495632_0001743 3300046519 Bacteria 17635
511 Ga0495632_0008921 3300046519 Bacteria 6093
512 Ga0495632_0010081 3300046519 Bacteria 5626
513 Ga0495632_0018363 3300046519 Bacteria 3838
514 Ga0495632_0026449 3300046519 Bacteria 3054
515 Ga0495632_0065399 3300046519 Bacteria 1756
516 Ga0495632_0106291 3300046519 Bacteria 1320
517 Ga0495632_0114596 3300046519 Bacteria 1263
518 Ga0495632_0136740 3300046519 Bacteria 1138
519 Ga0495632_0186571 3300046519 Bacteria 948
520 Ga0495632_0217171 3300046519 Bacteria 865
521 Ga0495637_0000298 3300046520 Bacteria 38413
522 Ga0495637_0003904 3300046520 Bacteria 7820
523 Ga0495637_0012181 3300046520 Bacteria 4117
524 Ga0495637_0013878 3300046520 Bacteria 3813
525 Ga0495637_0015426 3300046520 Bacteria 3582
526 Ga0495637_0048387 3300046520 Bacteria 1791
527 Ga0495637_0062269 3300046520 Bacteria 1527
528 Ga0495637_0073028 3300046520 Bacteria 1381
529 Ga0495637_0123619 3300046520 Bacteria 993
530 Ga0495637_0141674 3300046520 Bacteria 912
531 Ga0495637_0142833 3300046520 Bacteria 907
532 Ga0495637_0162630 3300046520 Bacteria 836
533 Ga0495643_0010831 3300046522 Bacteria 5591
534 Ga0495643_0011262 3300046522 Bacteria 5459
535 Ga0495643_0031987 3300046522 Bacteria 2923
536 Ga0495644_0001580 3300046523 Bacteria 9287
537 Ga0495644_0014061 3300046523 Bacteria 3067
538 Ga0495648_0002138 3300046524 Bacteria 18598
539 Ga0495648_0013653 3300046524 Bacteria 5989
540 Ga0495648_0017526 3300046524 Bacteria 5115
541 Ga0495648_0029310 3300046524 Bacteria 3654
542 Ga0495648_0067009 3300046524 Bacteria 2101
543 Ga0495648_0081478 3300046524 Bacteria 1840
544 Ga0495648_0088603 3300046524 Bacteria 1739
545 Ga0495648_0099266 3300046524 Bacteria 1611
546 Ga0495648_0112168 3300046524 Bacteria 1481
547 Ga0495648_0228609 3300046524 Bacteria 912
548 Ga0495648_0259869 3300046524 Bacteria 833
549 Ga0495648_0310154 3300046524 Bacteria 735
550 Ga0495648_0372867 3300046524 Bacteria 645
551 Ga0495666_0061660 3300046526 Bacteria 1791
552 Ga0495666_0138443 3300046526 Bacteria 1135
553 Ga0495642_0000662 3300046528 Bacteria 17247
554 Ga0495642_0000940 3300046528 Bacteria 13633
555 Ga0495642_0001149 3300046528 Bacteria 12168
556 Ga0495654_0002507 3300046530 Bacteria 11794
557 Ga0495654_0002748 3300046530 Bacteria 11095
558 Ga0495654_0010159 3300046530 Bacteria 5131
559 Ga0495654_0012918 3300046530 Bacteria 4478
560 Ga0495654_0018632 3300046530 Bacteria 3635
561 Ga0495654_0044760 3300046530 Bacteria 2187
562 Ga0495654_0058885 3300046530 Bacteria 1851
563 Ga0495654_0096779 3300046530 Bacteria 1363
564 Ga0495654_0106946 3300046530 Bacteria 1280
565 Ga0495654_0115897 3300046530 Bacteria 1217
566 Ga0495654_0222893 3300046530 Bacteria 796
567 Ga0495654_0233138 3300046530 Bacteria 773
568 Ga0495654_0255963 3300046530 Bacteria 727
569 Ga0495586_0208552 3300046535 Bacteria 1108
570 Ga0495587_0017674 3300046536 Bacteria 4427
571 Ga0495587_0018153 3300046536 Bacteria 4362
572 Ga0495587_0085731 3300046536 Bacteria 1823
573 Ga0495609_0000283 3300046538 Bacteria 46879
574 Ga0495609_0017903 3300046538 Bacteria 3287
575 Ga0495609_0019921 3300046538 Bacteria 3101
576 Ga0495609_0108960 3300046538 Bacteria 1196
577 Ga0495609_0147849 3300046538 Bacteria 1000
578 Ga0495597_0010035 3300046542 Bacteria 4646
579 Ga0495597_0011165 3300046542 Bacteria 4360
580 Ga0495597_0043007 3300046542 Bacteria 2012
581 Ga0495597_0057791 3300046542 Bacteria 1696
582 Ga0495597_0090738 3300046542 Bacteria 1297
583 Ga0495597_0112472 3300046542 Bacteria 1140
584 Ga0495597_0148068 3300046542 Bacteria 964
585 Ga0495597_0151978 3300046542 Bacteria 949
586 Ga0495597_0178765 3300046542 Bacteria 858
587 Ga0495597_0230716 3300046542 Bacteria 732
588 Ga0495645_0147401 3300046543 Bacteria 1638
589 Ga0495622_0001532 3300046557 Bacteria 11519
590 Ga0495622_0005369 3300046557 Bacteria 5950
591 Ga0495622_0055032 3300046557 Bacteria 1845
592 Ga0495622_0065301 3300046557 Bacteria 1682
593 Ga0495622_0259170 3300046557 Bacteria 763
594 Ga0495633_0003837 3300046558 Bacteria 9826
595 Ga0495633_0105045 3300046558 Bacteria 1310
596 Ga0495633_0109704 3300046558 Bacteria 1279
597 Ga0495633_0182207 3300046558 Bacteria 967
598 Ga0495633_0410903 3300046558 Bacteria 612
599 Ga0495656_0315933 3300046615 Bacteria 803
600 Ga0495668_0004933 3300046616 Bacteria 9250
601 Ga0495668_0064263 3300046616 Bacteria 2020
602 Ga0495634_0021303 3300046642 Bacteria 4584
603 Ga0495611_0001569 3300046648 Bacteria 11197
604 Ga0495611_0029745 3300046648 Bacteria 2397
605 Ga0495611_0063222 3300046648 Bacteria 1684
606 Ga0495611_0141917 3300046648 Bacteria 1121
607 Ga0495611_0246991 3300046648 Bacteria 827
608 Ga0495625_0000086 3300046660 Bacteria 151735
609 Ga0495625_0092577 3300046660 Bacteria 2088
610 Ga0495625_0111308 3300046660 Bacteria 1871
611 Ga0495625_0116247 3300046660 Bacteria 1824
612 Ga0495625_0129075 3300046660 Bacteria 1713
613 Ga0495625_0146515 3300046660 Bacteria 1589
614 Ga0495625_0168088 3300046660 Bacteria 1465
615 Ga0495625_0169332 3300046660 Bacteria 1459
616 Ga0495625_0328260 3300046660 Bacteria 972
617 Ga0495625_0340945 3300046660 Bacteria 949
618 Ga0495635_0055596 3300046663 Bacteria 2726
619 Ga0495635_0089204 3300046663 Bacteria 2109
620 Ga0495659_0000820 3300046664 Bacteria 11054
621 Ga0495659_0002070 3300046664 Bacteria 6558
622 Ga0495659_0072398 3300046664 Bacteria 1293
623 Ga0495661_0000212 3300046665 Bacteria 67078
624 Ga0495661_0001263 3300046665 Bacteria 21779
625 Ga0495661_0019813 3300046665 Bacteria 4402
626 Ga0495661_0124168 3300046665 Bacteria 1422
627 Ga0495661_0157000 3300046665 Bacteria 1224
628 Ga0495661_0172054 3300046665 Bacteria 1154
629 Ga0495661_0186881 3300046665 Bacteria 1094
630 Ga0495661_0199884 3300046665 Bacteria 1047
631 Ga0495661_0239843 3300046665 Bacteria 930
632 Ga0495588_0071064 3300046674 Bacteria 1809
633 Ga0495657_0127527 3300046675 Bacteria 1597
634 Ga0495623_0043351 3300046679 Bacteria 2863
635 Ga0495623_0224125 3300046679 Bacteria 1069
636 Ga0495646_0038226 3300046680 Bacteria 2964
637 Ga0495646_0053319 3300046680 Bacteria 2438
638 Ga0495646_0056240 3300046680 Bacteria 2359
639 Ga0495613_0134739 3300046689 Bacteria 1767
640 Ga0495613_0153347 3300046689 Bacteria 1642
641 Ga0495613_0424188 3300046689 Bacteria 904
642 Ga0495624_0003018 3300046690 Bacteria 12599
643 Ga0495670_0005198 3300046691 Bacteria 6403
644 Ga0495670_0005874 3300046691 Bacteria 6017
645 Ga0495670_0022253 3300046691 Bacteria 3129
646 Ga0495670_0024799 3300046691 Bacteria 2964
647 Ga0495670_0076998 3300046691 Bacteria 1695
648 Ga0495670_0218889 3300046691 Bacteria 1011
649 Ga0495671_0004628 3300046692 Bacteria 8161
650 Ga0495671_0008562 3300046692 Bacteria 5745
651 Ga0495671_0009715 3300046692 Bacteria 5363
652 Ga0495671_0017976 3300046692 Bacteria 3759
653 Ga0495671_0041400 3300046692 Bacteria 2319
654 Ga0495671_0047927 3300046692 Bacteria 2132
655 Ga0495671_0076678 3300046692 Bacteria 1639
656 Ga0495671_0110517 3300046692 Bacteria 1342
657 Ga0495671_0178527 3300046692 Bacteria 1031
658 Ga0495671_0193218 3300046692 Bacteria 988
659 Ga0495671_0225582 3300046692 Bacteria 906
660 Ga0495671_0232033 3300046692 Bacteria 892
661 Ga0495671_0342220 3300046692 Bacteria 717
662 Ga0495649_0001824 3300046694 Bacteria 15645
663 Ga0495649_0012385 3300046694 Bacteria 4964
664 Ga0495649_0031659 3300046694 Bacteria 2915
665 Ga0495649_0046671 3300046694 Bacteria 2358
666 Ga0495649_0064886 3300046694 Bacteria 1960
667 Ga0495649_0065109 3300046694 Bacteria 1956
668 Ga0495649_0083414 3300046694 Bacteria 1707
669 Ga0495649_0090370 3300046694 Bacteria 1632
670 Ga0495649_0142045 3300046694 Bacteria 1263
671 Ga0495649_0191786 3300046694 Bacteria 1063
672 Ga0495649_0354084 3300046694 Bacteria 741
673 Ga0495649_0407064 3300046694 Bacteria 682
674 Ga0495649_0507047 3300046694 Bacteria 600
675 Ga0495589_0000918 3300046794 Bacteria 18098
676 Ga0495589_0002071 3300046794 Bacteria 11354
677 Ga0495589_0006815 3300046794 Bacteria 6011
678 Ga0495589_0015503 3300046794 Bacteria 3920
679 Ga0495589_0021718 3300046794 Bacteria 3279
680 Ga0495589_0041255 3300046794 Bacteria 2303
681 Ga0495589_0140918 3300046794 Bacteria 1154
682 Ga0495600_0061164 3300046809 Bacteria 2459
683 Ga0495600_0178085 3300046809 Bacteria 1370
684 Ga0495660_0021679 3300046810 Bacteria 3676
685 Ga0495660_0081388 3300046810 Bacteria 1697
686 Ga0495660_0089496 3300046810 Bacteria 1602
687 Ga0495660_0094580 3300046810 Bacteria 1547
688 Ga0495660_0107983 3300046810 Bacteria 1423
689 Ga0495660_0110362 3300046810 Bacteria 1404
690 Ga0495660_0168010 3300046810 Bacteria 1070
691 Ga0495660_0264590 3300046810 Bacteria 792
692 Ga0495581_0061855 3300047315 Bacteria 2163
693 Ga0495581_0258372 3300047315 Bacteria 1019
694 Ga0495604_0062389 3300047317 Bacteria 2847
695 Ga0495636_0013407 3300047318 Bacteria 3253
696 Ga0495636_0016829 3300047318 Bacteria 2924
697 Ga0495674_0431563 3300047319 Bacteria 1060
698 Ga0495672_0003884 3300047320 Bacteria 12561
699 Ga0495672_0004360 3300047320 Bacteria 11624
700 Ga0495672_0006960 3300047320 Bacteria 8600
701 Ga0495672_0011630 3300047320 Bacteria 6197
702 Ga0495672_0012419 3300047320 Bacteria 5942
703 Ga0495672_0017506 3300047320 Bacteria 4793
704 Ga0495672_0019239 3300047320 Bacteria 4508
705 Ga0495672_0039236 3300047320 Bacteria 2880
706 Ga0495672_0053952 3300047320 Bacteria 2352
707 Ga0495672_0075740 3300047320 Bacteria 1891
708 Ga0495672_0083248 3300047320 Bacteria 1777
709 Ga0495672_0103027 3300047320 Bacteria 1544
710 Ga0495672_0125285 3300047320 Bacteria 1359
711 Ga0495672_0212981 3300047320 Bacteria 958
712 Ga0495672_0283261 3300047320 Bacteria 791
713 Ga0495676_0000022 3300047321 Bacteria 163719
714 Ga0495676_0058928 3300047321 Bacteria 3018
715 Ga0495680_0002433 3300047322 Bacteria 19048
716 Ga0495680_0036378 3300047322 Bacteria 3953
717 Ga0495680_0091746 3300047322 Bacteria 2276
718 Ga0495680_0165381 3300047322 Bacteria 1604
719 Ga0495680_0459215 3300047322 Bacteria 870
720 Ga0495680_0537051 3300047322 Bacteria 789
721 Ga0495683_0008727 3300047323 Bacteria 5408
722 Ga0495683_0026936 3300047323 Bacteria 2940
723 Ga0495683_0105458 3300047323 Bacteria 1351
724 Ga0495683_0113503 3300047323 Bacteria 1291
725 Ga0495683_0141210 3300047323 Bacteria 1128
726 Ga0495683_0174334 3300047323 Bacteria 986
727 Ga0495683_0343617 3300047323 Bacteria 631
728 Ga0495687_005361 3300047443 Bacteria 8197
729 Ga0495687_031459 3300047443 Bacteria 2434
730 Ga0495687_044748 3300047443 Bacteria 1921
731 Ga0495687_074572 3300047443 Bacteria 1348
732 Ga0495675_0139142 3300047444 Bacteria 1505
733 Ga0495677_0001306 3300047445 Bacteria 9964
734 Ga0495677_0145115 3300047445 Bacteria 912
735 Ga0495679_000212 3300047446 Bacteria 49948
736 Ga0495679_024738 3300047446 Bacteria 2019
737 Ga0495679_029831 3300047446 Bacteria 1775
738 Ga0495679_037239 3300047446 Bacteria 1531
739 Ga0495679_069304 3300047446 Bacteria 1019
740 Ga0495679_101527 3300047446 Bacteria 798
741 Ga0495685_085515 3300047447 Bacteria 1048
742 Ga0495673_0005218 3300047469 Bacteria 7898
743 Ga0495673_0006168 3300047469 Bacteria 7099
744 Ga0495673_0007676 3300047469 Bacteria 6161
745 Ga0495673_0009165 3300047469 Bacteria 5492
746 Ga0495673_0009710 3300047469 Bacteria 5299
747 Ga0495673_0015441 3300047469 Bacteria 3934
748 Ga0495673_0025778 3300047469 Bacteria 2818
749 Ga0495673_0029141 3300047469 Bacteria 2608
750 Ga0495673_0038061 3300047469 Bacteria 2191
751 Ga0495673_0073508 3300047469 Bacteria 1432
752 Ga0495673_0105918 3300047469 Bacteria 1130
753 Ga0495673_0135083 3300047469 Bacteria 966
754 Ga0495673_0150889 3300047469 Bacteria 898
755 Ga0495673_0156760 3300047469 Bacteria 876
756 Ga0495681_0002383 3300047470 Bacteria 13460
757 Ga0495681_0004962 3300047470 Bacteria 8980
758 Ga0495681_0008341 3300047470 Bacteria 6507
759 Ga0495681_0009563 3300047470 Bacteria 5955
760 Ga0495681_0010666 3300047470 Bacteria 5548
761 Ga0495681_0016197 3300047470 Bacteria 4192
762 Ga0495681_0016536 3300047470 Bacteria 4129
763 Ga0495681_0020738 3300047470 Bacteria 3557
764 Ga0495681_0054819 3300047470 Bacteria 1861
765 Ga0495681_0060390 3300047470 Bacteria 1749
766 Ga0495681_0065421 3300047470 Bacteria 1662
767 Ga0495681_0071792 3300047470 Bacteria 1567
768 Ga0495681_0081306 3300047470 Bacteria 1446
769 Ga0495681_0129096 3300047470 Bacteria 1077
770 Ga0495681_0172902 3300047470 Bacteria 892
771 Ga0495684_0510901 3300047471 Bacteria 824
772 Ga0495686_0029158 3300047472 Bacteria 3591
773 Ga0495686_0038370 3300047472 Bacteria 3063
774 Ga0495686_0046754 3300047472 Bacteria 2734
775 Ga0495686_0064955 3300047472 Bacteria 2257
776 Ga0495686_0183861 3300047472 Bacteria 1209
777 Ga0495686_0238883 3300047472 Bacteria 1025
778 Ga0495593_0017925 3300047673 Bacteria 3984
779 Ga0495593_0082252 3300047673 Bacteria 1664
780 Ga0495593_0085393 3300047673 Bacteria 1628
781 Ga0495593_0355268 3300047673 Bacteria 732
782 Ga0495602_0170217 3300048088 Bacteria 1691
783 Ga0495614_0177743 3300048089 Bacteria 957
784 Ga0495626_0000039 3300048091 Bacteria 175454
785 Ga0495626_0000242 3300048091 Bacteria 63298
786 Ga0495626_0001832 3300048091 Bacteria 15978
787 Ga0495626_0003058 3300048091 Bacteria 10981
788 Ga0495626_0007505 3300048091 Bacteria 6063
789 Ga0495626_0024057 3300048091 Bacteria 2989
790 Ga0495626_0052218 3300048091 Bacteria 1884
791 Ga0495626_0063285 3300048091 Bacteria 1678
792 Ga0495626_0207197 3300048091 Bacteria 801
793 Ga0495626_0240986 3300048091 Bacteria 728
794 Ga0496102_0002921 3300048905 Bacteria 14497
795 Ga0496102_0412767 3300048905 Bacteria 1268
796 Ga0496102_0879801 3300048905 Bacteria 818
797 Ga0496103_0199568 3300048906 Bacteria 1286
798 Ga0496105_0199517 3300048908 Bacteria 1633
799 Ga0496106_0383505 3300048909 Bacteria 1129
800 Ga0496110_0069439 3300048913 Bacteria 3120
801 Ga0496110_0384741 3300048913 Bacteria 1278
802 Ga0496110_0387135 3300048913 Bacteria 1274
803 Ga0496110_0661238 3300048913 Bacteria 945
804 Ga0496110_0796049 3300048913 Bacteria 850
805 Ga0496111_0429774 3300048914 Bacteria 975
806 Ga0496112_0595844 3300048915 Bacteria 1037
807 Ga0496114_0318725 3300048917 Bacteria 1373
808 Ga0496115_0338557 3300048918 Bacteria 1228
809 Ga0496116_0000881 3300048919 Bacteria 37470
810 Ga0496116_0004892 3300048919 Bacteria 12634
811 Ga0496116_0005284 3300048919 Bacteria 12049
812 Ga0496116_0053916 3300048919 Bacteria 2652
813 Ga0496116_0095145 3300048919 Bacteria 1798
814 Ga0496116_0102424 3300048919 Bacteria 1707
815 Ga0496117_0000385 3300048920 Bacteria 75873
816 Ga0496117_0002861 3300048920 Bacteria 20985
817 Ga0496117_0008441 3300048920 Bacteria 9778
818 Ga0496117_0015017 3300048920 Bacteria 6634
819 Ga0496117_0021194 3300048920 Bacteria 5268
820 Ga0496117_0049035 3300048920 Bacteria 3008
821 Ga0496117_0065064 3300048920 Bacteria 2482
822 Ga0496117_0140100 3300048920 Bacteria 1450
823 Ga0496117_0173425 3300048920 Bacteria 1249
824 Ga0496117_0221332 3300048920 Bacteria 1053
825 Ga0496118_0009635 3300048921 Bacteria 9717
826 Ga0496118_0053236 3300048921 Bacteria 3079
827 Ga0496118_0089322 3300048921 Bacteria 2128
828 Ga0496118_0104397 3300048921 Bacteria 1902
829 Ga0496118_0133121 3300048921 Bacteria 1591
830 Ga0496118_0160884 3300048921 Bacteria 1388
831 Ga0496118_0203565 3300048921 Bacteria 1169
832 Ga0496118_0206512 3300048921 Bacteria 1157
833 Ga0496118_0388422 3300048921 Bacteria 729
834 Ga0496119_0116846 3300048922 Bacteria 1471
835 Ga0496119_0156893 3300048922 Bacteria 1214
836 Ga0496121_0001650 3300048924 Bacteria 36892
837 Ga0496121_0002827 3300048924 Bacteria 25645
838 Ga0496121_0045727 3300048924 Bacteria 3758
839 Ga0496121_0063687 3300048924 Bacteria 3010
840 Ga0496121_0080979 3300048924 Bacteria 2571
841 Ga0496121_0223445 3300048924 Bacteria 1324
842 Ga0496121_0672401 3300048924 Bacteria 627
843 Ga0496122_0002897 3300048925 Bacteria 23445
844 Ga0496122_0096287 3300048925 Bacteria 1996
845 Ga0496122_0116835 3300048925 Bacteria 1733
846 Ga0496122_0132207 3300048925 Bacteria 1582
847 Ga0496122_0347889 3300048925 Bacteria 775
848 Ga0496123_0000717 3300048926 Bacteria 54100
849 Ga0496123_0027453 3300048926 Bacteria 4239
850 Ga0496123_0081253 3300048926 Bacteria 1971
851 Ga0496123_0103535 3300048926 Bacteria 1648
852 Ga0496123_0174367 3300048926 Bacteria 1130
853 Ga0496124_0001280 3300048927 Bacteria 38218
854 Ga0496124_0015978 3300048927 Bacteria 7164
855 Ga0496124_0019027 3300048927 Bacteria 6409
856 Ga0496124_0024994 3300048927 Bacteria 5417
857 Ga0496124_0025744 3300048927 Bacteria 5320
858 Ga0496124_0041266 3300048927 Bacteria 3983
859 Ga0496124_0273670 3300048927 Bacteria 1235
860 Ga0496124_0279264 3300048927 Bacteria 1218
861 Ga0496124_0306361 3300048927 Bacteria 1144
862 Ga0496124_0484925 3300048927 Bacteria 833
863 Ga0496124_0484971 3300048927 Bacteria 833
864 Ga0496124_0501643 3300048927 Bacteria 813
865 Ga0496124_0520607 3300048927 Bacteria 792
866 Ga0496125_0013483 3300048928 Bacteria 8029
867 Ga0496125_0022065 3300048928 Bacteria 5920
868 Ga0496125_0156909 3300048928 Bacteria 1553
869 Ga0496125_0180253 3300048928 Bacteria 1409
870 Ga0496125_0603207 3300048928 Bacteria 599
871 Ga0496126_0326389 3300048929 Bacteria 1260
872 Ga0495678_001946 3300049459 Bacteria 14952
873 Ga0495678_019529 3300049459 Bacteria 3020
874 Ga0495678_032957 3300049459 Bacteria 2142
875 Ga0495678_039954 3300049459 Bacteria 1889
876 Ga0495678_042971 3300049459 Bacteria 1798
877 Ga0495678_045109 3300049459 Bacteria 1740
878 Ga0495678_057195 3300049459 Bacteria 1478
879 Ga0495678_057220 3300049459 Bacteria 1478
880 Ga0495678_175058 3300049459 Bacteria 676
881 Ga0495682_0035529 3300049460 Bacteria 1835
882 Ga0495682_0036598 3300049460 Bacteria 1806
883 Ga0495682_0045704 3300049460 Bacteria 1599
884 Ga0495682_0076491 3300049460 Bacteria 1204
885 Ga0495682_0077877 3300049460 Bacteria 1192
886 Ga0495682_0089738 3300049460 Bacteria 1104
887 Ga0495682_0185216 3300049460 Bacteria 739
888 Ga0501032_0007380 3300049569 Bacteria 8028
889 Ga0501034_0001845 3300049571 Bacteria 26903
890 Ga0501034_0683379 3300049571 Bacteria 926
891 Ga0501241_011913 3300049758 Bacteria 1579
892 Ga0501269_014228 3300049766 Bacteria 975
893 nmdc:mga03683_305342_c1 3300050489 Bacteria 747
894 nmdc:mga00v17_222156_c1 3300050491 Bacteria 1223
895 nmdc:mga00v17_450395_c1 3300050491 Bacteria 836
896 Ga0500659_0008421 3300053135 Bacteria 5684
897 Ga0500573_0064542 3300053140 Bacteria 2094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0603207 Ga0496125_0603207_44_577 177
2 3300046452 Ga0495617_037441 Ga0495617_037441_96_635 179
3 3300046458 Ga0495591_029507 Ga0495591_029507_1099_1638 179
4 3300046491 Ga0495584_0409651 Ga0495584_0409651_95_634 179
5 3300046492 Ga0495585_0321566 Ga0495585_0321566_25_564 179
6 3300046524 Ga0495648_0372867 Ga0495648_0372867_83_622 179
7 3300046530 Ga0495654_0222893 Ga0495654_0222893_19_558 179
8 3300046694 Ga0495649_0507047 Ga0495649_0507047_25_564 179
9 3300047323 Ga0495683_0343617 Ga0495683_0343617_68_607 179
10 3300047469 Ga0495673_0135083 Ga0495673_0135083_16_555 179
11 3300050491 nmdc:mga00v17_450395_c1 nmdc:mga00v17_450395_c1_73_612 179
12 3300047471 Ga0495684_0510901 Ga0495684_0510901_223_804 186
13 3300009036 Ga0105244_10039366 Ga0105244_100393662 187
14 3300013104 Ga0157370_10526386 Ga0157370_105263862 187
15 3300025728 Ga0207655_1008967 Ga0207655_10089675 187
16 3300047322 Ga0495680_0459215 Ga0495680_0459215_17_598 187
17 3300048919 Ga0496116_0053916 Ga0496116_0053916_679_1281 187
18 3300048920 Ga0496117_0049035 Ga0496117_0049035_718_1320 187
19 3300048921 Ga0496118_0160884 Ga0496118_0160884_716_1318 187
20 3300009092 Ga0105250_10028488 Ga0105250_100284882 188
21 3300046491 Ga0495584_0085372 Ga0495584_0085372_618_1220 188
22 3300046507 Ga0495606_0052345 Ga0495606_0052345_681_1283 188
23 3300006051 Ga0075364_10382202 Ga0075364_103822022 190
24 3300009092 Ga0105250_10001638 Ga0105250_100016382 190
25 3300025711 Ga0207696_1000057 Ga0207696_1000057177 190
26 3300041405 Ga0439438_001802 Ga0439438_001802_3135_3737 190
27 3300041407 Ga0439447_002676 Ga0439447_002676_2416_3018 190
28 3300041411 Ga0439466_0019683 Ga0439466_0019683_1778_2380 190
29 3300042010 Ga0439452_000786 Ga0439452_000786_9767_10369 190
30 3300048919 Ga0496116_0005284 Ga0496116_0005284_2527_3129 190
31 3300048927 Ga0496124_0484925 Ga0496124_0484925_96_698 190
32 3300005548 Ga0070665_100851998 Ga0070665_1008519981 191
33 3300006051 Ga0075364_10435456 Ga0075364_104354562 191
34 3300009011 Ga0105251_10065668 Ga0105251_100656682 191
35 3300013100 Ga0157373_10177542 Ga0157373_101775421 191
36 3300013102 Ga0157371_10361784 Ga0157371_103617842 191
37 3300013105 Ga0157369_10538158 Ga0157369_105381582 191
38 3300015261 Ga0182006_1005124 Ga0182006_10051242 191
39 3300015262 Ga0182007_10057015 Ga0182007_100570152 191
40 3300025230 Ga0209563_102899 Ga0209563_1028994 191
41 3300025735 Ga0207713_1036810 Ga0207713_10368104 191
42 3300025735 Ga0207713_1048553 Ga0207713_10485532 191
43 3300028379 Ga0268266_10010145 Ga0268266_100101458 191
44 3300028379 Ga0268266_10051944 Ga0268266_100519444 191
45 3300031730 Ga0307516_10150724 Ga0307516_101507243 191
46 3300041405 Ga0439438_091702 Ga0439438_091702_39_614 191
47 3300046458 Ga0495591_019077 Ga0495591_019077_1642_2244 191
48 3300046492 Ga0495585_0126753 Ga0495585_0126753_29_631 191
49 3300046501 Ga0495607_0054926 Ga0495607_0054926_465_1067 191
50 3300046515 Ga0495620_0001025 Ga0495620_0001025_10531_11133 191
51 3300046519 Ga0495632_0114596 Ga0495632_0114596_567_1169 191
52 3300046530 Ga0495654_0018632 Ga0495654_0018632_337_939 191
53 3300046665 Ga0495661_0186881 Ga0495661_0186881_441_1043 191
54 3300046692 Ga0495671_0193218 Ga0495671_0193218_60_662 191
55 3300046694 Ga0495649_0191786 Ga0495649_0191786_76_678 191
56 3300046794 Ga0495589_0006815 Ga0495589_0006815_4688_5290 191
57 3300046810 Ga0495660_0107983 Ga0495660_0107983_98_700 191
58 3300047321 Ga0495676_0058928 Ga0495676_0058928_669_1271 191
59 3300047323 Ga0495683_0105458 Ga0495683_0105458_39_641 191
60 3300047446 Ga0495679_101527 Ga0495679_101527_62_664 191
61 3300047469 Ga0495673_0029141 Ga0495673_0029141_1301_1903 191
62 3300047470 Ga0495681_0065421 Ga0495681_0065421_348_950 191
63 3300047472 Ga0495686_0046754 Ga0495686_0046754_721_1323 191
64 3300048091 Ga0495626_0007505 Ga0495626_0007505_747_1349 191
65 3300048924 Ga0496121_0080979 Ga0496121_0080979_1264_1866 191
66 3300048924 Ga0496121_0672401 Ga0496121_0672401_20_595 191
67 3300048925 Ga0496122_0116835 Ga0496122_0116835_37_639 191
68 3300048926 Ga0496123_0174367 Ga0496123_0174367_56_658 191
69 3300046524 Ga0495648_0017526 Ga0495648_0017526_1890_2468 192
70 3300049459 Ga0495678_057195 Ga0495678_057195_736_1338 192
71 3300009092 Ga0105250_10018379 Ga0105250_100183792 193
72 3300012498 Ga0157345_1001666 Ga0157345_10016662 193
73 3300025711 Ga0207696_1001785 Ga0207696_10017853 193
74 3300031731 Ga0307405_10208162 Ga0307405_102081622 193
75 3300046452 Ga0495617_027193 Ga0495617_027193_935_1537 193
76 3300046453 Ga0495627_052872 Ga0495627_052872_619_1200 193
77 3300046459 Ga0495629_0123644 Ga0495629_0123644_10_591 193
78 3300046460 Ga0495638_0084640 Ga0495638_0084640_13_594 193
79 3300046460 Ga0495638_0440320 Ga0495638_0440320_73_654 193
80 3300046471 Ga0495650_0139875 Ga0495650_0139875_164_766 193
81 3300046492 Ga0495585_0006088 Ga0495585_0006088_3306_3908 193
82 3300046500 Ga0495596_0009976 Ga0495596_0009976_1260_1862 193
83 3300046506 Ga0495583_0005841 Ga0495583_0005841_636_1238 193
84 3300046507 Ga0495606_0000447 Ga0495606_0000447_15144_15746 193
85 3300046512 Ga0495610_0011082 Ga0495610_0011082_4688_5290 193
86 3300046513 Ga0495616_0154822 Ga0495616_0154822_322_924 193
87 3300046515 Ga0495620_0033790 Ga0495620_0033790_165_767 193
88 3300046517 Ga0495630_0251400 Ga0495630_0251400_569_1171 193
89 3300046518 Ga0495631_0019223 Ga0495631_0019223_1249_1851 193
90 3300046518 Ga0495631_0220987 Ga0495631_0220987_32_634 193
91 3300046519 Ga0495632_0217171 Ga0495632_0217171_153_755 193
92 3300046520 Ga0495637_0000298 Ga0495637_0000298_55_657 193
93 3300046522 Ga0495643_0031987 Ga0495643_0031987_1601_2203 193
94 3300046523 Ga0495644_0014061 Ga0495644_0014061_100_702 193
95 3300046524 Ga0495648_0259869 Ga0495648_0259869_42_644 193
96 3300046524 Ga0495648_0310154 Ga0495648_0310154_15_596 193
97 3300046526 Ga0495666_0061660 Ga0495666_0061660_305_907 193
98 3300046530 Ga0495654_0002748 Ga0495654_0002748_261_863 193
99 3300046538 Ga0495609_0000283 Ga0495609_0000283_13847_14449 193
100 3300046557 Ga0495622_0005369 Ga0495622_0005369_694_1296 193
101 3300046558 Ga0495633_0410903 Ga0495633_0410903_15_596 193
102 3300046660 Ga0495625_0000086 Ga0495625_0000086_37105_37707 193
103 3300046660 Ga0495625_0116247 Ga0495625_0116247_1230_1811 193
104 3300046675 Ga0495657_0127527 Ga0495657_0127527_864_1466 193
105 3300046679 Ga0495623_0043351 Ga0495623_0043351_1588_2190 193
106 3300046689 Ga0495613_0134739 Ga0495613_0134739_1166_1747 193
107 3300046692 Ga0495671_0178527 Ga0495671_0178527_247_849 193
108 3300046692 Ga0495671_0225582 Ga0495671_0225582_251_853 193
109 3300047321 Ga0495676_0000022 Ga0495676_0000022_37612_38214 193
110 3300047322 Ga0495680_0091746 Ga0495680_0091746_848_1450 193
111 3300047323 Ga0495683_0141210 Ga0495683_0141210_13_594 193
112 3300047444 Ga0495675_0139142 Ga0495675_0139142_208_810 193
113 3300047446 Ga0495679_000212 Ga0495679_000212_27940_28542 193
114 3300047446 Ga0495679_029831 Ga0495679_029831_246_848 193
115 3300047469 Ga0495673_0073508 Ga0495673_0073508_340_942 193
116 3300047472 Ga0495686_0038370 Ga0495686_0038370_854_1456 193
117 3300047673 Ga0495593_0085393 Ga0495593_0085393_200_802 193
118 3300048091 Ga0495626_0000039 Ga0495626_0000039_125537_126139 193
119 3300049459 Ga0495678_175058 Ga0495678_175058_13_594 193
120 3300041498 Ga0451841_0662075 Ga0451841_0662075_310_912 194
121 3300046538 Ga0495609_0017903 Ga0495609_0017903_726_1328 194
122 iso_pu_bacteria 2511231156 2511822355 194
123 iso_pu_bacteria 2554235231 2555247803 194
124 iso_pu_bacteria 2599185188 2599502565 194
125 iso_pu_bacteria 2599185212 2599613044 194
126 iso_pu_bacteria 2599185248 2599769311 194
127 iso_pu_bacteria 2599185289 2599888554 194
128 iso_pu_bacteria 2599185291 2599900197 194
129 iso_pu_bacteria 2599185300 2599934157 194
130 iso_pu_bacteria 2599185302 2599943676 194
131 iso_pu_bacteria 2599185304 2599955986 194
132 iso_pu_bacteria 2599185305 2599961788 194
133 iso_pu_bacteria 2599185306 2599966913 194
134 iso_pu_bacteria 2599185308 2599978276 194
135 iso_pu_bacteria 2599185309 2599984680 194
136 iso_pu_bacteria 2599185310 2599991167 194
137 iso_pu_bacteria 2599185311 2599994949 194
138 iso_pu_bacteria 2599185312 2600002302 194
139 iso_pu_bacteria 2599185313 2600004764 194
140 iso_pu_bacteria 2599185314 2600012504 194
141 iso_pu_bacteria 2599185315 2600018740 194
142 iso_pu_bacteria 2599185316 2600026734 194
143 iso_pu_bacteria 2599185317 2600029877 194
144 iso_pu_bacteria 2599185318 2600034777 194
145 iso_pu_bacteria 2599185319 2600043902 194
146 iso_pu_bacteria 2599185320 2600047978 194
147 iso_pu_bacteria 2599185321 2600055618 194
148 iso_pu_bacteria 2599185322 2600060298 194
149 iso_pu_bacteria 2599185323 2600067558 194
150 iso_pu_bacteria 2599185324 2600071419 194
151 iso_pu_bacteria 2599185325 2600080409 194
152 iso_pu_bacteria 2600254930 2600359186 194
153 iso_pu_bacteria 2643221650 2644282655 194
154 iso_pu_bacteria 2651869719 2652546623 194
155 iso_pu_bacteria 2667528170 2671092681 194
156 iso_pu_bacteria 2667528176 2671127243 194
157 iso_pu_bacteria 2675903515 2678260891 194
158 iso_pu_bacteria 2744054620 2745006204 194
159 iso_pu_bacteria 2791355520 2794598747 194
160 iso_pu_bacteria 2808606361 2808856555 194
161 iso_pu_bacteria 2808606376 2808922838 194
162 iso_pu_bacteria 2808606378 2808936542 194
163 iso_pu_bacteria 2808606380 2808944525 194
164 iso_pu_bacteria 2808606383 2808964942 194
165 iso_pu_bacteria 2808606389 2808999834 194
166 iso_pu_bacteria 2825651385 2825654351 194
167 iso_pu_bacteria 2842854478 2842859474 194
168 iso_pu_bacteria 2913036834 2913037186 194
169 iso_pu_bacteria 2919481497 2919486485 194
170 iso_pu_bacteria 2923586266 2923589684 194
171 iso_pu_bacteria 2929144301 2929144723 194
172 iso_pu_bacteria 2931369376 2931371944 194
173 iso_pu_bacteria 2988728565 2988732117 194
174 iso_pu_bacteria 3007803356 3007805674 194
175 iso_pu_bacteria 3007866637 3007871980 194
176 iso_pu_bacteria 3007872151 3007875581 194
177 iso_pu_bacteria 8052494512 8052494992 194
178 iso_pu_bacteria 8055878733 8055880032 194
179 iso_pu_bacteria 8056143049 8056143649 194
180 iso_pu_bacteria 2600254954 2600443948 195
181 iso_pu_bacteria 2600255389 2602008568 195
182 iso_pu_bacteria 2823421272 2823425573 195
183 iso_pu_bacteria 2919501602 2919502309 195
184 iso_pu_bacteria 2926063275 2926063982 195
185 iso_pu_bacteria 8034962539 8034963520 195
186 iso_pu_bacteria 2511231004 2511258454 196
187 iso_pu_bacteria 2511231006 2511265613 196
188 iso_pu_bacteria 2511231007 2511269652 196
189 iso_pu_bacteria 2511231008 2511280592 196
190 iso_pu_bacteria 2511231010 2511288864 196
191 iso_pu_bacteria 2511231011 2511293895 196
192 iso_pu_bacteria 2511231012 2511302327 196
193 iso_pu_bacteria 2511231014 2511315176 196
194 iso_pu_bacteria 2511231015 2511322577 196
195 iso_pu_bacteria 2511231016 2511323634 196
196 iso_pu_bacteria 2511231017 2511332717 196
197 iso_pu_bacteria 2511231018 2511337886 196
198 iso_pu_bacteria 2511231019 2511345095 196
199 iso_pu_bacteria 2511231020 2511349026 196
200 iso_pu_bacteria 2511231021 2511355915 196
201 iso_pu_bacteria 2511231022 2511361407 196
202 iso_pu_bacteria 2511231023 2511368550 196
203 iso_pu_bacteria 2511231031 2511411236 196
204 iso_pu_bacteria 2512047018 2512325875 196
205 iso_pu_bacteria 2554235132 2554818157 196
206 iso_pu_bacteria 2554235341 2555667340 196
207 iso_pu_bacteria 2582580891 2583789884 196
208 iso_pu_bacteria 2597489887 2597855582 196
209 iso_pu_bacteria 2599185160 2599356563 196
210 iso_pu_bacteria 2599185161 2599363407 196
211 iso_pu_bacteria 2599185162 2599369641 196
212 iso_pu_bacteria 2599185163 2599376516 196
213 iso_pu_bacteria 2599185164 2599381668 196
214 iso_pu_bacteria 2599185165 2599388188 196
215 iso_pu_bacteria 2599185166 2599395288 196
216 iso_pu_bacteria 2599185168 2599407053 196
217 iso_pu_bacteria 2599185181 2599463396 196
218 iso_pu_bacteria 2599185182 2599469254 196
219 iso_pu_bacteria 2599185185 2599485484 196
220 iso_pu_bacteria 2599185186 2599492413 196
221 iso_pu_bacteria 2599185257 2599806613 196
222 iso_pu_bacteria 2599185307 2599974400 196
223 iso_pu_bacteria 2599185356 2600216025 196
224 iso_pu_bacteria 2600254931 2600364959 196
225 iso_pu_bacteria 2600255313 2601776192 196
226 iso_pu_bacteria 2600255318 2601797752 196
227 iso_pu_bacteria 2603880185 2606076765 196
228 iso_pu_bacteria 2603880199 2606128821 196
229 iso_pu_bacteria 2606217733 2608380544 196
230 iso_pu_bacteria 2623620443 2624478139 196
231 iso_pu_bacteria 2623620446 2624489684 196
232 iso_pu_bacteria 2643221565 2643840904 196
233 iso_pu_bacteria 2643221589 2643954992 196
234 iso_pu_bacteria 2643221602 2644024629 196
235 iso_pu_bacteria 2643221633 2644186042 196
236 iso_pu_bacteria 2667528171 2671100047 196
237 iso_pu_bacteria 2671180172 2671772264 196
238 iso_pu_bacteria 2713897148 2715749128 196
239 iso_pu_bacteria 2713897149 2715754398 196
240 iso_pu_bacteria 2718217725 2718632085 196
241 iso_pu_bacteria 2738543004 2739197947 196
242 iso_pu_bacteria 2738543015 2739260392 196
243 iso_pu_bacteria 2738543025 2739311203 196
244 iso_pu_bacteria 2740892503 2743735000 196
245 iso_pu_bacteria 2773857670 2774119639 196
246 iso_pu_bacteria 2773857673 2774134661 196
247 iso_pu_bacteria 2784132063 2784261129 196
248 iso_pu_bacteria 2784132072 2784316286 196
249 iso_pu_bacteria 2808606377 2808932102 196
250 iso_pu_bacteria 2808606379 2808939762 196
251 iso_pu_bacteria 2808606381 2808954297 196
252 iso_pu_bacteria 2808606382 2808955779 196
253 iso_pu_bacteria 2808606445 2809217900 196
254 iso_pu_bacteria 2818991456 2819657148 196
255 iso_pu_bacteria 2818991464 2819705137 196
256 iso_pu_bacteria 2826581358 2826582511 196
257 iso_pu_bacteria 2842815866 2842817643 196
258 iso_pu_bacteria 2842832357 2842834087 196
259 iso_pu_bacteria 2842843487 2842846441 196
260 iso_pu_bacteria 2842849001 2842851601 196
261 iso_pu_bacteria 2844665904 2844667818 196
262 iso_pu_bacteria 2852657418 2852660531 196
263 iso_pu_bacteria 2860339153 2860343718 196
264 iso_pu_bacteria 2878029506 2878030084 196
265 iso_pu_bacteria 2880230671 2880231035 196
266 iso_pu_bacteria 2904518522 2904519494 196
267 iso_pu_bacteria 2904550169 2904552328 196
268 iso_pu_bacteria 2917070673 2917071091 196
269 iso_pu_bacteria 2919063839 2919066234 196
270 iso_pu_bacteria 2919385768 2919389850 196
271 iso_pu_bacteria 2919456309 2919459905 196
272 iso_pu_bacteria 2919487758 2919488785 196
273 iso_pu_bacteria 2919697872 2919699037 196
274 iso_pu_bacteria 2923153595 2923153995 196
275 iso_pu_bacteria 2931396565 2931398758 196
276 iso_pu_bacteria 2935353572 2935358919 196
277 iso_pu_bacteria 2939636861 2939641021 196
278 iso_pu_bacteria 2969304461 2969304880 196
279 iso_pu_bacteria 2974289157 2974293426 196
280 iso_pu_bacteria 2984286254 2984292066 196
281 iso_pu_bacteria 2998139840 2998140381 196
282 iso_pu_bacteria 3007395558 3007398008 196
283 iso_pu_bacteria 3007419365 3007419937 196
284 iso_pu_bacteria 3007511990 3007517816 196
285 iso_pu_bacteria 3007614139 3007619178 196
286 iso_pu_bacteria 3007619802 3007625373 196
287 iso_pu_bacteria 3007718800 3007724022 196
288 iso_pu_bacteria 3007855910 3007857171 196
289 iso_pu_bacteria 3007861166 3007864413 196
290 iso_pu_bacteria 637000220 637317737 196
291 iso_pu_bacteria 8015687852 8015688244 196
292 iso_pu_bacteria 8019775933 8019777258 196
293 iso_pu_bacteria 8029995093 8030000351 196
294 iso_pu_bacteria 8055770955 8055771340 196
295 iso_pu_bacteria 8056125926 8056126388 196
296 iso_pu_bacteria 8056155041 8056158437 196
297 iso_pu_bacteria 8056166840 8056170665 196
298 iso_pu_bacteria 8056172158 8056176781 196
299 iso_pu_bacteria 8056177738 8056179714 196
300 iso_pu_bacteria 8056569372 8056572243 196
301 iso_pu_bacteria 8057798959 8057802633 196
302 2162886007 SwRhRL2b_contig_1475603 SwRhRL2b_0116.00004770 198
303 3300003781 Ga0055536_1021229 Ga0055536_10212291 198
304 3300003791 Ga0055530_10000404 Ga0055530_1000040423 198
305 3300003792 Ga0055540_1000339 Ga0055540_10003397 198
306 3300005288 Ga0065714_10065496 Ga0065714_100654963 198
307 3300005289 Ga0065704_10071810 Ga0065704_100718104 198
308 3300005289 Ga0065704_10079604 Ga0065704_100796044 198
309 3300005289 Ga0065704_10132020 Ga0065704_101320202 198
310 3300006058 Ga0075432_10061096 Ga0075432_100610962 198
311 3300006944 Ga0099823_1007118 Ga0099823_10071186 198
312 3300006944 Ga0099823_1088359 Ga0099823_10883592 198
313 3300006946 Ga0079104_1001202 Ga0079104_10012028 198
314 3300006948 Ga0099826_10031348 Ga0099826_100313484 198
315 3300009036 Ga0105244_10009518 Ga0105244_100095185 198
316 3300009036 Ga0105244_10013527 Ga0105244_100135271 198
317 3300009036 Ga0105244_10016561 Ga0105244_100165612 198
318 3300009036 Ga0105244_10072826 Ga0105244_100728264 198
319 3300009036 Ga0105244_10221878 Ga0105244_102218781 198
320 3300009148 Ga0105243_10047304 Ga0105243_100473041 198
321 3300009148 Ga0105243_10137242 Ga0105243_101372422 198
322 3300013100 Ga0157373_10000945 Ga0157373_1000094517 198
323 3300013104 Ga0157370_10056033 Ga0157370_100560333 198
324 3300014497 Ga0182008_10207141 Ga0182008_102071412 198
325 3300015261 Ga0182006_1058122 Ga0182006_10581222 198
326 3300015262 Ga0182007_10040384 Ga0182007_100403842 198
327 3300025292 Ga0209676_1000519 Ga0209676_100051922 198
328 3300025292 Ga0209676_1011363 Ga0209676_10113633 198
329 3300025298 Ga0209050_1000028 Ga0209050_1000028174 198
330 3300025303 Ga0209051_1000080 Ga0209051_10000807 198
331 3300025304 Ga0209257_1025113 Ga0209257_10251132 198
332 3300025711 Ga0207696_1000074 Ga0207696_100007411 198
333 3300025711 Ga0207696_1001528 Ga0207696_10015282 198
334 3300025711 Ga0207696_1012979 Ga0207696_10129792 198
335 3300025728 Ga0207655_1001007 Ga0207655_10010074 198
336 3300025728 Ga0207655_1001386 Ga0207655_10013864 198
337 3300025728 Ga0207655_1009044 Ga0207655_10090444 198
338 3300025728 Ga0207655_1025214 Ga0207655_10252142 198
339 3300025735 Ga0207713_1015567 Ga0207713_10155674 198
340 3300025735 Ga0207713_1035758 Ga0207713_10357582 198
341 3300025935 Ga0207709_10014819 Ga0207709_100148195 198
342 3300027111 Ga0209281_1000033 Ga0209281_1000033317 198
343 3300027296 Ga0209389_1000190 Ga0209389_10001907 198
344 3300027296 Ga0209389_1073805 Ga0209389_10738053 198
345 3300027312 Ga0209371_1000630 Ga0209371_100063020 198
346 3300027312 Ga0209371_1057069 Ga0209371_10570691 198
347 3300030500 Ga0268256_1000273 Ga0268256_100027326 198
348 3300030500 Ga0268256_1063969 Ga0268256_10639691 198
349 3300030731 Ga0316177_1034781 Ga0316177_10347812 198
350 3300030733 Ga0314311_1075429 Ga0314311_10754299 198
351 3300030744 Ga0316181_1032700 Ga0316181_10327003 198
352 3300030744 Ga0316181_1121023 Ga0316181_11210235 198
353 3300031548 Ga0307408_100235261 Ga0307408_1002352612 198
354 3300031548 Ga0307408_100270026 Ga0307408_1002700262 198
355 3300031548 Ga0307408_100473090 Ga0307408_1004730902 198
356 3300031731 Ga0307405_10008242 Ga0307405_100082422 198
357 3300031901 Ga0307406_10075207 Ga0307406_100752072 198
358 3300031911 Ga0307412_10019210 Ga0307412_100192104 198
359 3300031911 Ga0307412_10383636 Ga0307412_103836362 198
360 3300032004 Ga0307414_10180202 Ga0307414_101802022 198
361 3300032005 Ga0307411_10020058 Ga0307411_100200585 198
362 3300032005 Ga0307411_10269808 Ga0307411_102698082 198
363 3300041405 Ga0439438_004828 Ga0439438_004828_3899_4495 198
364 3300042006 Ga0439432_000775 Ga0439432_000775_4832_5428 198
365 3300042006 Ga0439432_013395 Ga0439432_013395_313_909 198
366 3300042009 Ga0439451_036052 Ga0439451_036052_266_862 198
367 3300042009 Ga0439451_054542 Ga0439451_054542_164_760 198
368 3300042136 Ga0450900_010246 Ga0450900_010246_119_715 198
369 3300042142 Ga0450905_002901 Ga0450905_002901_604_1200 198
370 3300042439 Ga0439464_0014826 Ga0439464_0014826_1129_1725 198
371 3300046515 Ga0495620_0000146 Ga0495620_0000146_5193_5789 198
372 3300046519 Ga0495632_0010081 Ga0495632_0010081_549_1145 198
373 3300046522 Ga0495643_0010831 Ga0495643_0010831_4550_5146 198
374 3300046522 Ga0495643_0011262 Ga0495643_0011262_3099_3695 198
375 3300046524 Ga0495648_0013653 Ga0495648_0013653_4264_4860 198
376 3300048913 Ga0496110_0387135 Ga0496110_0387135_430_1026 198
377 3300048917 Ga0496114_0318725 Ga0496114_0318725_570_1166 198
378 3300048920 Ga0496117_0000385 Ga0496117_0000385_592_1188 198
379 3300048920 Ga0496117_0008441 Ga0496117_0008441_4505_5101 198
380 3300048920 Ga0496117_0015017 Ga0496117_0015017_1213_1809 198
381 3300048921 Ga0496118_0009635 Ga0496118_0009635_4459_5055 198
382 3300048921 Ga0496118_0089322 Ga0496118_0089322_397_993 198
383 3300048922 Ga0496119_0156893 Ga0496119_0156893_218_814 198
384 3300048925 Ga0496122_0002897 Ga0496122_0002897_21367_21963 198
385 3300048925 Ga0496122_0347889 Ga0496122_0347889_123_719 198
386 3300048926 Ga0496123_0000717 Ga0496123_0000717_1677_2273 198
387 3300048927 Ga0496124_0015978 Ga0496124_0015978_291_887 198
388 3300048927 Ga0496124_0019027 Ga0496124_0019027_67_663 198
389 3300048927 Ga0496124_0025744 Ga0496124_0025744_4148_4744 198
390 3300048927 Ga0496124_0041266 Ga0496124_0041266_619_1215 198
391 3300048928 Ga0496125_0013483 Ga0496125_0013483_4476_5072 198
392 3300048928 Ga0496125_0022065 Ga0496125_0022065_794_1390 198
393 3300049571 Ga0501034_0001845 Ga0501034_0001845_10181_10777 198
394 3300053135 Ga0500659_0008421 Ga0500659_0008421_893_1489 198
395 3300031548 Ga0307408_100000002 Ga0307408_100000002260 199
396 3300041404 Ga0439436_0023073 Ga0439436_0023073_621_1220 199
397 3300041405 Ga0439438_018083 Ga0439438_018083_949_1548 199
398 3300041407 Ga0439447_004670 Ga0439447_004670_1489_2088 199
399 3300041411 Ga0439466_0001279 Ga0439466_0001279_6485_7084 199
400 3300042006 Ga0439432_000595 Ga0439432_000595_4599_5198 199
401 3300042010 Ga0439452_002364 Ga0439452_002364_409_1008 199
402 3300042125 Ga0450923_000363 Ga0450923_000363_2296_2895 199
403 3300042156 Ga0439446_0000081 Ga0439446_0000081_4850_5449 199
404 3300042156 Ga0439446_0009359 Ga0439446_0009359_382_981 199
405 3300042435 Ga0439434_0001340 Ga0439434_0001340_2777_3376 199
406 3300042439 Ga0439464_0000180 Ga0439464_0000180_4878_5480 199
407 3300049569 Ga0501032_0007380 Ga0501032_0007380_208_807 199
408 3300049571 Ga0501034_0683379 Ga0501034_0683379_80_679 199
409 2124908027 MRS2a_Contig_52 MRS2a_00400620 200
410 2162886011 MRS1b_contig_2669205 MRS1b_0887.00002850 200
411 3300002737 JGI25162J39368_1000129 JGI25162J39368_100012937 200
412 3300002771 JGI25163J39215_1001408 JGI25163J39215_10014081 200
413 3300002771 JGI25163J39215_1001444 JGI25163J39215_10014444 200
414 3300002772 JGI25164J39214_1000076 JGI25164J39214_100007636 200
415 3300002772 JGI25164J39214_1000101 JGI25164J39214_100010140 200
416 3300003214 JGI25165J46597_1000150 JGI25165J46597_100015063 200
417 3300003214 JGI25165J46597_1000180 JGI25165J46597_100018054 200
418 3300003781 Ga0055536_1000312 Ga0055536_100031222 200
419 3300003781 Ga0055536_1003306 Ga0055536_10033068 200
420 3300003791 Ga0055530_10003582 Ga0055530_100035828 200
421 3300003791 Ga0055530_10003672 Ga0055530_100036728 200
422 3300003792 Ga0055540_1002883 Ga0055540_10028838 200
423 3300003792 Ga0055540_1002945 Ga0055540_10029458 200
424 3300003794 Ga0055531_10000238 Ga0055531_100002383 200
425 3300005288 Ga0065714_10002970 Ga0065714_100029705 200
426 3300005288 Ga0065714_10009649 Ga0065714_100096493 200
427 3300005288 Ga0065714_10013965 Ga0065714_100139652 200
428 3300005288 Ga0065714_10105677 Ga0065714_101056772 200
429 3300005288 Ga0065714_10236865 Ga0065714_102368652 200
430 3300005289 Ga0065704_10252860 Ga0065704_102528602 200
431 3300005289 Ga0065704_10336932 Ga0065704_103369322 200
432 3300005290 Ga0065712_10011023 Ga0065712_100110231 200
433 3300005353 Ga0070669_100000233 Ga0070669_1000002337 200
434 3300005457 Ga0070662_100050060 Ga0070662_1000500603 200
435 3300006058 Ga0075432_10001952 Ga0075432_100019522 200
436 3300006058 Ga0075432_10074320 Ga0075432_100743201 200
437 3300006058 Ga0075432_10133939 Ga0075432_101339392 200
438 3300006177 Ga0075362_10170789 Ga0075362_101707892 200
439 3300006914 Ga0075436_100070423 Ga0075436_1000704234 200
440 3300006914 Ga0075436_100403642 Ga0075436_1004036421 200
441 3300006946 Ga0079104_1000423 Ga0079104_100042333 200
442 3300006946 Ga0079104_1082988 Ga0079104_10829881 200
443 3300009011 Ga0105251_10057788 Ga0105251_100577884 200
444 3300009011 Ga0105251_10209644 Ga0105251_102096441 200
445 3300009036 Ga0105244_10008644 Ga0105244_100086442 200
446 3300009036 Ga0105244_10009952 Ga0105244_100099523 200
447 3300009036 Ga0105244_10087337 Ga0105244_100873372 200
448 3300009036 Ga0105244_10093106 Ga0105244_100931062 200
449 3300009092 Ga0105250_10053860 Ga0105250_100538601 200
450 3300009092 Ga0105250_10105964 Ga0105250_101059642 200
451 3300009092 Ga0105250_10170766 Ga0105250_101707662 200
452 3300009148 Ga0105243_10000299 Ga0105243_1000029942 200
453 3300009148 Ga0105243_10001887 Ga0105243_100018879 200
454 3300009176 Ga0105242_10328437 Ga0105242_103284371 200
455 3300009176 Ga0105242_11163892 Ga0105242_111638921 200
456 3300011119 Ga0105246_10002004 Ga0105246_100020044 200
457 3300011119 Ga0105246_10101845 Ga0105246_101018451 200
458 3300012502 Ga0157347_1031758 Ga0157347_10317581 200
459 3300013100 Ga0157373_10147580 Ga0157373_101475802 200
460 3300013102 Ga0157371_10004002 Ga0157371_100040029 200
461 3300013102 Ga0157371_10005478 Ga0157371_100054783 200
462 3300013102 Ga0157371_10012849 Ga0157371_100128492 200
463 3300013102 Ga0157371_10304475 Ga0157371_103044753 200
464 3300013102 Ga0157371_10623606 Ga0157371_106236061 200
465 3300013104 Ga0157370_10023954 Ga0157370_100239542 200
466 3300013104 Ga0157370_10112108 Ga0157370_101121082 200
467 3300013104 Ga0157370_10265443 Ga0157370_102654432 200
468 3300013104 Ga0157370_10559520 Ga0157370_105595202 200
469 3300013105 Ga0157369_10068916 Ga0157369_100689163 200
470 3300013105 Ga0157369_10108625 Ga0157369_101086252 200
471 3300013105 Ga0157369_10643160 Ga0157369_106431602 200
472 3300013306 Ga0163162_10023363 Ga0163162_100233632 200
473 3300013306 Ga0163162_10313239 Ga0163162_103132392 200
474 3300013307 Ga0157372_10105826 Ga0157372_101058262 200
475 3300014497 Ga0182008_10003739 Ga0182008_100037399 200
476 3300014497 Ga0182008_10007470 Ga0182008_100074702 200
477 3300014497 Ga0182008_10008836 Ga0182008_100088362 200
478 3300014497 Ga0182008_10023268 Ga0182008_100232684 200
479 3300014497 Ga0182008_10026929 Ga0182008_100269292 200
480 3300014497 Ga0182008_10046317 Ga0182008_100463172 200
481 3300014497 Ga0182008_10084800 Ga0182008_100848004 200
482 3300014497 Ga0182008_10365040 Ga0182008_103650401 200
483 3300015261 Ga0182006_1000753 Ga0182006_10007537 200
484 3300015261 Ga0182006_1020800 Ga0182006_10208002 200
485 3300015261 Ga0182006_1026552 Ga0182006_10265522 200
486 3300015261 Ga0182006_1044318 Ga0182006_10443184 200
487 3300015262 Ga0182007_10001061 Ga0182007_100010615 200
488 3300015262 Ga0182007_10136843 Ga0182007_101368432 200
489 3300015265 Ga0182005_1002918 Ga0182005_10029185 200
490 3300015265 Ga0182005_1021781 Ga0182005_10217813 200
491 3300015265 Ga0182005_1023237 Ga0182005_10232372 200
492 3300015265 Ga0182005_1036292 Ga0182005_10362922 200
493 3300017792 Ga0163161_10016885 Ga0163161_100168852 200
494 3300017792 Ga0163161_10029907 Ga0163161_100299072 200
495 3300017792 Ga0163161_10036066 Ga0163161_100360667 200
496 3300017792 Ga0163161_10151877 Ga0163161_101518772 200
497 3300017792 Ga0163161_10708586 Ga0163161_107085862 200
498 3300025207 Ga0209760_100080 Ga0209760_1000807 200
499 3300025207 Ga0209760_100159 Ga0209760_10015926 200
500 3300025231 Ga0207427_100014 Ga0207427_100014293 200
501 3300025231 Ga0207427_100016 Ga0207427_10001658 200
502 3300025233 Ga0209437_100011 Ga0209437_100011247 200
503 3300025233 Ga0209437_100016 Ga0209437_100016344 200
504 3300025261 Ga0209233_1000019 Ga0209233_1000019247 200
505 3300025261 Ga0209233_1000036 Ga0209233_1000036293 200
506 3300025291 Ga0209675_1007415 Ga0209675_10074154 200
507 3300025292 Ga0209676_1000025 Ga0209676_1000025348 200
508 3300025292 Ga0209676_1000032 Ga0209676_1000032274 200
509 3300025292 Ga0209676_1000208 Ga0209676_100020834 200
510 3300025292 Ga0209676_1008270 Ga0209676_10082705 200
511 3300025298 Ga0209050_1000025 Ga0209050_1000025275 200
512 3300025298 Ga0209050_1000381 Ga0209050_100038162 200
513 3300025298 Ga0209050_1004298 Ga0209050_10042982 200
514 3300025303 Ga0209051_1000026 Ga0209051_1000026143 200
515 3300025303 Ga0209051_1000039 Ga0209051_10000392 200
516 3300025303 Ga0209051_1000047 Ga0209051_10000472 200
517 3300025304 Ga0209257_1000034 Ga0209257_1000034348 200
518 3300025711 Ga0207696_1001618 Ga0207696_10016182 200
519 3300025711 Ga0207696_1021497 Ga0207696_10214972 200
520 3300025711 Ga0207696_1024317 Ga0207696_10243172 200
521 3300025728 Ga0207655_1001190 Ga0207655_100119013 200
522 3300025728 Ga0207655_1002635 Ga0207655_10026356 200
523 3300025728 Ga0207655_1004551 Ga0207655_10045512 200
524 3300025728 Ga0207655_1008767 Ga0207655_10087673 200
525 3300025728 Ga0207655_1014720 Ga0207655_10147204 200
526 3300025728 Ga0207655_1029864 Ga0207655_10298642 200
527 3300025728 Ga0207655_1030573 Ga0207655_10305732 200
528 3300025728 Ga0207655_1042014 Ga0207655_10420142 200
529 3300025728 Ga0207655_1158757 Ga0207655_11587571 200
530 3300025735 Ga0207713_1002649 Ga0207713_10026492 200
531 3300025735 Ga0207713_1002650 Ga0207713_10026504 200
532 3300025735 Ga0207713_1008684 Ga0207713_10086843 200
533 3300025735 Ga0207713_1018900 Ga0207713_10189004 200
534 3300025735 Ga0207713_1020907 Ga0207713_10209072 200
535 3300025735 Ga0207713_1036589 Ga0207713_10365894 200
536 3300025735 Ga0207713_1041267 Ga0207713_10412672 200
537 3300025735 Ga0207713_1152342 Ga0207713_11523422 200
538 3300025923 Ga0207681_10003730 Ga0207681_1000373010 200
539 3300025933 Ga0207706_10150088 Ga0207706_101500883 200
540 3300025934 Ga0207686_10240835 Ga0207686_102408351 200
541 3300025934 Ga0207686_10693268 Ga0207686_106932681 200
542 3300025935 Ga0207709_10000451 Ga0207709_100004517 200
543 3300025935 Ga0207709_10001143 Ga0207709_100011437 200
544 3300025935 Ga0207709_10235104 Ga0207709_102351041 200
545 3300027111 Ga0209281_1000026 Ga0209281_1000026214 200
546 3300027111 Ga0209281_1008220 Ga0209281_10082202 200
547 3300027111 Ga0209281_1037826 Ga0209281_10378262 200
548 3300027111 Ga0209281_1039692 Ga0209281_10396921 200
549 3300027543 Ga0209999_1035782 Ga0209999_10357822 200
550 3300027907 Ga0207428_10068561 Ga0207428_100685612 200
551 3300027907 Ga0207428_10086363 Ga0207428_100863632 200
552 3300027907 Ga0207428_10173455 Ga0207428_101734552 200
553 3300027907 Ga0207428_10188003 Ga0207428_101880032 200
554 3300027907 Ga0207428_10461898 Ga0207428_104618981 200
555 3300030521 Ga0307511_10145036 Ga0307511_101450362 200
556 3300030731 Ga0316177_1094337 Ga0316177_10943371 200
557 3300030734 Ga0316179_1046502 Ga0316179_10465021 200
558 3300030735 Ga0316178_1102168 Ga0316178_110216818 200
559 3300031548 Ga0307408_100012498 Ga0307408_1000124985 200
560 3300031548 Ga0307408_100247501 Ga0307408_1002475012 200
561 3300031731 Ga0307405_11060458 Ga0307405_110604581 200
562 3300031901 Ga0307406_10449820 Ga0307406_104498202 200
563 3300031911 Ga0307412_10022176 Ga0307412_100221762 200
564 3300031911 Ga0307412_10074041 Ga0307412_100740412 200
565 3300031995 Ga0307409_100098675 Ga0307409_1000986753 200
566 3300032002 Ga0307416_100603663 Ga0307416_1006036632 200
567 3300032002 Ga0307416_100732095 Ga0307416_1007320952 200
568 3300032004 Ga0307414_10026090 Ga0307414_100260902 200
569 3300032005 Ga0307411_10017361 Ga0307411_100173612 200
570 3300033180 Ga0307510_10062849 Ga0307510_100628492 200
571 3300038705 Ga0237819_01489 Ga0237819_01489_5231_5833 200
572 3300041405 Ga0439438_003654 Ga0439438_003654_4427_5029 200
573 3300041405 Ga0439438_005738 Ga0439438_005738_3182_3784 200
574 3300041405 Ga0439438_016022 Ga0439438_016022_1130_1732 200
575 3300041405 Ga0439438_016104 Ga0439438_016104_49_651 200
576 3300041405 Ga0439438_036906 Ga0439438_036906_234_836 200
577 3300041407 Ga0439447_003145 Ga0439447_003145_4601_5203 200
578 3300041407 Ga0439447_023317 Ga0439447_023317_918_1520 200
579 3300041407 Ga0439447_023670 Ga0439447_023670_139_741 200
580 3300041407 Ga0439447_034585 Ga0439447_034585_409_1011 200
581 3300041407 Ga0439447_037076 Ga0439447_037076_439_1041 200
582 3300041407 Ga0439447_040885 Ga0439447_040885_411_1013 200
583 3300041411 Ga0439466_0002609 Ga0439466_0002609_734_1336 200
584 3300041411 Ga0439466_0007307 Ga0439466_0007307_218_820 200
585 3300041411 Ga0439466_0012672 Ga0439466_0012672_1788_2390 200
586 3300041411 Ga0439466_0017279 Ga0439466_0017279_1329_1931 200
587 3300041411 Ga0439466_0019640 Ga0439466_0019640_909_1511 200
588 3300041411 Ga0439466_0034938 Ga0439466_0034938_800_1471 200
589 3300041411 Ga0439466_0045757 Ga0439466_0045757_415_1017 200
590 3300041411 Ga0439466_0067547 Ga0439466_0067547_11_613 200
591 3300041413 Ga0439465_0049967 Ga0439465_0049967_489_1091 200
592 3300041413 Ga0439465_0159963 Ga0439465_0159963_86_688 200
593 3300042002 Ga0439442_065256 Ga0439442_065256_19_621 200
594 3300042004 Ga0439445_0024078 Ga0439445_0024078_382_984 200
595 3300042006 Ga0439432_006348 Ga0439432_006348_2780_3382 200
596 3300042006 Ga0439432_103675 Ga0439432_103675_108_710 200
597 3300042009 Ga0439451_000219 Ga0439451_000219_6476_7078 200
598 3300042009 Ga0439451_002362 Ga0439451_002362_840_1442 200
599 3300042009 Ga0439451_021435 Ga0439451_021435_673_1275 200
600 3300042009 Ga0439451_029436 Ga0439451_029436_80_682 200
601 3300042010 Ga0439452_000858 Ga0439452_000858_4687_5289 200
602 3300042010 Ga0439452_000882 Ga0439452_000882_3268_3870 200
603 3300042010 Ga0439452_003489 Ga0439452_003489_52_654 200
604 3300042010 Ga0439452_007333 Ga0439452_007333_719_1321 200
605 3300042010 Ga0439452_019195 Ga0439452_019195_869_1471 200
606 3300042010 Ga0439452_053247 Ga0439452_053247_219_821 200
607 3300042013 Ga0439456_001434 Ga0439456_001434_3671_4273 200
608 3300042013 Ga0439456_013110 Ga0439456_013110_292_894 200
609 3300042013 Ga0439456_034888 Ga0439456_034888_198_800 200
610 3300042013 Ga0439456_037733 Ga0439456_037733_146_748 200
611 3300042013 Ga0439456_103814 Ga0439456_103814_11_613 200
612 3300042016 Ga0439463_000059 Ga0439463_000059_11249_11851 200
613 3300042016 Ga0439463_000975 Ga0439463_000975_5788_6390 200
614 3300042016 Ga0439463_023114 Ga0439463_023114_358_960 200
615 3300042016 Ga0439463_024566 Ga0439463_024566_385_987 200
616 3300042016 Ga0439463_039072 Ga0439463_039072_69_671 200
617 3300042115 Ga0450911_000355 Ga0450911_000355_4882_5484 200
618 3300042115 Ga0450911_008084 Ga0450911_008084_804_1406 200
619 3300042121 Ga0450919_003787 Ga0450919_003787_553_1155 200
620 3300042124 Ga0450922_002212 Ga0450922_002212_485_1087 200
621 3300042124 Ga0450922_013753 Ga0450922_013753_56_658 200
622 3300042125 Ga0450923_027521 Ga0450923_027521_341_943 200
623 3300042137 Ga0450902_006084 Ga0450902_006084_656_1258 200
624 3300042137 Ga0450902_007993 Ga0450902_007993_663_1265 200
625 3300042137 Ga0450902_013193 Ga0450902_013193_477_1079 200
626 3300042137 Ga0450902_019776 Ga0450902_019776_410_1012 200
627 3300042137 Ga0450902_023966 Ga0450902_023966_198_800 200
628 3300042138 Ga0450903_014745 Ga0450903_014745_22_624 200
629 3300042139 Ga0450904_001666 Ga0450904_001666_972_1574 200
630 3300042139 Ga0450904_009174 Ga0450904_009174_341_943 200
631 3300042139 Ga0450904_014253 Ga0450904_014253_46_648 200
632 3300042142 Ga0450905_034651 Ga0450905_034651_107_709 200
633 3300042145 Ga0450906_014183 Ga0450906_014183_282_884 200
634 3300042145 Ga0450906_035512 Ga0450906_035512_181_783 200
635 3300042146 Ga0450907_000751 Ga0450907_000751_738_1340 200
636 3300042146 Ga0450907_005713 Ga0450907_005713_1144_1746 200
637 3300042146 Ga0450907_005795 Ga0450907_005795_1233_1835 200
638 3300042147 Ga0450910_012410 Ga0450910_012410_195_797 200
639 3300042147 Ga0450910_020715 Ga0450910_020715_43_645 200
640 3300042156 Ga0439446_0065059 Ga0439446_0065059_280_882 200
641 3300042184 Ga0450908_014825 Ga0450908_014825_453_1055 200
642 3300042184 Ga0450908_018726 Ga0450908_018726_389_991 200
643 3300042185 Ga0450909_014786 Ga0450909_014786_526_1128 200
644 3300042435 Ga0439434_0013350 Ga0439434_0013350_1147_1749 200
645 3300042461 Ga0439460_0007942 Ga0439460_0007942_1771_2373 200
646 3300042461 Ga0439460_0026436 Ga0439460_0026436_363_965 200
647 3300042531 Ga0450918_035818 Ga0450918_035818_34_636 200
648 3300042532 Ga0450893_0011986 Ga0450893_0011986_249_851 200
649 3300042533 Ga0450901_001588 Ga0450901_001588_511_1113 200
650 3300042993 Ga0439440_0019024 Ga0439440_0019024_320_922 200
651 3300042993 Ga0439440_0024970 Ga0439440_0024970_133_735 200
652 3300042993 Ga0439440_0054586 Ga0439440_0054586_276_878 200
653 3300046452 Ga0495617_000455 Ga0495617_000455_11582_12184 200
654 3300046452 Ga0495617_008242 Ga0495617_008242_555_1157 200
655 3300046452 Ga0495617_010516 Ga0495617_010516_1757_2359 200
656 3300046452 Ga0495617_018854 Ga0495617_018854_158_760 200
657 3300046452 Ga0495617_037529 Ga0495617_037529_336_938 200
658 3300046452 Ga0495617_052407 Ga0495617_052407_725_1327 200
659 3300046453 Ga0495627_005394 Ga0495627_005394_327_929 200
660 3300046453 Ga0495627_025389 Ga0495627_025389_84_686 200
661 3300046453 Ga0495627_045176 Ga0495627_045176_304_906 200
662 3300046455 Ga0495603_0069851 Ga0495603_0069851_54_656 200
663 3300046455 Ga0495603_0200734 Ga0495603_0200734_74_676 200
664 3300046455 Ga0495603_0328673 Ga0495603_0328673_221_823 200
665 3300046455 Ga0495603_0336349 Ga0495603_0336349_246_848 200
666 3300046457 Ga0495590_0003662 Ga0495590_0003662_2676_3278 200
667 3300046457 Ga0495590_0005324 Ga0495590_0005324_3831_4433 200
668 3300046457 Ga0495590_0035972 Ga0495590_0035972_163_765 200
669 3300046457 Ga0495590_0043579 Ga0495590_0043579_767_1369 200
670 3300046457 Ga0495590_0072389 Ga0495590_0072389_555_1157 200
671 3300046457 Ga0495590_0154541 Ga0495590_0154541_70_672 200
672 3300046457 Ga0495590_0222446 Ga0495590_0222446_73_675 200
673 3300046457 Ga0495590_0224123 Ga0495590_0224123_20_622 200
674 3300046458 Ga0495591_000668 Ga0495591_000668_13848_14450 200
675 3300046458 Ga0495591_002443 Ga0495591_002443_1671_2273 200
676 3300046458 Ga0495591_004511 Ga0495591_004511_5151_5753 200
677 3300046458 Ga0495591_009614 Ga0495591_009614_732_1334 200
678 3300046458 Ga0495591_011156 Ga0495591_011156_2084_2686 200
679 3300046458 Ga0495591_027027 Ga0495591_027027_135_737 200
680 3300046458 Ga0495591_044350 Ga0495591_044350_284_886 200
681 3300046458 Ga0495591_049763 Ga0495591_049763_168_770 200
682 3300046458 Ga0495591_055672 Ga0495591_055672_329_931 200
683 3300046458 Ga0495591_082483 Ga0495591_082483_163_765 200
684 3300046458 Ga0495591_096415 Ga0495591_096415_79_681 200
685 3300046460 Ga0495638_0012439 Ga0495638_0012439_4746_5348 200
686 3300046460 Ga0495638_0028218 Ga0495638_0028218_718_1320 200
687 3300046460 Ga0495638_0035196 Ga0495638_0035196_1824_2426 200
688 3300046460 Ga0495638_0061880 Ga0495638_0061880_1033_1635 200
689 3300046460 Ga0495638_0068844 Ga0495638_0068844_830_1432 200
690 3300046460 Ga0495638_0095065 Ga0495638_0095065_627_1229 200
691 3300046460 Ga0495638_0098972 Ga0495638_0098972_563_1165 200
692 3300046460 Ga0495638_0115535 Ga0495638_0115535_976_1578 200
693 3300046460 Ga0495638_0162267 Ga0495638_0162267_438_1040 200
694 3300046460 Ga0495638_0196748 Ga0495638_0196748_524_1126 200
695 3300046460 Ga0495638_0258099 Ga0495638_0258099_267_869 200
696 3300046471 Ga0495650_0000718 Ga0495650_0000718_41369_41971 200
697 3300046471 Ga0495650_0009711 Ga0495650_0009711_723_1325 200
698 3300046471 Ga0495650_0025619 Ga0495650_0025619_343_945 200
699 3300046471 Ga0495650_0035372 Ga0495650_0035372_1341_1943 200
700 3300046471 Ga0495650_0037040 Ga0495650_0037040_550_1152 200
701 3300046471 Ga0495650_0058180 Ga0495650_0058180_111_713 200
702 3300046471 Ga0495650_0070280 Ga0495650_0070280_693_1295 200
703 3300046471 Ga0495650_0090063 Ga0495650_0090063_235_837 200
704 3300046471 Ga0495650_0187509 Ga0495650_0187509_37_639 200
705 3300046473 Ga0495582_0051045 Ga0495582_0051045_1445_2047 200
706 3300046474 Ga0495605_0005176 Ga0495605_0005176_77_679 200
707 3300046474 Ga0495605_0009136 Ga0495605_0009136_1204_1806 200
708 3300046474 Ga0495605_0034883 Ga0495605_0034883_967_1569 200
709 3300046474 Ga0495605_0039788 Ga0495605_0039788_422_1024 200
710 3300046474 Ga0495605_0062241 Ga0495605_0062241_666_1268 200
711 3300046474 Ga0495605_0104383 Ga0495605_0104383_317_919 200
712 3300046474 Ga0495605_0111678 Ga0495605_0111678_632_1234 200
713 3300046474 Ga0495605_0203645 Ga0495605_0203645_26_628 200
714 3300046474 Ga0495605_0235409 Ga0495605_0235409_102_704 200
715 3300046475 Ga0495639_0001263 Ga0495639_0001263_897_1499 200
716 3300046475 Ga0495639_0023584 Ga0495639_0023584_1436_2038 200
717 3300046475 Ga0495639_0088834 Ga0495639_0088834_392_994 200
718 3300046491 Ga0495584_0003386 Ga0495584_0003386_730_1332 200
719 3300046491 Ga0495584_0007989 Ga0495584_0007989_4295_4897 200
720 3300046491 Ga0495584_0009605 Ga0495584_0009605_86_688 200
721 3300046491 Ga0495584_0009780 Ga0495584_0009780_2676_3278 200
722 3300046491 Ga0495584_0012470 Ga0495584_0012470_3647_4249 200
723 3300046491 Ga0495584_0016376 Ga0495584_0016376_3165_3767 200
724 3300046491 Ga0495584_0026970 Ga0495584_0026970_1590_2192 200
725 3300046491 Ga0495584_0052857 Ga0495584_0052857_484_1086 200
726 3300046491 Ga0495584_0065932 Ga0495584_0065932_1163_1765 200
727 3300046491 Ga0495584_0286103 Ga0495584_0286103_105_707 200
728 3300046492 Ga0495585_0005619 Ga0495585_0005619_6698_7300 200
729 3300046492 Ga0495585_0010425 Ga0495585_0010425_317_919 200
730 3300046492 Ga0495585_0069938 Ga0495585_0069938_116_718 200
731 3300046492 Ga0495585_0079002 Ga0495585_0079002_1090_1692 200
732 3300046492 Ga0495585_0094044 Ga0495585_0094044_769_1371 200
733 3300046492 Ga0495585_0134730 Ga0495585_0134730_595_1197 200
734 3300046499 Ga0495594_0135885 Ga0495594_0135885_128_730 200
735 3300046499 Ga0495594_0149148 Ga0495594_0149148_455_1057 200
736 3300046499 Ga0495594_0278278 Ga0495594_0278278_180_782 200
737 3300046500 Ga0495596_0000545 Ga0495596_0000545_12448_13050 200
738 3300046501 Ga0495607_0002719 Ga0495607_0002719_9861_10463 200
739 3300046501 Ga0495607_0004529 Ga0495607_0004529_1013_1615 200
740 3300046501 Ga0495607_0011725 Ga0495607_0011725_1860_2462 200
741 3300046501 Ga0495607_0021554 Ga0495607_0021554_2352_2954 200
742 3300046501 Ga0495607_0027707 Ga0495607_0027707_698_1300 200
743 3300046501 Ga0495607_0112956 Ga0495607_0112956_444_1046 200
744 3300046501 Ga0495607_0114085 Ga0495607_0114085_663_1265 200
745 3300046501 Ga0495607_0160168 Ga0495607_0160168_194_796 200
746 3300046501 Ga0495607_0162951 Ga0495607_0162951_135_737 200
747 3300046506 Ga0495583_0004153 Ga0495583_0004153_3738_4340 200
748 3300046506 Ga0495583_0004386 Ga0495583_0004386_9036_9638 200
749 3300046506 Ga0495583_0081461 Ga0495583_0081461_610_1212 200
750 3300046506 Ga0495583_0129364 Ga0495583_0129364_440_1042 200
751 3300046507 Ga0495606_0013954 Ga0495606_0013954_714_1316 200
752 3300046507 Ga0495606_0016616 Ga0495606_0016616_725_1327 200
753 3300046507 Ga0495606_0047624 Ga0495606_0047624_1363_1965 200
754 3300046507 Ga0495606_0066377 Ga0495606_0066377_1038_1640 200
755 3300046512 Ga0495610_0015733 Ga0495610_0015733_52_654 200
756 3300046512 Ga0495610_0016575 Ga0495610_0016575_146_748 200
757 3300046512 Ga0495610_0028275 Ga0495610_0028275_719_1321 200
758 3300046512 Ga0495610_0028769 Ga0495610_0028769_1610_2212 200
759 3300046512 Ga0495610_0091376 Ga0495610_0091376_173_775 200
760 3300046512 Ga0495610_0242977 Ga0495610_0242977_31_633 200
761 3300046513 Ga0495616_0008264 Ga0495616_0008264_3898_4500 200
762 3300046513 Ga0495616_0044744 Ga0495616_0044744_727_1329 200
763 3300046513 Ga0495616_0065538 Ga0495616_0065538_383_985 200
764 3300046513 Ga0495616_0095772 Ga0495616_0095772_74_676 200
765 3300046513 Ga0495616_0097330 Ga0495616_0097330_579_1181 200
766 3300046513 Ga0495616_0207843 Ga0495616_0207843_221_823 200
767 3300046515 Ga0495620_0007957 Ga0495620_0007957_5041_5643 200
768 3300046515 Ga0495620_0011678 Ga0495620_0011678_3746_4348 200
769 3300046515 Ga0495620_0084459 Ga0495620_0084459_460_1062 200
770 3300046515 Ga0495620_0148426 Ga0495620_0148426_243_845 200
771 3300046516 Ga0495628_0110833 Ga0495628_0110833_716_1318 200
772 3300046516 Ga0495628_0623214 Ga0495628_0623214_82_684 200
773 3300046517 Ga0495630_0259542 Ga0495630_0259542_602_1204 200
774 3300046518 Ga0495631_0001255 Ga0495631_0001255_10334_10936 200
775 3300046518 Ga0495631_0002798 Ga0495631_0002798_7266_7868 200
776 3300046518 Ga0495631_0053416 Ga0495631_0053416_1133_1735 200
777 3300046518 Ga0495631_0134440 Ga0495631_0134440_255_857 200
778 3300046519 Ga0495632_0000599 Ga0495632_0000599_497_1099 200
779 3300046519 Ga0495632_0001743 Ga0495632_0001743_6840_7442 200
780 3300046519 Ga0495632_0008921 Ga0495632_0008921_4728_5330 200
781 3300046519 Ga0495632_0018363 Ga0495632_0018363_2422_3024 200
782 3300046519 Ga0495632_0026449 Ga0495632_0026449_749_1351 200
783 3300046519 Ga0495632_0065399 Ga0495632_0065399_1117_1719 200
784 3300046519 Ga0495632_0106291 Ga0495632_0106291_100_702 200
785 3300046519 Ga0495632_0136740 Ga0495632_0136740_78_680 200
786 3300046519 Ga0495632_0186571 Ga0495632_0186571_78_680 200
787 3300046520 Ga0495637_0003904 Ga0495637_0003904_6848_7450 200
788 3300046520 Ga0495637_0012181 Ga0495637_0012181_163_765 200
789 3300046520 Ga0495637_0013878 Ga0495637_0013878_726_1328 200
790 3300046520 Ga0495637_0015426 Ga0495637_0015426_270_872 200
791 3300046520 Ga0495637_0048387 Ga0495637_0048387_593_1195 200
792 3300046520 Ga0495637_0062269 Ga0495637_0062269_227_829 200
793 3300046520 Ga0495637_0073028 Ga0495637_0073028_730_1332 200
794 3300046520 Ga0495637_0123619 Ga0495637_0123619_325_927 200
795 3300046520 Ga0495637_0141674 Ga0495637_0141674_148_750 200
796 3300046520 Ga0495637_0142833 Ga0495637_0142833_251_853 200
797 3300046520 Ga0495637_0162630 Ga0495637_0162630_50_652 200
798 3300046523 Ga0495644_0001580 Ga0495644_0001580_373_975 200
799 3300046524 Ga0495648_0002138 Ga0495648_0002138_766_1368 200
800 3300046524 Ga0495648_0029310 Ga0495648_0029310_636_1238 200
801 3300046524 Ga0495648_0067009 Ga0495648_0067009_719_1321 200
802 3300046524 Ga0495648_0081478 Ga0495648_0081478_582_1184 200
803 3300046524 Ga0495648_0088603 Ga0495648_0088603_411_1013 200
804 3300046524 Ga0495648_0099266 Ga0495648_0099266_89_691 200
805 3300046524 Ga0495648_0112168 Ga0495648_0112168_590_1192 200
806 3300046524 Ga0495648_0228609 Ga0495648_0228609_239_841 200
807 3300046526 Ga0495666_0138443 Ga0495666_0138443_352_954 200
808 3300046528 Ga0495642_0000662 Ga0495642_0000662_6802_7404 200
809 3300046528 Ga0495642_0000940 Ga0495642_0000940_5229_5831 200
810 3300046528 Ga0495642_0001149 Ga0495642_0001149_7836_8438 200
811 3300046530 Ga0495654_0002507 Ga0495654_0002507_9816_10418 200
812 3300046530 Ga0495654_0010159 Ga0495654_0010159_1028_1630 200
813 3300046530 Ga0495654_0012918 Ga0495654_0012918_3664_4266 200
814 3300046530 Ga0495654_0044760 Ga0495654_0044760_862_1464 200
815 3300046530 Ga0495654_0058885 Ga0495654_0058885_721_1323 200
816 3300046530 Ga0495654_0096779 Ga0495654_0096779_555_1157 200
817 3300046530 Ga0495654_0106946 Ga0495654_0106946_583_1185 200
818 3300046530 Ga0495654_0115897 Ga0495654_0115897_424_1026 200
819 3300046530 Ga0495654_0233138 Ga0495654_0233138_151_753 200
820 3300046530 Ga0495654_0255963 Ga0495654_0255963_18_620 200
821 3300046535 Ga0495586_0208552 Ga0495586_0208552_465_1067 200
822 3300046536 Ga0495587_0017674 Ga0495587_0017674_576_1178 200
823 3300046536 Ga0495587_0018153 Ga0495587_0018153_1991_2593 200
824 3300046536 Ga0495587_0085731 Ga0495587_0085731_594_1196 200
825 3300046538 Ga0495609_0019921 Ga0495609_0019921_1019_1621 200
826 3300046538 Ga0495609_0108960 Ga0495609_0108960_506_1108 200
827 3300046538 Ga0495609_0147849 Ga0495609_0147849_49_651 200
828 3300046542 Ga0495597_0010035 Ga0495597_0010035_3548_4150 200
829 3300046542 Ga0495597_0011165 Ga0495597_0011165_1656_2258 200
830 3300046542 Ga0495597_0043007 Ga0495597_0043007_172_774 200
831 3300046542 Ga0495597_0057791 Ga0495597_0057791_72_674 200
832 3300046542 Ga0495597_0090738 Ga0495597_0090738_612_1214 200
833 3300046542 Ga0495597_0112472 Ga0495597_0112472_61_663 200
834 3300046542 Ga0495597_0148068 Ga0495597_0148068_262_864 200
835 3300046542 Ga0495597_0151978 Ga0495597_0151978_250_852 200
836 3300046542 Ga0495597_0178765 Ga0495597_0178765_225_827 200
837 3300046542 Ga0495597_0230716 Ga0495597_0230716_23_625 200
838 3300046543 Ga0495645_0147401 Ga0495645_0147401_305_907 200
839 3300046557 Ga0495622_0001532 Ga0495622_0001532_9908_10510 200
840 3300046557 Ga0495622_0055032 Ga0495622_0055032_678_1280 200
841 3300046557 Ga0495622_0065301 Ga0495622_0065301_492_1094 200
842 3300046557 Ga0495622_0259170 Ga0495622_0259170_38_640 200
843 3300046558 Ga0495633_0003837 Ga0495633_0003837_1384_1986 200
844 3300046558 Ga0495633_0105045 Ga0495633_0105045_392_994 200
845 3300046558 Ga0495633_0109704 Ga0495633_0109704_393_995 200
846 3300046558 Ga0495633_0182207 Ga0495633_0182207_134_736 200
847 3300046615 Ga0495656_0315933 Ga0495656_0315933_81_683 200
848 3300046616 Ga0495668_0004933 Ga0495668_0004933_4443_5045 200
849 3300046616 Ga0495668_0064263 Ga0495668_0064263_601_1203 200
850 3300046642 Ga0495634_0021303 Ga0495634_0021303_3705_4307 200
851 3300046648 Ga0495611_0001569 Ga0495611_0001569_4710_5312 200
852 3300046648 Ga0495611_0029745 Ga0495611_0029745_737_1339 200
853 3300046648 Ga0495611_0063222 Ga0495611_0063222_761_1363 200
854 3300046648 Ga0495611_0141917 Ga0495611_0141917_261_863 200
855 3300046648 Ga0495611_0246991 Ga0495611_0246991_64_666 200
856 3300046660 Ga0495625_0092577 Ga0495625_0092577_1104_1706 200
857 3300046660 Ga0495625_0111308 Ga0495625_0111308_1150_1752 200
858 3300046660 Ga0495625_0129075 Ga0495625_0129075_772_1374 200
859 3300046660 Ga0495625_0146515 Ga0495625_0146515_169_771 200
860 3300046660 Ga0495625_0168088 Ga0495625_0168088_536_1138 200
861 3300046660 Ga0495625_0169332 Ga0495625_0169332_768_1370 200
862 3300046660 Ga0495625_0328260 Ga0495625_0328260_325_927 200
863 3300046660 Ga0495625_0340945 Ga0495625_0340945_230_832 200
864 3300046663 Ga0495635_0055596 Ga0495635_0055596_718_1320 200
865 3300046663 Ga0495635_0089204 Ga0495635_0089204_163_765 200
866 3300046664 Ga0495659_0000820 Ga0495659_0000820_658_1260 200
867 3300046664 Ga0495659_0002070 Ga0495659_0002070_5253_5855 200
868 3300046664 Ga0495659_0072398 Ga0495659_0072398_271_873 200
869 3300046665 Ga0495661_0000212 Ga0495661_0000212_34950_35552 200
870 3300046665 Ga0495661_0001263 Ga0495661_0001263_20534_21136 200
871 3300046665 Ga0495661_0019813 Ga0495661_0019813_3075_3677 200
872 3300046665 Ga0495661_0124168 Ga0495661_0124168_720_1322 200
873 3300046665 Ga0495661_0157000 Ga0495661_0157000_256_858 200
874 3300046665 Ga0495661_0172054 Ga0495661_0172054_509_1111 200
875 3300046665 Ga0495661_0199884 Ga0495661_0199884_391_993 200
876 3300046665 Ga0495661_0239843 Ga0495661_0239843_93_695 200
877 3300046674 Ga0495588_0071064 Ga0495588_0071064_716_1318 200
878 3300046679 Ga0495623_0224125 Ga0495623_0224125_271_873 200
879 3300046680 Ga0495646_0038226 Ga0495646_0038226_710_1312 200
880 3300046680 Ga0495646_0053319 Ga0495646_0053319_324_926 200
881 3300046680 Ga0495646_0056240 Ga0495646_0056240_528_1130 200
882 3300046689 Ga0495613_0153347 Ga0495613_0153347_707_1309 200
883 3300046689 Ga0495613_0424188 Ga0495613_0424188_44_646 200
884 3300046690 Ga0495624_0003018 Ga0495624_0003018_7404_8006 200
885 3300046691 Ga0495670_0005198 Ga0495670_0005198_4052_4654 200
886 3300046691 Ga0495670_0005874 Ga0495670_0005874_4691_5293 200
887 3300046691 Ga0495670_0022253 Ga0495670_0022253_1802_2404 200
888 3300046691 Ga0495670_0024799 Ga0495670_0024799_21_623 200
889 3300046691 Ga0495670_0076998 Ga0495670_0076998_1035_1637 200
890 3300046691 Ga0495670_0218889 Ga0495670_0218889_142_744 200
891 3300046692 Ga0495671_0004628 Ga0495671_0004628_782_1384 200
892 3300046692 Ga0495671_0008562 Ga0495671_0008562_4498_5100 200
893 3300046692 Ga0495671_0009715 Ga0495671_0009715_3748_4350 200
894 3300046692 Ga0495671_0017976 Ga0495671_0017976_201_803 200
895 3300046692 Ga0495671_0041400 Ga0495671_0041400_555_1157 200
896 3300046692 Ga0495671_0047927 Ga0495671_0047927_1038_1640 200
897 3300046692 Ga0495671_0076678 Ga0495671_0076678_170_772 200
898 3300046692 Ga0495671_0110517 Ga0495671_0110517_403_1005 200
899 3300046692 Ga0495671_0232033 Ga0495671_0232033_218_820 200
900 3300046692 Ga0495671_0342220 Ga0495671_0342220_63_665 200
901 3300046694 Ga0495649_0001824 Ga0495649_0001824_4831_5433 200
902 3300046694 Ga0495649_0012385 Ga0495649_0012385_482_1084 200
903 3300046694 Ga0495649_0031659 Ga0495649_0031659_2141_2743 200
904 3300046694 Ga0495649_0046671 Ga0495649_0046671_1049_1651 200
905 3300046694 Ga0495649_0064886 Ga0495649_0064886_651_1253 200
906 3300046694 Ga0495649_0065109 Ga0495649_0065109_625_1227 200
907 3300046694 Ga0495649_0083414 Ga0495649_0083414_207_809 200
908 3300046694 Ga0495649_0090370 Ga0495649_0090370_730_1332 200
909 3300046694 Ga0495649_0142045 Ga0495649_0142045_184_786 200
910 3300046694 Ga0495649_0354084 Ga0495649_0354084_14_616 200
911 3300046694 Ga0495649_0407064 Ga0495649_0407064_48_650 200
912 3300046794 Ga0495589_0000918 Ga0495589_0000918_7736_8338 200
913 3300046794 Ga0495589_0002071 Ga0495589_0002071_5602_6204 200
914 3300046794 Ga0495589_0015503 Ga0495589_0015503_3064_3666 200
915 3300046794 Ga0495589_0021718 Ga0495589_0021718_2275_2877 200
916 3300046794 Ga0495589_0041255 Ga0495589_0041255_1644_2246 200
917 3300046794 Ga0495589_0140918 Ga0495589_0140918_531_1133 200
918 3300046809 Ga0495600_0061164 Ga0495600_0061164_1135_1737 200
919 3300046809 Ga0495600_0178085 Ga0495600_0178085_688_1290 200
920 3300046810 Ga0495660_0021679 Ga0495660_0021679_2855_3457 200
921 3300046810 Ga0495660_0081388 Ga0495660_0081388_710_1312 200
922 3300046810 Ga0495660_0089496 Ga0495660_0089496_195_797 200
923 3300046810 Ga0495660_0094580 Ga0495660_0094580_860_1462 200
924 3300046810 Ga0495660_0110362 Ga0495660_0110362_625_1227 200
925 3300046810 Ga0495660_0168010 Ga0495660_0168010_151_753 200
926 3300046810 Ga0495660_0264590 Ga0495660_0264590_68_670 200
927 3300047315 Ga0495581_0061855 Ga0495581_0061855_351_953 200
928 3300047315 Ga0495581_0258372 Ga0495581_0258372_203_805 200
929 3300047317 Ga0495604_0062389 Ga0495604_0062389_1517_2119 200
930 3300047318 Ga0495636_0013407 Ga0495636_0013407_2547_3149 200
931 3300047318 Ga0495636_0016829 Ga0495636_0016829_674_1276 200
932 3300047319 Ga0495674_0431563 Ga0495674_0431563_187_789 200
933 3300047320 Ga0495672_0003884 Ga0495672_0003884_9224_9826 200
934 3300047320 Ga0495672_0004360 Ga0495672_0004360_7252_7854 200
935 3300047320 Ga0495672_0006960 Ga0495672_0006960_525_1127 200
936 3300047320 Ga0495672_0011630 Ga0495672_0011630_4868_5470 200
937 3300047320 Ga0495672_0012419 Ga0495672_0012419_4648_5250 200
938 3300047320 Ga0495672_0017506 Ga0495672_0017506_1785_2387 200
939 3300047320 Ga0495672_0019239 Ga0495672_0019239_3751_4353 200
940 3300047320 Ga0495672_0039236 Ga0495672_0039236_1133_1735 200
941 3300047320 Ga0495672_0053952 Ga0495672_0053952_1691_2293 200
942 3300047320 Ga0495672_0075740 Ga0495672_0075740_35_637 200
943 3300047320 Ga0495672_0083248 Ga0495672_0083248_564_1166 200
944 3300047320 Ga0495672_0103027 Ga0495672_0103027_172_774 200
945 3300047320 Ga0495672_0125285 Ga0495672_0125285_566_1168 200
946 3300047320 Ga0495672_0212981 Ga0495672_0212981_211_813 200
947 3300047320 Ga0495672_0283261 Ga0495672_0283261_152_754 200
948 3300047322 Ga0495680_0002433 Ga0495680_0002433_7320_7922 200
949 3300047322 Ga0495680_0036378 Ga0495680_0036378_730_1332 200
950 3300047322 Ga0495680_0165381 Ga0495680_0165381_788_1390 200
951 3300047322 Ga0495680_0537051 Ga0495680_0537051_108_710 200
952 3300047323 Ga0495683_0008727 Ga0495683_0008727_820_1422 200
953 3300047323 Ga0495683_0026936 Ga0495683_0026936_1375_1977 200
954 3300047323 Ga0495683_0113503 Ga0495683_0113503_92_694 200
955 3300047323 Ga0495683_0174334 Ga0495683_0174334_89_691 200
956 3300047443 Ga0495687_005361 Ga0495687_005361_6569_7171 200
957 3300047443 Ga0495687_031459 Ga0495687_031459_112_714 200
958 3300047443 Ga0495687_044748 Ga0495687_044748_596_1198 200
959 3300047443 Ga0495687_074572 Ga0495687_074572_80_682 200
960 3300047445 Ga0495677_0001306 Ga0495677_0001306_543_1145 200
961 3300047445 Ga0495677_0145115 Ga0495677_0145115_131_733 200
962 3300047446 Ga0495679_024738 Ga0495679_024738_1194_1796 200
963 3300047446 Ga0495679_037239 Ga0495679_037239_737_1339 200
964 3300047446 Ga0495679_069304 Ga0495679_069304_86_688 200
965 3300047447 Ga0495685_085515 Ga0495685_085515_317_919 200
966 3300047469 Ga0495673_0005218 Ga0495673_0005218_4639_5241 200
967 3300047469 Ga0495673_0006168 Ga0495673_0006168_1161_1763 200
968 3300047469 Ga0495673_0007676 Ga0495673_0007676_4596_5198 200
969 3300047469 Ga0495673_0009165 Ga0495673_0009165_4552_5154 200
970 3300047469 Ga0495673_0009710 Ga0495673_0009710_4411_5013 200
971 3300047469 Ga0495673_0015441 Ga0495673_0015441_2739_3341 200
972 3300047469 Ga0495673_0025778 Ga0495673_0025778_505_1107 200
973 3300047469 Ga0495673_0038061 Ga0495673_0038061_1159_1761 200
974 3300047469 Ga0495673_0105918 Ga0495673_0105918_449_1051 200
975 3300047469 Ga0495673_0150889 Ga0495673_0150889_206_808 200
976 3300047469 Ga0495673_0156760 Ga0495673_0156760_179_781 200
977 3300047470 Ga0495681_0002383 Ga0495681_0002383_10041_10643 200
978 3300047470 Ga0495681_0004962 Ga0495681_0004962_333_935 200
979 3300047470 Ga0495681_0008341 Ga0495681_0008341_747_1349 200
980 3300047470 Ga0495681_0009563 Ga0495681_0009563_4631_5233 200
981 3300047470 Ga0495681_0010666 Ga0495681_0010666_631_1233 200
982 3300047470 Ga0495681_0016197 Ga0495681_0016197_3203_3805 200
983 3300047470 Ga0495681_0016536 Ga0495681_0016536_2770_3372 200
984 3300047470 Ga0495681_0020738 Ga0495681_0020738_2736_3338 200
985 3300047470 Ga0495681_0054819 Ga0495681_0054819_61_663 200
986 3300047470 Ga0495681_0060390 Ga0495681_0060390_988_1590 200
987 3300047470 Ga0495681_0071792 Ga0495681_0071792_239_841 200
988 3300047470 Ga0495681_0081306 Ga0495681_0081306_658_1260 200
989 3300047470 Ga0495681_0129096 Ga0495681_0129096_353_955 200
990 3300047470 Ga0495681_0172902 Ga0495681_0172902_211_813 200
991 3300047472 Ga0495686_0029158 Ga0495686_0029158_565_1167 200
992 3300047472 Ga0495686_0064955 Ga0495686_0064955_75_677 200
993 3300047472 Ga0495686_0183861 Ga0495686_0183861_429_1031 200
994 3300047472 Ga0495686_0238883 Ga0495686_0238883_292_894 200
995 3300047673 Ga0495593_0017925 Ga0495593_0017925_732_1334 200
996 3300047673 Ga0495593_0082252 Ga0495593_0082252_514_1116 200
997 3300047673 Ga0495593_0355268 Ga0495593_0355268_117_719 200
998 3300048088 Ga0495602_0170217 Ga0495602_0170217_378_980 200
999 3300048089 Ga0495614_0177743 Ga0495614_0177743_50_652 200
1000 3300048091 Ga0495626_0000242 Ga0495626_0000242_7251_7853 200
1001 3300048091 Ga0495626_0001832 Ga0495626_0001832_5315_5917 200
1002 3300048091 Ga0495626_0003058 Ga0495626_0003058_1156_1758 200
1003 3300048091 Ga0495626_0024057 Ga0495626_0024057_1664_2266 200
1004 3300048091 Ga0495626_0052218 Ga0495626_0052218_232_834 200
1005 3300048091 Ga0495626_0063285 Ga0495626_0063285_86_688 200
1006 3300048091 Ga0495626_0207197 Ga0495626_0207197_121_723 200
1007 3300048091 Ga0495626_0240986 Ga0495626_0240986_27_629 200
1008 3300048905 Ga0496102_0002921 Ga0496102_0002921_10170_10772 200
1009 3300048905 Ga0496102_0412767 Ga0496102_0412767_275_877 200
1010 3300048905 Ga0496102_0879801 Ga0496102_0879801_37_639 200
1011 3300048906 Ga0496103_0199568 Ga0496103_0199568_525_1127 200
1012 3300048908 Ga0496105_0199517 Ga0496105_0199517_724_1326 200
1013 3300048909 Ga0496106_0383505 Ga0496106_0383505_470_1072 200
1014 3300048913 Ga0496110_0069439 Ga0496110_0069439_2419_3021 200
1015 3300048913 Ga0496110_0384741 Ga0496110_0384741_238_840 200
1016 3300048913 Ga0496110_0661238 Ga0496110_0661238_109_711 200
1017 3300048913 Ga0496110_0796049 Ga0496110_0796049_100_702 200
1018 3300048914 Ga0496111_0429774 Ga0496111_0429774_117_719 200
1019 3300048915 Ga0496112_0595844 Ga0496112_0595844_245_847 200
1020 3300048918 Ga0496115_0338557 Ga0496115_0338557_97_699 200
1021 3300048919 Ga0496116_0000881 Ga0496116_0000881_11301_11903 200
1022 3300048919 Ga0496116_0004892 Ga0496116_0004892_7612_8214 200
1023 3300048919 Ga0496116_0095145 Ga0496116_0095145_549_1151 200
1024 3300048919 Ga0496116_0102424 Ga0496116_0102424_474_1076 200
1025 3300048920 Ga0496117_0002861 Ga0496117_0002861_11301_11903 200
1026 3300048920 Ga0496117_0021194 Ga0496117_0021194_176_778 200
1027 3300048920 Ga0496117_0065064 Ga0496117_0065064_1180_1782 200
1028 3300048920 Ga0496117_0140100 Ga0496117_0140100_198_800 200
1029 3300048920 Ga0496117_0173425 Ga0496117_0173425_293_895 200
1030 3300048920 Ga0496117_0221332 Ga0496117_0221332_93_695 200
1031 3300048921 Ga0496118_0053236 Ga0496118_0053236_1125_1727 200
1032 3300048921 Ga0496118_0104397 Ga0496118_0104397_620_1222 200
1033 3300048921 Ga0496118_0133121 Ga0496118_0133121_278_880 200
1034 3300048921 Ga0496118_0203565 Ga0496118_0203565_54_656 200
1035 3300048921 Ga0496118_0206512 Ga0496118_0206512_530_1132 200
1036 3300048921 Ga0496118_0388422 Ga0496118_0388422_57_659 200
1037 3300048922 Ga0496119_0116846 Ga0496119_0116846_393_995 200
1038 3300048924 Ga0496121_0001650 Ga0496121_0001650_11428_12030 200
1039 3300048924 Ga0496121_0002827 Ga0496121_0002827_22684_23286 200
1040 3300048924 Ga0496121_0045727 Ga0496121_0045727_240_842 200
1041 3300048924 Ga0496121_0063687 Ga0496121_0063687_673_1275 200
1042 3300048924 Ga0496121_0223445 Ga0496121_0223445_279_881 200
1043 3300048925 Ga0496122_0096287 Ga0496122_0096287_675_1277 200
1044 3300048925 Ga0496122_0132207 Ga0496122_0132207_373_975 200
1045 3300048926 Ga0496123_0027453 Ga0496123_0027453_3142_3744 200
1046 3300048926 Ga0496123_0081253 Ga0496123_0081253_1314_1916 200
1047 3300048926 Ga0496123_0103535 Ga0496123_0103535_747_1349 200
1048 3300048927 Ga0496124_0001280 Ga0496124_0001280_35524_36126 200
1049 3300048927 Ga0496124_0024994 Ga0496124_0024994_283_885 200
1050 3300048927 Ga0496124_0273670 Ga0496124_0273670_153_755 200
1051 3300048927 Ga0496124_0279264 Ga0496124_0279264_99_701 200
1052 3300048927 Ga0496124_0306361 Ga0496124_0306361_328_930 200
1053 3300048927 Ga0496124_0484971 Ga0496124_0484971_67_669 200
1054 3300048927 Ga0496124_0501643 Ga0496124_0501643_136_738 200
1055 3300048927 Ga0496124_0520607 Ga0496124_0520607_113_715 200
1056 3300048928 Ga0496125_0156909 Ga0496125_0156909_84_686 200
1057 3300048928 Ga0496125_0180253 Ga0496125_0180253_625_1227 200
1058 3300048929 Ga0496126_0326389 Ga0496126_0326389_611_1213 200
1059 3300049459 Ga0495678_001946 Ga0495678_001946_9863_10465 200
1060 3300049459 Ga0495678_019529 Ga0495678_019529_1571_2173 200
1061 3300049459 Ga0495678_032957 Ga0495678_032957_208_810 200
1062 3300049459 Ga0495678_039954 Ga0495678_039954_438_1040 200
1063 3300049459 Ga0495678_042971 Ga0495678_042971_211_813 200
1064 3300049459 Ga0495678_045109 Ga0495678_045109_625_1227 200
1065 3300049459 Ga0495678_057220 Ga0495678_057220_850_1452 200
1066 3300049460 Ga0495682_0035529 Ga0495682_0035529_700_1302 200
1067 3300049460 Ga0495682_0036598 Ga0495682_0036598_35_637 200
1068 3300049460 Ga0495682_0045704 Ga0495682_0045704_266_868 200
1069 3300049460 Ga0495682_0076491 Ga0495682_0076491_124_726 200
1070 3300049460 Ga0495682_0077877 Ga0495682_0077877_185_787 200
1071 3300049460 Ga0495682_0089738 Ga0495682_0089738_486_1088 200
1072 3300049460 Ga0495682_0185216 Ga0495682_0185216_72_674 200
1073 3300049758 Ga0501241_011913 Ga0501241_011913_568_1170 200
1074 3300049766 Ga0501269_014228 Ga0501269_014228_170_772 200
1075 3300050489 nmdc:mga03683_305342_c1 nmdc:mga03683_305342_c1_46_648 200
1076 3300050491 nmdc:mga00v17_222156_c1 nmdc:mga00v17_222156_c1_267_869 200
1077 3300053140 Ga0500573_0064542 Ga0500573_0064542_247_849 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06041

DUF924

Bacterial protein of unknown function (DUF924)

8

195

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6h-assembly1.cif.gz_B structure of protein of unknown function atu0120 from agrobacterium tumefaciens 0.8736 19 192
2i6h-assembly1.cif.gz_B structure of protein of unknown function atu0120 from agrobacterium tumefaciens 0.8304 19 192
2n8w-assembly1.cif.gz_A solution nmr structure of designed protein da05r1, northeast structural genomics consortium (nesg) target or690 0.6406 93 169
3jaj-assembly1.cif.gz_6 structure of the engaged state of the mammalian srp-ribosome complex 0.5396 16 169
4epz-assembly1.cif.gz_A crystal structure of a transcription anti-terminator antagonist upxz (bacuni_04315) from bacteroides uniformis atcc 8492 at 1.68 a resolution 0.5369 16 164
ID Description Score Start End Superfamily
2i6hB02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9272 91 192 1.25.40.10
2i6hB02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8727 91 192 1.25.40.10
af_P82872_1_141_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6215 44 181 1.25.40.10
af_P82805_1_146_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6123 35 186 1.25.40.10
af_P82805_1_146_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.596 35 186 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A3D0KBE4-F1-model_v4 deleted 0.9975 1 125
AF-A0A365VNW2-F1-model_v4 deleted 0.9954 87 199
AF-A0A068Z0E8-F1-model_v4 Putative transmembrane protein 0.9913 124 195
AF-A0A1E4PPH0-F1-model_v4 deleted 0.9886 5 199
AF-A0A2V4L6P2-F1-model_v4 DUF924 domain-containing protein 0.9885 1 199

Feature Viewer

pLDDT pTM Quality
94.6 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map