F489570
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1075 | 662 | 667 | 528 |
Family's Representative Sequence
| Representative Sequence | 3300049822|Ga0501035_0031397|Ga0501035_0031397_1577_3280 |
| Length | 567 |
| Sequence | MFMAPFPNPEWTRTPLGDEIDCTHVSNTSKKGERGVMNPFKIMGLAVAALFAAYVPAFAATPADTVVIADKIDDIVSLDPAESFEFSGNDALNNVYDRLIEIDPATMKLKPGLAESWSVADDGKTYTFKIRQGVKFHSGNPVTAEDCAWSLQRAVKLNKTPAFILTQFGFTPQNVDQMIKANGDAELQITTDKSYAPSFFYNILTAIVASVVDKKEALSHEENGDMGYNWLKTHSAASGPFMLRAWKPNDSLVLEKPEGFDYFNGKVAMRRIYVRHVPESSAQRLLLEKGDIDIARKLTPGDVEAVSKSPDIKIKEEVRGRIFYVAGNQKVEALAKPKVMEAIKYAIDYDGMVNSFLKGQMKVHQSFLPEGFLGAIDDNPYKLDIDKAKALLKEAGYPDGLDLTLWVRNDQQRLDMAQSIQATLGQAGIKITLKTGTGSEILGDFRARKQQLILEAWGPDYPDPQTNASTFASNANNSDEAKLTGVLAWRTAWDAKETTPMVEAAVVEKDSDKRAKMYEDMQRKMQKEAPFAWMFQEVAQTAIRKNVNGFGAGGALSSAFYWPVTKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 2 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 7 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 8 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 9 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 10 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 11 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 12 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 13 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 14 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 15 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 16 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 17 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 18 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 19 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 20 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 21 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 22 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 23 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 24 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 25 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 26 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 27 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 28 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 29 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 30 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 31 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 32 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 33 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 34 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 35 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 36 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 37 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 38 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 39 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 40 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 41 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 42 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 43 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 44 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 45 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 46 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 47 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 48 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 49 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 50 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 51 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 52 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 53 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 54 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 55 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 56 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 57 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 58 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 59 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 60 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 61 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 62 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 63 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 64 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 65 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 66 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 67 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 68 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 69 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 70 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 71 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 72 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 73 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 74 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 75 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 76 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 77 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 78 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 79 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 80 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 81 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 82 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 83 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 84 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 85 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 86 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 87 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 88 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 89 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 90 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 91 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 92 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 93 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 94 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 95 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 96 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 97 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 98 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 99 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 100 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 101 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 102 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 103 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 104 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 105 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 106 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 107 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 108 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 109 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 110 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 111 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 112 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 113 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 114 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 115 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 116 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 117 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 118 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 119 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 120 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 121 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 122 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 123 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 124 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 125 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 126 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 127 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 128 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 129 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 130 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 131 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 132 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 133 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 134 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 135 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 136 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 137 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 138 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 139 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 140 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 141 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 142 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 143 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 144 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 145 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 146 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 147 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 148 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 149 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 150 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 151 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 152 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 153 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 154 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 155 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 156 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 157 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 158 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 159 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 160 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 161 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 162 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 163 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 164 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 165 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 166 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 167 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 168 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 169 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 170 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 171 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 172 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 173 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 174 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 175 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 176 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 177 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 178 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 179 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 180 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 181 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 182 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 183 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 184 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 185 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 186 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 187 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 188 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 189 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 190 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 191 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 192 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 193 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 194 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 195 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 196 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 197 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 198 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 199 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 200 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 201 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 202 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 203 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 204 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 205 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 206 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 207 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 208 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 209 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 210 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 211 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 212 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 213 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 214 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 215 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 216 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 217 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 218 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 219 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 220 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 221 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 222 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 223 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 224 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 225 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 226 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 227 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 228 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 229 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 230 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 231 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 232 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 233 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 234 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 235 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 236 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 237 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 238 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 239 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 240 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 241 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 242 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 243 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 244 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 245 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 246 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 247 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 248 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 249 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 250 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 251 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 252 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 253 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 254 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 255 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 256 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 257 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 258 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 259 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 260 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 261 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 262 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 263 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 264 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 265 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 266 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 267 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 268 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 269 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 270 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 271 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 272 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 273 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 274 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 275 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 276 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 277 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 278 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 279 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 280 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 281 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 282 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 283 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 284 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 285 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 286 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 287 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 288 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 289 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 290 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 291 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 292 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 293 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 294 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 295 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 296 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 297 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 298 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 299 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 300 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 301 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 302 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 303 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 304 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 305 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 306 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 307 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 308 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 309 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 310 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 311 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 312 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 313 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 314 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 315 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 316 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 317 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 318 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 319 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 320 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 321 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 322 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 323 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 324 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 325 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 326 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 327 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 328 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 329 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 330 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 331 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 332 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 333 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 334 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 335 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 336 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 337 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 338 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 339 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 340 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 341 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 342 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 343 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 344 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 345 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 346 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 347 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 348 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 349 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 350 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 351 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 352 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 353 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 354 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 355 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 356 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 357 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 358 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 359 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 360 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 361 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 362 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 363 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 364 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 365 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 366 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 367 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 368 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 369 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 370 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 371 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 372 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 373 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 374 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 375 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 377 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 378 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 379 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 381 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 382 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 383 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 384 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 385 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 386 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 387 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 388 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 389 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 390 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 391 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 392 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 393 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 394 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 395 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 396 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 397 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 398 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 399 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 400 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 401 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 402 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 403 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 404 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 405 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 406 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 407 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 408 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 409 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 410 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 411 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 412 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 413 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 414 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 415 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 416 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 417 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 418 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 419 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 420 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 421 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 422 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 423 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 424 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 425 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 426 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 427 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 428 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 429 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 430 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 431 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 432 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 433 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 434 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 435 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 466 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 469 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 470 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 471 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 472 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 473 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 474 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 475 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 476 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 477 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 478 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 479 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 480 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 481 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 482 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 483 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 484 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 485 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 486 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 487 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 488 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 489 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 490 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 491 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 492 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 493 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 494 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 495 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 554 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 555 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 556 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 557 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 558 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 559 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 560 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 561 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 562 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 563 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 564 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 565 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 566 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 567 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 568 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 569 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 570 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 571 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 572 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 573 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 574 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 575 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 576 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 577 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 579 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 580 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 582 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 583 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 584 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 585 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 586 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 587 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 588 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 589 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 590 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 591 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 592 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 593 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 594 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 595 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 596 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 597 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 598 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 599 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 600 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 601 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 602 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 603 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 604 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 605 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 606 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 607 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 608 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 609 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 610 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 611 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 612 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 613 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 614 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 615 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 616 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 617 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 618 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 619 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 620 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 621 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 622 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 623 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 624 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 625 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 626 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 627 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 628 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 629 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 630 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 631 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 632 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 633 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 634 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 635 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 636 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 637 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 638 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 639 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 640 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 641 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 642 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 643 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 644 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 645 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 646 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 647 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 648 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 649 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 650 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 651 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 652 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 653 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 654 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 655 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 656 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 657 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 658 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 659 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 660 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 661 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 662 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 63.72 |
| Metatranscriptomes | 0 |
| Isolates | 36.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.37 |
| Bulb | 0 |
| Endosphere | 23.16 |
| Nodule | 20.19 |
| Rhizoplane | 3.44 |
| Rhizosphere | 36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10010600 | 3300001979 | Bacteria | 3541 |
| 2 | JGI24735J21928_10004245 | 3300002067 | Bacteria | 4832 |
| 3 | JGI24735J21928_10011784 | 3300002067 | Bacteria | 2769 |
| 4 | JGI24738J21930_10000994 | 3300002075 | Bacteria | 8127 |
| 5 | JGI25155J39150_1000021 | 3300002704 | Bacteria | 150730 |
| 6 | JGI25155J39150_1000323 | 3300002704 | Bacteria | 16055 |
| 7 | JGI25156J39149_1000022 | 3300002705 | Bacteria | 150730 |
| 8 | JGI25156J39149_1000542 | 3300002705 | Bacteria | 21695 |
| 9 | JGI25156J39149_1000553 | 3300002705 | Bacteria | 21412 |
| 10 | JGI25156J39149_1000666 | 3300002705 | Bacteria | 18714 |
| 11 | JGI25156J39149_1000897 | 3300002705 | Bacteria | 14652 |
| 12 | JGI25154J39366_1000048 | 3300002738 | Bacteria | 126252 |
| 13 | JGI25154J39366_1000657 | 3300002738 | Bacteria | 16151 |
| 14 | JGI25158J39367_1001429 | 3300002739 | Bacteria | 4186 |
| 15 | JGI25157J39369_1000025 | 3300002741 | Bacteria | 150726 |
| 16 | JGI25157J39369_1000791 | 3300002741 | Bacteria | 16148 |
| 17 | JGI25152J39213_1001761 | 3300002773 | Bacteria | 8823 |
| 18 | JGI25152J39213_1002623 | 3300002773 | Bacteria | 6688 |
| 19 | JGI25152J39213_1011838 | 3300002773 | Bacteria | 1906 |
| 20 | JGI25150J39212_1004051 | 3300002774 | Bacteria | 3318 |
| 21 | JGI25159J45721_1000407 | 3300002987 | Bacteria | 19965 |
| 22 | JGI25159J45721_1001213 | 3300002987 | Bacteria | 10935 |
| 23 | JGI25159J45721_1001463 | 3300002987 | Bacteria | 9739 |
| 24 | JGI25151J46595_10000143 | 3300003187 | Bacteria | 95160 |
| 25 | JGI25151J46595_10003498 | 3300003187 | Bacteria | 8666 |
| 26 | JGI25151J46595_10020879 | 3300003187 | Bacteria | 2751 |
| 27 | JGI25165J46597_1000508 | 3300003214 | Bacteria | 37207 |
| 28 | JGI25153J46596_10003267 | 3300003215 | Bacteria | 9113 |
| 29 | JGI25153J46596_10004883 | 3300003215 | Bacteria | 7129 |
| 30 | JGI25153J46596_10009989 | 3300003215 | Bacteria | 4337 |
| 31 | JGI25153J46596_10017391 | 3300003215 | Bacteria | 2833 |
| 32 | JGI25153J46596_10027568 | 3300003215 | Bacteria | 1987 |
| 33 | rootH2_10017840 | 3300003320 | Bacteria | 4868 |
| 34 | rootH2_10048674 | 3300003320 | Bacteria | 5572 |
| 35 | rootL2_10017323 | 3300003322 | Bacteria | 6871 |
| 36 | rootL2_10034586 | 3300003322 | Bacteria | 6634 |
| 37 | rootH1_10138215 | 3300003323 | Bacteria | 3757 |
| 38 | rootH1_10157577 | 3300003323 | Bacteria | 3692 |
| 39 | rootH1_10345004 | 3300003323 | Bacteria | 2373 |
| 40 | JGI25160J50197_1000172 | 3300003354 | Bacteria | 55781 |
| 41 | JGI25160J50197_1001141 | 3300003354 | Bacteria | 13584 |
| 42 | JGI25160J50197_1001510 | 3300003354 | Bacteria | 11568 |
| 43 | JGI25160J50197_1002009 | 3300003354 | Bacteria | 9705 |
| 44 | JGI25161J50226_1000007 | 3300003374 | Bacteria | 256181 |
| 45 | JGI25161J50226_1000119 | 3300003374 | Bacteria | 58009 |
| 46 | Ga0055533_1000188 | 3300003756 | Bacteria | 51375 |
| 47 | Ga0055532_1000069 | 3300003758 | Bacteria | 138614 |
| 48 | Ga0055532_1000743 | 3300003758 | Bacteria | 11887 |
| 49 | Ga0055532_1001039 | 3300003758 | Bacteria | 8594 |
| 50 | Ga0055527_1000034 | 3300003760 | Bacteria | 138614 |
| 51 | Ga0055527_1000643 | 3300003760 | Bacteria | 10622 |
| 52 | Ga0055527_1002267 | 3300003760 | Bacteria | 3357 |
| 53 | Ga0055535_1000049 | 3300003761 | Bacteria | 138835 |
| 54 | Ga0055535_1001039 | 3300003761 | Bacteria | 17502 |
| 55 | Ga0055535_1001609 | 3300003761 | Bacteria | 10622 |
| 56 | Ga0055542_1000077 | 3300003762 | Bacteria | 138614 |
| 57 | Ga0055542_1001029 | 3300003762 | Bacteria | 17502 |
| 58 | Ga0055542_1002338 | 3300003762 | Bacteria | 6505 |
| 59 | Ga0055529_1000090 | 3300003763 | Bacteria | 138416 |
| 60 | Ga0055529_1000861 | 3300003763 | Bacteria | 17502 |
| 61 | Ga0055529_1001109 | 3300003763 | Bacteria | 11958 |
| 62 | Ga0055529_1003258 | 3300003763 | Bacteria | 2748 |
| 63 | Ga0055526_1000483 | 3300003771 | Bacteria | 31566 |
| 64 | Ga0055526_1003358 | 3300003771 | Bacteria | 10218 |
| 65 | Ga0055526_1003566 | 3300003771 | Bacteria | 9799 |
| 66 | Ga0055526_1008055 | 3300003771 | Bacteria | 5323 |
| 67 | Ga0055537_1000356 | 3300003773 | Bacteria | 31055 |
| 68 | Ga0055524_1000213 | 3300003775 | Bacteria | 61225 |
| 69 | Ga0055524_1005603 | 3300003775 | Bacteria | 5576 |
| 70 | Ga0055524_1010867 | 3300003775 | Bacteria | 3596 |
| 71 | Ga0055536_1002551 | 3300003781 | Bacteria | 10178 |
| 72 | Ga0055536_1003731 | 3300003781 | Bacteria | 8072 |
| 73 | Ga0055536_1005112 | 3300003781 | Bacteria | 6494 |
| 74 | Ga0055536_1005115 | 3300003781 | Bacteria | 6493 |
| 75 | Ga0055534_1001441 | 3300003784 | Bacteria | 9464 |
| 76 | Ga0055528_1000106 | 3300003790 | Bacteria | 67208 |
| 77 | Ga0055528_1002706 | 3300003790 | Bacteria | 9314 |
| 78 | Ga0055528_1003757 | 3300003790 | Bacteria | 7489 |
| 79 | Ga0055528_1004586 | 3300003790 | Bacteria | 6618 |
| 80 | Ga0055528_1005284 | 3300003790 | Bacteria | 6046 |
| 81 | Ga0055528_1006282 | 3300003790 | Bacteria | 5405 |
| 82 | Ga0055528_1015996 | 3300003790 | Bacteria | 2678 |
| 83 | Ga0055530_10000763 | 3300003791 | Bacteria | 26793 |
| 84 | Ga0055530_10001299 | 3300003791 | Bacteria | 18844 |
| 85 | Ga0055540_1000103 | 3300003792 | Bacteria | 94710 |
| 86 | Ga0055540_1000504 | 3300003792 | Bacteria | 29761 |
| 87 | Ga0055540_1000919 | 3300003792 | Bacteria | 19209 |
| 88 | Ga0055531_10000857 | 3300003794 | Bacteria | 24966 |
| 89 | Ga0055531_10003817 | 3300003794 | Bacteria | 9448 |
| 90 | Ga0058692_1001653 | 3300003856 | Bacteria | 7999 |
| 91 | Ga0058692_1010442 | 3300003856 | Bacteria | 2293 |
| 92 | Ga0055543_1000492 | 3300004625 | Bacteria | 22827 |
| 93 | Ga0055543_1003014 | 3300004625 | Bacteria | 5206 |
| 94 | Ga0065165_1000617 | 3300005262 | Bacteria | 51627 |
| 95 | Ga0065165_1007234 | 3300005262 | Bacteria | 5523 |
| 96 | Ga0065715_10125569 | 3300005293 | Bacteria | 2128 |
| 97 | Ga0070658_10086424 | 3300005327 | Bacteria | 2580 |
| 98 | Ga0070658_10148830 | 3300005327 | Bacteria | 1959 |
| 99 | Ga0070676_10005120 | 3300005328 | Bacteria | 6956 |
| 100 | Ga0070676_10067579 | 3300005328 | Bacteria | 2137 |
| 101 | Ga0070670_100002139 | 3300005331 | Bacteria | 16217 |
| 102 | Ga0070670_100007600 | 3300005331 | Bacteria | 9204 |
| 103 | Ga0070670_100010144 | 3300005331 | Bacteria | 8036 |
| 104 | Ga0068869_100000007 | 3300005334 | Bacteria | 78820 |
| 105 | Ga0068869_100011980 | 3300005334 | Bacteria | 5708 |
| 106 | Ga0070666_10052478 | 3300005335 | Bacteria | 2748 |
| 107 | Ga0068868_100018350 | 3300005338 | Bacteria | 5231 |
| 108 | Ga0070660_100000013 | 3300005339 | Bacteria | 116814 |
| 109 | Ga0070660_100004148 | 3300005339 | Bacteria | 10008 |
| 110 | Ga0070660_100042870 | 3300005339 | Bacteria | 3455 |
| 111 | Ga0070668_100005031 | 3300005347 | Bacteria | 9790 |
| 112 | Ga0070668_100005135 | 3300005347 | Bacteria | 9706 |
| 113 | Ga0070668_100021570 | 3300005347 | Bacteria | 4867 |
| 114 | Ga0070668_100061481 | 3300005347 | Bacteria | 2910 |
| 115 | Ga0070669_100024859 | 3300005353 | Bacteria | 4299 |
| 116 | Ga0070673_100007422 | 3300005364 | Bacteria | 7227 |
| 117 | Ga0070673_100014047 | 3300005364 | Bacteria | 5561 |
| 118 | Ga0070688_100045766 | 3300005365 | Bacteria | 2706 |
| 119 | Ga0070659_100000028 | 3300005366 | Bacteria | 140665 |
| 120 | Ga0070667_100001939 | 3300005367 | Bacteria | 18351 |
| 121 | Ga0070667_100058752 | 3300005367 | Bacteria | 3252 |
| 122 | Ga0070667_100116288 | 3300005367 | Bacteria | 2323 |
| 123 | Ga0070713_100012418 | 3300005436 | Bacteria | 6247 |
| 124 | Ga0070700_100031085 | 3300005441 | Bacteria | 3196 |
| 125 | Ga0070663_100001036 | 3300005455 | Bacteria | 15176 |
| 126 | Ga0070663_100046701 | 3300005455 | Bacteria | 3065 |
| 127 | Ga0070663_100134410 | 3300005455 | Bacteria | 1882 |
| 128 | Ga0070662_100008004 | 3300005457 | Bacteria | 6878 |
| 129 | Ga0068867_100005604 | 3300005459 | Bacteria | 8896 |
| 130 | Ga0068867_100018855 | 3300005459 | Bacteria | 4909 |
| 131 | Ga0070665_100018024 | 3300005548 | Bacteria | 7086 |
| 132 | Ga0068855_100022253 | 3300005563 | Bacteria | 7596 |
| 133 | Ga0068855_100067537 | 3300005563 | Bacteria | 4164 |
| 134 | Ga0068857_100000676 | 3300005577 | Bacteria | 25307 |
| 135 | Ga0068856_100040417 | 3300005614 | Bacteria | 4581 |
| 136 | Ga0068852_100012681 | 3300005616 | Bacteria | 6412 |
| 137 | Ga0068859_100003514 | 3300005617 | Bacteria | 15961 |
| 138 | Ga0068864_100001466 | 3300005618 | Bacteria | 19448 |
| 139 | Ga0068864_100014538 | 3300005618 | Bacteria | 6540 |
| 140 | Ga0068861_100001688 | 3300005719 | Bacteria | 14166 |
| 141 | Ga0068870_10015499 | 3300005840 | Bacteria | 3617 |
| 142 | Ga0068863_100008080 | 3300005841 | Bacteria | 10275 |
| 143 | Ga0068863_100014934 | 3300005841 | Bacteria | 7459 |
| 144 | Ga0068863_100132868 | 3300005841 | Bacteria | 2376 |
| 145 | Ga0068860_100005878 | 3300005843 | Bacteria | 12351 |
| 146 | Ga0068860_100011434 | 3300005843 | Bacteria | 8744 |
| 147 | Ga0068862_100002922 | 3300005844 | Bacteria | 14933 |
| 148 | Ga0068862_100016544 | 3300005844 | Bacteria | 6141 |
| 149 | Ga0081455_10107414 | 3300005937 | Bacteria | 2225 |
| 150 | Ga0075365_10001384 | 3300006038 | Bacteria | 10914 |
| 151 | Ga0075365_10015773 | 3300006038 | Bacteria | 4576 |
| 152 | Ga0075363_100021412 | 3300006048 | Bacteria | 3256 |
| 153 | Ga0075363_100034542 | 3300006048 | Bacteria | 2640 |
| 154 | Ga0075364_10000058 | 3300006051 | Bacteria | 41383 |
| 155 | Ga0075364_10000212 | 3300006051 | Bacteria | 27340 |
| 156 | Ga0075364_10007527 | 3300006051 | Bacteria | 6472 |
| 157 | Ga0075364_10020347 | 3300006051 | Bacteria | 4173 |
| 158 | Ga0075362_10002938 | 3300006177 | Bacteria | 5848 |
| 159 | Ga0075362_10010457 | 3300006177 | Bacteria | 3624 |
| 160 | Ga0075362_10016569 | 3300006177 | Bacteria | 3020 |
| 161 | Ga0075367_10002340 | 3300006178 | Bacteria | 8628 |
| 162 | Ga0075367_10008133 | 3300006178 | Bacteria | 5416 |
| 163 | Ga0075367_10017248 | 3300006178 | Bacteria | 3960 |
| 164 | Ga0075367_10030197 | 3300006178 | Bacteria | 3106 |
| 165 | Ga0075369_10012793 | 3300006186 | Bacteria | 3318 |
| 166 | Ga0075366_10003686 | 3300006195 | Bacteria | 8128 |
| 167 | Ga0097621_100011117 | 3300006237 | Bacteria | 6621 |
| 168 | Ga0075370_10009495 | 3300006353 | Bacteria | 5055 |
| 169 | Ga0075370_10018094 | 3300006353 | Bacteria | 3818 |
| 170 | Ga0075370_10039503 | 3300006353 | Bacteria | 2659 |
| 171 | Ga0075428_100054216 | 3300006844 | Bacteria | 4394 |
| 172 | Ga0068865_100111894 | 3300006881 | Bacteria | 2015 |
| 173 | Ga0097620_100003514 | 3300006931 | Bacteria | 15961 |
| 174 | Ga0099826_10000047 | 3300006948 | Bacteria | 74994 |
| 175 | Ga0099826_10008443 | 3300006948 | Bacteria | 7663 |
| 176 | Ga0105251_10000167 | 3300009011 | Bacteria | 67775 |
| 177 | Ga0105251_10000498 | 3300009011 | Bacteria | 37201 |
| 178 | Ga0105244_10024403 | 3300009036 | Bacteria | 3301 |
| 179 | Ga0105240_10008156 | 3300009093 | Bacteria | 15019 |
| 180 | Ga0105240_10089219 | 3300009093 | Bacteria | 3771 |
| 181 | Ga0105240_10097281 | 3300009093 | Bacteria | 3587 |
| 182 | Ga0105240_10226211 | 3300009093 | Bacteria | 2177 |
| 183 | Ga0105243_10009057 | 3300009148 | Bacteria | 7603 |
| 184 | Ga0105248_10001664 | 3300009177 | Bacteria | 24713 |
| 185 | Ga0105248_10069122 | 3300009177 | Bacteria | 3965 |
| 186 | Ga0105248_10069635 | 3300009177 | Bacteria | 3950 |
| 187 | Ga0105248_10215836 | 3300009177 | Bacteria | 2161 |
| 188 | Ga0105237_10039816 | 3300009545 | Bacteria | 4742 |
| 189 | Ga0105237_10050555 | 3300009545 | Bacteria | 4177 |
| 190 | Ga0105238_10024386 | 3300009551 | Bacteria | 6166 |
| 191 | Ga0105238_10054000 | 3300009551 | Bacteria | 4037 |
| 192 | Ga0105238_10163320 | 3300009551 | Bacteria | 2203 |
| 193 | Ga0105249_10151297 | 3300009553 | Bacteria | 2234 |
| 194 | Ga0123341_1000095 | 3300009765 | Bacteria | 37499 |
| 195 | Ga0123342_1022517 | 3300009766 | Bacteria | 4253 |
| 196 | Ga0105239_10003889 | 3300010375 | Bacteria | 18095 |
| 197 | Ga0105239_10079545 | 3300010375 | Bacteria | 3607 |
| 198 | Ga0105246_10080402 | 3300011119 | Bacteria | 2320 |
| 199 | Ga0105246_10104329 | 3300011119 | Bacteria | 2070 |
| 200 | Ga0157373_10013144 | 3300013100 | Bacteria | 6078 |
| 201 | Ga0157371_10000005 | 3300013102 | Bacteria | 416456 |
| 202 | Ga0157369_10012773 | 3300013105 | Bacteria | 9523 |
| 203 | Ga0157374_10000749 | 3300013296 | Bacteria | 28318 |
| 204 | Ga0157378_10030049 | 3300013297 | Bacteria | 4800 |
| 205 | Ga0157378_10206315 | 3300013297 | Bacteria | 1861 |
| 206 | Ga0163162_10002290 | 3300013306 | Bacteria | 17975 |
| 207 | Ga0163162_10007957 | 3300013306 | Bacteria | 10334 |
| 208 | Ga0163162_10047742 | 3300013306 | Bacteria | 4290 |
| 209 | Ga0157375_10001469 | 3300013308 | Bacteria | 20277 |
| 210 | Ga0157375_10035782 | 3300013308 | Bacteria | 4743 |
| 211 | Ga0163163_10001547 | 3300014325 | Bacteria | 19382 |
| 212 | Ga0157379_10000142 | 3300014968 | Bacteria | 51727 |
| 213 | Ga0182007_10005970 | 3300015262 | Bacteria | 5281 |
| 214 | Ga0182005_1003552 | 3300015265 | Bacteria | 5262 |
| 215 | Ga0183361_10002 | 3300016635 | Bacteria | 907642 |
| 216 | Ga0209435_100019 | 3300025206 | Bacteria | 260989 |
| 217 | Ga0209435_100033 | 3300025206 | Bacteria | 150395 |
| 218 | Ga0209436_100017 | 3300025208 | Bacteria | 116238 |
| 219 | Ga0209436_103175 | 3300025208 | Bacteria | 4490 |
| 220 | Ga0209566_100293 | 3300025225 | Bacteria | 45453 |
| 221 | Ga0209566_101869 | 3300025225 | Bacteria | 4725 |
| 222 | Ga0209566_102656 | 3300025225 | Bacteria | 3146 |
| 223 | Ga0209674_100139 | 3300025226 | Bacteria | 110389 |
| 224 | Ga0209674_100155 | 3300025226 | Bacteria | 91885 |
| 225 | Ga0209674_102069 | 3300025226 | Bacteria | 4569 |
| 226 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 227 | Ga0209672_100067 | 3300025228 | Bacteria | 180819 |
| 228 | Ga0209672_100079 | 3300025228 | Bacteria | 156875 |
| 229 | Ga0209672_100431 | 3300025228 | Bacteria | 24301 |
| 230 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 231 | Ga0209147_100012 | 3300025229 | Bacteria | 681990 |
| 232 | Ga0209147_100061 | 3300025229 | Bacteria | 248809 |
| 233 | Ga0209147_100107 | 3300025229 | Bacteria | 156875 |
| 234 | Ga0209563_101073 | 3300025230 | Bacteria | 7890 |
| 235 | Ga0207427_100494 | 3300025231 | Bacteria | 21083 |
| 236 | Ga0209258_100077 | 3300025242 | Bacteria | 264510 |
| 237 | Ga0209258_100107 | 3300025242 | Bacteria | 206572 |
| 238 | Ga0209258_100273 | 3300025242 | Bacteria | 87726 |
| 239 | Ga0207425_1000475 | 3300025245 | Bacteria | 25473 |
| 240 | Ga0209646_1000038 | 3300025246 | Bacteria | 353982 |
| 241 | Ga0209646_1000116 | 3300025246 | Bacteria | 150395 |
| 242 | Ga0209026_1000048 | 3300025250 | Bacteria | 257264 |
| 243 | Ga0209026_1000103 | 3300025250 | Bacteria | 152843 |
| 244 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 245 | Ga0209148_1000022 | 3300025254 | Bacteria | 681990 |
| 246 | Ga0209148_1001754 | 3300025254 | Bacteria | 9368 |
| 247 | Ga0209759_1000028 | 3300025256 | Bacteria | 298755 |
| 248 | Ga0209759_1000038 | 3300025256 | Bacteria | 257264 |
| 249 | Ga0209759_1000105 | 3300025256 | Bacteria | 150395 |
| 250 | Ga0209759_1000138 | 3300025256 | Bacteria | 125136 |
| 251 | Ga0209759_1000170 | 3300025256 | Bacteria | 110023 |
| 252 | Ga0209759_1005034 | 3300025256 | Bacteria | 4747 |
| 253 | Ga0209129_1000474 | 3300025258 | Bacteria | 29449 |
| 254 | Ga0209129_1000690 | 3300025258 | Bacteria | 22130 |
| 255 | Ga0209129_1001388 | 3300025258 | Bacteria | 13539 |
| 256 | Ga0209129_1002928 | 3300025258 | Bacteria | 7823 |
| 257 | Ga0209233_1000177 | 3300025261 | Bacteria | 141716 |
| 258 | Ga0209565_1000041 | 3300025263 | Bacteria | 251081 |
| 259 | Ga0209565_1000333 | 3300025263 | Bacteria | 42094 |
| 260 | Ga0209455_1000024 | 3300025272 | Bacteria | 676133 |
| 261 | Ga0209455_1000140 | 3300025272 | Bacteria | 138610 |
| 262 | Ga0209455_1000300 | 3300025272 | Bacteria | 51031 |
| 263 | Ga0209455_1000534 | 3300025272 | Bacteria | 26400 |
| 264 | Ga0209673_1000021 | 3300025273 | Bacteria | 422978 |
| 265 | Ga0209673_1000139 | 3300025273 | Bacteria | 157765 |
| 266 | Ga0209673_1000364 | 3300025273 | Bacteria | 81319 |
| 267 | Ga0209673_1004415 | 3300025273 | Bacteria | 7550 |
| 268 | Ga0209673_1004743 | 3300025273 | Bacteria | 7150 |
| 269 | Ga0209673_1005362 | 3300025273 | Bacteria | 6477 |
| 270 | Ga0209673_1005469 | 3300025273 | Bacteria | 6370 |
| 271 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 272 | Ga0209130_1000160 | 3300025284 | Bacteria | 100965 |
| 273 | Ga0209130_1000245 | 3300025284 | Bacteria | 68668 |
| 274 | Ga0209130_1000708 | 3300025284 | Bacteria | 29740 |
| 275 | Ga0209130_1008625 | 3300025284 | Bacteria | 2989 |
| 276 | Ga0209675_1003873 | 3300025291 | Bacteria | 6883 |
| 277 | Ga0209675_1004518 | 3300025291 | Bacteria | 6160 |
| 278 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 279 | Ga0209676_1002248 | 3300025292 | Bacteria | 14263 |
| 280 | Ga0209676_1005029 | 3300025292 | Bacteria | 7075 |
| 281 | Ga0209676_1017127 | 3300025292 | Bacteria | 2579 |
| 282 | Ga0209676_1019932 | 3300025292 | Bacteria | 2293 |
| 283 | Ga0209025_1000237 | 3300025294 | Bacteria | 128553 |
| 284 | Ga0209025_1000299 | 3300025294 | Bacteria | 110988 |
| 285 | Ga0209025_1002369 | 3300025294 | Bacteria | 20182 |
| 286 | Ga0209025_1004718 | 3300025294 | Bacteria | 11627 |
| 287 | Ga0209025_1004937 | 3300025294 | Bacteria | 11205 |
| 288 | Ga0209025_1009265 | 3300025294 | Bacteria | 6894 |
| 289 | Ga0209025_1012206 | 3300025294 | Bacteria | 5538 |
| 290 | Ga0209025_1015698 | 3300025294 | Bacteria | 4540 |
| 291 | Ga0209025_1022011 | 3300025294 | Bacteria | 3403 |
| 292 | Ga0209564_1000331 | 3300025295 | Bacteria | 91919 |
| 293 | Ga0209564_1000875 | 3300025295 | Bacteria | 40039 |
| 294 | Ga0209564_1002543 | 3300025295 | Bacteria | 14056 |
| 295 | Ga0209564_1002675 | 3300025295 | Bacteria | 13524 |
| 296 | Ga0209564_1003092 | 3300025295 | Bacteria | 11781 |
| 297 | Ga0209564_1003107 | 3300025295 | Bacteria | 11742 |
| 298 | Ga0209564_1008223 | 3300025295 | Bacteria | 5201 |
| 299 | Ga0209564_1015536 | 3300025295 | Bacteria | 3087 |
| 300 | Ga0209758_1000115 | 3300025297 | Bacteria | 199268 |
| 301 | Ga0209758_1000341 | 3300025297 | Bacteria | 86460 |
| 302 | Ga0209758_1000931 | 3300025297 | Bacteria | 39600 |
| 303 | Ga0209758_1001568 | 3300025297 | Bacteria | 26208 |
| 304 | Ga0209758_1005602 | 3300025297 | Bacteria | 9551 |
| 305 | Ga0209758_1012588 | 3300025297 | Bacteria | 4717 |
| 306 | Ga0209758_1018992 | 3300025297 | Bacteria | 3338 |
| 307 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 308 | Ga0209050_1004159 | 3300025298 | Bacteria | 10020 |
| 309 | Ga0209050_1020092 | 3300025298 | Bacteria | 2500 |
| 310 | Ga0209050_1026495 | 3300025298 | Bacteria | 1938 |
| 311 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 312 | Ga0209256_1000299 | 3300025299 | Bacteria | 86909 |
| 313 | Ga0209256_1003540 | 3300025299 | Bacteria | 10849 |
| 314 | Ga0209256_1005810 | 3300025299 | Bacteria | 6878 |
| 315 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 316 | Ga0207426_1000021 | 3300025302 | Bacteria | 556343 |
| 317 | Ga0207426_1000091 | 3300025302 | Bacteria | 280561 |
| 318 | Ga0207426_1000098 | 3300025302 | Bacteria | 264264 |
| 319 | Ga0207426_1000290 | 3300025302 | Bacteria | 99519 |
| 320 | Ga0207426_1001819 | 3300025302 | Bacteria | 15806 |
| 321 | Ga0207426_1003492 | 3300025302 | Bacteria | 8481 |
| 322 | Ga0207426_1004159 | 3300025302 | Bacteria | 7235 |
| 323 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 324 | Ga0209051_1000095 | 3300025303 | Bacteria | 167840 |
| 325 | Ga0209051_1000751 | 3300025303 | Bacteria | 34884 |
| 326 | Ga0209051_1000950 | 3300025303 | Bacteria | 28418 |
| 327 | Ga0209051_1001177 | 3300025303 | Bacteria | 23706 |
| 328 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 329 | Ga0209257_1003729 | 3300025304 | Bacteria | 12646 |
| 330 | Ga0209257_1003744 | 3300025304 | Bacteria | 12591 |
| 331 | Ga0209257_1005759 | 3300025304 | Bacteria | 8468 |
| 332 | Ga0209257_1006426 | 3300025304 | Bacteria | 7578 |
| 333 | Ga0207713_1002977 | 3300025735 | Bacteria | 11841 |
| 334 | Ga0207713_1003310 | 3300025735 | Bacteria | 11076 |
| 335 | Ga0207680_10016485 | 3300025903 | Bacteria | 3880 |
| 336 | Ga0207647_10000396 | 3300025904 | Bacteria | 35814 |
| 337 | Ga0207647_10004607 | 3300025904 | Bacteria | 10212 |
| 338 | Ga0207647_10005725 | 3300025904 | Bacteria | 9076 |
| 339 | Ga0207647_10008189 | 3300025904 | Bacteria | 7509 |
| 340 | Ga0207647_10021580 | 3300025904 | Bacteria | 4297 |
| 341 | Ga0207647_10072120 | 3300025904 | Bacteria | 2083 |
| 342 | Ga0207645_10009537 | 3300025907 | Bacteria | 6709 |
| 343 | Ga0207695_10000255 | 3300025913 | Bacteria | 136470 |
| 344 | Ga0207695_10006348 | 3300025913 | Bacteria | 15380 |
| 345 | Ga0207695_10070513 | 3300025913 | Bacteria | 3572 |
| 346 | Ga0207695_10085546 | 3300025913 | Bacteria | 3182 |
| 347 | Ga0207671_10031690 | 3300025914 | Bacteria | 3939 |
| 348 | Ga0207657_10000017 | 3300025919 | Bacteria | 173373 |
| 349 | Ga0207657_10003040 | 3300025919 | Bacteria | 17960 |
| 350 | Ga0207681_10025853 | 3300025923 | Bacteria | 3781 |
| 351 | Ga0207694_10091863 | 3300025924 | Bacteria | 2396 |
| 352 | Ga0207650_10016713 | 3300025925 | Bacteria | 5130 |
| 353 | Ga0207650_10074523 | 3300025925 | Bacteria | 2559 |
| 354 | Ga0207659_10071265 | 3300025926 | Bacteria | 2537 |
| 355 | Ga0207690_10000009 | 3300025932 | Bacteria | 366044 |
| 356 | Ga0207706_10021471 | 3300025933 | Bacteria | 5799 |
| 357 | Ga0207691_10000111 | 3300025940 | Bacteria | 72961 |
| 358 | Ga0207691_10035480 | 3300025940 | Bacteria | 4627 |
| 359 | Ga0207691_10113731 | 3300025940 | Bacteria | 2405 |
| 360 | Ga0207711_10057548 | 3300025941 | Bacteria | 3342 |
| 361 | Ga0207711_10146500 | 3300025941 | Bacteria | 2128 |
| 362 | Ga0207689_10000142 | 3300025942 | Bacteria | 61457 |
| 363 | Ga0207667_10000690 | 3300025949 | Bacteria | 43775 |
| 364 | Ga0207667_10022191 | 3300025949 | Bacteria | 7021 |
| 365 | Ga0207667_10027790 | 3300025949 | Bacteria | 6153 |
| 366 | Ga0207667_10069557 | 3300025949 | Bacteria | 3663 |
| 367 | Ga0207667_10096331 | 3300025949 | Bacteria | 3054 |
| 368 | Ga0207651_10008045 | 3300025960 | Bacteria | 5658 |
| 369 | Ga0207668_10007922 | 3300025972 | Bacteria | 6317 |
| 370 | Ga0207668_10021266 | 3300025972 | Bacteria | 4136 |
| 371 | Ga0207658_10018094 | 3300025986 | Bacteria | 4861 |
| 372 | Ga0207658_10032074 | 3300025986 | Bacteria | 3736 |
| 373 | Ga0207677_10163746 | 3300026023 | Bacteria | 1731 |
| 374 | Ga0207703_10000195 | 3300026035 | Bacteria | 70480 |
| 375 | Ga0207678_10001300 | 3300026067 | Bacteria | 23141 |
| 376 | Ga0207678_10067634 | 3300026067 | Bacteria | 3067 |
| 377 | Ga0207708_10026709 | 3300026075 | Bacteria | 4370 |
| 378 | Ga0207641_10006316 | 3300026088 | Bacteria | 10019 |
| 379 | Ga0207641_10040449 | 3300026088 | Bacteria | 3904 |
| 380 | Ga0207648_10005172 | 3300026089 | Bacteria | 13215 |
| 381 | Ga0207648_10016833 | 3300026089 | Bacteria | 6666 |
| 382 | Ga0207676_10001696 | 3300026095 | Bacteria | 16247 |
| 383 | Ga0207676_10002462 | 3300026095 | Bacteria | 13209 |
| 384 | Ga0207676_10044252 | 3300026095 | Bacteria | 3433 |
| 385 | Ga0207675_100004037 | 3300026118 | Bacteria | 14223 |
| 386 | Ga0207683_10021988 | 3300026121 | Bacteria | 5472 |
| 387 | Ga0209371_1000012 | 3300027312 | Bacteria | 748304 |
| 388 | Ga0209371_1000128 | 3300027312 | Bacteria | 124861 |
| 389 | Ga0209371_1001150 | 3300027312 | Bacteria | 19371 |
| 390 | Ga0209371_1004198 | 3300027312 | Bacteria | 6424 |
| 391 | Ga0209371_1014361 | 3300027312 | Bacteria | 2173 |
| 392 | Ga0209282_1000071 | 3300027666 | Bacteria | 81290 |
| 393 | Ga0268265_10002425 | 3300028380 | Bacteria | 14080 |
| 394 | Ga0268265_10099182 | 3300028380 | Bacteria | 2348 |
| 395 | Ga0268264_10000606 | 3300028381 | Bacteria | 43164 |
| 396 | Ga0268264_10081089 | 3300028381 | Bacteria | 2772 |
| 397 | Ga0307515_10003849 | 3300028794 | Bacteria | 31385 |
| 398 | Ga0307515_10004729 | 3300028794 | Bacteria | 27894 |
| 399 | Ga0307515_10098268 | 3300028794 | Bacteria | 3567 |
| 400 | Ga0268256_1000013 | 3300030500 | Bacteria | 752103 |
| 401 | Ga0268256_1000152 | 3300030500 | Bacteria | 92565 |
| 402 | Ga0268256_1015923 | 3300030500 | Bacteria | 2174 |
| 403 | Ga0265331_10006391 | 3300031250 | Bacteria | 6975 |
| 404 | Ga0307513_10000206 | 3300031456 | Bacteria | 85338 |
| 405 | Ga0307513_10002571 | 3300031456 | Bacteria | 25076 |
| 406 | Ga0307513_10014035 | 3300031456 | Bacteria | 9811 |
| 407 | Ga0307513_10048134 | 3300031456 | Bacteria | 4630 |
| 408 | Ga0307408_100009027 | 3300031548 | Bacteria | 6586 |
| 409 | Ga0265313_10000597 | 3300031595 | Bacteria | 37470 |
| 410 | Ga0265313_10000955 | 3300031595 | Bacteria | 28688 |
| 411 | Ga0307514_10004553 | 3300031649 | Bacteria | 12734 |
| 412 | Ga0307412_10000166 | 3300031911 | Bacteria | 46636 |
| 413 | Ga0316584_0022817 | 3300036712 | Bacteria | 4567 |
| 414 | Ga0395898_0000705 | 3300037466 | Bacteria | 59562 |
| 415 | Ga0395898_0047046 | 3300037466 | Bacteria | 4235 |
| 416 | Ga0395905_0000004 | 3300037471 | Bacteria | 674991 |
| 417 | Ga0395905_0041876 | 3300037471 | Bacteria | 4298 |
| 418 | Ga0451833_0074361 | 3300041491 | Bacteria | 2805 |
| 419 | Ga0451835_0854527 | 3300041492 | Bacteria | 3100 |
| 420 | Ga0451847_0010142 | 3300041503 | Bacteria | 3160 |
| 421 | Ga0451847_0297095 | 3300041503 | Bacteria | 3230 |
| 422 | Ga0439431_0008387 | 3300041997 | Bacteria | 2323 |
| 423 | Ga0451577_0066111 | 3300042876 | Bacteria | 3225 |
| 424 | Ga0451577_0146198 | 3300042876 | Bacteria | 2125 |
| 425 | Ga0466969_0004388 | 3300044656 | Bacteria | 7504 |
| 426 | Ga0466965_0005387 | 3300044683 | Bacteria | 5765 |
| 427 | Ga0466966_0007483 | 3300044684 | Bacteria | 7235 |
| 428 | Ga0466961_0000331 | 3300044693 | Bacteria | 31174 |
| 429 | Ga0466961_0002861 | 3300044693 | Bacteria | 10705 |
| 430 | Ga0466961_0028434 | 3300044693 | Bacteria | 3595 |
| 431 | Ga0466963_0008691 | 3300044694 | Bacteria | 6097 |
| 432 | Ga0466971_0004206 | 3300044719 | Bacteria | 6204 |
| 433 | Ga0466968_0015285 | 3300044735 | Bacteria | 3040 |
| 434 | Ga0466957_0000233 | 3300044842 | Bacteria | 26263 |
| 435 | Ga0466959_0003452 | 3300045049 | Bacteria | 10347 |
| 436 | Ga0466959_0033823 | 3300045049 | Bacteria | 3780 |
| 437 | Ga0451576_0004586 | 3300045051 | Bacteria | 17837 |
| 438 | Ga0466958_0040661 | 3300045836 | Bacteria | 2794 |
| 439 | Ga0495590_0001138 | 3300046457 | Bacteria | 11638 |
| 440 | Ga0495629_0000115 | 3300046459 | Bacteria | 72648 |
| 441 | Ga0495629_0000187 | 3300046459 | Bacteria | 56028 |
| 442 | Ga0495629_0011880 | 3300046459 | Bacteria | 6314 |
| 443 | Ga0495638_0000151 | 3300046460 | Bacteria | 109795 |
| 444 | Ga0495638_0000445 | 3300046460 | Bacteria | 49638 |
| 445 | Ga0495651_0037525 | 3300046462 | Bacteria | 3772 |
| 446 | Ga0495653_0000273 | 3300046463 | Bacteria | 41704 |
| 447 | Ga0495580_0000062 | 3300046472 | Bacteria | 63605 |
| 448 | Ga0495580_0005039 | 3300046472 | Bacteria | 11012 |
| 449 | Ga0495580_0005063 | 3300046472 | Bacteria | 10988 |
| 450 | Ga0495580_0034459 | 3300046472 | Bacteria | 3645 |
| 451 | Ga0495580_0043427 | 3300046472 | Bacteria | 3199 |
| 452 | Ga0495580_0076658 | 3300046472 | Bacteria | 2332 |
| 453 | Ga0495582_0019142 | 3300046473 | Bacteria | 3746 |
| 454 | Ga0495605_0000905 | 3300046474 | Bacteria | 20369 |
| 455 | Ga0495605_0014686 | 3300046474 | Bacteria | 4281 |
| 456 | Ga0495605_0015637 | 3300046474 | Bacteria | 4123 |
| 457 | Ga0495664_0018009 | 3300046477 | Bacteria | 4040 |
| 458 | Ga0495664_0058045 | 3300046477 | Bacteria | 2302 |
| 459 | Ga0495664_0133696 | 3300046477 | Bacteria | 1502 |
| 460 | Ga0495585_0015532 | 3300046492 | Bacteria | 4425 |
| 461 | Ga0495596_0007099 | 3300046500 | Bacteria | 5075 |
| 462 | Ga0495607_0012524 | 3300046501 | Bacteria | 5593 |
| 463 | Ga0495583_0002836 | 3300046506 | Bacteria | 14141 |
| 464 | Ga0495583_0015547 | 3300046506 | Bacteria | 4134 |
| 465 | Ga0495583_0018574 | 3300046506 | Bacteria | 3657 |
| 466 | Ga0495606_0008280 | 3300046507 | Bacteria | 9071 |
| 467 | Ga0495606_0022345 | 3300046507 | Bacteria | 4610 |
| 468 | Ga0495608_0004864 | 3300046511 | Bacteria | 9605 |
| 469 | Ga0495610_0000262 | 3300046512 | Bacteria | 55293 |
| 470 | Ga0495610_0000678 | 3300046512 | Bacteria | 32921 |
| 471 | Ga0495610_0009325 | 3300046512 | Bacteria | 6217 |
| 472 | Ga0495616_0027958 | 3300046513 | Bacteria | 2989 |
| 473 | Ga0495628_0002943 | 3300046516 | Bacteria | 15273 |
| 474 | Ga0495630_0032461 | 3300046517 | Bacteria | 3891 |
| 475 | Ga0495630_0047868 | 3300046517 | Bacteria | 3199 |
| 476 | Ga0495631_0000428 | 3300046518 | Bacteria | 29120 |
| 477 | Ga0495631_0003509 | 3300046518 | Bacteria | 8573 |
| 478 | Ga0495632_0003019 | 3300046519 | Bacteria | 12271 |
| 479 | Ga0495632_0015116 | 3300046519 | Bacteria | 4340 |
| 480 | Ga0495632_0063310 | 3300046519 | Bacteria | 1791 |
| 481 | Ga0495643_0026548 | 3300046522 | Bacteria | 3267 |
| 482 | Ga0495643_0084776 | 3300046522 | Bacteria | 1644 |
| 483 | Ga0495666_0000875 | 3300046526 | Bacteria | 14044 |
| 484 | Ga0495642_0006946 | 3300046528 | Bacteria | 4343 |
| 485 | Ga0495652_0071817 | 3300046529 | Bacteria | 2887 |
| 486 | Ga0495654_0003858 | 3300046530 | Bacteria | 9057 |
| 487 | Ga0495665_0019902 | 3300046531 | Bacteria | 3609 |
| 488 | Ga0495665_0028609 | 3300046531 | Bacteria | 2987 |
| 489 | Ga0495640_0009136 | 3300046533 | Bacteria | 7737 |
| 490 | Ga0495586_0033394 | 3300046535 | Bacteria | 2761 |
| 491 | Ga0495609_0027209 | 3300046538 | Bacteria | 2615 |
| 492 | Ga0495597_0013073 | 3300046542 | Bacteria | 3985 |
| 493 | Ga0495645_0007678 | 3300046543 | Bacteria | 7504 |
| 494 | Ga0495645_0013558 | 3300046543 | Bacteria | 5768 |
| 495 | Ga0495645_0192074 | 3300046543 | Bacteria | 1390 |
| 496 | Ga0495668_0078352 | 3300046616 | Bacteria | 1814 |
| 497 | Ga0495634_0036206 | 3300046642 | Bacteria | 3376 |
| 498 | Ga0495625_0000618 | 3300046660 | Bacteria | 51604 |
| 499 | Ga0495625_0005647 | 3300046660 | Bacteria | 11334 |
| 500 | Ga0495635_0084117 | 3300046663 | Bacteria | 2177 |
| 501 | Ga0495588_0027064 | 3300046674 | Bacteria | 2865 |
| 502 | Ga0495599_0025276 | 3300046678 | Bacteria | 3716 |
| 503 | Ga0495599_0033579 | 3300046678 | Bacteria | 3224 |
| 504 | Ga0495623_0002507 | 3300046679 | Bacteria | 12151 |
| 505 | Ga0495623_0039922 | 3300046679 | Bacteria | 2998 |
| 506 | Ga0495646_0000965 | 3300046680 | Bacteria | 16445 |
| 507 | Ga0495646_0023501 | 3300046680 | Bacteria | 3880 |
| 508 | Ga0495624_0000424 | 3300046690 | Bacteria | 33401 |
| 509 | Ga0495624_0000583 | 3300046690 | Bacteria | 28499 |
| 510 | Ga0495624_0019003 | 3300046690 | Bacteria | 4590 |
| 511 | Ga0495670_0011808 | 3300046691 | Bacteria | 4300 |
| 512 | Ga0495670_0030380 | 3300046691 | Bacteria | 2684 |
| 513 | Ga0495649_0001816 | 3300046694 | Bacteria | 15674 |
| 514 | Ga0495649_0006300 | 3300046694 | Bacteria | 7384 |
| 515 | Ga0495649_0039711 | 3300046694 | Bacteria | 2580 |
| 516 | Ga0495589_0004343 | 3300046794 | Bacteria | 7558 |
| 517 | Ga0495600_0003182 | 3300046809 | Bacteria | 9606 |
| 518 | Ga0495581_0003799 | 3300047315 | Bacteria | 8691 |
| 519 | Ga0495604_0000893 | 3300047317 | Bacteria | 24849 |
| 520 | Ga0495674_0026569 | 3300047319 | Bacteria | 5296 |
| 521 | Ga0495672_0013646 | 3300047320 | Bacteria | 5593 |
| 522 | Ga0495672_0044697 | 3300047320 | Bacteria | 2655 |
| 523 | Ga0495680_0007288 | 3300047322 | Bacteria | 10178 |
| 524 | Ga0495680_0028946 | 3300047322 | Bacteria | 4540 |
| 525 | Ga0495683_0001826 | 3300047323 | Bacteria | 13386 |
| 526 | Ga0495683_0016234 | 3300047323 | Bacteria | 3867 |
| 527 | Ga0495683_0057920 | 3300047323 | Bacteria | 1925 |
| 528 | Ga0495687_000022 | 3300047443 | Bacteria | 327353 |
| 529 | Ga0495687_005628 | 3300047443 | Bacteria | 7916 |
| 530 | Ga0495675_0005742 | 3300047444 | Bacteria | 7591 |
| 531 | Ga0495673_0017301 | 3300047469 | Bacteria | 3666 |
| 532 | Ga0495681_0002123 | 3300047470 | Bacteria | 14424 |
| 533 | Ga0495686_0000002 | 3300047472 | Bacteria | 1050777 |
| 534 | Ga0495686_0007803 | 3300047472 | Bacteria | 7963 |
| 535 | Ga0495686_0079555 | 3300047472 | Bacteria | 2004 |
| 536 | Ga0495602_0003066 | 3300048088 | Bacteria | 17159 |
| 537 | Ga0495614_0007828 | 3300048089 | Bacteria | 4752 |
| 538 | Ga0496100_0000102 | 3300048903 | Bacteria | 49167 |
| 539 | Ga0496101_0000823 | 3300048904 | Bacteria | 18271 |
| 540 | Ga0496101_0011169 | 3300048904 | Bacteria | 5950 |
| 541 | Ga0496101_0129461 | 3300048904 | Bacteria | 1915 |
| 542 | Ga0496102_0000808 | 3300048905 | Bacteria | 30475 |
| 543 | Ga0496102_0017869 | 3300048905 | Bacteria | 6219 |
| 544 | Ga0496102_0020537 | 3300048905 | Bacteria | 5836 |
| 545 | Ga0496102_0061201 | 3300048905 | Bacteria | 3445 |
| 546 | Ga0496103_0001958 | 3300048906 | Bacteria | 13318 |
| 547 | Ga0496104_0000378 | 3300048907 | Bacteria | 39345 |
| 548 | Ga0496104_0015197 | 3300048907 | Bacteria | 6969 |
| 549 | Ga0496105_0001811 | 3300048908 | Bacteria | 15296 |
| 550 | Ga0496106_0000016 | 3300048909 | Bacteria | 182368 |
| 551 | Ga0496106_0002647 | 3300048909 | Bacteria | 13321 |
| 552 | Ga0496106_0019975 | 3300048909 | Bacteria | 4968 |
| 553 | Ga0496106_0041245 | 3300048909 | Bacteria | 3458 |
| 554 | Ga0496107_0006509 | 3300048910 | Bacteria | 8033 |
| 555 | Ga0496110_0005772 | 3300048913 | Bacteria | 9726 |
| 556 | Ga0496111_0015118 | 3300048914 | Bacteria | 5289 |
| 557 | Ga0496112_0005092 | 3300048915 | Bacteria | 11293 |
| 558 | Ga0496112_0021844 | 3300048915 | Bacteria | 6090 |
| 559 | Ga0496113_0005982 | 3300048916 | Bacteria | 7656 |
| 560 | Ga0496115_0143225 | 3300048918 | Bacteria | 1972 |
| 561 | Ga0496116_0017856 | 3300048919 | Bacteria | 5492 |
| 562 | Ga0496117_0000083 | 3300048920 | Bacteria | 218945 |
| 563 | Ga0496117_0000852 | 3300048920 | Bacteria | 47272 |
| 564 | Ga0496117_0001721 | 3300048920 | Bacteria | 30302 |
| 565 | Ga0496117_0009987 | 3300048920 | Bacteria | 8726 |
| 566 | Ga0496117_0011016 | 3300048920 | Bacteria | 8142 |
| 567 | Ga0496117_0029143 | 3300048920 | Bacteria | 4261 |
| 568 | Ga0496118_0000549 | 3300048921 | Bacteria | 61765 |
| 569 | Ga0496118_0001660 | 3300048921 | Bacteria | 32686 |
| 570 | Ga0496118_0002046 | 3300048921 | Bacteria | 28504 |
| 571 | Ga0496118_0003154 | 3300048921 | Bacteria | 21083 |
| 572 | Ga0496118_0004942 | 3300048921 | Bacteria | 15455 |
| 573 | Ga0496118_0006775 | 3300048921 | Bacteria | 12457 |
| 574 | Ga0496118_0026013 | 3300048921 | Bacteria | 4998 |
| 575 | Ga0496118_0040453 | 3300048921 | Bacteria | 3707 |
| 576 | Ga0496118_0104922 | 3300048921 | Bacteria | 1896 |
| 577 | Ga0496119_0001603 | 3300048922 | Bacteria | 26894 |
| 578 | Ga0496119_0056397 | 3300048922 | Bacteria | 2381 |
| 579 | Ga0496119_0075822 | 3300048922 | Bacteria | 1953 |
| 580 | Ga0496119_0087464 | 3300048922 | Bacteria | 1778 |
| 581 | Ga0496120_0000030 | 3300048923 | Bacteria | 226066 |
| 582 | Ga0496120_0057513 | 3300048923 | Bacteria | 2188 |
| 583 | Ga0496121_0002102 | 3300048924 | Bacteria | 31349 |
| 584 | Ga0496121_0003960 | 3300048924 | Bacteria | 20448 |
| 585 | Ga0496121_0005745 | 3300048924 | Bacteria | 15753 |
| 586 | Ga0496121_0013320 | 3300048924 | Bacteria | 8852 |
| 587 | Ga0496121_0013461 | 3300048924 | Bacteria | 8783 |
| 588 | Ga0496121_0015580 | 3300048924 | Bacteria | 7943 |
| 589 | Ga0496121_0120140 | 3300048924 | Bacteria | 1986 |
| 590 | Ga0496121_0149130 | 3300048924 | Bacteria | 1724 |
| 591 | Ga0496122_0000050 | 3300048925 | Bacteria | 267874 |
| 592 | Ga0496122_0004444 | 3300048925 | Bacteria | 17402 |
| 593 | Ga0496122_0035439 | 3300048925 | Bacteria | 4059 |
| 594 | Ga0496122_0079672 | 3300048925 | Bacteria | 2287 |
| 595 | Ga0496123_0000052 | 3300048926 | Bacteria | 236409 |
| 596 | Ga0496123_0038042 | 3300048926 | Bacteria | 3388 |
| 597 | Ga0496124_0011004 | 3300048927 | Bacteria | 9087 |
| 598 | Ga0496124_0014715 | 3300048927 | Bacteria | 7551 |
| 599 | Ga0496124_0093714 | 3300048927 | Bacteria | 2444 |
| 600 | Ga0496125_0005452 | 3300048928 | Bacteria | 14135 |
| 601 | Ga0496125_0071734 | 3300048928 | Bacteria | 2703 |
| 602 | Ga0496125_0124641 | 3300048928 | Bacteria | 1829 |
| 603 | Ga0496126_0000254 | 3300048929 | Bacteria | 114937 |
| 604 | Ga0496126_0000475 | 3300048929 | Bacteria | 79715 |
| 605 | Ga0496126_0000550 | 3300048929 | Bacteria | 72171 |
| 606 | Ga0496126_0000965 | 3300048929 | Bacteria | 49314 |
| 607 | Ga0496126_0067500 | 3300048929 | Bacteria | 3195 |
| 608 | Ga0496126_0126507 | 3300048929 | Bacteria | 2212 |
| 609 | Ga0495682_0005320 | 3300049460 | Bacteria | 5368 |
| 610 | Ga0495682_0006377 | 3300049460 | Bacteria | 4777 |
| 611 | Ga0501032_0068686 | 3300049569 | Bacteria | 2365 |
| 612 | Ga0501033_0041602 | 3300049570 | Bacteria | 3428 |
| 613 | Ga0501033_0125546 | 3300049570 | Bacteria | 1861 |
| 614 | Ga0501047_0037197 | 3300049581 | Bacteria | 4707 |
| 615 | Ga0501238_001331 | 3300049671 | Bacteria | 2844 |
| 616 | Ga0501083_0009266 | 3300049744 | Bacteria | 6949 |
| 617 | Ga0501035_0006648 | 3300049822 | Bacteria | 10817 |
| 618 | Ga0501035_0031397 | 3300049822 | Bacteria | 4838 |
| 619 | Ga0501044_0000185 | 3300049823 | Bacteria | 77663 |
| 620 | Ga0501044_0152734 | 3300049823 | Bacteria | 2291 |
| 621 | Ga0501044_0165986 | 3300049823 | Bacteria | 2182 |
| 622 | Ga0501044_0193024 | 3300049823 | Bacteria | 1998 |
| 623 | nmdc:mga03683_12371_c2 | 3300050489 | Bacteria | 2587 |
| 624 | nmdc:mga03683_51646_c1 | 3300050489 | Bacteria | 1717 |
| 625 | nmdc:mga03683_8314_c1 | 3300050489 | Bacteria | 2645 |
| 626 | nmdc:mga00v17_10788_c1 | 3300050491 | Bacteria | 5004 |
| 627 | nmdc:mga00v17_31_c1 | 3300050491 | Bacteria | 87312 |
| 628 | nmdc:mga00v17_34_c1 | 3300050491 | Bacteria | 85919 |
| 629 | nmdc:mga00v17_42_c1 | 3300050491 | Bacteria | 79984 |
| 630 | nmdc:mga0yw44_1286_c1 | 3300050492 | Bacteria | 9902 |
| 631 | nmdc:mga0k408_14382_c1 | 3300050493 | Bacteria | 4359 |
| 632 | nmdc:mga06z11_10121_c1 | 3300050494 | Bacteria | 4003 |
| 633 | nmdc:mga06z11_28525_c1 | 3300050494 | Bacteria | 2679 |
| 634 | nmdc:mga06z11_65449_c1 | 3300050494 | Bacteria | 1908 |
| 635 | nmdc:mga04h51_31900_c1 | 3300050495 | Bacteria | 1668 |
| 636 | nmdc:mga07m45_3768_c1 | 3300050496 | Bacteria | 7334 |
| 637 | nmdc:mga07m45_83741_c1 | 3300050496 | Bacteria | 1823 |
| 638 | nmdc:mga0sz30_244_c1 | 3300050516 | Bacteria | 20932 |
| 639 | Ga0500578_0053615 | 3300053086 | Bacteria | 2581 |
| 640 | Ga0500644_0000824 | 3300053088 | Bacteria | 10459 |
| 641 | Ga0500557_000836 | 3300053105 | Bacteria | 4490 |
| 642 | Ga0500593_000456 | 3300053117 | Bacteria | 16197 |
| 643 | Ga0500594_0001736 | 3300053118 | Bacteria | 4744 |
| 644 | Ga0500594_0004570 | 3300053118 | Bacteria | 3051 |
| 645 | Ga0500618_000349 | 3300053125 | Bacteria | 32348 |
| 646 | Ga0500618_000356 | 3300053125 | Bacteria | 31771 |
| 647 | Ga0500618_001394 | 3300053125 | Bacteria | 10891 |
| 648 | Ga0500658_0000086 | 3300053134 | Bacteria | 43329 |
| 649 | Ga0500561_0000089 | 3300053137 | Bacteria | 17790 |
| 650 | Ga0500568_0000295 | 3300053139 | Bacteria | 40681 |
| 651 | Ga0500568_0000659 | 3300053139 | Bacteria | 24925 |
| 652 | Ga0500568_0001721 | 3300053139 | Bacteria | 13596 |
| 653 | Ga0500568_0023651 | 3300053139 | Bacteria | 2612 |
| 654 | Ga0500573_0051522 | 3300053140 | Bacteria | 2367 |
| 655 | Ga0500616_0000203 | 3300053153 | Bacteria | 97028 |
| 656 | Ga0500616_0000341 | 3300053153 | Bacteria | 66760 |
| 657 | Ga0500616_0000522 | 3300053153 | Bacteria | 48622 |
| 658 | Ga0500622_0000836 | 3300053156 | Bacteria | 26294 |
| 659 | Ga0500622_0055565 | 3300053156 | Bacteria | 2028 |
| 660 | Ga0500633_0000086 | 3300053160 | Bacteria | 13425 |
| 661 | Ga0500634_0002483 | 3300053161 | Bacteria | 7800 |
| 662 | Ga0500634_0005497 | 3300053161 | Bacteria | 6024 |
| 663 | Ga0500634_0008269 | 3300053161 | Bacteria | 5194 |
| 664 | Ga0500645_000042 | 3300053730 | Bacteria | 110470 |
| 665 | Ga0500645_002276 | 3300053730 | Bacteria | 8718 |
| 666 | Ga0500661_000314 | 3300055283 | Bacteria | 8843 |
| 667 | Ga0466962_0012455 | 3300061719 | Bacteria | 4087 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2510917026 | 2511173266 | 418 |
| 2 | 3300050489 | nmdc:mga03683_51646_c1 | nmdc:mga03683_51646_c1_345_1685 | 434 |
| 3 | 3300046477 | Ga0495664_0133696 | Ga0495664_0133696_11_1348 | 445 |
| 4 | 3300046543 | Ga0495645_0192074 | Ga0495645_0192074_17_1354 | 445 |
| 5 | 3300048924 | Ga0496121_0120140 | Ga0496121_0120140_24_1361 | 445 |
| 6 | iso_pu_bacteria | 2513237083 | 2513563994 | 449 |
| 7 | iso_pu_bacteria | 8003955200 | 8003960071 | 449 |
| 8 | 3300050495 | nmdc:mga04h51_31900_c1 | nmdc:mga04h51_31900_c1_188_1651 | 484 |
| 9 | 3300002705 | JGI25156J39149_1000666 | JGI25156J39149_100066615 | 485 |
| 10 | 3300025256 | Ga0209759_1000028 | Ga0209759_100002847 | 485 |
| 11 | 3300003187 | JGI25151J46595_10000143 | JGI25151J46595_1000014322 | 492 |
| 12 | 3300025294 | Ga0209025_1000299 | Ga0209025_100029985 | 492 |
| 13 | 3300025297 | Ga0209758_1005602 | Ga0209758_10056026 | 492 |
| 14 | 3300047469 | Ga0495673_0017301 | Ga0495673_0017301_1203_2810 | 495 |
| 15 | 3300049671 | Ga0501238_001331 | Ga0501238_001331_37_1530 | 497 |
| 16 | 3300048924 | Ga0496121_0149130 | Ga0496121_0149130_32_1549 | 499 |
| 17 | 3300046459 | Ga0495629_0000115 | Ga0495629_0000115_53266_54873 | 502 |
| 18 | 3300046463 | Ga0495653_0000273 | Ga0495653_0000273_22322_23929 | 502 |
| 19 | 3300046472 | Ga0495580_0005063 | Ga0495580_0005063_8665_10272 | 502 |
| 20 | 3300046472 | Ga0495580_0034459 | Ga0495580_0034459_717_2324 | 502 |
| 21 | 3300046477 | Ga0495664_0018009 | Ga0495664_0018009_1124_2731 | 502 |
| 22 | 3300046506 | Ga0495583_0002836 | Ga0495583_0002836_9218_10825 | 502 |
| 23 | 3300046516 | Ga0495628_0002943 | Ga0495628_0002943_12978_14585 | 502 |
| 24 | 3300046517 | Ga0495630_0032461 | Ga0495630_0032461_2175_3782 | 502 |
| 25 | 3300046530 | Ga0495654_0003858 | Ga0495654_0003858_5892_7505 | 502 |
| 26 | 3300046531 | Ga0495665_0019902 | Ga0495665_0019902_185_1792 | 502 |
| 27 | 3300046680 | Ga0495646_0000965 | Ga0495646_0000965_14709_16316 | 502 |
| 28 | 3300046690 | Ga0495624_0000583 | Ga0495624_0000583_717_2324 | 502 |
| 29 | 3300046690 | Ga0495624_0019003 | Ga0495624_0019003_717_2324 | 502 |
| 30 | 3300046694 | Ga0495649_0006300 | Ga0495649_0006300_1138_2745 | 502 |
| 31 | 3300047320 | Ga0495672_0044697 | Ga0495672_0044697_82_1689 | 502 |
| 32 | 3300048089 | Ga0495614_0007828 | Ga0495614_0007828_1896_3503 | 502 |
| 33 | 3300049460 | Ga0495682_0005320 | Ga0495682_0005320_2327_3934 | 502 |
| 34 | 3300003354 | JGI25160J50197_1002009 | JGI25160J50197_10020094 | 503 |
| 35 | 3300025284 | Ga0209130_1000160 | Ga0209130_100016066 | 503 |
| 36 | 3300025302 | Ga0207426_1000098 | Ga0207426_100009870 | 503 |
| 37 | 3300031250 | Ga0265331_10006391 | Ga0265331_100063913 | 503 |
| 38 | 3300031595 | Ga0265313_10000597 | Ga0265313_1000059723 | 503 |
| 39 | 3300041997 | Ga0439431_0008387 | Ga0439431_0008387_327_1919 | 503 |
| 40 | 3300003320 | rootH2_10017840 | rootH2_100178402 | 504 |
| 41 | 3300046519 | Ga0495632_0063310 | Ga0495632_0063310_33_1580 | 507 |
| 42 | 3300046678 | Ga0495599_0025276 | Ga0495599_0025276_1961_3568 | 507 |
| 43 | 3300046679 | Ga0495623_0002507 | Ga0495623_0002507_8665_10272 | 507 |
| 44 | 3300047317 | Ga0495604_0000893 | Ga0495604_0000893_21318_22925 | 507 |
| 45 | 3300047320 | Ga0495672_0013646 | Ga0495672_0013646_43_1590 | 507 |
| 46 | 3300047444 | Ga0495675_0005742 | Ga0495675_0005742_1130_2737 | 507 |
| 47 | 3300048088 | Ga0495602_0003066 | Ga0495602_0003066_253_1860 | 507 |
| 48 | 3300036712 | Ga0316584_0022817 | Ga0316584_0022817_889_2484 | 510 |
| 49 | 3300045051 | Ga0451576_0004586 | Ga0451576_0004586_4292_5890 | 511 |
| 50 | 3300046528 | Ga0495642_0006946 | Ga0495642_0006946_11_1549 | 512 |
| 51 | 3300037471 | Ga0395905_0000004 | Ga0395905_0000004_361185_362792 | 513 |
| 52 | 3300003320 | rootH2_10048674 | rootH2_100486743 | 514 |
| 53 | 3300003322 | rootL2_10017323 | rootL2_100173236 | 514 |
| 54 | 3300003354 | JGI25160J50197_1001141 | JGI25160J50197_10011415 | 514 |
| 55 | 3300005262 | Ga0065165_1000617 | Ga0065165_100061710 | 514 |
| 56 | 3300025284 | Ga0209130_1008625 | Ga0209130_10086251 | 514 |
| 57 | 3300025302 | Ga0207426_1000021 | Ga0207426_1000021414 | 514 |
| 58 | 3300025913 | Ga0207695_10070513 | Ga0207695_100705133 | 514 |
| 59 | 3300046472 | Ga0495580_0043427 | Ga0495580_0043427_1060_2667 | 514 |
| 60 | 3300046474 | Ga0495605_0015637 | Ga0495605_0015637_1674_3281 | 514 |
| 61 | 3300046506 | Ga0495583_0015547 | Ga0495583_0015547_1616_3223 | 514 |
| 62 | 3300046513 | Ga0495616_0027958 | Ga0495616_0027958_1323_2930 | 514 |
| 63 | 3300048903 | Ga0496100_0000102 | Ga0496100_0000102_9858_11465 | 514 |
| 64 | 3300048904 | Ga0496101_0000823 | Ga0496101_0000823_8000_9607 | 514 |
| 65 | 3300048904 | Ga0496101_0129461 | Ga0496101_0129461_252_1859 | 514 |
| 66 | 3300048905 | Ga0496102_0000808 | Ga0496102_0000808_9461_11068 | 514 |
| 67 | 3300048907 | Ga0496104_0015197 | Ga0496104_0015197_1378_2985 | 514 |
| 68 | 3300048915 | Ga0496112_0021844 | Ga0496112_0021844_2781_4388 | 514 |
| 69 | 3300048920 | Ga0496117_0001721 | Ga0496117_0001721_20533_22140 | 514 |
| 70 | 3300048921 | Ga0496118_0000549 | Ga0496118_0000549_4392_5999 | 514 |
| 71 | 3300048924 | Ga0496121_0002102 | Ga0496121_0002102_8641_10248 | 514 |
| 72 | 3300048924 | Ga0496121_0015580 | Ga0496121_0015580_4059_5666 | 514 |
| 73 | 3300048926 | Ga0496123_0038042 | Ga0496123_0038042_606_2213 | 514 |
| 74 | 3300048928 | Ga0496125_0124641 | Ga0496125_0124641_48_1655 | 514 |
| 75 | 3300049460 | Ga0495682_0006377 | Ga0495682_0006377_243_1850 | 514 |
| 76 | 3300002705 | JGI25156J39149_1000897 | JGI25156J39149_10008979 | 516 |
| 77 | 3300003322 | rootL2_10034586 | rootL2_100345864 | 516 |
| 78 | 3300025206 | Ga0209435_100019 | Ga0209435_100019122 | 516 |
| 79 | 3300025250 | Ga0209026_1000048 | Ga0209026_1000048122 | 516 |
| 80 | 3300025256 | Ga0209759_1000038 | Ga0209759_1000038122 | 516 |
| 81 | 3300025295 | Ga0209564_1008223 | Ga0209564_10082233 | 516 |
| 82 | 3300031548 | Ga0307408_100009027 | Ga0307408_1000090272 | 516 |
| 83 | 3300049570 | Ga0501033_0041602 | Ga0501033_0041602_1589_3208 | 516 |
| 84 | 3300049823 | Ga0501044_0165986 | Ga0501044_0165986_418_2037 | 516 |
| 85 | 3300050496 | nmdc:mga07m45_3768_c1 | nmdc:mga07m45_3768_c1_2698_4272 | 516 |
| 86 | 3300053117 | Ga0500593_000456 | Ga0500593_000456_8020_9573 | 516 |
| 87 | 3300025940 | Ga0207691_10113731 | Ga0207691_101137311 | 517 |
| 88 | 3300048905 | Ga0496102_0061201 | Ga0496102_0061201_465_2072 | 517 |
| 89 | 3300048920 | Ga0496117_0000852 | Ga0496117_0000852_9154_10761 | 517 |
| 90 | 3300048921 | Ga0496118_0004942 | Ga0496118_0004942_12860_14467 | 517 |
| 91 | iso_pu_bacteria | 2516143018 | 2516207915 | 518 |
| 92 | iso_pu_bacteria | 2690316117 | 2692318905 | 518 |
| 93 | iso_pu_bacteria | 2738543031 | 2739347188 | 518 |
| 94 | iso_pu_bacteria | 2791355091 | 2792619785 | 518 |
| 95 | iso_pu_bacteria | 2791355092 | 2792627559 | 518 |
| 96 | iso_pu_bacteria | 2847417321 | 2847422589 | 518 |
| 97 | iso_pu_bacteria | 2848992105 | 2848998007 | 518 |
| 98 | iso_pu_bacteria | 2855872281 | 2855873939 | 518 |
| 99 | iso_pu_bacteria | 3002141150 | 3002145373 | 518 |
| 100 | iso_pu_bacteria | 643692032 | 643823432 | 518 |
| 101 | 3300003323 | rootH1_10345004 | rootH1_103450042 | 519 |
| 102 | 3300005937 | Ga0081455_10107414 | Ga0081455_101074141 | 519 |
| 103 | 3300013105 | Ga0157369_10012773 | Ga0157369_100127732 | 519 |
| 104 | 3300046462 | Ga0495651_0037525 | Ga0495651_0037525_180_1787 | 519 |
| 105 | 3300046472 | Ga0495580_0000062 | Ga0495580_0000062_33442_35049 | 519 |
| 106 | 3300046517 | Ga0495630_0047868 | Ga0495630_0047868_240_1847 | 519 |
| 107 | 3300046674 | Ga0495588_0027064 | Ga0495588_0027064_363_1937 | 519 |
| 108 | 3300046678 | Ga0495599_0033579 | Ga0495599_0033579_1044_2651 | 519 |
| 109 | 3300046680 | Ga0495646_0023501 | Ga0495646_0023501_1264_2871 | 519 |
| 110 | 3300046690 | Ga0495624_0000424 | Ga0495624_0000424_24778_26385 | 519 |
| 111 | 3300047322 | Ga0495680_0028946 | Ga0495680_0028946_1441_3048 | 519 |
| 112 | 3300047470 | Ga0495681_0002123 | Ga0495681_0002123_6473_8047 | 519 |
| 113 | 3300048922 | Ga0496119_0087464 | Ga0496119_0087464_12_1586 | 519 |
| 114 | 3300048929 | Ga0496126_0000475 | Ga0496126_0000475_65926_67533 | 519 |
| 115 | 3300053153 | Ga0500616_0000341 | Ga0500616_0000341_42059_43642 | 519 |
| 116 | iso_pu_bacteria | 2509276021 | 2509386977 | 519 |
| 117 | iso_pu_bacteria | 2509276033 | 2509442505 | 519 |
| 118 | iso_pu_bacteria | 2510065019 | 2510132974 | 519 |
| 119 | iso_pu_bacteria | 2510461076 | 2510894353 | 519 |
| 120 | iso_pu_bacteria | 2510461076 | 2510899378 | 519 |
| 121 | iso_pu_bacteria | 2510917022 | 2511136964 | 519 |
| 122 | iso_pu_bacteria | 2510917028 | 2511184311 | 519 |
| 123 | iso_pu_bacteria | 2510917030 | 2511195763 | 519 |
| 124 | iso_pu_bacteria | 2513237084 | 2513569930 | 519 |
| 125 | iso_pu_bacteria | 2513237085 | 2513575203 | 519 |
| 126 | iso_pu_bacteria | 2513237093 | 2513633118 | 519 |
| 127 | iso_pu_bacteria | 2513237103 | 2513710144 | 519 |
| 128 | iso_pu_bacteria | 2513237138 | 2513866161 | 519 |
| 129 | iso_pu_bacteria | 2513237144 | 2513910779 | 519 |
| 130 | iso_pu_bacteria | 2513237146 | 2513927252 | 519 |
| 131 | iso_pu_bacteria | 2513237162 | 2514021797 | 519 |
| 132 | iso_pu_bacteria | 2515075009 | 2515111925 | 519 |
| 133 | iso_pu_bacteria | 2515154113 | 2515633729 | 519 |
| 134 | iso_pu_bacteria | 2515154114 | 2515645097 | 519 |
| 135 | iso_pu_bacteria | 2515154116 | 2515660241 | 519 |
| 136 | iso_pu_bacteria | 2515154134 | 2515738899 | 519 |
| 137 | iso_pu_bacteria | 2516653077 | 2517035666 | 519 |
| 138 | iso_pu_bacteria | 2516653085 | 2517076093 | 519 |
| 139 | iso_pu_bacteria | 2517093000 | 2517094847 | 519 |
| 140 | iso_pu_bacteria | 2517287029 | 2517406471 | 519 |
| 141 | iso_pu_bacteria | 2519899620 | 2520379447 | 519 |
| 142 | iso_pu_bacteria | 2529292951 | 2530645229 | 519 |
| 143 | iso_pu_bacteria | 2537561587 | 2537875039 | 519 |
| 144 | iso_pu_bacteria | 2554235003 | 2554244408 | 519 |
| 145 | iso_pu_bacteria | 2558860242 | 2559297785 | 519 |
| 146 | iso_pu_bacteria | 2582581294 | 2585200911 | 519 |
| 147 | iso_pu_bacteria | 2582581298 | 2585221787 | 519 |
| 148 | iso_pu_bacteria | 2582581307 | 2585272235 | 519 |
| 149 | iso_pu_bacteria | 2582581867 | 2585405233 | 519 |
| 150 | iso_pu_bacteria | 2585427526 | 2585528247 | 519 |
| 151 | iso_pu_bacteria | 2585427528 | 2585540445 | 519 |
| 152 | iso_pu_bacteria | 2585427529 | 2585544043 | 519 |
| 153 | iso_pu_bacteria | 2585427531 | 2585561701 | 519 |
| 154 | iso_pu_bacteria | 2585427590 | 2585823439 | 519 |
| 155 | iso_pu_bacteria | 2585427593 | 2585838656 | 519 |
| 156 | iso_pu_bacteria | 2585427608 | 2585899545 | 519 |
| 157 | iso_pu_bacteria | 2585427609 | 2585906929 | 519 |
| 158 | iso_pu_bacteria | 2585427633 | 2585993839 | 519 |
| 159 | iso_pu_bacteria | 2585427634 | 2586004764 | 519 |
| 160 | iso_pu_bacteria | 2585428125 | 2587982350 | 519 |
| 161 | iso_pu_bacteria | 2599185170 | 2599415307 | 519 |
| 162 | iso_pu_bacteria | 2599185210 | 2599603820 | 519 |
| 163 | iso_pu_bacteria | 2600255279 | 2601612643 | 519 |
| 164 | iso_pu_bacteria | 2600255308 | 2601749765 | 519 |
| 165 | iso_pu_bacteria | 2615840624 | 2616292740 | 519 |
| 166 | iso_pu_bacteria | 2615840698 | 2616555682 | 519 |
| 167 | iso_pu_bacteria | 2643221582 | 2643917796 | 519 |
| 168 | iso_pu_bacteria | 2643221634 | 2644194466 | 519 |
| 169 | iso_pu_bacteria | 2643221693 | 2644522583 | 519 |
| 170 | iso_pu_bacteria | 2718217882 | 2719180900 | 519 |
| 171 | iso_pu_bacteria | 2718217927 | 2719385504 | 519 |
| 172 | iso_pu_bacteria | 2718217997 | 2719665323 | 519 |
| 173 | iso_pu_bacteria | 2718218009 | 2719731649 | 519 |
| 174 | iso_pu_bacteria | 2718218199 | 2720491743 | 519 |
| 175 | iso_pu_bacteria | 2718218232 | 2720613012 | 519 |
| 176 | iso_pu_bacteria | 2718218233 | 2720619862 | 519 |
| 177 | iso_pu_bacteria | 2718218235 | 2720631290 | 519 |
| 178 | iso_pu_bacteria | 2718218269 | 2720775017 | 519 |
| 179 | iso_pu_bacteria | 2718218363 | 2721146994 | 519 |
| 180 | iso_pu_bacteria | 2718218365 | 2721158524 | 519 |
| 181 | iso_pu_bacteria | 2718218366 | 2721163912 | 519 |
| 182 | iso_pu_bacteria | 2718218423 | 2721399252 | 519 |
| 183 | iso_pu_bacteria | 2721755514 | 2722840082 | 519 |
| 184 | iso_pu_bacteria | 2721755556 | 2723026656 | 519 |
| 185 | iso_pu_bacteria | 2721755684 | 2723560270 | 519 |
| 186 | iso_pu_bacteria | 2721755685 | 2723566837 | 519 |
| 187 | iso_pu_bacteria | 2721755809 | 2724038065 | 519 |
| 188 | iso_pu_bacteria | 2721755810 | 2724044405 | 519 |
| 189 | iso_pu_bacteria | 2721755819 | 2724089624 | 519 |
| 190 | iso_pu_bacteria | 2721755822 | 2724104102 | 519 |
| 191 | iso_pu_bacteria | 2721755823 | 2724109911 | 519 |
| 192 | iso_pu_bacteria | 2724679232 | 2725949856 | 519 |
| 193 | iso_pu_bacteria | 2728369352 | 2730107592 | 519 |
| 194 | iso_pu_bacteria | 2728369365 | 2730164137 | 519 |
| 195 | iso_pu_bacteria | 2728369397 | 2730298156 | 519 |
| 196 | iso_pu_bacteria | 2738541333 | 2739037937 | 519 |
| 197 | iso_pu_bacteria | 2751185821 | 2753461462 | 519 |
| 198 | iso_pu_bacteria | 2765235942 | 2766062354 | 519 |
| 199 | iso_pu_bacteria | 2791355094 | 2792641862 | 519 |
| 200 | iso_pu_bacteria | 2791355256 | 2793298323 | 519 |
| 201 | iso_pu_bacteria | 2791355259 | 2793313800 | 519 |
| 202 | iso_pu_bacteria | 2791355260 | 2793324386 | 519 |
| 203 | iso_pu_bacteria | 2791355261 | 2793326411 | 519 |
| 204 | iso_pu_bacteria | 2791355262 | 2793337809 | 519 |
| 205 | iso_pu_bacteria | 2791355263 | 2793341245 | 519 |
| 206 | iso_pu_bacteria | 2791355264 | 2793347582 | 519 |
| 207 | iso_pu_bacteria | 2791355265 | 2793352347 | 519 |
| 208 | iso_pu_bacteria | 2791355266 | 2793361476 | 519 |
| 209 | iso_pu_bacteria | 2791355267 | 2793366499 | 519 |
| 210 | iso_pu_bacteria | 2802429605 | 2805927683 | 519 |
| 211 | iso_pu_bacteria | 2802429606 | 2805935591 | 519 |
| 212 | iso_pu_bacteria | 2802429633 | 2806045454 | 519 |
| 213 | iso_pu_bacteria | 2802429634 | 2806051743 | 519 |
| 214 | iso_pu_bacteria | 2802429635 | 2806061787 | 519 |
| 215 | iso_pu_bacteria | 2802429636 | 2806067968 | 519 |
| 216 | iso_pu_bacteria | 2802429637 | 2806072683 | 519 |
| 217 | iso_pu_bacteria | 2808606387 | 2808989265 | 519 |
| 218 | iso_pu_bacteria | 2818991439 | 2819561870 | 519 |
| 219 | iso_pu_bacteria | 2821443989 | 2821449727 | 519 |
| 220 | iso_pu_bacteria | 2838016132 | 2838018858 | 519 |
| 221 | iso_pu_bacteria | 2838022645 | 2838025439 | 519 |
| 222 | iso_pu_bacteria | 2838035591 | 2838038968 | 519 |
| 223 | iso_pu_bacteria | 2838042994 | 2838043146 | 519 |
| 224 | iso_pu_bacteria | 2838048938 | 2838052076 | 519 |
| 225 | iso_pu_bacteria | 2838061910 | 2838067307 | 519 |
| 226 | iso_pu_bacteria | 2838068647 | 2838071422 | 519 |
| 227 | iso_pu_bacteria | 2838661181 | 2838664440 | 519 |
| 228 | iso_pu_bacteria | 2838668709 | 2838670129 | 519 |
| 229 | iso_pu_bacteria | 2838675328 | 2838679151 | 519 |
| 230 | iso_pu_bacteria | 2838680041 | 2838682531 | 519 |
| 231 | iso_pu_bacteria | 2838686498 | 2838689164 | 519 |
| 232 | iso_pu_bacteria | 2838694306 | 2838697102 | 519 |
| 233 | iso_pu_bacteria | 2838701080 | 2838702500 | 519 |
| 234 | iso_pu_bacteria | 2838707686 | 2838709657 | 519 |
| 235 | iso_pu_bacteria | 2838714209 | 2838718996 | 519 |
| 236 | iso_pu_bacteria | 2838719591 | 2838723995 | 519 |
| 237 | iso_pu_bacteria | 2838724970 | 2838728829 | 519 |
| 238 | iso_pu_bacteria | 2838729681 | 2838730512 | 519 |
| 239 | iso_pu_bacteria | 2838742623 | 2838743453 | 519 |
| 240 | iso_pu_bacteria | 2841846520 | 2841850120 | 519 |
| 241 | iso_pu_bacteria | 2841851746 | 2841854871 | 519 |
| 242 | iso_pu_bacteria | 2841859092 | 2841861106 | 519 |
| 243 | iso_pu_bacteria | 2841864319 | 2841864854 | 519 |
| 244 | iso_pu_bacteria | 2842077413 | 2842077831 | 519 |
| 245 | iso_pu_bacteria | 2842110456 | 2842110841 | 519 |
| 246 | iso_pu_bacteria | 2842118031 | 2842119661 | 519 |
| 247 | iso_pu_bacteria | 2842124991 | 2842128592 | 519 |
| 248 | iso_pu_bacteria | 2842130223 | 2842134053 | 519 |
| 249 | iso_pu_bacteria | 2842146304 | 2842146955 | 519 |
| 250 | iso_pu_bacteria | 2842152218 | 2842156049 | 519 |
| 251 | iso_pu_bacteria | 2842156927 | 2842157734 | 519 |
| 252 | iso_pu_bacteria | 2842163707 | 2842164945 | 519 |
| 253 | iso_pu_bacteria | 2842170452 | 2842175242 | 519 |
| 254 | iso_pu_bacteria | 2842175837 | 2842179858 | 519 |
| 255 | iso_pu_bacteria | 2842180545 | 2842180681 | 519 |
| 256 | iso_pu_bacteria | 2842187318 | 2842191871 | 519 |
| 257 | iso_pu_bacteria | 2842192696 | 2842196937 | 519 |
| 258 | iso_pu_bacteria | 2842198810 | 2842201007 | 519 |
| 259 | iso_pu_bacteria | 2842205361 | 2842206335 | 519 |
| 260 | iso_pu_bacteria | 2842211629 | 2842216188 | 519 |
| 261 | iso_pu_bacteria | 2842217011 | 2842223055 | 519 |
| 262 | iso_pu_bacteria | 2842224351 | 2842228760 | 519 |
| 263 | iso_pu_bacteria | 2842229732 | 2842231267 | 519 |
| 264 | iso_pu_bacteria | 2842237096 | 2842239070 | 519 |
| 265 | iso_pu_bacteria | 2842243621 | 2842244632 | 519 |
| 266 | iso_pu_bacteria | 2842250916 | 2842252020 | 519 |
| 267 | iso_pu_bacteria | 2842257432 | 2842258445 | 519 |
| 268 | iso_pu_bacteria | 2842264693 | 2842267466 | 519 |
| 269 | iso_pu_bacteria | 2842271015 | 2842273184 | 519 |
| 270 | iso_pu_bacteria | 2842278818 | 2842279792 | 519 |
| 271 | iso_pu_bacteria | 2842285085 | 2842287439 | 519 |
| 272 | iso_pu_bacteria | 2842291075 | 2842291493 | 519 |
| 273 | iso_pu_bacteria | 2842304105 | 2842309333 | 519 |
| 274 | iso_pu_bacteria | 2842311132 | 2842315468 | 519 |
| 275 | iso_pu_bacteria | 2842317721 | 2842318202 | 519 |
| 276 | iso_pu_bacteria | 2842341865 | 2842347218 | 519 |
| 277 | iso_pu_bacteria | 2842363717 | 2842366597 | 519 |
| 278 | iso_pu_bacteria | 2842370503 | 2842373098 | 519 |
| 279 | iso_pu_bacteria | 2842377471 | 2842377889 | 519 |
| 280 | iso_pu_bacteria | 2842384541 | 2842386170 | 519 |
| 281 | iso_pu_bacteria | 2842395702 | 2842397363 | 519 |
| 282 | iso_pu_bacteria | 2842402390 | 2842405032 | 519 |
| 283 | iso_pu_bacteria | 2842409023 | 2842411614 | 519 |
| 284 | iso_pu_bacteria | 2842415677 | 2842417935 | 519 |
| 285 | iso_pu_bacteria | 2842422224 | 2842424920 | 519 |
| 286 | iso_pu_bacteria | 2842428310 | 2842431956 | 519 |
| 287 | iso_pu_bacteria | 2842434925 | 2842438069 | 519 |
| 288 | iso_pu_bacteria | 2842441272 | 2842444882 | 519 |
| 289 | iso_pu_bacteria | 2842447887 | 2842451797 | 519 |
| 290 | iso_pu_bacteria | 2842462802 | 2842465740 | 519 |
| 291 | iso_pu_bacteria | 2842469257 | 2842472686 | 519 |
| 292 | iso_pu_bacteria | 2842489311 | 2842492833 | 519 |
| 293 | iso_pu_bacteria | 2842495871 | 2842496472 | 519 |
| 294 | iso_pu_bacteria | 2842515876 | 2842518627 | 519 |
| 295 | iso_pu_bacteria | 2842922631 | 2842927023 | 519 |
| 296 | iso_pu_bacteria | 2844454524 | 2844459481 | 519 |
| 297 | iso_pu_bacteria | 2854896431 | 2854899912 | 519 |
| 298 | iso_pu_bacteria | 2857516855 | 2857523761 | 519 |
| 299 | iso_pu_bacteria | 2857537821 | 2857538947 | 519 |
| 300 | iso_pu_bacteria | 2898795034 | 2898796019 | 519 |
| 301 | iso_pu_bacteria | 2899792073 | 2899795044 | 519 |
| 302 | iso_pu_bacteria | 2899803654 | 2899807097 | 519 |
| 303 | iso_pu_bacteria | 2899845264 | 2899849780 | 519 |
| 304 | iso_pu_bacteria | 2919100787 | 2919103257 | 519 |
| 305 | iso_pu_bacteria | 2919114240 | 2919117853 | 519 |
| 306 | iso_pu_bacteria | 2919171160 | 2919174314 | 519 |
| 307 | iso_pu_bacteria | 2923556063 | 2923561651 | 519 |
| 308 | iso_pu_bacteria | 2926754445 | 2926757658 | 519 |
| 309 | iso_pu_bacteria | 2926760298 | 2926764726 | 519 |
| 310 | iso_pu_bacteria | 2933006813 | 2933010258 | 519 |
| 311 | iso_pu_bacteria | 2933011516 | 2933014253 | 519 |
| 312 | iso_pu_bacteria | 2933016740 | 2933023125 | 519 |
| 313 | iso_pu_bacteria | 2933570622 | 2933575894 | 519 |
| 314 | iso_pu_bacteria | 2933586486 | 2933586866 | 519 |
| 315 | iso_pu_bacteria | 2933594066 | 2933597134 | 519 |
| 316 | iso_pu_bacteria | 2933599457 | 2933602221 | 519 |
| 317 | iso_pu_bacteria | 2935894831 | 2935899032 | 519 |
| 318 | iso_pu_bacteria | 2935901341 | 2935904408 | 519 |
| 319 | iso_pu_bacteria | 2936367885 | 2936373065 | 519 |
| 320 | iso_pu_bacteria | 2936375103 | 2936381210 | 519 |
| 321 | iso_pu_bacteria | 2936381700 | 2936385997 | 519 |
| 322 | iso_pu_bacteria | 2937836603 | 2937838491 | 519 |
| 323 | iso_pu_bacteria | 2979095461 | 2979095692 | 519 |
| 324 | iso_pu_bacteria | 2984509177 | 2984510851 | 519 |
| 325 | iso_pu_bacteria | 2984518228 | 2984518449 | 519 |
| 326 | iso_pu_bacteria | 2984537506 | 2984539200 | 519 |
| 327 | iso_pu_bacteria | 2984601300 | 2984605907 | 519 |
| 328 | iso_pu_bacteria | 2996893221 | 2996898418 | 519 |
| 329 | iso_pu_bacteria | 3000017691 | 3000020945 | 519 |
| 330 | iso_pu_bacteria | 3000405567 | 3000406369 | 519 |
| 331 | iso_pu_bacteria | 3000405567 | 3000408934 | 519 |
| 332 | iso_pu_bacteria | 3005416602 | 3005419133 | 519 |
| 333 | iso_pu_bacteria | 639633055 | 639648220 | 519 |
| 334 | iso_pu_bacteria | 650716007 | 650842487 | 519 |
| 335 | iso_pu_bacteria | 8003570095 | 8003573376 | 519 |
| 336 | iso_pu_bacteria | 8005258706 | 8005260640 | 519 |
| 337 | iso_pu_bacteria | 8005275841 | 8005280275 | 519 |
| 338 | iso_pu_bacteria | 8005282627 | 8005288341 | 519 |
| 339 | iso_pu_bacteria | 8005289223 | 8005294853 | 519 |
| 340 | iso_pu_bacteria | 8005301065 | 8005306986 | 519 |
| 341 | iso_pu_bacteria | 8005307578 | 8005314196 | 519 |
| 342 | iso_pu_bacteria | 8005314921 | 8005318102 | 519 |
| 343 | iso_pu_bacteria | 8005376324 | 8005378867 | 519 |
| 344 | iso_pu_bacteria | 8005382845 | 8005388059 | 519 |
| 345 | iso_pu_bacteria | 8005395548 | 8005396985 | 519 |
| 346 | iso_pu_bacteria | 8005430974 | 8005433172 | 519 |
| 347 | iso_pu_bacteria | 8005460587 | 8005462585 | 519 |
| 348 | iso_pu_bacteria | 8005497431 | 8005499964 | 519 |
| 349 | iso_pu_bacteria | 8005556819 | 8005558044 | 519 |
| 350 | iso_pu_bacteria | 8005563573 | 8005569218 | 519 |
| 351 | iso_pu_bacteria | 8005570704 | 8005575492 | 519 |
| 352 | iso_pu_bacteria | 8005619151 | 8005621331 | 519 |
| 353 | iso_pu_bacteria | 8005626139 | 8005631380 | 519 |
| 354 | iso_pu_bacteria | 8005668836 | 8005671380 | 519 |
| 355 | iso_pu_bacteria | 8005688590 | 8005694901 | 519 |
| 356 | iso_pu_bacteria | 8005695170 | 8005696076 | 519 |
| 357 | iso_pu_bacteria | 8018127388 | 8018129621 | 519 |
| 358 | iso_pu_bacteria | 8018163183 | 8018168173 | 519 |
| 359 | iso_pu_bacteria | 8018176218 | 8018177953 | 519 |
| 360 | iso_pu_bacteria | 8023680758 | 8023681028 | 519 |
| 361 | iso_pu_bacteria | 8024479707 | 8024485827 | 519 |
| 362 | iso_pu_bacteria | 8024501048 | 8024505294 | 519 |
| 363 | iso_pu_bacteria | 8056375014 | 8056380211 | 519 |
| 364 | iso_pu_bacteria | 8056382006 | 8056387495 | 519 |
| 365 | iso_pu_bacteria | 8057874678 | 8057875414 | 519 |
| 366 | 3300042876 | Ga0451577_0066111 | Ga0451577_0066111_554_2158 | 520 |
| 367 | 3300049570 | Ga0501033_0125546 | Ga0501033_0125546_192_1787 | 520 |
| 368 | 3300049744 | Ga0501083_0009266 | Ga0501083_0009266_4660_6234 | 520 |
| 369 | 3300049823 | Ga0501044_0193024 | Ga0501044_0193024_359_1954 | 520 |
| 370 | 3300053140 | Ga0500573_0051522 | Ga0500573_0051522_685_2325 | 520 |
| 371 | iso_pu_bacteria | 2643221637 | 2644207771 | 520 |
| 372 | iso_pu_bacteria | 2643221718 | 2644651860 | 520 |
| 373 | iso_pu_bacteria | 2757320392 | 2757571886 | 520 |
| 374 | iso_pu_bacteria | 2844533157 | 2844536381 | 520 |
| 375 | 3300046473 | Ga0495582_0019142 | Ga0495582_0019142_1725_3332 | 521 |
| 376 | 3300046526 | Ga0495666_0000875 | Ga0495666_0000875_6107_7714 | 521 |
| 377 | 3300046535 | Ga0495586_0033394 | Ga0495586_0033394_588_2195 | 521 |
| 378 | 3300046663 | Ga0495635_0084117 | Ga0495635_0084117_340_1947 | 521 |
| 379 | 3300046809 | Ga0495600_0003182 | Ga0495600_0003182_6426_8033 | 521 |
| 380 | 3300047315 | Ga0495581_0003799 | Ga0495581_0003799_644_2251 | 521 |
| 381 | 3300047322 | Ga0495680_0007288 | Ga0495680_0007288_2310_3917 | 521 |
| 382 | iso_pu_bacteria | 2508501114 | 2509076261 | 521 |
| 383 | iso_pu_bacteria | 2919679072 | 2919682638 | 521 |
| 384 | 3300005436 | Ga0070713_100012418 | Ga0070713_1000124186 | 522 |
| 385 | 3300006038 | Ga0075365_10001384 | Ga0075365_100013848 | 522 |
| 386 | 3300006048 | Ga0075363_100034542 | Ga0075363_1000345422 | 522 |
| 387 | 3300006051 | Ga0075364_10020347 | Ga0075364_100203472 | 522 |
| 388 | 3300006178 | Ga0075367_10008133 | Ga0075367_100081335 | 522 |
| 389 | 3300006178 | Ga0075367_10030197 | Ga0075367_100301971 | 522 |
| 390 | 3300006353 | Ga0075370_10018094 | Ga0075370_100180942 | 522 |
| 391 | 3300009545 | Ga0105237_10039816 | Ga0105237_100398164 | 522 |
| 392 | 3300046459 | Ga0495629_0000187 | Ga0495629_0000187_44383_45999 | 522 |
| 393 | 3300046472 | Ga0495580_0005039 | Ga0495580_0005039_1901_3517 | 522 |
| 394 | 3300046511 | Ga0495608_0004864 | Ga0495608_0004864_7541_9148 | 522 |
| 395 | 3300046531 | Ga0495665_0028609 | Ga0495665_0028609_1118_2686 | 522 |
| 396 | 3300046533 | Ga0495640_0009136 | Ga0495640_0009136_278_1885 | 522 |
| 397 | 3300046543 | Ga0495645_0007678 | Ga0495645_0007678_3996_5612 | 522 |
| 398 | 3300046642 | Ga0495634_0036206 | Ga0495634_0036206_302_1909 | 522 |
| 399 | 3300050491 | nmdc:mga00v17_10788_c1 | nmdc:mga00v17_10788_c1_1014_2627 | 522 |
| 400 | 3300050494 | nmdc:mga06z11_28525_c1 | nmdc:mga06z11_28525_c1_780_2393 | 522 |
| 401 | 3300053139 | Ga0500568_0023651 | Ga0500568_0023651_186_1778 | 522 |
| 402 | iso_pu_bacteria | 2534681796 | 2535520450 | 522 |
| 403 | iso_pu_bacteria | 2585427633 | 2585997554 | 522 |
| 404 | iso_pu_bacteria | 2585427634 | 2586002160 | 522 |
| 405 | iso_pu_bacteria | 2599185156 | 2599335353 | 522 |
| 406 | iso_pu_bacteria | 2767802442 | 2770196445 | 522 |
| 407 | iso_pu_bacteria | 2775506902 | 2776272738 | 522 |
| 408 | iso_pu_bacteria | 2775506904 | 2776284681 | 522 |
| 409 | iso_pu_bacteria | 2840764183 | 2840768406 | 522 |
| 410 | iso_pu_bacteria | 2854896431 | 2854897846 | 522 |
| 411 | iso_pu_bacteria | 2854916844 | 2854920567 | 522 |
| 412 | iso_pu_bacteria | 2919171160 | 2919177095 | 522 |
| 413 | 3300002704 | JGI25155J39150_1000021 | JGI25155J39150_1000021101 | 523 |
| 414 | 3300002705 | JGI25156J39149_1000022 | JGI25156J39149_1000022100 | 523 |
| 415 | 3300002738 | JGI25154J39366_1000048 | JGI25154J39366_100004816 | 523 |
| 416 | 3300002739 | JGI25158J39367_1001429 | JGI25158J39367_10014293 | 523 |
| 417 | 3300002741 | JGI25157J39369_1000025 | JGI25157J39369_100002541 | 523 |
| 418 | 3300002773 | JGI25152J39213_1002623 | JGI25152J39213_10026233 | 523 |
| 419 | 3300002773 | JGI25152J39213_1011838 | JGI25152J39213_10118381 | 523 |
| 420 | 3300002774 | JGI25150J39212_1004051 | JGI25150J39212_10040511 | 523 |
| 421 | 3300002987 | JGI25159J45721_1001463 | JGI25159J45721_10014635 | 523 |
| 422 | 3300003187 | JGI25151J46595_10003498 | JGI25151J46595_100034983 | 523 |
| 423 | 3300003187 | JGI25151J46595_10020879 | JGI25151J46595_100208792 | 523 |
| 424 | 3300003215 | JGI25153J46596_10003267 | JGI25153J46596_100032675 | 523 |
| 425 | 3300003215 | JGI25153J46596_10004883 | JGI25153J46596_100048837 | 523 |
| 426 | 3300003215 | JGI25153J46596_10009989 | JGI25153J46596_100099891 | 523 |
| 427 | 3300003215 | JGI25153J46596_10027568 | JGI25153J46596_100275681 | 523 |
| 428 | 3300003323 | rootH1_10157577 | rootH1_101575772 | 523 |
| 429 | 3300003354 | JGI25160J50197_1001510 | JGI25160J50197_10015105 | 523 |
| 430 | 3300003374 | JGI25161J50226_1000119 | JGI25161J50226_100011918 | 523 |
| 431 | 3300003771 | Ga0055526_1000483 | Ga0055526_10004836 | 523 |
| 432 | 3300003771 | Ga0055526_1008055 | Ga0055526_10080552 | 523 |
| 433 | 3300003775 | Ga0055524_1005603 | Ga0055524_10056036 | 523 |
| 434 | 3300003775 | Ga0055524_1010867 | Ga0055524_10108672 | 523 |
| 435 | 3300003781 | Ga0055536_1002551 | Ga0055536_10025514 | 523 |
| 436 | 3300003790 | Ga0055528_1000106 | Ga0055528_100010637 | 523 |
| 437 | 3300003790 | Ga0055528_1003757 | Ga0055528_10037577 | 523 |
| 438 | 3300003790 | Ga0055528_1015996 | Ga0055528_10159961 | 523 |
| 439 | 3300003792 | Ga0055540_1000103 | Ga0055540_100010321 | 523 |
| 440 | 3300003792 | Ga0055540_1000919 | Ga0055540_10009194 | 523 |
| 441 | 3300003794 | Ga0055531_10000857 | Ga0055531_1000085711 | 523 |
| 442 | 3300003856 | Ga0058692_1001653 | Ga0058692_10016535 | 523 |
| 443 | 3300004625 | Ga0055543_1000492 | Ga0055543_10004924 | 523 |
| 444 | 3300005262 | Ga0065165_1007234 | Ga0065165_10072345 | 523 |
| 445 | 3300005353 | Ga0070669_100024859 | Ga0070669_1000248592 | 523 |
| 446 | 3300006048 | Ga0075363_100021412 | Ga0075363_1000214123 | 523 |
| 447 | 3300006177 | Ga0075362_10002938 | Ga0075362_100029382 | 523 |
| 448 | 3300006177 | Ga0075362_10010457 | Ga0075362_100104573 | 523 |
| 449 | 3300006177 | Ga0075362_10016569 | Ga0075362_100165692 | 523 |
| 450 | 3300006178 | Ga0075367_10002340 | Ga0075367_100023402 | 523 |
| 451 | 3300006178 | Ga0075367_10017248 | Ga0075367_100172483 | 523 |
| 452 | 3300006186 | Ga0075369_10012793 | Ga0075369_100127933 | 523 |
| 453 | 3300006195 | Ga0075366_10003686 | Ga0075366_100036865 | 523 |
| 454 | 3300006353 | Ga0075370_10009495 | Ga0075370_100094953 | 523 |
| 455 | 3300006353 | Ga0075370_10039503 | Ga0075370_100395032 | 523 |
| 456 | 3300006948 | Ga0099826_10000047 | Ga0099826_1000004718 | 523 |
| 457 | 3300006948 | Ga0099826_10008443 | Ga0099826_100084432 | 523 |
| 458 | 3300009148 | Ga0105243_10009057 | Ga0105243_100090573 | 523 |
| 459 | 3300009765 | Ga0123341_1000095 | Ga0123341_100009515 | 523 |
| 460 | 3300009766 | Ga0123342_1022517 | Ga0123342_10225173 | 523 |
| 461 | 3300013100 | Ga0157373_10013144 | Ga0157373_100131446 | 523 |
| 462 | 3300013102 | Ga0157371_10000005 | Ga0157371_10000005225 | 523 |
| 463 | 3300025206 | Ga0209435_100033 | Ga0209435_10003337 | 523 |
| 464 | 3300025208 | Ga0209436_100017 | Ga0209436_10001738 | 523 |
| 465 | 3300025245 | Ga0207425_1000475 | Ga0207425_100047519 | 523 |
| 466 | 3300025246 | Ga0209646_1000116 | Ga0209646_100011694 | 523 |
| 467 | 3300025250 | Ga0209026_1000103 | Ga0209026_100010337 | 523 |
| 468 | 3300025256 | Ga0209759_1000105 | Ga0209759_100010594 | 523 |
| 469 | 3300025258 | Ga0209129_1000474 | Ga0209129_100047414 | 523 |
| 470 | 3300025258 | Ga0209129_1001388 | Ga0209129_10013887 | 523 |
| 471 | 3300025258 | Ga0209129_1002928 | Ga0209129_10029286 | 523 |
| 472 | 3300025273 | Ga0209673_1000139 | Ga0209673_100013976 | 523 |
| 473 | 3300025273 | Ga0209673_1004415 | Ga0209673_10044156 | 523 |
| 474 | 3300025273 | Ga0209673_1005362 | Ga0209673_10053622 | 523 |
| 475 | 3300025273 | Ga0209673_1005469 | Ga0209673_10054696 | 523 |
| 476 | 3300025284 | Ga0209130_1000001 | Ga0209130_100000156 | 523 |
| 477 | 3300025292 | Ga0209676_1005029 | Ga0209676_10050294 | 523 |
| 478 | 3300025292 | Ga0209676_1017127 | Ga0209676_10171272 | 523 |
| 479 | 3300025294 | Ga0209025_1000237 | Ga0209025_1000237100 | 523 |
| 480 | 3300025294 | Ga0209025_1002369 | Ga0209025_10023694 | 523 |
| 481 | 3300025294 | Ga0209025_1012206 | Ga0209025_10122065 | 523 |
| 482 | 3300025295 | Ga0209564_1000331 | Ga0209564_100033140 | 523 |
| 483 | 3300025295 | Ga0209564_1003092 | Ga0209564_10030928 | 523 |
| 484 | 3300025295 | Ga0209564_1003107 | Ga0209564_10031076 | 523 |
| 485 | 3300025297 | Ga0209758_1000115 | Ga0209758_100011517 | 523 |
| 486 | 3300025297 | Ga0209758_1000931 | Ga0209758_100093119 | 523 |
| 487 | 3300025297 | Ga0209758_1001568 | Ga0209758_100156810 | 523 |
| 488 | 3300025297 | Ga0209758_1012588 | Ga0209758_10125883 | 523 |
| 489 | 3300025297 | Ga0209758_1018992 | Ga0209758_10189922 | 523 |
| 490 | 3300025298 | Ga0209050_1004159 | Ga0209050_10041594 | 523 |
| 491 | 3300025298 | Ga0209050_1026495 | Ga0209050_10264952 | 523 |
| 492 | 3300025299 | Ga0209256_1000299 | Ga0209256_100029935 | 523 |
| 493 | 3300025299 | Ga0209256_1003540 | Ga0209256_10035406 | 523 |
| 494 | 3300025299 | Ga0209256_1005810 | Ga0209256_10058102 | 523 |
| 495 | 3300025302 | Ga0207426_1000005 | Ga0207426_1000005661 | 523 |
| 496 | 3300025302 | Ga0207426_1000290 | Ga0207426_100029065 | 523 |
| 497 | 3300025303 | Ga0209051_1000095 | Ga0209051_100009543 | 523 |
| 498 | 3300025303 | Ga0209051_1000950 | Ga0209051_10009507 | 523 |
| 499 | 3300025304 | Ga0209257_1003729 | Ga0209257_10037294 | 523 |
| 500 | 3300025304 | Ga0209257_1003744 | Ga0209257_10037447 | 523 |
| 501 | 3300027312 | Ga0209371_1000012 | Ga0209371_1000012405 | 523 |
| 502 | 3300027312 | Ga0209371_1001150 | Ga0209371_10011507 | 523 |
| 503 | 3300027312 | Ga0209371_1004198 | Ga0209371_10041983 | 523 |
| 504 | 3300027666 | Ga0209282_1000071 | Ga0209282_100007152 | 523 |
| 505 | 3300028794 | Ga0307515_10004729 | Ga0307515_100047293 | 523 |
| 506 | 3300030500 | Ga0268256_1000013 | Ga0268256_1000013405 | 523 |
| 507 | 3300031456 | Ga0307513_10014035 | Ga0307513_100140353 | 523 |
| 508 | 3300041491 | Ga0451833_0074361 | Ga0451833_0074361_121_1716 | 523 |
| 509 | 3300041492 | Ga0451835_0854527 | Ga0451835_0854527_116_1711 | 523 |
| 510 | 3300041503 | Ga0451847_0010142 | Ga0451847_0010142_121_1716 | 523 |
| 511 | 3300041503 | Ga0451847_0297095 | Ga0451847_0297095_121_1716 | 523 |
| 512 | 3300046460 | Ga0495638_0000151 | Ga0495638_0000151_3775_5370 | 523 |
| 513 | 3300046460 | Ga0495638_0000445 | Ga0495638_0000445_15984_17579 | 523 |
| 514 | 3300046474 | Ga0495605_0000905 | Ga0495605_0000905_13219_14814 | 523 |
| 515 | 3300046474 | Ga0495605_0014686 | Ga0495605_0014686_462_2057 | 523 |
| 516 | 3300046492 | Ga0495585_0015532 | Ga0495585_0015532_1405_3000 | 523 |
| 517 | 3300046501 | Ga0495607_0012524 | Ga0495607_0012524_3907_5508 | 523 |
| 518 | 3300046506 | Ga0495583_0018574 | Ga0495583_0018574_429_2024 | 523 |
| 519 | 3300046507 | Ga0495606_0022345 | Ga0495606_0022345_1346_2941 | 523 |
| 520 | 3300046512 | Ga0495610_0000262 | Ga0495610_0000262_34180_35775 | 523 |
| 521 | 3300046512 | Ga0495610_0009325 | Ga0495610_0009325_4123_5718 | 523 |
| 522 | 3300046518 | Ga0495631_0000428 | Ga0495631_0000428_11536_13131 | 523 |
| 523 | 3300046518 | Ga0495631_0003509 | Ga0495631_0003509_2688_4283 | 523 |
| 524 | 3300046519 | Ga0495632_0003019 | Ga0495632_0003019_8064_9659 | 523 |
| 525 | 3300046519 | Ga0495632_0015116 | Ga0495632_0015116_1063_2658 | 523 |
| 526 | 3300046522 | Ga0495643_0026548 | Ga0495643_0026548_74_1669 | 523 |
| 527 | 3300046522 | Ga0495643_0084776 | Ga0495643_0084776_16_1611 | 523 |
| 528 | 3300046538 | Ga0495609_0027209 | Ga0495609_0027209_416_2011 | 523 |
| 529 | 3300046616 | Ga0495668_0078352 | Ga0495668_0078352_73_1668 | 523 |
| 530 | 3300046660 | Ga0495625_0000618 | Ga0495625_0000618_15978_17573 | 523 |
| 531 | 3300046660 | Ga0495625_0005647 | Ga0495625_0005647_7614_9209 | 523 |
| 532 | 3300046691 | Ga0495670_0011808 | Ga0495670_0011808_1707_3302 | 523 |
| 533 | 3300046691 | Ga0495670_0030380 | Ga0495670_0030380_806_2401 | 523 |
| 534 | 3300046694 | Ga0495649_0039711 | Ga0495649_0039711_442_2037 | 523 |
| 535 | 3300047323 | Ga0495683_0057920 | Ga0495683_0057920_186_1781 | 523 |
| 536 | 3300047472 | Ga0495686_0007803 | Ga0495686_0007803_2010_3605 | 523 |
| 537 | 3300048909 | Ga0496106_0002647 | Ga0496106_0002647_5215_6810 | 523 |
| 538 | 3300048909 | Ga0496106_0041245 | Ga0496106_0041245_308_1894 | 523 |
| 539 | 3300048919 | Ga0496116_0017856 | Ga0496116_0017856_1416_3011 | 523 |
| 540 | 3300048920 | Ga0496117_0000083 | Ga0496117_0000083_31925_33511 | 523 |
| 541 | 3300048920 | Ga0496117_0029143 | Ga0496117_0029143_1913_3508 | 523 |
| 542 | 3300048921 | Ga0496118_0002046 | Ga0496118_0002046_25294_26889 | 523 |
| 543 | 3300048921 | Ga0496118_0003154 | Ga0496118_0003154_3538_5124 | 523 |
| 544 | 3300048921 | Ga0496118_0006775 | Ga0496118_0006775_6012_7607 | 523 |
| 545 | 3300048921 | Ga0496118_0040453 | Ga0496118_0040453_766_2352 | 523 |
| 546 | 3300048922 | Ga0496119_0056397 | Ga0496119_0056397_279_1871 | 523 |
| 547 | 3300048923 | Ga0496120_0000030 | Ga0496120_0000030_47747_49333 | 523 |
| 548 | 3300048924 | Ga0496121_0013320 | Ga0496121_0013320_4320_5915 | 523 |
| 549 | 3300048925 | Ga0496122_0000050 | Ga0496122_0000050_186755_188341 | 523 |
| 550 | 3300048925 | Ga0496122_0035439 | Ga0496122_0035439_316_1911 | 523 |
| 551 | 3300048926 | Ga0496123_0000052 | Ga0496123_0000052_176273_177859 | 523 |
| 552 | 3300048927 | Ga0496124_0014715 | Ga0496124_0014715_1717_3303 | 523 |
| 553 | 3300048929 | Ga0496126_0000254 | Ga0496126_0000254_29718_31325 | 523 |
| 554 | 3300049569 | Ga0501032_0068686 | Ga0501032_0068686_373_1968 | 523 |
| 555 | 3300049581 | Ga0501047_0037197 | Ga0501047_0037197_639_2234 | 523 |
| 556 | 3300050489 | nmdc:mga03683_12371_c2 | nmdc:mga03683_12371_c2_98_1693 | 523 |
| 557 | 3300050491 | nmdc:mga00v17_34_c1 | nmdc:mga00v17_34_c1_929_2515 | 523 |
| 558 | 3300050493 | nmdc:mga0k408_14382_c1 | nmdc:mga0k408_14382_c1_1749_3344 | 523 |
| 559 | 3300050494 | nmdc:mga06z11_10121_c1 | nmdc:mga06z11_10121_c1_774_2360 | 523 |
| 560 | 3300050494 | nmdc:mga06z11_65449_c1 | nmdc:mga06z11_65449_c1_121_1716 | 523 |
| 561 | 3300050496 | nmdc:mga07m45_83741_c1 | nmdc:mga07m45_83741_c1_59_1654 | 523 |
| 562 | 3300050516 | nmdc:mga0sz30_244_c1 | nmdc:mga0sz30_244_c1_3967_5553 | 523 |
| 563 | 3300053086 | Ga0500578_0053615 | Ga0500578_0053615_836_2431 | 523 |
| 564 | 3300053105 | Ga0500557_000836 | Ga0500557_000836_1228_2823 | 523 |
| 565 | 3300053118 | Ga0500594_0001736 | Ga0500594_0001736_1476_3071 | 523 |
| 566 | 3300053118 | Ga0500594_0004570 | Ga0500594_0004570_232_1827 | 523 |
| 567 | 3300053134 | Ga0500658_0000086 | Ga0500658_0000086_17839_19434 | 523 |
| 568 | 3300053137 | Ga0500561_0000089 | Ga0500561_0000089_15899_17485 | 523 |
| 569 | 3300053139 | Ga0500568_0000295 | Ga0500568_0000295_2515_4110 | 523 |
| 570 | 3300053139 | Ga0500568_0000659 | Ga0500568_0000659_14365_15960 | 523 |
| 571 | 3300053139 | Ga0500568_0001721 | Ga0500568_0001721_5397_6992 | 523 |
| 572 | 3300053153 | Ga0500616_0000203 | Ga0500616_0000203_1634_3229 | 523 |
| 573 | 3300053153 | Ga0500616_0000522 | Ga0500616_0000522_32815_34410 | 523 |
| 574 | 3300053156 | Ga0500622_0000836 | Ga0500622_0000836_17955_19550 | 523 |
| 575 | 3300053156 | Ga0500622_0055565 | Ga0500622_0055565_387_1982 | 523 |
| 576 | 3300053160 | Ga0500633_0000086 | Ga0500633_0000086_9361_10956 | 523 |
| 577 | 3300053161 | Ga0500634_0005497 | Ga0500634_0005497_111_1703 | 523 |
| 578 | 3300053161 | Ga0500634_0008269 | Ga0500634_0008269_399_1985 | 523 |
| 579 | 3300053730 | Ga0500645_002276 | Ga0500645_002276_968_2617 | 523 |
| 580 | iso_pu_bacteria | 642555112 | 642599202 | 523 |
| 581 | 3300005347 | Ga0070668_100021570 | Ga0070668_1000215702 | 524 |
| 582 | 3300025294 | Ga0209025_1022011 | Ga0209025_10220112 | 524 |
| 583 | 3300025972 | Ga0207668_10021266 | Ga0207668_100212663 | 524 |
| 584 | 3300031456 | Ga0307513_10000206 | Ga0307513_100002069 | 524 |
| 585 | 3300049823 | Ga0501044_0152734 | Ga0501044_0152734_285_1874 | 524 |
| 586 | 3300053125 | Ga0500618_000349 | Ga0500618_000349_4216_5823 | 524 |
| 587 | iso_pu_bacteria | 2519103095 | 2519461396 | 524 |
| 588 | iso_pu_bacteria | 2582581311 | 2585290823 | 524 |
| 589 | iso_pu_bacteria | 2599185239 | 2599734655 | 524 |
| 590 | iso_pu_bacteria | 2599185240 | 2599745526 | 524 |
| 591 | iso_pu_bacteria | 2599185355 | 2600207433 | 524 |
| 592 | iso_pu_bacteria | 2675903129 | 2676741248 | 524 |
| 593 | iso_pu_bacteria | 2816332253 | 2817258303 | 524 |
| 594 | iso_pu_bacteria | 2816332256 | 2817281283 | 524 |
| 595 | iso_pu_bacteria | 2816332286 | 2817452029 | 524 |
| 596 | iso_pu_bacteria | 2818991452 | 2819634457 | 524 |
| 597 | iso_pu_bacteria | 2863421361 | 2863426732 | 524 |
| 598 | iso_pu_bacteria | 2870068957 | 2870075246 | 524 |
| 599 | iso_pu_bacteria | 2904564687 | 2904570633 | 524 |
| 600 | iso_pu_bacteria | 2904571731 | 2904577810 | 524 |
| 601 | iso_pu_bacteria | 2928157003 | 2928159024 | 524 |
| 602 | iso_pu_bacteria | 2928163908 | 2928167846 | 524 |
| 603 | iso_pu_bacteria | 2928170801 | 2928178078 | 524 |
| 604 | iso_pu_bacteria | 2928536128 | 2928537965 | 524 |
| 605 | iso_pu_bacteria | 2981990288 | 2981992402 | 524 |
| 606 | iso_pu_bacteria | 641736154 | 642418255 | 524 |
| 607 | iso_pu_bacteria | 8018845410 | 8018846584 | 524 |
| 608 | iso_pu_bacteria | 8020807995 | 8020810354 | 524 |
| 609 | iso_pu_bacteria | 8020938398 | 8020941786 | 524 |
| 610 | iso_pu_bacteria | 8020945358 | 8020945647 | 524 |
| 611 | iso_pu_bacteria | 8020953355 | 8020958739 | 524 |
| 612 | iso_pu_bacteria | 8021120328 | 8021121686 | 524 |
| 613 | iso_pu_bacteria | 8039098773 | 8039103868 | 524 |
| 614 | iso_pu_bacteria | 8040167225 | 8040167397 | 524 |
| 615 | iso_pu_bacteria | 8040173305 | 8040175408 | 524 |
| 616 | 3300006051 | Ga0075364_10000212 | Ga0075364_1000021213 | 525 |
| 617 | 3300050491 | nmdc:mga00v17_31_c1 | nmdc:mga00v17_31_c1_41444_43042 | 525 |
| 618 | 3300053125 | Ga0500618_001394 | Ga0500618_001394_8279_9877 | 525 |
| 619 | iso_pu_bacteria | 2808606384 | 2808969340 | 525 |
| 620 | iso_pu_bacteria | 2808606390 | 2809004171 | 525 |
| 621 | 3300002773 | JGI25152J39213_1001761 | JGI25152J39213_10017612 | 526 |
| 622 | 3300003215 | JGI25153J46596_10017391 | JGI25153J46596_100173912 | 526 |
| 623 | 3300003323 | rootH1_10138215 | rootH1_101382152 | 526 |
| 624 | 3300003781 | Ga0055536_1003731 | Ga0055536_10037318 | 526 |
| 625 | 3300003790 | Ga0055528_1005284 | Ga0055528_10052842 | 526 |
| 626 | 3300003794 | Ga0055531_10003817 | Ga0055531_1000381710 | 526 |
| 627 | 3300006038 | Ga0075365_10015773 | Ga0075365_100157733 | 526 |
| 628 | 3300009177 | Ga0105248_10069122 | Ga0105248_100691223 | 526 |
| 629 | 3300009551 | Ga0105238_10163320 | Ga0105238_101633202 | 526 |
| 630 | 3300009553 | Ga0105249_10151297 | Ga0105249_101512972 | 526 |
| 631 | 3300025258 | Ga0209129_1000690 | Ga0209129_100069011 | 526 |
| 632 | 3300025273 | Ga0209673_1004743 | Ga0209673_10047432 | 526 |
| 633 | 3300025292 | Ga0209676_1019932 | Ga0209676_10199321 | 526 |
| 634 | 3300025294 | Ga0209025_1004937 | Ga0209025_10049373 | 526 |
| 635 | 3300025295 | Ga0209564_1002675 | Ga0209564_10026757 | 526 |
| 636 | 3300025297 | Ga0209758_1000341 | Ga0209758_100034180 | 526 |
| 637 | 3300025298 | Ga0209050_1020092 | Ga0209050_10200922 | 526 |
| 638 | 3300025302 | Ga0207426_1004159 | Ga0207426_10041593 | 526 |
| 639 | 3300025303 | Ga0209051_1000751 | Ga0209051_10007515 | 526 |
| 640 | 3300025303 | Ga0209051_1001177 | Ga0209051_100117715 | 526 |
| 641 | 3300025304 | Ga0209257_1006426 | Ga0209257_10064267 | 526 |
| 642 | 3300025924 | Ga0207694_10091863 | Ga0207694_100918632 | 526 |
| 643 | 3300048907 | Ga0496104_0000378 | Ga0496104_0000378_29422_31026 | 526 |
| 644 | 3300048908 | Ga0496105_0001811 | Ga0496105_0001811_4039_5643 | 526 |
| 645 | 3300048909 | Ga0496106_0019975 | Ga0496106_0019975_2275_3879 | 526 |
| 646 | 3300048921 | Ga0496118_0104922 | Ga0496118_0104922_214_1818 | 526 |
| 647 | 3300048922 | Ga0496119_0001603 | Ga0496119_0001603_15676_17280 | 526 |
| 648 | 3300048923 | Ga0496120_0057513 | Ga0496120_0057513_220_1824 | 526 |
| 649 | 3300048925 | Ga0496122_0079672 | Ga0496122_0079672_101_1705 | 526 |
| 650 | 3300048928 | Ga0496125_0071734 | Ga0496125_0071734_455_2059 | 526 |
| 651 | 3300048929 | Ga0496126_0067500 | Ga0496126_0067500_1318_2922 | 526 |
| 652 | 3300050492 | nmdc:mga0yw44_1286_c1 | nmdc:mga0yw44_1286_c1_6744_8348 | 526 |
| 653 | 3300053161 | Ga0500634_0002483 | Ga0500634_0002483_4097_5701 | 526 |
| 654 | 3300005335 | Ga0070666_10052478 | Ga0070666_100524782 | 527 |
| 655 | 3300005367 | Ga0070667_100116288 | Ga0070667_1001162882 | 527 |
| 656 | 3300005455 | Ga0070663_100046701 | Ga0070663_1000467013 | 527 |
| 657 | 3300006051 | Ga0075364_10000058 | Ga0075364_100000582 | 527 |
| 658 | 3300009177 | Ga0105248_10215836 | Ga0105248_102158361 | 527 |
| 659 | 3300013306 | Ga0163162_10002290 | Ga0163162_100022906 | 527 |
| 660 | 3300025941 | Ga0207711_10146500 | Ga0207711_101465002 | 527 |
| 661 | 3300025986 | Ga0207658_10032074 | Ga0207658_100320742 | 527 |
| 662 | 3300026067 | Ga0207678_10067634 | Ga0207678_100676342 | 527 |
| 663 | 3300046507 | Ga0495606_0008280 | Ga0495606_0008280_1236_2828 | 527 |
| 664 | 3300046794 | Ga0495589_0004343 | Ga0495589_0004343_2678_4276 | 527 |
| 665 | 3300048924 | Ga0496121_0003960 | Ga0496121_0003960_9051_10661 | 527 |
| 666 | 3300050491 | nmdc:mga00v17_42_c1 | nmdc:mga00v17_42_c1_77601_79211 | 527 |
| 667 | 3300053125 | Ga0500618_000356 | Ga0500618_000356_27924_29573 | 527 |
| 668 | iso_pu_bacteria | 2773857925 | 2774869152 | 527 |
| 669 | iso_pu_bacteria | 2882456835 | 2882457618 | 527 |
| 670 | iso_pu_bacteria | 8005542996 | 8005548202 | 527 |
| 671 | 3300002067 | JGI24735J21928_10004245 | JGI24735J21928_100042456 | 528 |
| 672 | 3300003758 | Ga0055532_1001039 | Ga0055532_10010395 | 528 |
| 673 | 3300003760 | Ga0055527_1000643 | Ga0055527_10006436 | 528 |
| 674 | 3300003761 | Ga0055535_1001039 | Ga0055535_10010398 | 528 |
| 675 | 3300003761 | Ga0055535_1001609 | Ga0055535_10016095 | 528 |
| 676 | 3300003762 | Ga0055542_1001029 | Ga0055542_10010298 | 528 |
| 677 | 3300003762 | Ga0055542_1002338 | Ga0055542_10023385 | 528 |
| 678 | 3300003763 | Ga0055529_1000861 | Ga0055529_10008618 | 528 |
| 679 | 3300003763 | Ga0055529_1003258 | Ga0055529_10032582 | 528 |
| 680 | 3300003790 | Ga0055528_1006282 | Ga0055528_10062822 | 528 |
| 681 | 3300003856 | Ga0058692_1010442 | Ga0058692_10104422 | 528 |
| 682 | 3300005327 | Ga0070658_10086424 | Ga0070658_100864241 | 528 |
| 683 | 3300005339 | Ga0070660_100000013 | Ga0070660_10000001349 | 528 |
| 684 | 3300005339 | Ga0070660_100004148 | Ga0070660_1000041487 | 528 |
| 685 | 3300005366 | Ga0070659_100000028 | Ga0070659_10000002850 | 528 |
| 686 | 3300005455 | Ga0070663_100001036 | Ga0070663_1000010365 | 528 |
| 687 | 3300005563 | Ga0068855_100022253 | Ga0068855_1000222539 | 528 |
| 688 | 3300009093 | Ga0105240_10008156 | Ga0105240_100081569 | 528 |
| 689 | 3300009093 | Ga0105240_10097281 | Ga0105240_100972812 | 528 |
| 690 | 3300009545 | Ga0105237_10050555 | Ga0105237_100505553 | 528 |
| 691 | 3300009551 | Ga0105238_10054000 | Ga0105238_100540002 | 528 |
| 692 | 3300010375 | Ga0105239_10079545 | Ga0105239_100795455 | 528 |
| 693 | 3300013296 | Ga0157374_10000749 | Ga0157374_1000074913 | 528 |
| 694 | 3300015265 | Ga0182005_1003552 | Ga0182005_10035523 | 528 |
| 695 | 3300025225 | Ga0209566_101869 | Ga0209566_1018693 | 528 |
| 696 | 3300025226 | Ga0209674_102069 | Ga0209674_1020693 | 528 |
| 697 | 3300025228 | Ga0209672_100067 | Ga0209672_10006783 | 528 |
| 698 | 3300025228 | Ga0209672_100079 | Ga0209672_10007969 | 528 |
| 699 | 3300025228 | Ga0209672_100431 | Ga0209672_10043122 | 528 |
| 700 | 3300025229 | Ga0209147_100012 | Ga0209147_100012444 | 528 |
| 701 | 3300025229 | Ga0209147_100061 | Ga0209147_10006162 | 528 |
| 702 | 3300025229 | Ga0209147_100107 | Ga0209147_10010769 | 528 |
| 703 | 3300025242 | Ga0209258_100107 | Ga0209258_1001077 | 528 |
| 704 | 3300025242 | Ga0209258_100273 | Ga0209258_1002736 | 528 |
| 705 | 3300025254 | Ga0209148_1000022 | Ga0209148_1000022183 | 528 |
| 706 | 3300025254 | Ga0209148_1001754 | Ga0209148_10017546 | 528 |
| 707 | 3300025256 | Ga0209759_1005034 | Ga0209759_10050344 | 528 |
| 708 | 3300025272 | Ga0209455_1000024 | Ga0209455_1000024440 | 528 |
| 709 | 3300025272 | Ga0209455_1000300 | Ga0209455_100030038 | 528 |
| 710 | 3300025273 | Ga0209673_1000021 | Ga0209673_1000021135 | 528 |
| 711 | 3300025904 | Ga0207647_10000396 | Ga0207647_1000039626 | 528 |
| 712 | 3300025904 | Ga0207647_10072120 | Ga0207647_100721202 | 528 |
| 713 | 3300025913 | Ga0207695_10000255 | Ga0207695_1000025590 | 528 |
| 714 | 3300025913 | Ga0207695_10006348 | Ga0207695_100063484 | 528 |
| 715 | 3300025913 | Ga0207695_10085546 | Ga0207695_100855462 | 528 |
| 716 | 3300025914 | Ga0207671_10031690 | Ga0207671_100316905 | 528 |
| 717 | 3300025919 | Ga0207657_10000017 | Ga0207657_10000017107 | 528 |
| 718 | 3300025919 | Ga0207657_10003040 | Ga0207657_1000304013 | 528 |
| 719 | 3300025932 | Ga0207690_10000009 | Ga0207690_10000009200 | 528 |
| 720 | 3300025949 | Ga0207667_10027790 | Ga0207667_100277905 | 528 |
| 721 | 3300025949 | Ga0207667_10069557 | Ga0207667_100695572 | 528 |
| 722 | 3300026067 | Ga0207678_10001300 | Ga0207678_100013007 | 528 |
| 723 | 3300027312 | Ga0209371_1000128 | Ga0209371_10001281 | 528 |
| 724 | 3300028381 | Ga0268264_10081089 | Ga0268264_100810892 | 528 |
| 725 | 3300030500 | Ga0268256_1000152 | Ga0268256_100015283 | 528 |
| 726 | 3300031595 | Ga0265313_10000955 | Ga0265313_1000095514 | 528 |
| 727 | 3300037466 | Ga0395898_0000705 | Ga0395898_0000705_374_1963 | 528 |
| 728 | 3300044656 | Ga0466969_0004388 | Ga0466969_0004388_96_1685 | 528 |
| 729 | 3300044693 | Ga0466961_0002861 | Ga0466961_0002861_3327_4916 | 528 |
| 730 | 3300044719 | Ga0466971_0004206 | Ga0466971_0004206_2868_4457 | 528 |
| 731 | 3300045049 | Ga0466959_0033823 | Ga0466959_0033823_436_2025 | 528 |
| 732 | 3300048929 | Ga0496126_0000550 | Ga0496126_0000550_36728_38335 | 528 |
| 733 | 3300061719 | Ga0466962_0012455 | Ga0466962_0012455_2376_3965 | 528 |
| 734 | iso_pu_bacteria | 2511231221 | 2512034252 | 528 |
| 735 | iso_pu_bacteria | 2808606384 | 2808969339 | 528 |
| 736 | iso_pu_bacteria | 2808606390 | 2809004170 | 528 |
| 737 | iso_pu_bacteria | 8054002106 | 8054004271 | 528 |
| 738 | 3300002067 | JGI24735J21928_10011784 | JGI24735J21928_100117843 | 529 |
| 739 | 3300011119 | Ga0105246_10104329 | Ga0105246_101043291 | 529 |
| 740 | 3300025228 | Ga0209672_100431 | Ga0209672_10043121 | 529 |
| 741 | 3300037466 | Ga0395898_0047046 | Ga0395898_0047046_2296_3918 | 529 |
| 742 | 3300044683 | Ga0466965_0005387 | Ga0466965_0005387_2333_3922 | 529 |
| 743 | 3300044684 | Ga0466966_0007483 | Ga0466966_0007483_2819_4408 | 529 |
| 744 | 3300044693 | Ga0466961_0000331 | Ga0466961_0000331_14919_16508 | 529 |
| 745 | 3300044693 | Ga0466961_0028434 | Ga0466961_0028434_1876_3465 | 529 |
| 746 | 3300044842 | Ga0466957_0000233 | Ga0466957_0000233_23401_24990 | 529 |
| 747 | 3300045836 | Ga0466958_0040661 | Ga0466958_0040661_1141_2730 | 529 |
| 748 | 3300048914 | Ga0496111_0015118 | Ga0496111_0015118_1435_3024 | 529 |
| 749 | 3300048924 | Ga0496121_0005745 | Ga0496121_0005745_6172_7761 | 529 |
| 750 | iso_pu_bacteria | 2519103095 | 2519461389 | 529 |
| 751 | iso_pu_bacteria | 2582581311 | 2585290830 | 529 |
| 752 | iso_pu_bacteria | 2599185239 | 2599734648 | 529 |
| 753 | iso_pu_bacteria | 2599185240 | 2599745531 | 529 |
| 754 | iso_pu_bacteria | 2599185355 | 2600207438 | 529 |
| 755 | iso_pu_bacteria | 2600255067 | 2600812425 | 529 |
| 756 | iso_pu_bacteria | 2675903129 | 2676741253 | 529 |
| 757 | iso_pu_bacteria | 2816332253 | 2817258296 | 529 |
| 758 | iso_pu_bacteria | 2816332256 | 2817281290 | 529 |
| 759 | iso_pu_bacteria | 2816332286 | 2817452022 | 529 |
| 760 | iso_pu_bacteria | 2818991452 | 2819634448 | 529 |
| 761 | iso_pu_bacteria | 2857576091 | 2857580018 | 529 |
| 762 | iso_pu_bacteria | 2863421361 | 2863426740 | 529 |
| 763 | iso_pu_bacteria | 2870068957 | 2870075237 | 529 |
| 764 | iso_pu_bacteria | 2904564687 | 2904570640 | 529 |
| 765 | iso_pu_bacteria | 2904571731 | 2904577817 | 529 |
| 766 | iso_pu_bacteria | 2928157003 | 2928159018 | 529 |
| 767 | iso_pu_bacteria | 2928163908 | 2928167841 | 529 |
| 768 | iso_pu_bacteria | 2928170801 | 2928178087 | 529 |
| 769 | iso_pu_bacteria | 2928536128 | 2928537972 | 529 |
| 770 | iso_pu_bacteria | 2981990288 | 2981992395 | 529 |
| 771 | iso_pu_bacteria | 641736154 | 642418261 | 529 |
| 772 | iso_pu_bacteria | 8018845410 | 8018846591 | 529 |
| 773 | iso_pu_bacteria | 8020807995 | 8020810347 | 529 |
| 774 | iso_pu_bacteria | 8020938398 | 8020941779 | 529 |
| 775 | iso_pu_bacteria | 8020945358 | 8020945655 | 529 |
| 776 | iso_pu_bacteria | 8020953355 | 8020958746 | 529 |
| 777 | iso_pu_bacteria | 8021120328 | 8021121679 | 529 |
| 778 | iso_pu_bacteria | 8039098773 | 8039103865 | 529 |
| 779 | iso_pu_bacteria | 8040167225 | 8040167390 | 529 |
| 780 | iso_pu_bacteria | 8040173305 | 8040175401 | 529 |
| 781 | 3300002987 | JGI25159J45721_1000407 | JGI25159J45721_100040710 | 530 |
| 782 | 3300003354 | JGI25160J50197_1000172 | JGI25160J50197_100017240 | 530 |
| 783 | 3300003374 | JGI25161J50226_1000007 | JGI25161J50226_100000789 | 530 |
| 784 | 3300003758 | Ga0055532_1000743 | Ga0055532_10007432 | 530 |
| 785 | 3300003760 | Ga0055527_1002267 | Ga0055527_10022673 | 530 |
| 786 | 3300003790 | Ga0055528_1002706 | Ga0055528_10027066 | 530 |
| 787 | 3300004625 | Ga0055543_1003014 | Ga0055543_10030142 | 530 |
| 788 | 3300005339 | Ga0070660_100000013 | Ga0070660_10000001344 | 530 |
| 789 | 3300005366 | Ga0070659_100000028 | Ga0070659_10000002856 | 530 |
| 790 | 3300005455 | Ga0070663_100001036 | Ga0070663_10000103611 | 530 |
| 791 | 3300005614 | Ga0068856_100040417 | Ga0068856_1000404175 | 530 |
| 792 | 3300005616 | Ga0068852_100012681 | Ga0068852_1000126817 | 530 |
| 793 | 3300009011 | Ga0105251_10000167 | Ga0105251_100001674 | 530 |
| 794 | 3300009036 | Ga0105244_10024403 | Ga0105244_100244031 | 530 |
| 795 | 3300009093 | Ga0105240_10226211 | Ga0105240_102262112 | 530 |
| 796 | 3300009551 | Ga0105238_10024386 | Ga0105238_100243863 | 530 |
| 797 | 3300010375 | Ga0105239_10003889 | Ga0105239_1000388915 | 530 |
| 798 | 3300025208 | Ga0209436_103175 | Ga0209436_1031754 | 530 |
| 799 | 3300025225 | Ga0209566_100293 | Ga0209566_10029337 | 530 |
| 800 | 3300025228 | Ga0209672_100067 | Ga0209672_10006789 | 530 |
| 801 | 3300025228 | Ga0209672_100079 | Ga0209672_10007964 | 530 |
| 802 | 3300025229 | Ga0209147_100012 | Ga0209147_100012438 | 530 |
| 803 | 3300025229 | Ga0209147_100061 | Ga0209147_10006153 | 530 |
| 804 | 3300025229 | Ga0209147_100107 | Ga0209147_10010764 | 530 |
| 805 | 3300025254 | Ga0209148_1000022 | Ga0209148_1000022189 | 530 |
| 806 | 3300025272 | Ga0209455_1000024 | Ga0209455_1000024434 | 530 |
| 807 | 3300025273 | Ga0209673_1000021 | Ga0209673_1000021143 | 530 |
| 808 | 3300025284 | Ga0209130_1000245 | Ga0209130_100024510 | 530 |
| 809 | 3300025295 | Ga0209564_1015536 | Ga0209564_10155363 | 530 |
| 810 | 3300025302 | Ga0207426_1000091 | Ga0207426_1000091130 | 530 |
| 811 | 3300025302 | Ga0207426_1001819 | Ga0207426_100181914 | 530 |
| 812 | 3300025735 | Ga0207713_1002977 | Ga0207713_10029775 | 530 |
| 813 | 3300025904 | Ga0207647_10004607 | Ga0207647_100046074 | 530 |
| 814 | 3300025913 | Ga0207695_10000255 | Ga0207695_1000025585 | 530 |
| 815 | 3300025919 | Ga0207657_10000017 | Ga0207657_10000017113 | 530 |
| 816 | 3300025932 | Ga0207690_10000009 | Ga0207690_10000009206 | 530 |
| 817 | 3300025949 | Ga0207667_10022191 | Ga0207667_100221915 | 530 |
| 818 | 3300026067 | Ga0207678_10001300 | Ga0207678_1000130013 | 530 |
| 819 | 3300027312 | Ga0209371_1000128 | Ga0209371_10001288 | 530 |
| 820 | 3300028794 | Ga0307515_10098268 | Ga0307515_100982682 | 530 |
| 821 | 3300030500 | Ga0268256_1000152 | Ga0268256_100015276 | 530 |
| 822 | 3300031456 | Ga0307513_10002571 | Ga0307513_1000257119 | 530 |
| 823 | 3300044694 | Ga0466963_0008691 | Ga0466963_0008691_3235_4848 | 530 |
| 824 | 3300044735 | Ga0466968_0015285 | Ga0466968_0015285_210_1823 | 530 |
| 825 | 3300045049 | Ga0466959_0003452 | Ga0466959_0003452_6914_8527 | 530 |
| 826 | 3300046457 | Ga0495590_0001138 | Ga0495590_0001138_8019_9611 | 530 |
| 827 | 3300046529 | Ga0495652_0071817 | Ga0495652_0071817_587_2179 | 530 |
| 828 | 3300046542 | Ga0495597_0013073 | Ga0495597_0013073_1847_3439 | 530 |
| 829 | 3300046543 | Ga0495645_0013558 | Ga0495645_0013558_62_1654 | 530 |
| 830 | 3300046679 | Ga0495623_0039922 | Ga0495623_0039922_1099_2691 | 530 |
| 831 | 3300047323 | Ga0495683_0001826 | Ga0495683_0001826_5549_7141 | 530 |
| 832 | 3300048904 | Ga0496101_0011169 | Ga0496101_0011169_4229_5821 | 530 |
| 833 | 3300048905 | Ga0496102_0017869 | Ga0496102_0017869_3599_5191 | 530 |
| 834 | 3300048906 | Ga0496103_0001958 | Ga0496103_0001958_3769_5361 | 530 |
| 835 | 3300048910 | Ga0496107_0006509 | Ga0496107_0006509_5649_7241 | 530 |
| 836 | 3300048913 | Ga0496110_0005772 | Ga0496110_0005772_8053_9645 | 530 |
| 837 | 3300048915 | Ga0496112_0005092 | Ga0496112_0005092_4144_5736 | 530 |
| 838 | 3300048916 | Ga0496113_0005982 | Ga0496113_0005982_1562_3154 | 530 |
| 839 | 3300048918 | Ga0496115_0143225 | Ga0496115_0143225_147_1739 | 530 |
| 840 | 3300048920 | Ga0496117_0011016 | Ga0496117_0011016_1423_3015 | 530 |
| 841 | 3300048922 | Ga0496119_0075822 | Ga0496119_0075822_336_1928 | 530 |
| 842 | 3300048925 | Ga0496122_0004444 | Ga0496122_0004444_11916_13508 | 530 |
| 843 | 3300048927 | Ga0496124_0011004 | Ga0496124_0011004_3738_5330 | 530 |
| 844 | 3300048928 | Ga0496125_0005452 | Ga0496125_0005452_717_2309 | 530 |
| 845 | 3300048929 | Ga0496126_0126507 | Ga0496126_0126507_351_1943 | 530 |
| 846 | 3300049822 | Ga0501035_0031397 | Ga0501035_0031397_1577_3280 | 530 |
| 847 | iso_pu_bacteria | 2597490356 | 2599105070 | 530 |
| 848 | iso_pu_bacteria | 2757320392 | 2757569799 | 530 |
| 849 | iso_pu_bacteria | 2818991450 | 2819622916 | 530 |
| 850 | iso_pu_bacteria | 2846952575 | 2846955254 | 530 |
| 851 | iso_pu_bacteria | 2848858292 | 2848860974 | 530 |
| 852 | iso_pu_bacteria | 2928108538 | 2928113427 | 530 |
| 853 | iso_pu_bacteria | 2928135762 | 2928140586 | 530 |
| 854 | iso_pu_bacteria | 2928503688 | 2928507326 | 530 |
| 855 | 3300005548 | Ga0070665_100018024 | Ga0070665_1000180245 | 531 |
| 856 | 3300005841 | Ga0068863_100132868 | Ga0068863_1001328681 | 531 |
| 857 | 3300006237 | Ga0097621_100011117 | Ga0097621_1000111176 | 531 |
| 858 | 3300013297 | Ga0157378_10206315 | Ga0157378_102063151 | 531 |
| 859 | 3300026088 | Ga0207641_10040449 | Ga0207641_100404493 | 531 |
| 860 | 3300037471 | Ga0395905_0041876 | Ga0395905_0041876_677_2272 | 531 |
| 861 | iso_pu_bacteria | 2508501125 | 2509126608 | 531 |
| 862 | iso_pu_bacteria | 2511231002 | 2511245290 | 531 |
| 863 | iso_pu_bacteria | 2512047030 | 2512352480 | 531 |
| 864 | iso_pu_bacteria | 2513237082 | 2513556726 | 531 |
| 865 | iso_pu_bacteria | 2513237151 | 2513958107 | 531 |
| 866 | iso_pu_bacteria | 2513237166 | 2514046562 | 531 |
| 867 | iso_pu_bacteria | 2515154122 | 2515683697 | 531 |
| 868 | iso_pu_bacteria | 2526164713 | 2527075822 | 531 |
| 869 | iso_pu_bacteria | 2562617112 | 2563060483 | 531 |
| 870 | iso_pu_bacteria | 2711768613 | 2713475657 | 531 |
| 871 | iso_pu_bacteria | 2738541296 | 2738819387 | 531 |
| 872 | iso_pu_bacteria | 2738541298 | 2738831866 | 531 |
| 873 | iso_pu_bacteria | 2738541306 | 2738873394 | 531 |
| 874 | iso_pu_bacteria | 2738543002 | 2739185024 | 531 |
| 875 | iso_pu_bacteria | 2738543008 | 2739219993 | 531 |
| 876 | iso_pu_bacteria | 2791355137 | 2792833340 | 531 |
| 877 | iso_pu_bacteria | 2885270888 | 2885280020 | 531 |
| 878 | iso_pu_bacteria | 2900634093 | 2900639892 | 531 |
| 879 | iso_pu_bacteria | 2902682994 | 2902688551 | 531 |
| 880 | iso_pu_bacteria | 2904483920 | 2904490273 | 531 |
| 881 | iso_pu_bacteria | 2904615490 | 2904615840 | 531 |
| 882 | iso_pu_bacteria | 2919527303 | 2919533444 | 531 |
| 883 | iso_pu_bacteria | 2921643360 | 2921653896 | 531 |
| 884 | iso_pu_bacteria | 2945934425 | 2945940401 | 531 |
| 885 | iso_pu_bacteria | 2990703756 | 2990707529 | 531 |
| 886 | iso_pu_bacteria | 641736151 | 642423970 | 531 |
| 887 | iso_pu_bacteria | 642555112 | 642595766 | 531 |
| 888 | iso_pu_bacteria | 642555113 | 642617356 | 531 |
| 889 | iso_pu_bacteria | 8055266321 | 8055270940 | 531 |
| 890 | iso_pu_bacteria | 8055301274 | 8055307137 | 531 |
| 891 | iso_pu_bacteria | 8056875544 | 8056876278 | 531 |
| 892 | 3300002704 | JGI25155J39150_1000323 | JGI25155J39150_10003236 | 532 |
| 893 | 3300002738 | JGI25154J39366_1000657 | JGI25154J39366_100065710 | 532 |
| 894 | 3300002741 | JGI25157J39369_1000791 | JGI25157J39369_100079110 | 532 |
| 895 | 3300002987 | JGI25159J45721_1001213 | JGI25159J45721_10012139 | 532 |
| 896 | 3300003771 | Ga0055526_1003358 | Ga0055526_10033583 | 532 |
| 897 | 3300003771 | Ga0055526_1003566 | Ga0055526_10035668 | 532 |
| 898 | 3300003773 | Ga0055537_1000356 | Ga0055537_100035612 | 532 |
| 899 | 3300003775 | Ga0055524_1000213 | Ga0055524_100021321 | 532 |
| 900 | 3300003781 | Ga0055536_1005112 | Ga0055536_10051123 | 532 |
| 901 | 3300003781 | Ga0055536_1005115 | Ga0055536_10051153 | 532 |
| 902 | 3300003784 | Ga0055534_1001441 | Ga0055534_10014413 | 532 |
| 903 | 3300003790 | Ga0055528_1004586 | Ga0055528_10045862 | 532 |
| 904 | 3300003791 | Ga0055530_10000763 | Ga0055530_100007637 | 532 |
| 905 | 3300003791 | Ga0055530_10001299 | Ga0055530_1000129910 | 532 |
| 906 | 3300003792 | Ga0055540_1000504 | Ga0055540_100050422 | 532 |
| 907 | 3300005293 | Ga0065715_10125569 | Ga0065715_101255692 | 532 |
| 908 | 3300005328 | Ga0070676_10005120 | Ga0070676_100051205 | 532 |
| 909 | 3300005331 | Ga0070670_100002139 | Ga0070670_1000021394 | 532 |
| 910 | 3300005334 | Ga0068869_100000007 | Ga0068869_10000000716 | 532 |
| 911 | 3300005338 | Ga0068868_100018350 | Ga0068868_1000183502 | 532 |
| 912 | 3300005347 | Ga0070668_100005031 | Ga0070668_1000050318 | 532 |
| 913 | 3300005364 | Ga0070673_100007422 | Ga0070673_1000074223 | 532 |
| 914 | 3300005367 | Ga0070667_100001939 | Ga0070667_10000193911 | 532 |
| 915 | 3300005455 | Ga0070663_100134410 | Ga0070663_1001344102 | 532 |
| 916 | 3300005459 | Ga0068867_100005604 | Ga0068867_1000056047 | 532 |
| 917 | 3300005577 | Ga0068857_100000676 | Ga0068857_10000067616 | 532 |
| 918 | 3300005617 | Ga0068859_100003514 | Ga0068859_10000351414 | 532 |
| 919 | 3300005618 | Ga0068864_100001466 | Ga0068864_10000146620 | 532 |
| 920 | 3300005719 | Ga0068861_100001688 | Ga0068861_10000168815 | 532 |
| 921 | 3300005841 | Ga0068863_100014934 | Ga0068863_1000149343 | 532 |
| 922 | 3300005843 | Ga0068860_100005878 | Ga0068860_1000058787 | 532 |
| 923 | 3300005844 | Ga0068862_100002922 | Ga0068862_10000292213 | 532 |
| 924 | 3300006051 | Ga0075364_10007527 | Ga0075364_100075271 | 532 |
| 925 | 3300006931 | Ga0097620_100003514 | Ga0097620_10000351414 | 532 |
| 926 | 3300009177 | Ga0105248_10001664 | Ga0105248_1000166415 | 532 |
| 927 | 3300011119 | Ga0105246_10080402 | Ga0105246_100804022 | 532 |
| 928 | 3300013297 | Ga0157378_10030049 | Ga0157378_100300492 | 532 |
| 929 | 3300013308 | Ga0157375_10035782 | Ga0157375_100357823 | 532 |
| 930 | 3300014968 | Ga0157379_10000142 | Ga0157379_1000014249 | 532 |
| 931 | 3300025246 | Ga0209646_1000038 | Ga0209646_1000038123 | 532 |
| 932 | 3300025263 | Ga0209565_1000041 | Ga0209565_100004131 | 532 |
| 933 | 3300025263 | Ga0209565_1000333 | Ga0209565_100033311 | 532 |
| 934 | 3300025273 | Ga0209673_1000364 | Ga0209673_100036422 | 532 |
| 935 | 3300025284 | Ga0209130_1000708 | Ga0209130_100070821 | 532 |
| 936 | 3300025291 | Ga0209675_1003873 | Ga0209675_10038731 | 532 |
| 937 | 3300025291 | Ga0209675_1004518 | Ga0209675_10045183 | 532 |
| 938 | 3300025292 | Ga0209676_1000013 | Ga0209676_1000013266 | 532 |
| 939 | 3300025292 | Ga0209676_1002248 | Ga0209676_10022483 | 532 |
| 940 | 3300025294 | Ga0209025_1004718 | Ga0209025_10047185 | 532 |
| 941 | 3300025294 | Ga0209025_1009265 | Ga0209025_10092656 | 532 |
| 942 | 3300025294 | Ga0209025_1015698 | Ga0209025_10156984 | 532 |
| 943 | 3300025295 | Ga0209564_1000875 | Ga0209564_10008757 | 532 |
| 944 | 3300025295 | Ga0209564_1002543 | Ga0209564_10025438 | 532 |
| 945 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008266 | 532 |
| 946 | 3300025299 | Ga0209256_1000003 | Ga0209256_1000003135 | 532 |
| 947 | 3300025302 | Ga0207426_1003492 | Ga0207426_10034924 | 532 |
| 948 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005266 | 532 |
| 949 | 3300025304 | Ga0209257_1000048 | Ga0209257_1000048266 | 532 |
| 950 | 3300025304 | Ga0209257_1005759 | Ga0209257_10057595 | 532 |
| 951 | 3300025903 | Ga0207680_10016485 | Ga0207680_100164853 | 532 |
| 952 | 3300025907 | Ga0207645_10009537 | Ga0207645_100095373 | 532 |
| 953 | 3300025942 | Ga0207689_10000142 | Ga0207689_1000014234 | 532 |
| 954 | 3300025949 | Ga0207667_10096331 | Ga0207667_100963313 | 532 |
| 955 | 3300025972 | Ga0207668_10007922 | Ga0207668_100079225 | 532 |
| 956 | 3300025986 | Ga0207658_10018094 | Ga0207658_100180943 | 532 |
| 957 | 3300026023 | Ga0207677_10163746 | Ga0207677_101637461 | 532 |
| 958 | 3300026035 | Ga0207703_10000195 | Ga0207703_100001957 | 532 |
| 959 | 3300026089 | Ga0207648_10005172 | Ga0207648_1000517210 | 532 |
| 960 | 3300026095 | Ga0207676_10002462 | Ga0207676_1000246211 | 532 |
| 961 | 3300026118 | Ga0207675_100004037 | Ga0207675_10000403714 | 532 |
| 962 | 3300028380 | Ga0268265_10002425 | Ga0268265_100024256 | 532 |
| 963 | 3300028380 | Ga0268265_10099182 | Ga0268265_100991822 | 532 |
| 964 | 3300028381 | Ga0268264_10000606 | Ga0268264_1000060628 | 532 |
| 965 | 3300028794 | Ga0307515_10003849 | Ga0307515_1000384920 | 532 |
| 966 | 3300031456 | Ga0307513_10048134 | Ga0307513_100481344 | 532 |
| 967 | 3300031649 | Ga0307514_10004553 | Ga0307514_1000455312 | 532 |
| 968 | 3300048905 | Ga0496102_0020537 | Ga0496102_0020537_2923_4533 | 532 |
| 969 | 3300048929 | Ga0496126_0000965 | Ga0496126_0000965_22241_23848 | 532 |
| 970 | 3300050489 | nmdc:mga03683_8314_c1 | nmdc:mga03683_8314_c1_750_2354 | 532 |
| 971 | 3300053088 | Ga0500644_0000824 | Ga0500644_0000824_6595_8199 | 532 |
| 972 | 3300053730 | Ga0500645_000042 | Ga0500645_000042_102365_104056 | 532 |
| 973 | 3300055283 | Ga0500661_000314 | Ga0500661_000314_3394_5004 | 532 |
| 974 | iso_pu_bacteria | 2687453129 | 2687578957 | 532 |
| 975 | 3300005328 | Ga0070676_10067579 | Ga0070676_100675792 | 533 |
| 976 | 3300005331 | Ga0070670_100007600 | Ga0070670_1000076002 | 533 |
| 977 | 3300005331 | Ga0070670_100010144 | Ga0070670_1000101443 | 533 |
| 978 | 3300005334 | Ga0068869_100011980 | Ga0068869_1000119805 | 533 |
| 979 | 3300005347 | Ga0070668_100005135 | Ga0070668_1000051357 | 533 |
| 980 | 3300005347 | Ga0070668_100061481 | Ga0070668_1000614812 | 533 |
| 981 | 3300005364 | Ga0070673_100014047 | Ga0070673_1000140474 | 533 |
| 982 | 3300005365 | Ga0070688_100045766 | Ga0070688_1000457662 | 533 |
| 983 | 3300005367 | Ga0070667_100058752 | Ga0070667_1000587523 | 533 |
| 984 | 3300005441 | Ga0070700_100031085 | Ga0070700_1000310853 | 533 |
| 985 | 3300005457 | Ga0070662_100008004 | Ga0070662_1000080045 | 533 |
| 986 | 3300005459 | Ga0068867_100018855 | Ga0068867_1000188552 | 533 |
| 987 | 3300005618 | Ga0068864_100014538 | Ga0068864_1000145384 | 533 |
| 988 | 3300005840 | Ga0068870_10015499 | Ga0068870_100154992 | 533 |
| 989 | 3300005841 | Ga0068863_100008080 | Ga0068863_1000080802 | 533 |
| 990 | 3300005843 | Ga0068860_100011434 | Ga0068860_1000114343 | 533 |
| 991 | 3300005844 | Ga0068862_100016544 | Ga0068862_1000165443 | 533 |
| 992 | 3300006844 | Ga0075428_100054216 | Ga0075428_1000542162 | 533 |
| 993 | 3300006881 | Ga0068865_100111894 | Ga0068865_1001118942 | 533 |
| 994 | 3300013306 | Ga0163162_10047742 | Ga0163162_100477424 | 533 |
| 995 | 3300013308 | Ga0157375_10001469 | Ga0157375_100014697 | 533 |
| 996 | 3300014325 | Ga0163163_10001547 | Ga0163163_100015479 | 533 |
| 997 | 3300025923 | Ga0207681_10025853 | Ga0207681_100258533 | 533 |
| 998 | 3300025925 | Ga0207650_10016713 | Ga0207650_100167132 | 533 |
| 999 | 3300025925 | Ga0207650_10074523 | Ga0207650_100745232 | 533 |
| 1000 | 3300025926 | Ga0207659_10071265 | Ga0207659_100712652 | 533 |
| 1001 | 3300025933 | Ga0207706_10021471 | Ga0207706_100214712 | 533 |
| 1002 | 3300025940 | Ga0207691_10000111 | Ga0207691_1000011141 | 533 |
| 1003 | 3300025940 | Ga0207691_10035480 | Ga0207691_100354804 | 533 |
| 1004 | 3300025960 | Ga0207651_10008045 | Ga0207651_100080454 | 533 |
| 1005 | 3300026075 | Ga0207708_10026709 | Ga0207708_100267093 | 533 |
| 1006 | 3300026088 | Ga0207641_10006316 | Ga0207641_100063165 | 533 |
| 1007 | 3300026089 | Ga0207648_10016833 | Ga0207648_100168332 | 533 |
| 1008 | 3300026095 | Ga0207676_10001696 | Ga0207676_1000169612 | 533 |
| 1009 | 3300026095 | Ga0207676_10044252 | Ga0207676_100442523 | 533 |
| 1010 | 3300026121 | Ga0207683_10021988 | Ga0207683_100219883 | 533 |
| 1011 | 3300042876 | Ga0451577_0146198 | Ga0451577_0146198_159_1802 | 533 |
| 1012 | 3300046477 | Ga0495664_0058045 | Ga0495664_0058045_278_1879 | 533 |
| 1013 | 3300047319 | Ga0495674_0026569 | Ga0495674_0026569_1636_3237 | 533 |
| 1014 | 3300047443 | Ga0495687_000022 | Ga0495687_000022_6613_8214 | 533 |
| 1015 | 3300009011 | Ga0105251_10000498 | Ga0105251_100004986 | 534 |
| 1016 | 3300015262 | Ga0182007_10005970 | Ga0182007_100059703 | 534 |
| 1017 | 3300025735 | Ga0207713_1003310 | Ga0207713_10033106 | 534 |
| 1018 | 3300025904 | Ga0207647_10005725 | Ga0207647_100057253 | 534 |
| 1019 | 3300048921 | Ga0496118_0001660 | Ga0496118_0001660_18363_19967 | 534 |
| 1020 | 3300001979 | JGI24740J21852_10010600 | JGI24740J21852_100106003 | 535 |
| 1021 | 3300002075 | JGI24738J21930_10000994 | JGI24738J21930_100009946 | 535 |
| 1022 | 3300002705 | JGI25156J39149_1000542 | JGI25156J39149_100054215 | 535 |
| 1023 | 3300002705 | JGI25156J39149_1000553 | JGI25156J39149_10005537 | 535 |
| 1024 | 3300003214 | JGI25165J46597_1000508 | JGI25165J46597_10005085 | 535 |
| 1025 | 3300003756 | Ga0055533_1000188 | Ga0055533_100018832 | 535 |
| 1026 | 3300003758 | Ga0055532_1000069 | Ga0055532_1000069114 | 535 |
| 1027 | 3300003760 | Ga0055527_1000034 | Ga0055527_1000034114 | 535 |
| 1028 | 3300003761 | Ga0055535_1000049 | Ga0055535_1000049114 | 535 |
| 1029 | 3300003762 | Ga0055542_1000077 | Ga0055542_100007720 | 535 |
| 1030 | 3300003763 | Ga0055529_1000090 | Ga0055529_1000090113 | 535 |
| 1031 | 3300003763 | Ga0055529_1001109 | Ga0055529_100110912 | 535 |
| 1032 | 3300005327 | Ga0070658_10148830 | Ga0070658_101488301 | 535 |
| 1033 | 3300005339 | Ga0070660_100042870 | Ga0070660_1000428701 | 535 |
| 1034 | 3300005563 | Ga0068855_100067537 | Ga0068855_1000675373 | 535 |
| 1035 | 3300009093 | Ga0105240_10089219 | Ga0105240_100892192 | 535 |
| 1036 | 3300009177 | Ga0105248_10069635 | Ga0105248_100696355 | 535 |
| 1037 | 3300013306 | Ga0163162_10007957 | Ga0163162_1000795711 | 535 |
| 1038 | 3300016635 | Ga0183361_10002 | Ga0183361_10002407 | 535 |
| 1039 | 3300025225 | Ga0209566_102656 | Ga0209566_1026562 | 535 |
| 1040 | 3300025226 | Ga0209674_100139 | Ga0209674_10013920 | 535 |
| 1041 | 3300025226 | Ga0209674_100155 | Ga0209674_10015545 | 535 |
| 1042 | 3300025228 | Ga0209672_100002 | Ga0209672_1000021455 | 535 |
| 1043 | 3300025229 | Ga0209147_100003 | Ga0209147_1000031455 | 535 |
| 1044 | 3300025230 | Ga0209563_101073 | Ga0209563_1010735 | 535 |
| 1045 | 3300025231 | Ga0207427_100494 | Ga0207427_10049410 | 535 |
| 1046 | 3300025242 | Ga0209258_100077 | Ga0209258_100077110 | 535 |
| 1047 | 3300025254 | Ga0209148_1000006 | Ga0209148_10000061455 | 535 |
| 1048 | 3300025256 | Ga0209759_1000138 | Ga0209759_100013878 | 535 |
| 1049 | 3300025256 | Ga0209759_1000170 | Ga0209759_100017020 | 535 |
| 1050 | 3300025261 | Ga0209233_1000177 | Ga0209233_100017720 | 535 |
| 1051 | 3300025272 | Ga0209455_1000140 | Ga0209455_100014020 | 535 |
| 1052 | 3300025272 | Ga0209455_1000534 | Ga0209455_100053412 | 535 |
| 1053 | 3300025904 | Ga0207647_10008189 | Ga0207647_100081897 | 535 |
| 1054 | 3300025904 | Ga0207647_10021580 | Ga0207647_100215804 | 535 |
| 1055 | 3300025941 | Ga0207711_10057548 | Ga0207711_100575482 | 535 |
| 1056 | 3300025949 | Ga0207667_10000690 | Ga0207667_1000069038 | 535 |
| 1057 | 3300027312 | Ga0209371_1014361 | Ga0209371_10143612 | 535 |
| 1058 | 3300030500 | Ga0268256_1015923 | Ga0268256_10159232 | 535 |
| 1059 | 3300031911 | Ga0307412_10000166 | Ga0307412_1000016622 | 535 |
| 1060 | 3300046459 | Ga0495629_0011880 | Ga0495629_0011880_4636_6243 | 535 |
| 1061 | 3300046472 | Ga0495580_0076658 | Ga0495580_0076658_690_2297 | 535 |
| 1062 | 3300046500 | Ga0495596_0007099 | Ga0495596_0007099_160_1767 | 535 |
| 1063 | 3300046512 | Ga0495610_0000678 | Ga0495610_0000678_10382_11989 | 535 |
| 1064 | 3300046694 | Ga0495649_0001816 | Ga0495649_0001816_916_2523 | 535 |
| 1065 | 3300047323 | Ga0495683_0016234 | Ga0495683_0016234_494_2101 | 535 |
| 1066 | 3300047443 | Ga0495687_005628 | Ga0495687_005628_5919_7526 | 535 |
| 1067 | 3300047472 | Ga0495686_0000002 | Ga0495686_0000002_821975_823582 | 535 |
| 1068 | 3300047472 | Ga0495686_0079555 | Ga0495686_0079555_307_1914 | 535 |
| 1069 | 3300048909 | Ga0496106_0000016 | Ga0496106_0000016_113045_114655 | 535 |
| 1070 | 3300048920 | Ga0496117_0009987 | Ga0496117_0009987_6455_8062 | 535 |
| 1071 | 3300048921 | Ga0496118_0026013 | Ga0496118_0026013_1103_2710 | 535 |
| 1072 | 3300048924 | Ga0496121_0013461 | Ga0496121_0013461_1970_3580 | 535 |
| 1073 | 3300048927 | Ga0496124_0093714 | Ga0496124_0093714_172_1782 | 535 |
| 1074 | 3300049822 | Ga0501035_0006648 | Ga0501035_0006648_1334_2944 | 535 |
| 1075 | 3300049823 | Ga0501044_0000185 | Ga0501044_0000185_50577_52187 | 535 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5u4o-assembly1.cif.gz_A-2 | a 2.05a x-ray structureof a bacterial extracellular solute-binding protein, family 5 for bacillus anthracis str. ames | 0.9164 | 33 | 534 |
| 5u4o-assembly1.cif.gz_A-2 | a 2.05a x-ray structureof a bacterial extracellular solute-binding protein, family 5 for bacillus anthracis str. ames | 0.9146 | 33 | 534 |
| 6i3g-assembly1.cif.gz_A | crystal structure of a putative peptide binding protein appa from clostridium difficile | 0.8922 | 37 | 534 |
| 6i3g-assembly1.cif.gz_A | crystal structure of a putative peptide binding protein appa from clostridium difficile | 0.8869 | 37 | 534 |
| 1uqw-assembly2.cif.gz_B | crystal structure of ylib protein from escherichia coi | 0.8773 | 33 | 534 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qfkA03 | Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 | 0.9011 | 287 | 503 | 3.10.105.10 |
| 5f1qB03 | Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 | 0.8945 | 286 | 502 | 3.10.105.10 |
| 4oeuB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8935 | 203 | 288 | 3.40.190.10 |
| 3tpaA03 | Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 | 0.8923 | 287 | 503 | 3.10.105.10 |
| 4qfkA03 | Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 | 0.8895 | 287 | 503 | 3.10.105.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529HN05-F1-model_v4 | ABC transporter substrate-binding protein | 0.9936 | 295 | 426 |
GO:0015833
GO:1904680 |
| AF-A0A211ZN59-F1-model_v4 | Peptide ABC transporter substrate-binding protein | 0.9757 | 28 | 533 |
GO:0015833
GO:0030288 GO:0043190 GO:1904680 |
| AF-A0A2W7QIK8-F1-model_v4 | Peptide/nickel transport system substrate-binding protein | 0.9747 | 23 | 534 |
GO:0015833
GO:0030288 GO:0043190 GO:1904680 |
| AF-A0A4Q2XGR4-F1-model_v4 | deleted | 0.9732 | 92 | 534 |
|
| AF-A0A529NRT9-F1-model_v4 | ABC transporter substrate-binding protein | 0.9703 | 270 | 464 |
GO:0015031
GO:0015833 GO:0030313 GO:1904680 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar