F489570

General Info

Members Datasets Scaffolds Average Seq Length
1075 662 667 528

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0031397|Ga0501035_0031397_1577_3280
Length 567
Sequence MFMAPFPNPEWTRTPLGDEIDCTHVSNTSKKGERGVMNPFKIMGLAVAALFAAYVPAFAATPADTVVIADKIDDIVSLDPAESFEFSGNDALNNVYDRLIEIDPATMKLKPGLAESWSVADDGKTYTFKIRQGVKFHSGNPVTAEDCAWSLQRAVKLNKTPAFILTQFGFTPQNVDQMIKANGDAELQITTDKSYAPSFFYNILTAIVASVVDKKEALSHEENGDMGYNWLKTHSAASGPFMLRAWKPNDSLVLEKPEGFDYFNGKVAMRRIYVRHVPESSAQRLLLEKGDIDIARKLTPGDVEAVSKSPDIKIKEEVRGRIFYVAGNQKVEALAKPKVMEAIKYAIDYDGMVNSFLKGQMKVHQSFLPEGFLGAIDDNPYKLDIDKAKALLKEAGYPDGLDLTLWVRNDQQRLDMAQSIQATLGQAGIKITLKTGTGSEILGDFRARKQQLILEAWGPDYPDPQTNASTFASNANNSDEAKLTGVLAWRTAWDAKETTPMVEAAVVEKDSDKRAKMYEDMQRKMQKEAPFAWMFQEVAQTAIRKNVNGFGAGGALSSAFYWPVTKE

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
12 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
13 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
14 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
15 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
19 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
20 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
21 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
22 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
23 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
24 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
25 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
26 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
27 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
28 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
29 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
30 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
31 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
32 2516143018 Ensifer sp. BR816 Isolate Nodule
33 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
34 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
35 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
36 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
37 2519103095 Burkholderia sp. KJ006 Isolate Nodule
38 2519899620 Rhizobium sp. Pop5 Isolate Nodule
39 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
40 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
41 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
42 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
43 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
44 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
45 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
46 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
47 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
48 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
49 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
50 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
51 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
52 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
53 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
54 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
55 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
56 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
57 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
58 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
59 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
60 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
61 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
62 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
63 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
64 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
65 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
66 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
67 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
68 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
69 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
70 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
71 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
72 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
73 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
74 2643221582 Rhizobium sp. Root651 Isolate Unclassified
75 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
76 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
77 2643221693 Rhizobium sp. Root491 Isolate Unclassified
78 2643221718 Rhizobium sp. Root268 Isolate Unclassified
79 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
80 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
81 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
82 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
83 2718217882 Rhizobium sp. N741 Isolate Nodule
84 2718217927 Rhizobium sp. N324 Isolate Nodule
85 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
86 2718218009 Rhizobium sp. N561 Isolate Nodule
87 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
88 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
89 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
90 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
91 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
92 2718218363 Rhizobium sp. N113 Isolate Nodule
93 2718218365 Rhizobium sp. N731 Isolate Nodule
94 2718218366 Rhizobium sp. N621 Isolate Nodule
95 2718218423 Rhizobium sp. N941 Isolate Nodule
96 2721755514 Rhizobium sp. N6212 Isolate Nodule
97 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
98 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
99 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
100 2721755809 Rhizobium sp. N541 Isolate Nodule
101 2721755810 Rhizobium sp. N871 Isolate Nodule
102 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
103 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
104 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
105 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
106 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
107 2728369365 Rhizobium sp. N1341 Isolate Nodule
108 2728369397 Rhizobium sp. N1314 Isolate Nodule
109 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
110 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
111 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
112 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
113 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
114 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
115 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
116 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
117 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
118 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
119 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
120 2773857925 Microvirga vignae BR3299 Isolate Unclassified
121 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
122 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
123 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
124 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
125 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
126 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
127 2791355256 Rhizobium sp. M10 Isolate Nodule
128 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
129 2791355260 Rhizobium sp. L9 Isolate Nodule
130 2791355261 Rhizobium sp. J15 Isolate Nodule
131 2791355262 Rhizobium sp. M1 Isolate Nodule
132 2791355263 Rhizobium chutanense C5 Isolate Nodule
133 2791355264 Rhizobium sp. S9 Isolate Nodule
134 2791355265 Rhizobium sp. H4 Isolate Nodule
135 2791355266 Rhizobium sp. L43 Isolate Nodule
136 2791355267 Rhizobium sp. L18 Isolate Nodule
137 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
138 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
139 2802429633 Rhizobium anhuiense J3 Isolate Nodule
140 2802429634 Rhizobium anhuiense S10 Isolate Nodule
141 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
142 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
143 2802429637 Rhizobium anhuiense C15 Isolate Nodule
144 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
145 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
146 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
147 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
148 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
149 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
150 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
151 2818991450 Burkholderia sp. 604 Isolate Unclassified
152 2818991452 Burkholderia cepacia 561 Isolate Unclassified
153 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
154 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
155 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
156 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
157 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
158 2838048938 Rhizobium pisi 27/80 Isolate Nodule
159 2838061910 Rhizobium phaseoli L15 Isolate Nodule
160 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
161 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
162 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
163 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
164 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
165 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
166 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
167 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
168 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
169 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
170 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
171 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
172 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
173 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
174 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
175 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
176 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
177 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
178 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
179 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
180 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
181 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
182 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
183 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
184 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
185 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
186 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
187 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
188 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
189 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
190 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
191 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
192 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
193 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
194 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
195 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
196 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
197 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
198 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
199 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
200 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
201 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
202 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
203 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
204 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
205 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
206 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
207 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
208 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
209 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
210 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
211 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
212 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
213 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
214 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
215 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
216 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
217 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
218 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
219 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
220 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
221 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
222 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
223 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
224 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
225 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
226 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
227 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
228 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
229 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
230 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
231 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
232 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
233 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
234 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
235 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
236 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
237 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
238 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
239 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
240 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
241 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
242 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
243 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
244 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
245 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
246 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
247 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
248 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
249 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
250 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
251 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
252 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
253 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
254 2904564687 Burkholderia sp. 571 Isolate Unclassified
255 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
256 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
257 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
258 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
259 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
260 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
261 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
262 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
263 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
264 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
265 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
266 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
267 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
268 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
269 2928163908 Burkholderia sp. 567 Isolate Unclassified
270 2928170801 Burkholderia sp. 572 Isolate Unclassified
271 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
272 2928536128 Burkholderia sola 565 Isolate Unclassified
273 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
274 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
275 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
276 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
277 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
278 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
279 2933599457 Rhizobium phaseoli M3 Isolate Nodule
280 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
281 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
282 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
283 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
284 2936381700 Rhizobium chutanense C16 Isolate Unclassified
285 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
286 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
287 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
288 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
289 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
290 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
291 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
292 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
293 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
294 2996893221 Rhizobium sp. R635 Isolate Nodule
295 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
296 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
297 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
298 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
299 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
300 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
301 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
302 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
303 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
304 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
305 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
306 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
307 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
308 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
309 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
310 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
311 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
312 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
313 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
314 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
315 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
316 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
317 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
318 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
319 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
320 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
321 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
322 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
323 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
324 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
325 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
326 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
327 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
328 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
329 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
330 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
331 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
332 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
333 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
334 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
335 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
336 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
337 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
338 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
339 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
340 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
341 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
342 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
343 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
344 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
345 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
346 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
347 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
348 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
349 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
350 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
351 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
352 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
353 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
354 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
355 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
356 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
357 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
358 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
359 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
360 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
361 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
362 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
363 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
364 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
365 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
366 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
367 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
368 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
369 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
370 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
371 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
372 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
373 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
374 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
375 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
376 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
377 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
378 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
379 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
380 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
381 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
382 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
383 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
384 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
385 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
386 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
387 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
388 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
389 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
390 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
391 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
392 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
393 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
394 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
395 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
396 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
397 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
398 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
399 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
400 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
401 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
402 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
403 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
404 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
405 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
406 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
407 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
408 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
409 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
410 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
411 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
412 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
413 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
414 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
415 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
416 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
417 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
418 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
419 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
420 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
421 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
422 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
423 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
424 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
425 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
426 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
427 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
428 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
429 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
430 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
431 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
432 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
433 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
434 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
435 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
462 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
463 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
465 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
466 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
467 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
469 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
470 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
471 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
472 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
473 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
474 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
475 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
476 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
477 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
478 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
479 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
480 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
481 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
482 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
483 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
484 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
485 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
486 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
487 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
488 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
489 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
490 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
491 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
492 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
493 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
494 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
495 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
496 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
497 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
498 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
499 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
500 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
501 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
502 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
503 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
504 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
505 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
506 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
507 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
508 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
509 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
510 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
511 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
512 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
513 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
514 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
515 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
516 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
517 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
518 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
519 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
520 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
521 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
522 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
523 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
524 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
525 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
526 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
527 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
528 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
529 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
530 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
531 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
532 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
533 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
534 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
535 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
536 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
537 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
538 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
539 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
540 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
541 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
542 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
543 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
544 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
545 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
546 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
547 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
548 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
549 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
550 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
551 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
552 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
553 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
554 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
555 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
556 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
557 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
558 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
559 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
560 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
561 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
562 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
563 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
564 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
565 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
566 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
567 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
568 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
569 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
570 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
571 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
572 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
573 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
574 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
575 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
576 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
577 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
578 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
579 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
580 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
581 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
582 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
583 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
584 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
585 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
586 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
587 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
588 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
589 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
590 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
591 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
592 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
593 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
594 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
595 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
596 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
597 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
598 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
599 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
600 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
601 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
602 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
603 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
604 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
605 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
606 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
607 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
608 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
609 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
610 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
611 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
612 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
613 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
614 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
615 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
616 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
617 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
618 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
619 8005258706 Rhizobium sp. R693 Isolate Nodule
620 8005275841 Rhizobium sp. N4311 Isolate Nodule
621 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
622 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
623 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
624 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
625 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
626 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
627 8005382845 Rhizobium sp. R634 Isolate Nodule
628 8005395548 Rhizobium sp. R339 Isolate Nodule
629 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
630 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
631 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
632 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
633 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
634 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
635 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
636 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
637 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
638 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
639 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
640 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
641 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
642 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
643 8018176218 Rhizobium sp. N122 Isolate Nodule
644 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
645 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
646 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
647 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
648 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
649 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
650 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
651 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
652 8024501048 Rhizobium sp. H4 Isolate Nodule
653 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
654 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
655 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
656 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
657 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
658 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
659 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
660 8056382006 Rhizobium croatiense 13T Isolate Nodule
661 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
662 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.72
Metatranscriptomes 0
Isolates 36.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 23.16
Nodule 20.19
Rhizoplane 3.44
Rhizosphere 36
Stem 0
Stem Tuber 0
Unclassified 16.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010600 3300001979 Bacteria 3541
2 JGI24735J21928_10004245 3300002067 Bacteria 4832
3 JGI24735J21928_10011784 3300002067 Bacteria 2769
4 JGI24738J21930_10000994 3300002075 Bacteria 8127
5 JGI25155J39150_1000021 3300002704 Bacteria 150730
6 JGI25155J39150_1000323 3300002704 Bacteria 16055
7 JGI25156J39149_1000022 3300002705 Bacteria 150730
8 JGI25156J39149_1000542 3300002705 Bacteria 21695
9 JGI25156J39149_1000553 3300002705 Bacteria 21412
10 JGI25156J39149_1000666 3300002705 Bacteria 18714
11 JGI25156J39149_1000897 3300002705 Bacteria 14652
12 JGI25154J39366_1000048 3300002738 Bacteria 126252
13 JGI25154J39366_1000657 3300002738 Bacteria 16151
14 JGI25158J39367_1001429 3300002739 Bacteria 4186
15 JGI25157J39369_1000025 3300002741 Bacteria 150726
16 JGI25157J39369_1000791 3300002741 Bacteria 16148
17 JGI25152J39213_1001761 3300002773 Bacteria 8823
18 JGI25152J39213_1002623 3300002773 Bacteria 6688
19 JGI25152J39213_1011838 3300002773 Bacteria 1906
20 JGI25150J39212_1004051 3300002774 Bacteria 3318
21 JGI25159J45721_1000407 3300002987 Bacteria 19965
22 JGI25159J45721_1001213 3300002987 Bacteria 10935
23 JGI25159J45721_1001463 3300002987 Bacteria 9739
24 JGI25151J46595_10000143 3300003187 Bacteria 95160
25 JGI25151J46595_10003498 3300003187 Bacteria 8666
26 JGI25151J46595_10020879 3300003187 Bacteria 2751
27 JGI25165J46597_1000508 3300003214 Bacteria 37207
28 JGI25153J46596_10003267 3300003215 Bacteria 9113
29 JGI25153J46596_10004883 3300003215 Bacteria 7129
30 JGI25153J46596_10009989 3300003215 Bacteria 4337
31 JGI25153J46596_10017391 3300003215 Bacteria 2833
32 JGI25153J46596_10027568 3300003215 Bacteria 1987
33 rootH2_10017840 3300003320 Bacteria 4868
34 rootH2_10048674 3300003320 Bacteria 5572
35 rootL2_10017323 3300003322 Bacteria 6871
36 rootL2_10034586 3300003322 Bacteria 6634
37 rootH1_10138215 3300003323 Bacteria 3757
38 rootH1_10157577 3300003323 Bacteria 3692
39 rootH1_10345004 3300003323 Bacteria 2373
40 JGI25160J50197_1000172 3300003354 Bacteria 55781
41 JGI25160J50197_1001141 3300003354 Bacteria 13584
42 JGI25160J50197_1001510 3300003354 Bacteria 11568
43 JGI25160J50197_1002009 3300003354 Bacteria 9705
44 JGI25161J50226_1000007 3300003374 Bacteria 256181
45 JGI25161J50226_1000119 3300003374 Bacteria 58009
46 Ga0055533_1000188 3300003756 Bacteria 51375
47 Ga0055532_1000069 3300003758 Bacteria 138614
48 Ga0055532_1000743 3300003758 Bacteria 11887
49 Ga0055532_1001039 3300003758 Bacteria 8594
50 Ga0055527_1000034 3300003760 Bacteria 138614
51 Ga0055527_1000643 3300003760 Bacteria 10622
52 Ga0055527_1002267 3300003760 Bacteria 3357
53 Ga0055535_1000049 3300003761 Bacteria 138835
54 Ga0055535_1001039 3300003761 Bacteria 17502
55 Ga0055535_1001609 3300003761 Bacteria 10622
56 Ga0055542_1000077 3300003762 Bacteria 138614
57 Ga0055542_1001029 3300003762 Bacteria 17502
58 Ga0055542_1002338 3300003762 Bacteria 6505
59 Ga0055529_1000090 3300003763 Bacteria 138416
60 Ga0055529_1000861 3300003763 Bacteria 17502
61 Ga0055529_1001109 3300003763 Bacteria 11958
62 Ga0055529_1003258 3300003763 Bacteria 2748
63 Ga0055526_1000483 3300003771 Bacteria 31566
64 Ga0055526_1003358 3300003771 Bacteria 10218
65 Ga0055526_1003566 3300003771 Bacteria 9799
66 Ga0055526_1008055 3300003771 Bacteria 5323
67 Ga0055537_1000356 3300003773 Bacteria 31055
68 Ga0055524_1000213 3300003775 Bacteria 61225
69 Ga0055524_1005603 3300003775 Bacteria 5576
70 Ga0055524_1010867 3300003775 Bacteria 3596
71 Ga0055536_1002551 3300003781 Bacteria 10178
72 Ga0055536_1003731 3300003781 Bacteria 8072
73 Ga0055536_1005112 3300003781 Bacteria 6494
74 Ga0055536_1005115 3300003781 Bacteria 6493
75 Ga0055534_1001441 3300003784 Bacteria 9464
76 Ga0055528_1000106 3300003790 Bacteria 67208
77 Ga0055528_1002706 3300003790 Bacteria 9314
78 Ga0055528_1003757 3300003790 Bacteria 7489
79 Ga0055528_1004586 3300003790 Bacteria 6618
80 Ga0055528_1005284 3300003790 Bacteria 6046
81 Ga0055528_1006282 3300003790 Bacteria 5405
82 Ga0055528_1015996 3300003790 Bacteria 2678
83 Ga0055530_10000763 3300003791 Bacteria 26793
84 Ga0055530_10001299 3300003791 Bacteria 18844
85 Ga0055540_1000103 3300003792 Bacteria 94710
86 Ga0055540_1000504 3300003792 Bacteria 29761
87 Ga0055540_1000919 3300003792 Bacteria 19209
88 Ga0055531_10000857 3300003794 Bacteria 24966
89 Ga0055531_10003817 3300003794 Bacteria 9448
90 Ga0058692_1001653 3300003856 Bacteria 7999
91 Ga0058692_1010442 3300003856 Bacteria 2293
92 Ga0055543_1000492 3300004625 Bacteria 22827
93 Ga0055543_1003014 3300004625 Bacteria 5206
94 Ga0065165_1000617 3300005262 Bacteria 51627
95 Ga0065165_1007234 3300005262 Bacteria 5523
96 Ga0065715_10125569 3300005293 Bacteria 2128
97 Ga0070658_10086424 3300005327 Bacteria 2580
98 Ga0070658_10148830 3300005327 Bacteria 1959
99 Ga0070676_10005120 3300005328 Bacteria 6956
100 Ga0070676_10067579 3300005328 Bacteria 2137
101 Ga0070670_100002139 3300005331 Bacteria 16217
102 Ga0070670_100007600 3300005331 Bacteria 9204
103 Ga0070670_100010144 3300005331 Bacteria 8036
104 Ga0068869_100000007 3300005334 Bacteria 78820
105 Ga0068869_100011980 3300005334 Bacteria 5708
106 Ga0070666_10052478 3300005335 Bacteria 2748
107 Ga0068868_100018350 3300005338 Bacteria 5231
108 Ga0070660_100000013 3300005339 Bacteria 116814
109 Ga0070660_100004148 3300005339 Bacteria 10008
110 Ga0070660_100042870 3300005339 Bacteria 3455
111 Ga0070668_100005031 3300005347 Bacteria 9790
112 Ga0070668_100005135 3300005347 Bacteria 9706
113 Ga0070668_100021570 3300005347 Bacteria 4867
114 Ga0070668_100061481 3300005347 Bacteria 2910
115 Ga0070669_100024859 3300005353 Bacteria 4299
116 Ga0070673_100007422 3300005364 Bacteria 7227
117 Ga0070673_100014047 3300005364 Bacteria 5561
118 Ga0070688_100045766 3300005365 Bacteria 2706
119 Ga0070659_100000028 3300005366 Bacteria 140665
120 Ga0070667_100001939 3300005367 Bacteria 18351
121 Ga0070667_100058752 3300005367 Bacteria 3252
122 Ga0070667_100116288 3300005367 Bacteria 2323
123 Ga0070713_100012418 3300005436 Bacteria 6247
124 Ga0070700_100031085 3300005441 Bacteria 3196
125 Ga0070663_100001036 3300005455 Bacteria 15176
126 Ga0070663_100046701 3300005455 Bacteria 3065
127 Ga0070663_100134410 3300005455 Bacteria 1882
128 Ga0070662_100008004 3300005457 Bacteria 6878
129 Ga0068867_100005604 3300005459 Bacteria 8896
130 Ga0068867_100018855 3300005459 Bacteria 4909
131 Ga0070665_100018024 3300005548 Bacteria 7086
132 Ga0068855_100022253 3300005563 Bacteria 7596
133 Ga0068855_100067537 3300005563 Bacteria 4164
134 Ga0068857_100000676 3300005577 Bacteria 25307
135 Ga0068856_100040417 3300005614 Bacteria 4581
136 Ga0068852_100012681 3300005616 Bacteria 6412
137 Ga0068859_100003514 3300005617 Bacteria 15961
138 Ga0068864_100001466 3300005618 Bacteria 19448
139 Ga0068864_100014538 3300005618 Bacteria 6540
140 Ga0068861_100001688 3300005719 Bacteria 14166
141 Ga0068870_10015499 3300005840 Bacteria 3617
142 Ga0068863_100008080 3300005841 Bacteria 10275
143 Ga0068863_100014934 3300005841 Bacteria 7459
144 Ga0068863_100132868 3300005841 Bacteria 2376
145 Ga0068860_100005878 3300005843 Bacteria 12351
146 Ga0068860_100011434 3300005843 Bacteria 8744
147 Ga0068862_100002922 3300005844 Bacteria 14933
148 Ga0068862_100016544 3300005844 Bacteria 6141
149 Ga0081455_10107414 3300005937 Bacteria 2225
150 Ga0075365_10001384 3300006038 Bacteria 10914
151 Ga0075365_10015773 3300006038 Bacteria 4576
152 Ga0075363_100021412 3300006048 Bacteria 3256
153 Ga0075363_100034542 3300006048 Bacteria 2640
154 Ga0075364_10000058 3300006051 Bacteria 41383
155 Ga0075364_10000212 3300006051 Bacteria 27340
156 Ga0075364_10007527 3300006051 Bacteria 6472
157 Ga0075364_10020347 3300006051 Bacteria 4173
158 Ga0075362_10002938 3300006177 Bacteria 5848
159 Ga0075362_10010457 3300006177 Bacteria 3624
160 Ga0075362_10016569 3300006177 Bacteria 3020
161 Ga0075367_10002340 3300006178 Bacteria 8628
162 Ga0075367_10008133 3300006178 Bacteria 5416
163 Ga0075367_10017248 3300006178 Bacteria 3960
164 Ga0075367_10030197 3300006178 Bacteria 3106
165 Ga0075369_10012793 3300006186 Bacteria 3318
166 Ga0075366_10003686 3300006195 Bacteria 8128
167 Ga0097621_100011117 3300006237 Bacteria 6621
168 Ga0075370_10009495 3300006353 Bacteria 5055
169 Ga0075370_10018094 3300006353 Bacteria 3818
170 Ga0075370_10039503 3300006353 Bacteria 2659
171 Ga0075428_100054216 3300006844 Bacteria 4394
172 Ga0068865_100111894 3300006881 Bacteria 2015
173 Ga0097620_100003514 3300006931 Bacteria 15961
174 Ga0099826_10000047 3300006948 Bacteria 74994
175 Ga0099826_10008443 3300006948 Bacteria 7663
176 Ga0105251_10000167 3300009011 Bacteria 67775
177 Ga0105251_10000498 3300009011 Bacteria 37201
178 Ga0105244_10024403 3300009036 Bacteria 3301
179 Ga0105240_10008156 3300009093 Bacteria 15019
180 Ga0105240_10089219 3300009093 Bacteria 3771
181 Ga0105240_10097281 3300009093 Bacteria 3587
182 Ga0105240_10226211 3300009093 Bacteria 2177
183 Ga0105243_10009057 3300009148 Bacteria 7603
184 Ga0105248_10001664 3300009177 Bacteria 24713
185 Ga0105248_10069122 3300009177 Bacteria 3965
186 Ga0105248_10069635 3300009177 Bacteria 3950
187 Ga0105248_10215836 3300009177 Bacteria 2161
188 Ga0105237_10039816 3300009545 Bacteria 4742
189 Ga0105237_10050555 3300009545 Bacteria 4177
190 Ga0105238_10024386 3300009551 Bacteria 6166
191 Ga0105238_10054000 3300009551 Bacteria 4037
192 Ga0105238_10163320 3300009551 Bacteria 2203
193 Ga0105249_10151297 3300009553 Bacteria 2234
194 Ga0123341_1000095 3300009765 Bacteria 37499
195 Ga0123342_1022517 3300009766 Bacteria 4253
196 Ga0105239_10003889 3300010375 Bacteria 18095
197 Ga0105239_10079545 3300010375 Bacteria 3607
198 Ga0105246_10080402 3300011119 Bacteria 2320
199 Ga0105246_10104329 3300011119 Bacteria 2070
200 Ga0157373_10013144 3300013100 Bacteria 6078
201 Ga0157371_10000005 3300013102 Bacteria 416456
202 Ga0157369_10012773 3300013105 Bacteria 9523
203 Ga0157374_10000749 3300013296 Bacteria 28318
204 Ga0157378_10030049 3300013297 Bacteria 4800
205 Ga0157378_10206315 3300013297 Bacteria 1861
206 Ga0163162_10002290 3300013306 Bacteria 17975
207 Ga0163162_10007957 3300013306 Bacteria 10334
208 Ga0163162_10047742 3300013306 Bacteria 4290
209 Ga0157375_10001469 3300013308 Bacteria 20277
210 Ga0157375_10035782 3300013308 Bacteria 4743
211 Ga0163163_10001547 3300014325 Bacteria 19382
212 Ga0157379_10000142 3300014968 Bacteria 51727
213 Ga0182007_10005970 3300015262 Bacteria 5281
214 Ga0182005_1003552 3300015265 Bacteria 5262
215 Ga0183361_10002 3300016635 Bacteria 907642
216 Ga0209435_100019 3300025206 Bacteria 260989
217 Ga0209435_100033 3300025206 Bacteria 150395
218 Ga0209436_100017 3300025208 Bacteria 116238
219 Ga0209436_103175 3300025208 Bacteria 4490
220 Ga0209566_100293 3300025225 Bacteria 45453
221 Ga0209566_101869 3300025225 Bacteria 4725
222 Ga0209566_102656 3300025225 Bacteria 3146
223 Ga0209674_100139 3300025226 Bacteria 110389
224 Ga0209674_100155 3300025226 Bacteria 91885
225 Ga0209674_102069 3300025226 Bacteria 4569
226 Ga0209672_100002 3300025228 Bacteria 1733325
227 Ga0209672_100067 3300025228 Bacteria 180819
228 Ga0209672_100079 3300025228 Bacteria 156875
229 Ga0209672_100431 3300025228 Bacteria 24301
230 Ga0209147_100003 3300025229 Bacteria 1733325
231 Ga0209147_100012 3300025229 Bacteria 681990
232 Ga0209147_100061 3300025229 Bacteria 248809
233 Ga0209147_100107 3300025229 Bacteria 156875
234 Ga0209563_101073 3300025230 Bacteria 7890
235 Ga0207427_100494 3300025231 Bacteria 21083
236 Ga0209258_100077 3300025242 Bacteria 264510
237 Ga0209258_100107 3300025242 Bacteria 206572
238 Ga0209258_100273 3300025242 Bacteria 87726
239 Ga0207425_1000475 3300025245 Bacteria 25473
240 Ga0209646_1000038 3300025246 Bacteria 353982
241 Ga0209646_1000116 3300025246 Bacteria 150395
242 Ga0209026_1000048 3300025250 Bacteria 257264
243 Ga0209026_1000103 3300025250 Bacteria 152843
244 Ga0209148_1000006 3300025254 Bacteria 1733325
245 Ga0209148_1000022 3300025254 Bacteria 681990
246 Ga0209148_1001754 3300025254 Bacteria 9368
247 Ga0209759_1000028 3300025256 Bacteria 298755
248 Ga0209759_1000038 3300025256 Bacteria 257264
249 Ga0209759_1000105 3300025256 Bacteria 150395
250 Ga0209759_1000138 3300025256 Bacteria 125136
251 Ga0209759_1000170 3300025256 Bacteria 110023
252 Ga0209759_1005034 3300025256 Bacteria 4747
253 Ga0209129_1000474 3300025258 Bacteria 29449
254 Ga0209129_1000690 3300025258 Bacteria 22130
255 Ga0209129_1001388 3300025258 Bacteria 13539
256 Ga0209129_1002928 3300025258 Bacteria 7823
257 Ga0209233_1000177 3300025261 Bacteria 141716
258 Ga0209565_1000041 3300025263 Bacteria 251081
259 Ga0209565_1000333 3300025263 Bacteria 42094
260 Ga0209455_1000024 3300025272 Bacteria 676133
261 Ga0209455_1000140 3300025272 Bacteria 138610
262 Ga0209455_1000300 3300025272 Bacteria 51031
263 Ga0209455_1000534 3300025272 Bacteria 26400
264 Ga0209673_1000021 3300025273 Bacteria 422978
265 Ga0209673_1000139 3300025273 Bacteria 157765
266 Ga0209673_1000364 3300025273 Bacteria 81319
267 Ga0209673_1004415 3300025273 Bacteria 7550
268 Ga0209673_1004743 3300025273 Bacteria 7150
269 Ga0209673_1005362 3300025273 Bacteria 6477
270 Ga0209673_1005469 3300025273 Bacteria 6370
271 Ga0209130_1000001 3300025284 Bacteria 831557
272 Ga0209130_1000160 3300025284 Bacteria 100965
273 Ga0209130_1000245 3300025284 Bacteria 68668
274 Ga0209130_1000708 3300025284 Bacteria 29740
275 Ga0209130_1008625 3300025284 Bacteria 2989
276 Ga0209675_1003873 3300025291 Bacteria 6883
277 Ga0209675_1004518 3300025291 Bacteria 6160
278 Ga0209676_1000013 3300025292 Bacteria 816080
279 Ga0209676_1002248 3300025292 Bacteria 14263
280 Ga0209676_1005029 3300025292 Bacteria 7075
281 Ga0209676_1017127 3300025292 Bacteria 2579
282 Ga0209676_1019932 3300025292 Bacteria 2293
283 Ga0209025_1000237 3300025294 Bacteria 128553
284 Ga0209025_1000299 3300025294 Bacteria 110988
285 Ga0209025_1002369 3300025294 Bacteria 20182
286 Ga0209025_1004718 3300025294 Bacteria 11627
287 Ga0209025_1004937 3300025294 Bacteria 11205
288 Ga0209025_1009265 3300025294 Bacteria 6894
289 Ga0209025_1012206 3300025294 Bacteria 5538
290 Ga0209025_1015698 3300025294 Bacteria 4540
291 Ga0209025_1022011 3300025294 Bacteria 3403
292 Ga0209564_1000331 3300025295 Bacteria 91919
293 Ga0209564_1000875 3300025295 Bacteria 40039
294 Ga0209564_1002543 3300025295 Bacteria 14056
295 Ga0209564_1002675 3300025295 Bacteria 13524
296 Ga0209564_1003092 3300025295 Bacteria 11781
297 Ga0209564_1003107 3300025295 Bacteria 11742
298 Ga0209564_1008223 3300025295 Bacteria 5201
299 Ga0209564_1015536 3300025295 Bacteria 3087
300 Ga0209758_1000115 3300025297 Bacteria 199268
301 Ga0209758_1000341 3300025297 Bacteria 86460
302 Ga0209758_1000931 3300025297 Bacteria 39600
303 Ga0209758_1001568 3300025297 Bacteria 26208
304 Ga0209758_1005602 3300025297 Bacteria 9551
305 Ga0209758_1012588 3300025297 Bacteria 4717
306 Ga0209758_1018992 3300025297 Bacteria 3338
307 Ga0209050_1000008 3300025298 Bacteria 1144179
308 Ga0209050_1004159 3300025298 Bacteria 10020
309 Ga0209050_1020092 3300025298 Bacteria 2500
310 Ga0209050_1026495 3300025298 Bacteria 1938
311 Ga0209256_1000003 3300025299 Bacteria 1661127
312 Ga0209256_1000299 3300025299 Bacteria 86909
313 Ga0209256_1003540 3300025299 Bacteria 10849
314 Ga0209256_1005810 3300025299 Bacteria 6878
315 Ga0207426_1000005 3300025302 Bacteria 1037188
316 Ga0207426_1000021 3300025302 Bacteria 556343
317 Ga0207426_1000091 3300025302 Bacteria 280561
318 Ga0207426_1000098 3300025302 Bacteria 264264
319 Ga0207426_1000290 3300025302 Bacteria 99519
320 Ga0207426_1001819 3300025302 Bacteria 15806
321 Ga0207426_1003492 3300025302 Bacteria 8481
322 Ga0207426_1004159 3300025302 Bacteria 7235
323 Ga0209051_1000005 3300025303 Bacteria 1142353
324 Ga0209051_1000095 3300025303 Bacteria 167840
325 Ga0209051_1000751 3300025303 Bacteria 34884
326 Ga0209051_1000950 3300025303 Bacteria 28418
327 Ga0209051_1001177 3300025303 Bacteria 23706
328 Ga0209257_1000048 3300025304 Bacteria 455536
329 Ga0209257_1003729 3300025304 Bacteria 12646
330 Ga0209257_1003744 3300025304 Bacteria 12591
331 Ga0209257_1005759 3300025304 Bacteria 8468
332 Ga0209257_1006426 3300025304 Bacteria 7578
333 Ga0207713_1002977 3300025735 Bacteria 11841
334 Ga0207713_1003310 3300025735 Bacteria 11076
335 Ga0207680_10016485 3300025903 Bacteria 3880
336 Ga0207647_10000396 3300025904 Bacteria 35814
337 Ga0207647_10004607 3300025904 Bacteria 10212
338 Ga0207647_10005725 3300025904 Bacteria 9076
339 Ga0207647_10008189 3300025904 Bacteria 7509
340 Ga0207647_10021580 3300025904 Bacteria 4297
341 Ga0207647_10072120 3300025904 Bacteria 2083
342 Ga0207645_10009537 3300025907 Bacteria 6709
343 Ga0207695_10000255 3300025913 Bacteria 136470
344 Ga0207695_10006348 3300025913 Bacteria 15380
345 Ga0207695_10070513 3300025913 Bacteria 3572
346 Ga0207695_10085546 3300025913 Bacteria 3182
347 Ga0207671_10031690 3300025914 Bacteria 3939
348 Ga0207657_10000017 3300025919 Bacteria 173373
349 Ga0207657_10003040 3300025919 Bacteria 17960
350 Ga0207681_10025853 3300025923 Bacteria 3781
351 Ga0207694_10091863 3300025924 Bacteria 2396
352 Ga0207650_10016713 3300025925 Bacteria 5130
353 Ga0207650_10074523 3300025925 Bacteria 2559
354 Ga0207659_10071265 3300025926 Bacteria 2537
355 Ga0207690_10000009 3300025932 Bacteria 366044
356 Ga0207706_10021471 3300025933 Bacteria 5799
357 Ga0207691_10000111 3300025940 Bacteria 72961
358 Ga0207691_10035480 3300025940 Bacteria 4627
359 Ga0207691_10113731 3300025940 Bacteria 2405
360 Ga0207711_10057548 3300025941 Bacteria 3342
361 Ga0207711_10146500 3300025941 Bacteria 2128
362 Ga0207689_10000142 3300025942 Bacteria 61457
363 Ga0207667_10000690 3300025949 Bacteria 43775
364 Ga0207667_10022191 3300025949 Bacteria 7021
365 Ga0207667_10027790 3300025949 Bacteria 6153
366 Ga0207667_10069557 3300025949 Bacteria 3663
367 Ga0207667_10096331 3300025949 Bacteria 3054
368 Ga0207651_10008045 3300025960 Bacteria 5658
369 Ga0207668_10007922 3300025972 Bacteria 6317
370 Ga0207668_10021266 3300025972 Bacteria 4136
371 Ga0207658_10018094 3300025986 Bacteria 4861
372 Ga0207658_10032074 3300025986 Bacteria 3736
373 Ga0207677_10163746 3300026023 Bacteria 1731
374 Ga0207703_10000195 3300026035 Bacteria 70480
375 Ga0207678_10001300 3300026067 Bacteria 23141
376 Ga0207678_10067634 3300026067 Bacteria 3067
377 Ga0207708_10026709 3300026075 Bacteria 4370
378 Ga0207641_10006316 3300026088 Bacteria 10019
379 Ga0207641_10040449 3300026088 Bacteria 3904
380 Ga0207648_10005172 3300026089 Bacteria 13215
381 Ga0207648_10016833 3300026089 Bacteria 6666
382 Ga0207676_10001696 3300026095 Bacteria 16247
383 Ga0207676_10002462 3300026095 Bacteria 13209
384 Ga0207676_10044252 3300026095 Bacteria 3433
385 Ga0207675_100004037 3300026118 Bacteria 14223
386 Ga0207683_10021988 3300026121 Bacteria 5472
387 Ga0209371_1000012 3300027312 Bacteria 748304
388 Ga0209371_1000128 3300027312 Bacteria 124861
389 Ga0209371_1001150 3300027312 Bacteria 19371
390 Ga0209371_1004198 3300027312 Bacteria 6424
391 Ga0209371_1014361 3300027312 Bacteria 2173
392 Ga0209282_1000071 3300027666 Bacteria 81290
393 Ga0268265_10002425 3300028380 Bacteria 14080
394 Ga0268265_10099182 3300028380 Bacteria 2348
395 Ga0268264_10000606 3300028381 Bacteria 43164
396 Ga0268264_10081089 3300028381 Bacteria 2772
397 Ga0307515_10003849 3300028794 Bacteria 31385
398 Ga0307515_10004729 3300028794 Bacteria 27894
399 Ga0307515_10098268 3300028794 Bacteria 3567
400 Ga0268256_1000013 3300030500 Bacteria 752103
401 Ga0268256_1000152 3300030500 Bacteria 92565
402 Ga0268256_1015923 3300030500 Bacteria 2174
403 Ga0265331_10006391 3300031250 Bacteria 6975
404 Ga0307513_10000206 3300031456 Bacteria 85338
405 Ga0307513_10002571 3300031456 Bacteria 25076
406 Ga0307513_10014035 3300031456 Bacteria 9811
407 Ga0307513_10048134 3300031456 Bacteria 4630
408 Ga0307408_100009027 3300031548 Bacteria 6586
409 Ga0265313_10000597 3300031595 Bacteria 37470
410 Ga0265313_10000955 3300031595 Bacteria 28688
411 Ga0307514_10004553 3300031649 Bacteria 12734
412 Ga0307412_10000166 3300031911 Bacteria 46636
413 Ga0316584_0022817 3300036712 Bacteria 4567
414 Ga0395898_0000705 3300037466 Bacteria 59562
415 Ga0395898_0047046 3300037466 Bacteria 4235
416 Ga0395905_0000004 3300037471 Bacteria 674991
417 Ga0395905_0041876 3300037471 Bacteria 4298
418 Ga0451833_0074361 3300041491 Bacteria 2805
419 Ga0451835_0854527 3300041492 Bacteria 3100
420 Ga0451847_0010142 3300041503 Bacteria 3160
421 Ga0451847_0297095 3300041503 Bacteria 3230
422 Ga0439431_0008387 3300041997 Bacteria 2323
423 Ga0451577_0066111 3300042876 Bacteria 3225
424 Ga0451577_0146198 3300042876 Bacteria 2125
425 Ga0466969_0004388 3300044656 Bacteria 7504
426 Ga0466965_0005387 3300044683 Bacteria 5765
427 Ga0466966_0007483 3300044684 Bacteria 7235
428 Ga0466961_0000331 3300044693 Bacteria 31174
429 Ga0466961_0002861 3300044693 Bacteria 10705
430 Ga0466961_0028434 3300044693 Bacteria 3595
431 Ga0466963_0008691 3300044694 Bacteria 6097
432 Ga0466971_0004206 3300044719 Bacteria 6204
433 Ga0466968_0015285 3300044735 Bacteria 3040
434 Ga0466957_0000233 3300044842 Bacteria 26263
435 Ga0466959_0003452 3300045049 Bacteria 10347
436 Ga0466959_0033823 3300045049 Bacteria 3780
437 Ga0451576_0004586 3300045051 Bacteria 17837
438 Ga0466958_0040661 3300045836 Bacteria 2794
439 Ga0495590_0001138 3300046457 Bacteria 11638
440 Ga0495629_0000115 3300046459 Bacteria 72648
441 Ga0495629_0000187 3300046459 Bacteria 56028
442 Ga0495629_0011880 3300046459 Bacteria 6314
443 Ga0495638_0000151 3300046460 Bacteria 109795
444 Ga0495638_0000445 3300046460 Bacteria 49638
445 Ga0495651_0037525 3300046462 Bacteria 3772
446 Ga0495653_0000273 3300046463 Bacteria 41704
447 Ga0495580_0000062 3300046472 Bacteria 63605
448 Ga0495580_0005039 3300046472 Bacteria 11012
449 Ga0495580_0005063 3300046472 Bacteria 10988
450 Ga0495580_0034459 3300046472 Bacteria 3645
451 Ga0495580_0043427 3300046472 Bacteria 3199
452 Ga0495580_0076658 3300046472 Bacteria 2332
453 Ga0495582_0019142 3300046473 Bacteria 3746
454 Ga0495605_0000905 3300046474 Bacteria 20369
455 Ga0495605_0014686 3300046474 Bacteria 4281
456 Ga0495605_0015637 3300046474 Bacteria 4123
457 Ga0495664_0018009 3300046477 Bacteria 4040
458 Ga0495664_0058045 3300046477 Bacteria 2302
459 Ga0495664_0133696 3300046477 Bacteria 1502
460 Ga0495585_0015532 3300046492 Bacteria 4425
461 Ga0495596_0007099 3300046500 Bacteria 5075
462 Ga0495607_0012524 3300046501 Bacteria 5593
463 Ga0495583_0002836 3300046506 Bacteria 14141
464 Ga0495583_0015547 3300046506 Bacteria 4134
465 Ga0495583_0018574 3300046506 Bacteria 3657
466 Ga0495606_0008280 3300046507 Bacteria 9071
467 Ga0495606_0022345 3300046507 Bacteria 4610
468 Ga0495608_0004864 3300046511 Bacteria 9605
469 Ga0495610_0000262 3300046512 Bacteria 55293
470 Ga0495610_0000678 3300046512 Bacteria 32921
471 Ga0495610_0009325 3300046512 Bacteria 6217
472 Ga0495616_0027958 3300046513 Bacteria 2989
473 Ga0495628_0002943 3300046516 Bacteria 15273
474 Ga0495630_0032461 3300046517 Bacteria 3891
475 Ga0495630_0047868 3300046517 Bacteria 3199
476 Ga0495631_0000428 3300046518 Bacteria 29120
477 Ga0495631_0003509 3300046518 Bacteria 8573
478 Ga0495632_0003019 3300046519 Bacteria 12271
479 Ga0495632_0015116 3300046519 Bacteria 4340
480 Ga0495632_0063310 3300046519 Bacteria 1791
481 Ga0495643_0026548 3300046522 Bacteria 3267
482 Ga0495643_0084776 3300046522 Bacteria 1644
483 Ga0495666_0000875 3300046526 Bacteria 14044
484 Ga0495642_0006946 3300046528 Bacteria 4343
485 Ga0495652_0071817 3300046529 Bacteria 2887
486 Ga0495654_0003858 3300046530 Bacteria 9057
487 Ga0495665_0019902 3300046531 Bacteria 3609
488 Ga0495665_0028609 3300046531 Bacteria 2987
489 Ga0495640_0009136 3300046533 Bacteria 7737
490 Ga0495586_0033394 3300046535 Bacteria 2761
491 Ga0495609_0027209 3300046538 Bacteria 2615
492 Ga0495597_0013073 3300046542 Bacteria 3985
493 Ga0495645_0007678 3300046543 Bacteria 7504
494 Ga0495645_0013558 3300046543 Bacteria 5768
495 Ga0495645_0192074 3300046543 Bacteria 1390
496 Ga0495668_0078352 3300046616 Bacteria 1814
497 Ga0495634_0036206 3300046642 Bacteria 3376
498 Ga0495625_0000618 3300046660 Bacteria 51604
499 Ga0495625_0005647 3300046660 Bacteria 11334
500 Ga0495635_0084117 3300046663 Bacteria 2177
501 Ga0495588_0027064 3300046674 Bacteria 2865
502 Ga0495599_0025276 3300046678 Bacteria 3716
503 Ga0495599_0033579 3300046678 Bacteria 3224
504 Ga0495623_0002507 3300046679 Bacteria 12151
505 Ga0495623_0039922 3300046679 Bacteria 2998
506 Ga0495646_0000965 3300046680 Bacteria 16445
507 Ga0495646_0023501 3300046680 Bacteria 3880
508 Ga0495624_0000424 3300046690 Bacteria 33401
509 Ga0495624_0000583 3300046690 Bacteria 28499
510 Ga0495624_0019003 3300046690 Bacteria 4590
511 Ga0495670_0011808 3300046691 Bacteria 4300
512 Ga0495670_0030380 3300046691 Bacteria 2684
513 Ga0495649_0001816 3300046694 Bacteria 15674
514 Ga0495649_0006300 3300046694 Bacteria 7384
515 Ga0495649_0039711 3300046694 Bacteria 2580
516 Ga0495589_0004343 3300046794 Bacteria 7558
517 Ga0495600_0003182 3300046809 Bacteria 9606
518 Ga0495581_0003799 3300047315 Bacteria 8691
519 Ga0495604_0000893 3300047317 Bacteria 24849
520 Ga0495674_0026569 3300047319 Bacteria 5296
521 Ga0495672_0013646 3300047320 Bacteria 5593
522 Ga0495672_0044697 3300047320 Bacteria 2655
523 Ga0495680_0007288 3300047322 Bacteria 10178
524 Ga0495680_0028946 3300047322 Bacteria 4540
525 Ga0495683_0001826 3300047323 Bacteria 13386
526 Ga0495683_0016234 3300047323 Bacteria 3867
527 Ga0495683_0057920 3300047323 Bacteria 1925
528 Ga0495687_000022 3300047443 Bacteria 327353
529 Ga0495687_005628 3300047443 Bacteria 7916
530 Ga0495675_0005742 3300047444 Bacteria 7591
531 Ga0495673_0017301 3300047469 Bacteria 3666
532 Ga0495681_0002123 3300047470 Bacteria 14424
533 Ga0495686_0000002 3300047472 Bacteria 1050777
534 Ga0495686_0007803 3300047472 Bacteria 7963
535 Ga0495686_0079555 3300047472 Bacteria 2004
536 Ga0495602_0003066 3300048088 Bacteria 17159
537 Ga0495614_0007828 3300048089 Bacteria 4752
538 Ga0496100_0000102 3300048903 Bacteria 49167
539 Ga0496101_0000823 3300048904 Bacteria 18271
540 Ga0496101_0011169 3300048904 Bacteria 5950
541 Ga0496101_0129461 3300048904 Bacteria 1915
542 Ga0496102_0000808 3300048905 Bacteria 30475
543 Ga0496102_0017869 3300048905 Bacteria 6219
544 Ga0496102_0020537 3300048905 Bacteria 5836
545 Ga0496102_0061201 3300048905 Bacteria 3445
546 Ga0496103_0001958 3300048906 Bacteria 13318
547 Ga0496104_0000378 3300048907 Bacteria 39345
548 Ga0496104_0015197 3300048907 Bacteria 6969
549 Ga0496105_0001811 3300048908 Bacteria 15296
550 Ga0496106_0000016 3300048909 Bacteria 182368
551 Ga0496106_0002647 3300048909 Bacteria 13321
552 Ga0496106_0019975 3300048909 Bacteria 4968
553 Ga0496106_0041245 3300048909 Bacteria 3458
554 Ga0496107_0006509 3300048910 Bacteria 8033
555 Ga0496110_0005772 3300048913 Bacteria 9726
556 Ga0496111_0015118 3300048914 Bacteria 5289
557 Ga0496112_0005092 3300048915 Bacteria 11293
558 Ga0496112_0021844 3300048915 Bacteria 6090
559 Ga0496113_0005982 3300048916 Bacteria 7656
560 Ga0496115_0143225 3300048918 Bacteria 1972
561 Ga0496116_0017856 3300048919 Bacteria 5492
562 Ga0496117_0000083 3300048920 Bacteria 218945
563 Ga0496117_0000852 3300048920 Bacteria 47272
564 Ga0496117_0001721 3300048920 Bacteria 30302
565 Ga0496117_0009987 3300048920 Bacteria 8726
566 Ga0496117_0011016 3300048920 Bacteria 8142
567 Ga0496117_0029143 3300048920 Bacteria 4261
568 Ga0496118_0000549 3300048921 Bacteria 61765
569 Ga0496118_0001660 3300048921 Bacteria 32686
570 Ga0496118_0002046 3300048921 Bacteria 28504
571 Ga0496118_0003154 3300048921 Bacteria 21083
572 Ga0496118_0004942 3300048921 Bacteria 15455
573 Ga0496118_0006775 3300048921 Bacteria 12457
574 Ga0496118_0026013 3300048921 Bacteria 4998
575 Ga0496118_0040453 3300048921 Bacteria 3707
576 Ga0496118_0104922 3300048921 Bacteria 1896
577 Ga0496119_0001603 3300048922 Bacteria 26894
578 Ga0496119_0056397 3300048922 Bacteria 2381
579 Ga0496119_0075822 3300048922 Bacteria 1953
580 Ga0496119_0087464 3300048922 Bacteria 1778
581 Ga0496120_0000030 3300048923 Bacteria 226066
582 Ga0496120_0057513 3300048923 Bacteria 2188
583 Ga0496121_0002102 3300048924 Bacteria 31349
584 Ga0496121_0003960 3300048924 Bacteria 20448
585 Ga0496121_0005745 3300048924 Bacteria 15753
586 Ga0496121_0013320 3300048924 Bacteria 8852
587 Ga0496121_0013461 3300048924 Bacteria 8783
588 Ga0496121_0015580 3300048924 Bacteria 7943
589 Ga0496121_0120140 3300048924 Bacteria 1986
590 Ga0496121_0149130 3300048924 Bacteria 1724
591 Ga0496122_0000050 3300048925 Bacteria 267874
592 Ga0496122_0004444 3300048925 Bacteria 17402
593 Ga0496122_0035439 3300048925 Bacteria 4059
594 Ga0496122_0079672 3300048925 Bacteria 2287
595 Ga0496123_0000052 3300048926 Bacteria 236409
596 Ga0496123_0038042 3300048926 Bacteria 3388
597 Ga0496124_0011004 3300048927 Bacteria 9087
598 Ga0496124_0014715 3300048927 Bacteria 7551
599 Ga0496124_0093714 3300048927 Bacteria 2444
600 Ga0496125_0005452 3300048928 Bacteria 14135
601 Ga0496125_0071734 3300048928 Bacteria 2703
602 Ga0496125_0124641 3300048928 Bacteria 1829
603 Ga0496126_0000254 3300048929 Bacteria 114937
604 Ga0496126_0000475 3300048929 Bacteria 79715
605 Ga0496126_0000550 3300048929 Bacteria 72171
606 Ga0496126_0000965 3300048929 Bacteria 49314
607 Ga0496126_0067500 3300048929 Bacteria 3195
608 Ga0496126_0126507 3300048929 Bacteria 2212
609 Ga0495682_0005320 3300049460 Bacteria 5368
610 Ga0495682_0006377 3300049460 Bacteria 4777
611 Ga0501032_0068686 3300049569 Bacteria 2365
612 Ga0501033_0041602 3300049570 Bacteria 3428
613 Ga0501033_0125546 3300049570 Bacteria 1861
614 Ga0501047_0037197 3300049581 Bacteria 4707
615 Ga0501238_001331 3300049671 Bacteria 2844
616 Ga0501083_0009266 3300049744 Bacteria 6949
617 Ga0501035_0006648 3300049822 Bacteria 10817
618 Ga0501035_0031397 3300049822 Bacteria 4838
619 Ga0501044_0000185 3300049823 Bacteria 77663
620 Ga0501044_0152734 3300049823 Bacteria 2291
621 Ga0501044_0165986 3300049823 Bacteria 2182
622 Ga0501044_0193024 3300049823 Bacteria 1998
623 nmdc:mga03683_12371_c2 3300050489 Bacteria 2587
624 nmdc:mga03683_51646_c1 3300050489 Bacteria 1717
625 nmdc:mga03683_8314_c1 3300050489 Bacteria 2645
626 nmdc:mga00v17_10788_c1 3300050491 Bacteria 5004
627 nmdc:mga00v17_31_c1 3300050491 Bacteria 87312
628 nmdc:mga00v17_34_c1 3300050491 Bacteria 85919
629 nmdc:mga00v17_42_c1 3300050491 Bacteria 79984
630 nmdc:mga0yw44_1286_c1 3300050492 Bacteria 9902
631 nmdc:mga0k408_14382_c1 3300050493 Bacteria 4359
632 nmdc:mga06z11_10121_c1 3300050494 Bacteria 4003
633 nmdc:mga06z11_28525_c1 3300050494 Bacteria 2679
634 nmdc:mga06z11_65449_c1 3300050494 Bacteria 1908
635 nmdc:mga04h51_31900_c1 3300050495 Bacteria 1668
636 nmdc:mga07m45_3768_c1 3300050496 Bacteria 7334
637 nmdc:mga07m45_83741_c1 3300050496 Bacteria 1823
638 nmdc:mga0sz30_244_c1 3300050516 Bacteria 20932
639 Ga0500578_0053615 3300053086 Bacteria 2581
640 Ga0500644_0000824 3300053088 Bacteria 10459
641 Ga0500557_000836 3300053105 Bacteria 4490
642 Ga0500593_000456 3300053117 Bacteria 16197
643 Ga0500594_0001736 3300053118 Bacteria 4744
644 Ga0500594_0004570 3300053118 Bacteria 3051
645 Ga0500618_000349 3300053125 Bacteria 32348
646 Ga0500618_000356 3300053125 Bacteria 31771
647 Ga0500618_001394 3300053125 Bacteria 10891
648 Ga0500658_0000086 3300053134 Bacteria 43329
649 Ga0500561_0000089 3300053137 Bacteria 17790
650 Ga0500568_0000295 3300053139 Bacteria 40681
651 Ga0500568_0000659 3300053139 Bacteria 24925
652 Ga0500568_0001721 3300053139 Bacteria 13596
653 Ga0500568_0023651 3300053139 Bacteria 2612
654 Ga0500573_0051522 3300053140 Bacteria 2367
655 Ga0500616_0000203 3300053153 Bacteria 97028
656 Ga0500616_0000341 3300053153 Bacteria 66760
657 Ga0500616_0000522 3300053153 Bacteria 48622
658 Ga0500622_0000836 3300053156 Bacteria 26294
659 Ga0500622_0055565 3300053156 Bacteria 2028
660 Ga0500633_0000086 3300053160 Bacteria 13425
661 Ga0500634_0002483 3300053161 Bacteria 7800
662 Ga0500634_0005497 3300053161 Bacteria 6024
663 Ga0500634_0008269 3300053161 Bacteria 5194
664 Ga0500645_000042 3300053730 Bacteria 110470
665 Ga0500645_002276 3300053730 Bacteria 8718
666 Ga0500661_000314 3300055283 Bacteria 8843
667 Ga0466962_0012455 3300061719 Bacteria 4087

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2510917026 2511173266 418
2 3300050489 nmdc:mga03683_51646_c1 nmdc:mga03683_51646_c1_345_1685 434
3 3300046477 Ga0495664_0133696 Ga0495664_0133696_11_1348 445
4 3300046543 Ga0495645_0192074 Ga0495645_0192074_17_1354 445
5 3300048924 Ga0496121_0120140 Ga0496121_0120140_24_1361 445
6 iso_pu_bacteria 2513237083 2513563994 449
7 iso_pu_bacteria 8003955200 8003960071 449
8 3300050495 nmdc:mga04h51_31900_c1 nmdc:mga04h51_31900_c1_188_1651 484
9 3300002705 JGI25156J39149_1000666 JGI25156J39149_100066615 485
10 3300025256 Ga0209759_1000028 Ga0209759_100002847 485
11 3300003187 JGI25151J46595_10000143 JGI25151J46595_1000014322 492
12 3300025294 Ga0209025_1000299 Ga0209025_100029985 492
13 3300025297 Ga0209758_1005602 Ga0209758_10056026 492
14 3300047469 Ga0495673_0017301 Ga0495673_0017301_1203_2810 495
15 3300049671 Ga0501238_001331 Ga0501238_001331_37_1530 497
16 3300048924 Ga0496121_0149130 Ga0496121_0149130_32_1549 499
17 3300046459 Ga0495629_0000115 Ga0495629_0000115_53266_54873 502
18 3300046463 Ga0495653_0000273 Ga0495653_0000273_22322_23929 502
19 3300046472 Ga0495580_0005063 Ga0495580_0005063_8665_10272 502
20 3300046472 Ga0495580_0034459 Ga0495580_0034459_717_2324 502
21 3300046477 Ga0495664_0018009 Ga0495664_0018009_1124_2731 502
22 3300046506 Ga0495583_0002836 Ga0495583_0002836_9218_10825 502
23 3300046516 Ga0495628_0002943 Ga0495628_0002943_12978_14585 502
24 3300046517 Ga0495630_0032461 Ga0495630_0032461_2175_3782 502
25 3300046530 Ga0495654_0003858 Ga0495654_0003858_5892_7505 502
26 3300046531 Ga0495665_0019902 Ga0495665_0019902_185_1792 502
27 3300046680 Ga0495646_0000965 Ga0495646_0000965_14709_16316 502
28 3300046690 Ga0495624_0000583 Ga0495624_0000583_717_2324 502
29 3300046690 Ga0495624_0019003 Ga0495624_0019003_717_2324 502
30 3300046694 Ga0495649_0006300 Ga0495649_0006300_1138_2745 502
31 3300047320 Ga0495672_0044697 Ga0495672_0044697_82_1689 502
32 3300048089 Ga0495614_0007828 Ga0495614_0007828_1896_3503 502
33 3300049460 Ga0495682_0005320 Ga0495682_0005320_2327_3934 502
34 3300003354 JGI25160J50197_1002009 JGI25160J50197_10020094 503
35 3300025284 Ga0209130_1000160 Ga0209130_100016066 503
36 3300025302 Ga0207426_1000098 Ga0207426_100009870 503
37 3300031250 Ga0265331_10006391 Ga0265331_100063913 503
38 3300031595 Ga0265313_10000597 Ga0265313_1000059723 503
39 3300041997 Ga0439431_0008387 Ga0439431_0008387_327_1919 503
40 3300003320 rootH2_10017840 rootH2_100178402 504
41 3300046519 Ga0495632_0063310 Ga0495632_0063310_33_1580 507
42 3300046678 Ga0495599_0025276 Ga0495599_0025276_1961_3568 507
43 3300046679 Ga0495623_0002507 Ga0495623_0002507_8665_10272 507
44 3300047317 Ga0495604_0000893 Ga0495604_0000893_21318_22925 507
45 3300047320 Ga0495672_0013646 Ga0495672_0013646_43_1590 507
46 3300047444 Ga0495675_0005742 Ga0495675_0005742_1130_2737 507
47 3300048088 Ga0495602_0003066 Ga0495602_0003066_253_1860 507
48 3300036712 Ga0316584_0022817 Ga0316584_0022817_889_2484 510
49 3300045051 Ga0451576_0004586 Ga0451576_0004586_4292_5890 511
50 3300046528 Ga0495642_0006946 Ga0495642_0006946_11_1549 512
51 3300037471 Ga0395905_0000004 Ga0395905_0000004_361185_362792 513
52 3300003320 rootH2_10048674 rootH2_100486743 514
53 3300003322 rootL2_10017323 rootL2_100173236 514
54 3300003354 JGI25160J50197_1001141 JGI25160J50197_10011415 514
55 3300005262 Ga0065165_1000617 Ga0065165_100061710 514
56 3300025284 Ga0209130_1008625 Ga0209130_10086251 514
57 3300025302 Ga0207426_1000021 Ga0207426_1000021414 514
58 3300025913 Ga0207695_10070513 Ga0207695_100705133 514
59 3300046472 Ga0495580_0043427 Ga0495580_0043427_1060_2667 514
60 3300046474 Ga0495605_0015637 Ga0495605_0015637_1674_3281 514
61 3300046506 Ga0495583_0015547 Ga0495583_0015547_1616_3223 514
62 3300046513 Ga0495616_0027958 Ga0495616_0027958_1323_2930 514
63 3300048903 Ga0496100_0000102 Ga0496100_0000102_9858_11465 514
64 3300048904 Ga0496101_0000823 Ga0496101_0000823_8000_9607 514
65 3300048904 Ga0496101_0129461 Ga0496101_0129461_252_1859 514
66 3300048905 Ga0496102_0000808 Ga0496102_0000808_9461_11068 514
67 3300048907 Ga0496104_0015197 Ga0496104_0015197_1378_2985 514
68 3300048915 Ga0496112_0021844 Ga0496112_0021844_2781_4388 514
69 3300048920 Ga0496117_0001721 Ga0496117_0001721_20533_22140 514
70 3300048921 Ga0496118_0000549 Ga0496118_0000549_4392_5999 514
71 3300048924 Ga0496121_0002102 Ga0496121_0002102_8641_10248 514
72 3300048924 Ga0496121_0015580 Ga0496121_0015580_4059_5666 514
73 3300048926 Ga0496123_0038042 Ga0496123_0038042_606_2213 514
74 3300048928 Ga0496125_0124641 Ga0496125_0124641_48_1655 514
75 3300049460 Ga0495682_0006377 Ga0495682_0006377_243_1850 514
76 3300002705 JGI25156J39149_1000897 JGI25156J39149_10008979 516
77 3300003322 rootL2_10034586 rootL2_100345864 516
78 3300025206 Ga0209435_100019 Ga0209435_100019122 516
79 3300025250 Ga0209026_1000048 Ga0209026_1000048122 516
80 3300025256 Ga0209759_1000038 Ga0209759_1000038122 516
81 3300025295 Ga0209564_1008223 Ga0209564_10082233 516
82 3300031548 Ga0307408_100009027 Ga0307408_1000090272 516
83 3300049570 Ga0501033_0041602 Ga0501033_0041602_1589_3208 516
84 3300049823 Ga0501044_0165986 Ga0501044_0165986_418_2037 516
85 3300050496 nmdc:mga07m45_3768_c1 nmdc:mga07m45_3768_c1_2698_4272 516
86 3300053117 Ga0500593_000456 Ga0500593_000456_8020_9573 516
87 3300025940 Ga0207691_10113731 Ga0207691_101137311 517
88 3300048905 Ga0496102_0061201 Ga0496102_0061201_465_2072 517
89 3300048920 Ga0496117_0000852 Ga0496117_0000852_9154_10761 517
90 3300048921 Ga0496118_0004942 Ga0496118_0004942_12860_14467 517
91 iso_pu_bacteria 2516143018 2516207915 518
92 iso_pu_bacteria 2690316117 2692318905 518
93 iso_pu_bacteria 2738543031 2739347188 518
94 iso_pu_bacteria 2791355091 2792619785 518
95 iso_pu_bacteria 2791355092 2792627559 518
96 iso_pu_bacteria 2847417321 2847422589 518
97 iso_pu_bacteria 2848992105 2848998007 518
98 iso_pu_bacteria 2855872281 2855873939 518
99 iso_pu_bacteria 3002141150 3002145373 518
100 iso_pu_bacteria 643692032 643823432 518
101 3300003323 rootH1_10345004 rootH1_103450042 519
102 3300005937 Ga0081455_10107414 Ga0081455_101074141 519
103 3300013105 Ga0157369_10012773 Ga0157369_100127732 519
104 3300046462 Ga0495651_0037525 Ga0495651_0037525_180_1787 519
105 3300046472 Ga0495580_0000062 Ga0495580_0000062_33442_35049 519
106 3300046517 Ga0495630_0047868 Ga0495630_0047868_240_1847 519
107 3300046674 Ga0495588_0027064 Ga0495588_0027064_363_1937 519
108 3300046678 Ga0495599_0033579 Ga0495599_0033579_1044_2651 519
109 3300046680 Ga0495646_0023501 Ga0495646_0023501_1264_2871 519
110 3300046690 Ga0495624_0000424 Ga0495624_0000424_24778_26385 519
111 3300047322 Ga0495680_0028946 Ga0495680_0028946_1441_3048 519
112 3300047470 Ga0495681_0002123 Ga0495681_0002123_6473_8047 519
113 3300048922 Ga0496119_0087464 Ga0496119_0087464_12_1586 519
114 3300048929 Ga0496126_0000475 Ga0496126_0000475_65926_67533 519
115 3300053153 Ga0500616_0000341 Ga0500616_0000341_42059_43642 519
116 iso_pu_bacteria 2509276021 2509386977 519
117 iso_pu_bacteria 2509276033 2509442505 519
118 iso_pu_bacteria 2510065019 2510132974 519
119 iso_pu_bacteria 2510461076 2510894353 519
120 iso_pu_bacteria 2510461076 2510899378 519
121 iso_pu_bacteria 2510917022 2511136964 519
122 iso_pu_bacteria 2510917028 2511184311 519
123 iso_pu_bacteria 2510917030 2511195763 519
124 iso_pu_bacteria 2513237084 2513569930 519
125 iso_pu_bacteria 2513237085 2513575203 519
126 iso_pu_bacteria 2513237093 2513633118 519
127 iso_pu_bacteria 2513237103 2513710144 519
128 iso_pu_bacteria 2513237138 2513866161 519
129 iso_pu_bacteria 2513237144 2513910779 519
130 iso_pu_bacteria 2513237146 2513927252 519
131 iso_pu_bacteria 2513237162 2514021797 519
132 iso_pu_bacteria 2515075009 2515111925 519
133 iso_pu_bacteria 2515154113 2515633729 519
134 iso_pu_bacteria 2515154114 2515645097 519
135 iso_pu_bacteria 2515154116 2515660241 519
136 iso_pu_bacteria 2515154134 2515738899 519
137 iso_pu_bacteria 2516653077 2517035666 519
138 iso_pu_bacteria 2516653085 2517076093 519
139 iso_pu_bacteria 2517093000 2517094847 519
140 iso_pu_bacteria 2517287029 2517406471 519
141 iso_pu_bacteria 2519899620 2520379447 519
142 iso_pu_bacteria 2529292951 2530645229 519
143 iso_pu_bacteria 2537561587 2537875039 519
144 iso_pu_bacteria 2554235003 2554244408 519
145 iso_pu_bacteria 2558860242 2559297785 519
146 iso_pu_bacteria 2582581294 2585200911 519
147 iso_pu_bacteria 2582581298 2585221787 519
148 iso_pu_bacteria 2582581307 2585272235 519
149 iso_pu_bacteria 2582581867 2585405233 519
150 iso_pu_bacteria 2585427526 2585528247 519
151 iso_pu_bacteria 2585427528 2585540445 519
152 iso_pu_bacteria 2585427529 2585544043 519
153 iso_pu_bacteria 2585427531 2585561701 519
154 iso_pu_bacteria 2585427590 2585823439 519
155 iso_pu_bacteria 2585427593 2585838656 519
156 iso_pu_bacteria 2585427608 2585899545 519
157 iso_pu_bacteria 2585427609 2585906929 519
158 iso_pu_bacteria 2585427633 2585993839 519
159 iso_pu_bacteria 2585427634 2586004764 519
160 iso_pu_bacteria 2585428125 2587982350 519
161 iso_pu_bacteria 2599185170 2599415307 519
162 iso_pu_bacteria 2599185210 2599603820 519
163 iso_pu_bacteria 2600255279 2601612643 519
164 iso_pu_bacteria 2600255308 2601749765 519
165 iso_pu_bacteria 2615840624 2616292740 519
166 iso_pu_bacteria 2615840698 2616555682 519
167 iso_pu_bacteria 2643221582 2643917796 519
168 iso_pu_bacteria 2643221634 2644194466 519
169 iso_pu_bacteria 2643221693 2644522583 519
170 iso_pu_bacteria 2718217882 2719180900 519
171 iso_pu_bacteria 2718217927 2719385504 519
172 iso_pu_bacteria 2718217997 2719665323 519
173 iso_pu_bacteria 2718218009 2719731649 519
174 iso_pu_bacteria 2718218199 2720491743 519
175 iso_pu_bacteria 2718218232 2720613012 519
176 iso_pu_bacteria 2718218233 2720619862 519
177 iso_pu_bacteria 2718218235 2720631290 519
178 iso_pu_bacteria 2718218269 2720775017 519
179 iso_pu_bacteria 2718218363 2721146994 519
180 iso_pu_bacteria 2718218365 2721158524 519
181 iso_pu_bacteria 2718218366 2721163912 519
182 iso_pu_bacteria 2718218423 2721399252 519
183 iso_pu_bacteria 2721755514 2722840082 519
184 iso_pu_bacteria 2721755556 2723026656 519
185 iso_pu_bacteria 2721755684 2723560270 519
186 iso_pu_bacteria 2721755685 2723566837 519
187 iso_pu_bacteria 2721755809 2724038065 519
188 iso_pu_bacteria 2721755810 2724044405 519
189 iso_pu_bacteria 2721755819 2724089624 519
190 iso_pu_bacteria 2721755822 2724104102 519
191 iso_pu_bacteria 2721755823 2724109911 519
192 iso_pu_bacteria 2724679232 2725949856 519
193 iso_pu_bacteria 2728369352 2730107592 519
194 iso_pu_bacteria 2728369365 2730164137 519
195 iso_pu_bacteria 2728369397 2730298156 519
196 iso_pu_bacteria 2738541333 2739037937 519
197 iso_pu_bacteria 2751185821 2753461462 519
198 iso_pu_bacteria 2765235942 2766062354 519
199 iso_pu_bacteria 2791355094 2792641862 519
200 iso_pu_bacteria 2791355256 2793298323 519
201 iso_pu_bacteria 2791355259 2793313800 519
202 iso_pu_bacteria 2791355260 2793324386 519
203 iso_pu_bacteria 2791355261 2793326411 519
204 iso_pu_bacteria 2791355262 2793337809 519
205 iso_pu_bacteria 2791355263 2793341245 519
206 iso_pu_bacteria 2791355264 2793347582 519
207 iso_pu_bacteria 2791355265 2793352347 519
208 iso_pu_bacteria 2791355266 2793361476 519
209 iso_pu_bacteria 2791355267 2793366499 519
210 iso_pu_bacteria 2802429605 2805927683 519
211 iso_pu_bacteria 2802429606 2805935591 519
212 iso_pu_bacteria 2802429633 2806045454 519
213 iso_pu_bacteria 2802429634 2806051743 519
214 iso_pu_bacteria 2802429635 2806061787 519
215 iso_pu_bacteria 2802429636 2806067968 519
216 iso_pu_bacteria 2802429637 2806072683 519
217 iso_pu_bacteria 2808606387 2808989265 519
218 iso_pu_bacteria 2818991439 2819561870 519
219 iso_pu_bacteria 2821443989 2821449727 519
220 iso_pu_bacteria 2838016132 2838018858 519
221 iso_pu_bacteria 2838022645 2838025439 519
222 iso_pu_bacteria 2838035591 2838038968 519
223 iso_pu_bacteria 2838042994 2838043146 519
224 iso_pu_bacteria 2838048938 2838052076 519
225 iso_pu_bacteria 2838061910 2838067307 519
226 iso_pu_bacteria 2838068647 2838071422 519
227 iso_pu_bacteria 2838661181 2838664440 519
228 iso_pu_bacteria 2838668709 2838670129 519
229 iso_pu_bacteria 2838675328 2838679151 519
230 iso_pu_bacteria 2838680041 2838682531 519
231 iso_pu_bacteria 2838686498 2838689164 519
232 iso_pu_bacteria 2838694306 2838697102 519
233 iso_pu_bacteria 2838701080 2838702500 519
234 iso_pu_bacteria 2838707686 2838709657 519
235 iso_pu_bacteria 2838714209 2838718996 519
236 iso_pu_bacteria 2838719591 2838723995 519
237 iso_pu_bacteria 2838724970 2838728829 519
238 iso_pu_bacteria 2838729681 2838730512 519
239 iso_pu_bacteria 2838742623 2838743453 519
240 iso_pu_bacteria 2841846520 2841850120 519
241 iso_pu_bacteria 2841851746 2841854871 519
242 iso_pu_bacteria 2841859092 2841861106 519
243 iso_pu_bacteria 2841864319 2841864854 519
244 iso_pu_bacteria 2842077413 2842077831 519
245 iso_pu_bacteria 2842110456 2842110841 519
246 iso_pu_bacteria 2842118031 2842119661 519
247 iso_pu_bacteria 2842124991 2842128592 519
248 iso_pu_bacteria 2842130223 2842134053 519
249 iso_pu_bacteria 2842146304 2842146955 519
250 iso_pu_bacteria 2842152218 2842156049 519
251 iso_pu_bacteria 2842156927 2842157734 519
252 iso_pu_bacteria 2842163707 2842164945 519
253 iso_pu_bacteria 2842170452 2842175242 519
254 iso_pu_bacteria 2842175837 2842179858 519
255 iso_pu_bacteria 2842180545 2842180681 519
256 iso_pu_bacteria 2842187318 2842191871 519
257 iso_pu_bacteria 2842192696 2842196937 519
258 iso_pu_bacteria 2842198810 2842201007 519
259 iso_pu_bacteria 2842205361 2842206335 519
260 iso_pu_bacteria 2842211629 2842216188 519
261 iso_pu_bacteria 2842217011 2842223055 519
262 iso_pu_bacteria 2842224351 2842228760 519
263 iso_pu_bacteria 2842229732 2842231267 519
264 iso_pu_bacteria 2842237096 2842239070 519
265 iso_pu_bacteria 2842243621 2842244632 519
266 iso_pu_bacteria 2842250916 2842252020 519
267 iso_pu_bacteria 2842257432 2842258445 519
268 iso_pu_bacteria 2842264693 2842267466 519
269 iso_pu_bacteria 2842271015 2842273184 519
270 iso_pu_bacteria 2842278818 2842279792 519
271 iso_pu_bacteria 2842285085 2842287439 519
272 iso_pu_bacteria 2842291075 2842291493 519
273 iso_pu_bacteria 2842304105 2842309333 519
274 iso_pu_bacteria 2842311132 2842315468 519
275 iso_pu_bacteria 2842317721 2842318202 519
276 iso_pu_bacteria 2842341865 2842347218 519
277 iso_pu_bacteria 2842363717 2842366597 519
278 iso_pu_bacteria 2842370503 2842373098 519
279 iso_pu_bacteria 2842377471 2842377889 519
280 iso_pu_bacteria 2842384541 2842386170 519
281 iso_pu_bacteria 2842395702 2842397363 519
282 iso_pu_bacteria 2842402390 2842405032 519
283 iso_pu_bacteria 2842409023 2842411614 519
284 iso_pu_bacteria 2842415677 2842417935 519
285 iso_pu_bacteria 2842422224 2842424920 519
286 iso_pu_bacteria 2842428310 2842431956 519
287 iso_pu_bacteria 2842434925 2842438069 519
288 iso_pu_bacteria 2842441272 2842444882 519
289 iso_pu_bacteria 2842447887 2842451797 519
290 iso_pu_bacteria 2842462802 2842465740 519
291 iso_pu_bacteria 2842469257 2842472686 519
292 iso_pu_bacteria 2842489311 2842492833 519
293 iso_pu_bacteria 2842495871 2842496472 519
294 iso_pu_bacteria 2842515876 2842518627 519
295 iso_pu_bacteria 2842922631 2842927023 519
296 iso_pu_bacteria 2844454524 2844459481 519
297 iso_pu_bacteria 2854896431 2854899912 519
298 iso_pu_bacteria 2857516855 2857523761 519
299 iso_pu_bacteria 2857537821 2857538947 519
300 iso_pu_bacteria 2898795034 2898796019 519
301 iso_pu_bacteria 2899792073 2899795044 519
302 iso_pu_bacteria 2899803654 2899807097 519
303 iso_pu_bacteria 2899845264 2899849780 519
304 iso_pu_bacteria 2919100787 2919103257 519
305 iso_pu_bacteria 2919114240 2919117853 519
306 iso_pu_bacteria 2919171160 2919174314 519
307 iso_pu_bacteria 2923556063 2923561651 519
308 iso_pu_bacteria 2926754445 2926757658 519
309 iso_pu_bacteria 2926760298 2926764726 519
310 iso_pu_bacteria 2933006813 2933010258 519
311 iso_pu_bacteria 2933011516 2933014253 519
312 iso_pu_bacteria 2933016740 2933023125 519
313 iso_pu_bacteria 2933570622 2933575894 519
314 iso_pu_bacteria 2933586486 2933586866 519
315 iso_pu_bacteria 2933594066 2933597134 519
316 iso_pu_bacteria 2933599457 2933602221 519
317 iso_pu_bacteria 2935894831 2935899032 519
318 iso_pu_bacteria 2935901341 2935904408 519
319 iso_pu_bacteria 2936367885 2936373065 519
320 iso_pu_bacteria 2936375103 2936381210 519
321 iso_pu_bacteria 2936381700 2936385997 519
322 iso_pu_bacteria 2937836603 2937838491 519
323 iso_pu_bacteria 2979095461 2979095692 519
324 iso_pu_bacteria 2984509177 2984510851 519
325 iso_pu_bacteria 2984518228 2984518449 519
326 iso_pu_bacteria 2984537506 2984539200 519
327 iso_pu_bacteria 2984601300 2984605907 519
328 iso_pu_bacteria 2996893221 2996898418 519
329 iso_pu_bacteria 3000017691 3000020945 519
330 iso_pu_bacteria 3000405567 3000406369 519
331 iso_pu_bacteria 3000405567 3000408934 519
332 iso_pu_bacteria 3005416602 3005419133 519
333 iso_pu_bacteria 639633055 639648220 519
334 iso_pu_bacteria 650716007 650842487 519
335 iso_pu_bacteria 8003570095 8003573376 519
336 iso_pu_bacteria 8005258706 8005260640 519
337 iso_pu_bacteria 8005275841 8005280275 519
338 iso_pu_bacteria 8005282627 8005288341 519
339 iso_pu_bacteria 8005289223 8005294853 519
340 iso_pu_bacteria 8005301065 8005306986 519
341 iso_pu_bacteria 8005307578 8005314196 519
342 iso_pu_bacteria 8005314921 8005318102 519
343 iso_pu_bacteria 8005376324 8005378867 519
344 iso_pu_bacteria 8005382845 8005388059 519
345 iso_pu_bacteria 8005395548 8005396985 519
346 iso_pu_bacteria 8005430974 8005433172 519
347 iso_pu_bacteria 8005460587 8005462585 519
348 iso_pu_bacteria 8005497431 8005499964 519
349 iso_pu_bacteria 8005556819 8005558044 519
350 iso_pu_bacteria 8005563573 8005569218 519
351 iso_pu_bacteria 8005570704 8005575492 519
352 iso_pu_bacteria 8005619151 8005621331 519
353 iso_pu_bacteria 8005626139 8005631380 519
354 iso_pu_bacteria 8005668836 8005671380 519
355 iso_pu_bacteria 8005688590 8005694901 519
356 iso_pu_bacteria 8005695170 8005696076 519
357 iso_pu_bacteria 8018127388 8018129621 519
358 iso_pu_bacteria 8018163183 8018168173 519
359 iso_pu_bacteria 8018176218 8018177953 519
360 iso_pu_bacteria 8023680758 8023681028 519
361 iso_pu_bacteria 8024479707 8024485827 519
362 iso_pu_bacteria 8024501048 8024505294 519
363 iso_pu_bacteria 8056375014 8056380211 519
364 iso_pu_bacteria 8056382006 8056387495 519
365 iso_pu_bacteria 8057874678 8057875414 519
366 3300042876 Ga0451577_0066111 Ga0451577_0066111_554_2158 520
367 3300049570 Ga0501033_0125546 Ga0501033_0125546_192_1787 520
368 3300049744 Ga0501083_0009266 Ga0501083_0009266_4660_6234 520
369 3300049823 Ga0501044_0193024 Ga0501044_0193024_359_1954 520
370 3300053140 Ga0500573_0051522 Ga0500573_0051522_685_2325 520
371 iso_pu_bacteria 2643221637 2644207771 520
372 iso_pu_bacteria 2643221718 2644651860 520
373 iso_pu_bacteria 2757320392 2757571886 520
374 iso_pu_bacteria 2844533157 2844536381 520
375 3300046473 Ga0495582_0019142 Ga0495582_0019142_1725_3332 521
376 3300046526 Ga0495666_0000875 Ga0495666_0000875_6107_7714 521
377 3300046535 Ga0495586_0033394 Ga0495586_0033394_588_2195 521
378 3300046663 Ga0495635_0084117 Ga0495635_0084117_340_1947 521
379 3300046809 Ga0495600_0003182 Ga0495600_0003182_6426_8033 521
380 3300047315 Ga0495581_0003799 Ga0495581_0003799_644_2251 521
381 3300047322 Ga0495680_0007288 Ga0495680_0007288_2310_3917 521
382 iso_pu_bacteria 2508501114 2509076261 521
383 iso_pu_bacteria 2919679072 2919682638 521
384 3300005436 Ga0070713_100012418 Ga0070713_1000124186 522
385 3300006038 Ga0075365_10001384 Ga0075365_100013848 522
386 3300006048 Ga0075363_100034542 Ga0075363_1000345422 522
387 3300006051 Ga0075364_10020347 Ga0075364_100203472 522
388 3300006178 Ga0075367_10008133 Ga0075367_100081335 522
389 3300006178 Ga0075367_10030197 Ga0075367_100301971 522
390 3300006353 Ga0075370_10018094 Ga0075370_100180942 522
391 3300009545 Ga0105237_10039816 Ga0105237_100398164 522
392 3300046459 Ga0495629_0000187 Ga0495629_0000187_44383_45999 522
393 3300046472 Ga0495580_0005039 Ga0495580_0005039_1901_3517 522
394 3300046511 Ga0495608_0004864 Ga0495608_0004864_7541_9148 522
395 3300046531 Ga0495665_0028609 Ga0495665_0028609_1118_2686 522
396 3300046533 Ga0495640_0009136 Ga0495640_0009136_278_1885 522
397 3300046543 Ga0495645_0007678 Ga0495645_0007678_3996_5612 522
398 3300046642 Ga0495634_0036206 Ga0495634_0036206_302_1909 522
399 3300050491 nmdc:mga00v17_10788_c1 nmdc:mga00v17_10788_c1_1014_2627 522
400 3300050494 nmdc:mga06z11_28525_c1 nmdc:mga06z11_28525_c1_780_2393 522
401 3300053139 Ga0500568_0023651 Ga0500568_0023651_186_1778 522
402 iso_pu_bacteria 2534681796 2535520450 522
403 iso_pu_bacteria 2585427633 2585997554 522
404 iso_pu_bacteria 2585427634 2586002160 522
405 iso_pu_bacteria 2599185156 2599335353 522
406 iso_pu_bacteria 2767802442 2770196445 522
407 iso_pu_bacteria 2775506902 2776272738 522
408 iso_pu_bacteria 2775506904 2776284681 522
409 iso_pu_bacteria 2840764183 2840768406 522
410 iso_pu_bacteria 2854896431 2854897846 522
411 iso_pu_bacteria 2854916844 2854920567 522
412 iso_pu_bacteria 2919171160 2919177095 522
413 3300002704 JGI25155J39150_1000021 JGI25155J39150_1000021101 523
414 3300002705 JGI25156J39149_1000022 JGI25156J39149_1000022100 523
415 3300002738 JGI25154J39366_1000048 JGI25154J39366_100004816 523
416 3300002739 JGI25158J39367_1001429 JGI25158J39367_10014293 523
417 3300002741 JGI25157J39369_1000025 JGI25157J39369_100002541 523
418 3300002773 JGI25152J39213_1002623 JGI25152J39213_10026233 523
419 3300002773 JGI25152J39213_1011838 JGI25152J39213_10118381 523
420 3300002774 JGI25150J39212_1004051 JGI25150J39212_10040511 523
421 3300002987 JGI25159J45721_1001463 JGI25159J45721_10014635 523
422 3300003187 JGI25151J46595_10003498 JGI25151J46595_100034983 523
423 3300003187 JGI25151J46595_10020879 JGI25151J46595_100208792 523
424 3300003215 JGI25153J46596_10003267 JGI25153J46596_100032675 523
425 3300003215 JGI25153J46596_10004883 JGI25153J46596_100048837 523
426 3300003215 JGI25153J46596_10009989 JGI25153J46596_100099891 523
427 3300003215 JGI25153J46596_10027568 JGI25153J46596_100275681 523
428 3300003323 rootH1_10157577 rootH1_101575772 523
429 3300003354 JGI25160J50197_1001510 JGI25160J50197_10015105 523
430 3300003374 JGI25161J50226_1000119 JGI25161J50226_100011918 523
431 3300003771 Ga0055526_1000483 Ga0055526_10004836 523
432 3300003771 Ga0055526_1008055 Ga0055526_10080552 523
433 3300003775 Ga0055524_1005603 Ga0055524_10056036 523
434 3300003775 Ga0055524_1010867 Ga0055524_10108672 523
435 3300003781 Ga0055536_1002551 Ga0055536_10025514 523
436 3300003790 Ga0055528_1000106 Ga0055528_100010637 523
437 3300003790 Ga0055528_1003757 Ga0055528_10037577 523
438 3300003790 Ga0055528_1015996 Ga0055528_10159961 523
439 3300003792 Ga0055540_1000103 Ga0055540_100010321 523
440 3300003792 Ga0055540_1000919 Ga0055540_10009194 523
441 3300003794 Ga0055531_10000857 Ga0055531_1000085711 523
442 3300003856 Ga0058692_1001653 Ga0058692_10016535 523
443 3300004625 Ga0055543_1000492 Ga0055543_10004924 523
444 3300005262 Ga0065165_1007234 Ga0065165_10072345 523
445 3300005353 Ga0070669_100024859 Ga0070669_1000248592 523
446 3300006048 Ga0075363_100021412 Ga0075363_1000214123 523
447 3300006177 Ga0075362_10002938 Ga0075362_100029382 523
448 3300006177 Ga0075362_10010457 Ga0075362_100104573 523
449 3300006177 Ga0075362_10016569 Ga0075362_100165692 523
450 3300006178 Ga0075367_10002340 Ga0075367_100023402 523
451 3300006178 Ga0075367_10017248 Ga0075367_100172483 523
452 3300006186 Ga0075369_10012793 Ga0075369_100127933 523
453 3300006195 Ga0075366_10003686 Ga0075366_100036865 523
454 3300006353 Ga0075370_10009495 Ga0075370_100094953 523
455 3300006353 Ga0075370_10039503 Ga0075370_100395032 523
456 3300006948 Ga0099826_10000047 Ga0099826_1000004718 523
457 3300006948 Ga0099826_10008443 Ga0099826_100084432 523
458 3300009148 Ga0105243_10009057 Ga0105243_100090573 523
459 3300009765 Ga0123341_1000095 Ga0123341_100009515 523
460 3300009766 Ga0123342_1022517 Ga0123342_10225173 523
461 3300013100 Ga0157373_10013144 Ga0157373_100131446 523
462 3300013102 Ga0157371_10000005 Ga0157371_10000005225 523
463 3300025206 Ga0209435_100033 Ga0209435_10003337 523
464 3300025208 Ga0209436_100017 Ga0209436_10001738 523
465 3300025245 Ga0207425_1000475 Ga0207425_100047519 523
466 3300025246 Ga0209646_1000116 Ga0209646_100011694 523
467 3300025250 Ga0209026_1000103 Ga0209026_100010337 523
468 3300025256 Ga0209759_1000105 Ga0209759_100010594 523
469 3300025258 Ga0209129_1000474 Ga0209129_100047414 523
470 3300025258 Ga0209129_1001388 Ga0209129_10013887 523
471 3300025258 Ga0209129_1002928 Ga0209129_10029286 523
472 3300025273 Ga0209673_1000139 Ga0209673_100013976 523
473 3300025273 Ga0209673_1004415 Ga0209673_10044156 523
474 3300025273 Ga0209673_1005362 Ga0209673_10053622 523
475 3300025273 Ga0209673_1005469 Ga0209673_10054696 523
476 3300025284 Ga0209130_1000001 Ga0209130_100000156 523
477 3300025292 Ga0209676_1005029 Ga0209676_10050294 523
478 3300025292 Ga0209676_1017127 Ga0209676_10171272 523
479 3300025294 Ga0209025_1000237 Ga0209025_1000237100 523
480 3300025294 Ga0209025_1002369 Ga0209025_10023694 523
481 3300025294 Ga0209025_1012206 Ga0209025_10122065 523
482 3300025295 Ga0209564_1000331 Ga0209564_100033140 523
483 3300025295 Ga0209564_1003092 Ga0209564_10030928 523
484 3300025295 Ga0209564_1003107 Ga0209564_10031076 523
485 3300025297 Ga0209758_1000115 Ga0209758_100011517 523
486 3300025297 Ga0209758_1000931 Ga0209758_100093119 523
487 3300025297 Ga0209758_1001568 Ga0209758_100156810 523
488 3300025297 Ga0209758_1012588 Ga0209758_10125883 523
489 3300025297 Ga0209758_1018992 Ga0209758_10189922 523
490 3300025298 Ga0209050_1004159 Ga0209050_10041594 523
491 3300025298 Ga0209050_1026495 Ga0209050_10264952 523
492 3300025299 Ga0209256_1000299 Ga0209256_100029935 523
493 3300025299 Ga0209256_1003540 Ga0209256_10035406 523
494 3300025299 Ga0209256_1005810 Ga0209256_10058102 523
495 3300025302 Ga0207426_1000005 Ga0207426_1000005661 523
496 3300025302 Ga0207426_1000290 Ga0207426_100029065 523
497 3300025303 Ga0209051_1000095 Ga0209051_100009543 523
498 3300025303 Ga0209051_1000950 Ga0209051_10009507 523
499 3300025304 Ga0209257_1003729 Ga0209257_10037294 523
500 3300025304 Ga0209257_1003744 Ga0209257_10037447 523
501 3300027312 Ga0209371_1000012 Ga0209371_1000012405 523
502 3300027312 Ga0209371_1001150 Ga0209371_10011507 523
503 3300027312 Ga0209371_1004198 Ga0209371_10041983 523
504 3300027666 Ga0209282_1000071 Ga0209282_100007152 523
505 3300028794 Ga0307515_10004729 Ga0307515_100047293 523
506 3300030500 Ga0268256_1000013 Ga0268256_1000013405 523
507 3300031456 Ga0307513_10014035 Ga0307513_100140353 523
508 3300041491 Ga0451833_0074361 Ga0451833_0074361_121_1716 523
509 3300041492 Ga0451835_0854527 Ga0451835_0854527_116_1711 523
510 3300041503 Ga0451847_0010142 Ga0451847_0010142_121_1716 523
511 3300041503 Ga0451847_0297095 Ga0451847_0297095_121_1716 523
512 3300046460 Ga0495638_0000151 Ga0495638_0000151_3775_5370 523
513 3300046460 Ga0495638_0000445 Ga0495638_0000445_15984_17579 523
514 3300046474 Ga0495605_0000905 Ga0495605_0000905_13219_14814 523
515 3300046474 Ga0495605_0014686 Ga0495605_0014686_462_2057 523
516 3300046492 Ga0495585_0015532 Ga0495585_0015532_1405_3000 523
517 3300046501 Ga0495607_0012524 Ga0495607_0012524_3907_5508 523
518 3300046506 Ga0495583_0018574 Ga0495583_0018574_429_2024 523
519 3300046507 Ga0495606_0022345 Ga0495606_0022345_1346_2941 523
520 3300046512 Ga0495610_0000262 Ga0495610_0000262_34180_35775 523
521 3300046512 Ga0495610_0009325 Ga0495610_0009325_4123_5718 523
522 3300046518 Ga0495631_0000428 Ga0495631_0000428_11536_13131 523
523 3300046518 Ga0495631_0003509 Ga0495631_0003509_2688_4283 523
524 3300046519 Ga0495632_0003019 Ga0495632_0003019_8064_9659 523
525 3300046519 Ga0495632_0015116 Ga0495632_0015116_1063_2658 523
526 3300046522 Ga0495643_0026548 Ga0495643_0026548_74_1669 523
527 3300046522 Ga0495643_0084776 Ga0495643_0084776_16_1611 523
528 3300046538 Ga0495609_0027209 Ga0495609_0027209_416_2011 523
529 3300046616 Ga0495668_0078352 Ga0495668_0078352_73_1668 523
530 3300046660 Ga0495625_0000618 Ga0495625_0000618_15978_17573 523
531 3300046660 Ga0495625_0005647 Ga0495625_0005647_7614_9209 523
532 3300046691 Ga0495670_0011808 Ga0495670_0011808_1707_3302 523
533 3300046691 Ga0495670_0030380 Ga0495670_0030380_806_2401 523
534 3300046694 Ga0495649_0039711 Ga0495649_0039711_442_2037 523
535 3300047323 Ga0495683_0057920 Ga0495683_0057920_186_1781 523
536 3300047472 Ga0495686_0007803 Ga0495686_0007803_2010_3605 523
537 3300048909 Ga0496106_0002647 Ga0496106_0002647_5215_6810 523
538 3300048909 Ga0496106_0041245 Ga0496106_0041245_308_1894 523
539 3300048919 Ga0496116_0017856 Ga0496116_0017856_1416_3011 523
540 3300048920 Ga0496117_0000083 Ga0496117_0000083_31925_33511 523
541 3300048920 Ga0496117_0029143 Ga0496117_0029143_1913_3508 523
542 3300048921 Ga0496118_0002046 Ga0496118_0002046_25294_26889 523
543 3300048921 Ga0496118_0003154 Ga0496118_0003154_3538_5124 523
544 3300048921 Ga0496118_0006775 Ga0496118_0006775_6012_7607 523
545 3300048921 Ga0496118_0040453 Ga0496118_0040453_766_2352 523
546 3300048922 Ga0496119_0056397 Ga0496119_0056397_279_1871 523
547 3300048923 Ga0496120_0000030 Ga0496120_0000030_47747_49333 523
548 3300048924 Ga0496121_0013320 Ga0496121_0013320_4320_5915 523
549 3300048925 Ga0496122_0000050 Ga0496122_0000050_186755_188341 523
550 3300048925 Ga0496122_0035439 Ga0496122_0035439_316_1911 523
551 3300048926 Ga0496123_0000052 Ga0496123_0000052_176273_177859 523
552 3300048927 Ga0496124_0014715 Ga0496124_0014715_1717_3303 523
553 3300048929 Ga0496126_0000254 Ga0496126_0000254_29718_31325 523
554 3300049569 Ga0501032_0068686 Ga0501032_0068686_373_1968 523
555 3300049581 Ga0501047_0037197 Ga0501047_0037197_639_2234 523
556 3300050489 nmdc:mga03683_12371_c2 nmdc:mga03683_12371_c2_98_1693 523
557 3300050491 nmdc:mga00v17_34_c1 nmdc:mga00v17_34_c1_929_2515 523
558 3300050493 nmdc:mga0k408_14382_c1 nmdc:mga0k408_14382_c1_1749_3344 523
559 3300050494 nmdc:mga06z11_10121_c1 nmdc:mga06z11_10121_c1_774_2360 523
560 3300050494 nmdc:mga06z11_65449_c1 nmdc:mga06z11_65449_c1_121_1716 523
561 3300050496 nmdc:mga07m45_83741_c1 nmdc:mga07m45_83741_c1_59_1654 523
562 3300050516 nmdc:mga0sz30_244_c1 nmdc:mga0sz30_244_c1_3967_5553 523
563 3300053086 Ga0500578_0053615 Ga0500578_0053615_836_2431 523
564 3300053105 Ga0500557_000836 Ga0500557_000836_1228_2823 523
565 3300053118 Ga0500594_0001736 Ga0500594_0001736_1476_3071 523
566 3300053118 Ga0500594_0004570 Ga0500594_0004570_232_1827 523
567 3300053134 Ga0500658_0000086 Ga0500658_0000086_17839_19434 523
568 3300053137 Ga0500561_0000089 Ga0500561_0000089_15899_17485 523
569 3300053139 Ga0500568_0000295 Ga0500568_0000295_2515_4110 523
570 3300053139 Ga0500568_0000659 Ga0500568_0000659_14365_15960 523
571 3300053139 Ga0500568_0001721 Ga0500568_0001721_5397_6992 523
572 3300053153 Ga0500616_0000203 Ga0500616_0000203_1634_3229 523
573 3300053153 Ga0500616_0000522 Ga0500616_0000522_32815_34410 523
574 3300053156 Ga0500622_0000836 Ga0500622_0000836_17955_19550 523
575 3300053156 Ga0500622_0055565 Ga0500622_0055565_387_1982 523
576 3300053160 Ga0500633_0000086 Ga0500633_0000086_9361_10956 523
577 3300053161 Ga0500634_0005497 Ga0500634_0005497_111_1703 523
578 3300053161 Ga0500634_0008269 Ga0500634_0008269_399_1985 523
579 3300053730 Ga0500645_002276 Ga0500645_002276_968_2617 523
580 iso_pu_bacteria 642555112 642599202 523
581 3300005347 Ga0070668_100021570 Ga0070668_1000215702 524
582 3300025294 Ga0209025_1022011 Ga0209025_10220112 524
583 3300025972 Ga0207668_10021266 Ga0207668_100212663 524
584 3300031456 Ga0307513_10000206 Ga0307513_100002069 524
585 3300049823 Ga0501044_0152734 Ga0501044_0152734_285_1874 524
586 3300053125 Ga0500618_000349 Ga0500618_000349_4216_5823 524
587 iso_pu_bacteria 2519103095 2519461396 524
588 iso_pu_bacteria 2582581311 2585290823 524
589 iso_pu_bacteria 2599185239 2599734655 524
590 iso_pu_bacteria 2599185240 2599745526 524
591 iso_pu_bacteria 2599185355 2600207433 524
592 iso_pu_bacteria 2675903129 2676741248 524
593 iso_pu_bacteria 2816332253 2817258303 524
594 iso_pu_bacteria 2816332256 2817281283 524
595 iso_pu_bacteria 2816332286 2817452029 524
596 iso_pu_bacteria 2818991452 2819634457 524
597 iso_pu_bacteria 2863421361 2863426732 524
598 iso_pu_bacteria 2870068957 2870075246 524
599 iso_pu_bacteria 2904564687 2904570633 524
600 iso_pu_bacteria 2904571731 2904577810 524
601 iso_pu_bacteria 2928157003 2928159024 524
602 iso_pu_bacteria 2928163908 2928167846 524
603 iso_pu_bacteria 2928170801 2928178078 524
604 iso_pu_bacteria 2928536128 2928537965 524
605 iso_pu_bacteria 2981990288 2981992402 524
606 iso_pu_bacteria 641736154 642418255 524
607 iso_pu_bacteria 8018845410 8018846584 524
608 iso_pu_bacteria 8020807995 8020810354 524
609 iso_pu_bacteria 8020938398 8020941786 524
610 iso_pu_bacteria 8020945358 8020945647 524
611 iso_pu_bacteria 8020953355 8020958739 524
612 iso_pu_bacteria 8021120328 8021121686 524
613 iso_pu_bacteria 8039098773 8039103868 524
614 iso_pu_bacteria 8040167225 8040167397 524
615 iso_pu_bacteria 8040173305 8040175408 524
616 3300006051 Ga0075364_10000212 Ga0075364_1000021213 525
617 3300050491 nmdc:mga00v17_31_c1 nmdc:mga00v17_31_c1_41444_43042 525
618 3300053125 Ga0500618_001394 Ga0500618_001394_8279_9877 525
619 iso_pu_bacteria 2808606384 2808969340 525
620 iso_pu_bacteria 2808606390 2809004171 525
621 3300002773 JGI25152J39213_1001761 JGI25152J39213_10017612 526
622 3300003215 JGI25153J46596_10017391 JGI25153J46596_100173912 526
623 3300003323 rootH1_10138215 rootH1_101382152 526
624 3300003781 Ga0055536_1003731 Ga0055536_10037318 526
625 3300003790 Ga0055528_1005284 Ga0055528_10052842 526
626 3300003794 Ga0055531_10003817 Ga0055531_1000381710 526
627 3300006038 Ga0075365_10015773 Ga0075365_100157733 526
628 3300009177 Ga0105248_10069122 Ga0105248_100691223 526
629 3300009551 Ga0105238_10163320 Ga0105238_101633202 526
630 3300009553 Ga0105249_10151297 Ga0105249_101512972 526
631 3300025258 Ga0209129_1000690 Ga0209129_100069011 526
632 3300025273 Ga0209673_1004743 Ga0209673_10047432 526
633 3300025292 Ga0209676_1019932 Ga0209676_10199321 526
634 3300025294 Ga0209025_1004937 Ga0209025_10049373 526
635 3300025295 Ga0209564_1002675 Ga0209564_10026757 526
636 3300025297 Ga0209758_1000341 Ga0209758_100034180 526
637 3300025298 Ga0209050_1020092 Ga0209050_10200922 526
638 3300025302 Ga0207426_1004159 Ga0207426_10041593 526
639 3300025303 Ga0209051_1000751 Ga0209051_10007515 526
640 3300025303 Ga0209051_1001177 Ga0209051_100117715 526
641 3300025304 Ga0209257_1006426 Ga0209257_10064267 526
642 3300025924 Ga0207694_10091863 Ga0207694_100918632 526
643 3300048907 Ga0496104_0000378 Ga0496104_0000378_29422_31026 526
644 3300048908 Ga0496105_0001811 Ga0496105_0001811_4039_5643 526
645 3300048909 Ga0496106_0019975 Ga0496106_0019975_2275_3879 526
646 3300048921 Ga0496118_0104922 Ga0496118_0104922_214_1818 526
647 3300048922 Ga0496119_0001603 Ga0496119_0001603_15676_17280 526
648 3300048923 Ga0496120_0057513 Ga0496120_0057513_220_1824 526
649 3300048925 Ga0496122_0079672 Ga0496122_0079672_101_1705 526
650 3300048928 Ga0496125_0071734 Ga0496125_0071734_455_2059 526
651 3300048929 Ga0496126_0067500 Ga0496126_0067500_1318_2922 526
652 3300050492 nmdc:mga0yw44_1286_c1 nmdc:mga0yw44_1286_c1_6744_8348 526
653 3300053161 Ga0500634_0002483 Ga0500634_0002483_4097_5701 526
654 3300005335 Ga0070666_10052478 Ga0070666_100524782 527
655 3300005367 Ga0070667_100116288 Ga0070667_1001162882 527
656 3300005455 Ga0070663_100046701 Ga0070663_1000467013 527
657 3300006051 Ga0075364_10000058 Ga0075364_100000582 527
658 3300009177 Ga0105248_10215836 Ga0105248_102158361 527
659 3300013306 Ga0163162_10002290 Ga0163162_100022906 527
660 3300025941 Ga0207711_10146500 Ga0207711_101465002 527
661 3300025986 Ga0207658_10032074 Ga0207658_100320742 527
662 3300026067 Ga0207678_10067634 Ga0207678_100676342 527
663 3300046507 Ga0495606_0008280 Ga0495606_0008280_1236_2828 527
664 3300046794 Ga0495589_0004343 Ga0495589_0004343_2678_4276 527
665 3300048924 Ga0496121_0003960 Ga0496121_0003960_9051_10661 527
666 3300050491 nmdc:mga00v17_42_c1 nmdc:mga00v17_42_c1_77601_79211 527
667 3300053125 Ga0500618_000356 Ga0500618_000356_27924_29573 527
668 iso_pu_bacteria 2773857925 2774869152 527
669 iso_pu_bacteria 2882456835 2882457618 527
670 iso_pu_bacteria 8005542996 8005548202 527
671 3300002067 JGI24735J21928_10004245 JGI24735J21928_100042456 528
672 3300003758 Ga0055532_1001039 Ga0055532_10010395 528
673 3300003760 Ga0055527_1000643 Ga0055527_10006436 528
674 3300003761 Ga0055535_1001039 Ga0055535_10010398 528
675 3300003761 Ga0055535_1001609 Ga0055535_10016095 528
676 3300003762 Ga0055542_1001029 Ga0055542_10010298 528
677 3300003762 Ga0055542_1002338 Ga0055542_10023385 528
678 3300003763 Ga0055529_1000861 Ga0055529_10008618 528
679 3300003763 Ga0055529_1003258 Ga0055529_10032582 528
680 3300003790 Ga0055528_1006282 Ga0055528_10062822 528
681 3300003856 Ga0058692_1010442 Ga0058692_10104422 528
682 3300005327 Ga0070658_10086424 Ga0070658_100864241 528
683 3300005339 Ga0070660_100000013 Ga0070660_10000001349 528
684 3300005339 Ga0070660_100004148 Ga0070660_1000041487 528
685 3300005366 Ga0070659_100000028 Ga0070659_10000002850 528
686 3300005455 Ga0070663_100001036 Ga0070663_1000010365 528
687 3300005563 Ga0068855_100022253 Ga0068855_1000222539 528
688 3300009093 Ga0105240_10008156 Ga0105240_100081569 528
689 3300009093 Ga0105240_10097281 Ga0105240_100972812 528
690 3300009545 Ga0105237_10050555 Ga0105237_100505553 528
691 3300009551 Ga0105238_10054000 Ga0105238_100540002 528
692 3300010375 Ga0105239_10079545 Ga0105239_100795455 528
693 3300013296 Ga0157374_10000749 Ga0157374_1000074913 528
694 3300015265 Ga0182005_1003552 Ga0182005_10035523 528
695 3300025225 Ga0209566_101869 Ga0209566_1018693 528
696 3300025226 Ga0209674_102069 Ga0209674_1020693 528
697 3300025228 Ga0209672_100067 Ga0209672_10006783 528
698 3300025228 Ga0209672_100079 Ga0209672_10007969 528
699 3300025228 Ga0209672_100431 Ga0209672_10043122 528
700 3300025229 Ga0209147_100012 Ga0209147_100012444 528
701 3300025229 Ga0209147_100061 Ga0209147_10006162 528
702 3300025229 Ga0209147_100107 Ga0209147_10010769 528
703 3300025242 Ga0209258_100107 Ga0209258_1001077 528
704 3300025242 Ga0209258_100273 Ga0209258_1002736 528
705 3300025254 Ga0209148_1000022 Ga0209148_1000022183 528
706 3300025254 Ga0209148_1001754 Ga0209148_10017546 528
707 3300025256 Ga0209759_1005034 Ga0209759_10050344 528
708 3300025272 Ga0209455_1000024 Ga0209455_1000024440 528
709 3300025272 Ga0209455_1000300 Ga0209455_100030038 528
710 3300025273 Ga0209673_1000021 Ga0209673_1000021135 528
711 3300025904 Ga0207647_10000396 Ga0207647_1000039626 528
712 3300025904 Ga0207647_10072120 Ga0207647_100721202 528
713 3300025913 Ga0207695_10000255 Ga0207695_1000025590 528
714 3300025913 Ga0207695_10006348 Ga0207695_100063484 528
715 3300025913 Ga0207695_10085546 Ga0207695_100855462 528
716 3300025914 Ga0207671_10031690 Ga0207671_100316905 528
717 3300025919 Ga0207657_10000017 Ga0207657_10000017107 528
718 3300025919 Ga0207657_10003040 Ga0207657_1000304013 528
719 3300025932 Ga0207690_10000009 Ga0207690_10000009200 528
720 3300025949 Ga0207667_10027790 Ga0207667_100277905 528
721 3300025949 Ga0207667_10069557 Ga0207667_100695572 528
722 3300026067 Ga0207678_10001300 Ga0207678_100013007 528
723 3300027312 Ga0209371_1000128 Ga0209371_10001281 528
724 3300028381 Ga0268264_10081089 Ga0268264_100810892 528
725 3300030500 Ga0268256_1000152 Ga0268256_100015283 528
726 3300031595 Ga0265313_10000955 Ga0265313_1000095514 528
727 3300037466 Ga0395898_0000705 Ga0395898_0000705_374_1963 528
728 3300044656 Ga0466969_0004388 Ga0466969_0004388_96_1685 528
729 3300044693 Ga0466961_0002861 Ga0466961_0002861_3327_4916 528
730 3300044719 Ga0466971_0004206 Ga0466971_0004206_2868_4457 528
731 3300045049 Ga0466959_0033823 Ga0466959_0033823_436_2025 528
732 3300048929 Ga0496126_0000550 Ga0496126_0000550_36728_38335 528
733 3300061719 Ga0466962_0012455 Ga0466962_0012455_2376_3965 528
734 iso_pu_bacteria 2511231221 2512034252 528
735 iso_pu_bacteria 2808606384 2808969339 528
736 iso_pu_bacteria 2808606390 2809004170 528
737 iso_pu_bacteria 8054002106 8054004271 528
738 3300002067 JGI24735J21928_10011784 JGI24735J21928_100117843 529
739 3300011119 Ga0105246_10104329 Ga0105246_101043291 529
740 3300025228 Ga0209672_100431 Ga0209672_10043121 529
741 3300037466 Ga0395898_0047046 Ga0395898_0047046_2296_3918 529
742 3300044683 Ga0466965_0005387 Ga0466965_0005387_2333_3922 529
743 3300044684 Ga0466966_0007483 Ga0466966_0007483_2819_4408 529
744 3300044693 Ga0466961_0000331 Ga0466961_0000331_14919_16508 529
745 3300044693 Ga0466961_0028434 Ga0466961_0028434_1876_3465 529
746 3300044842 Ga0466957_0000233 Ga0466957_0000233_23401_24990 529
747 3300045836 Ga0466958_0040661 Ga0466958_0040661_1141_2730 529
748 3300048914 Ga0496111_0015118 Ga0496111_0015118_1435_3024 529
749 3300048924 Ga0496121_0005745 Ga0496121_0005745_6172_7761 529
750 iso_pu_bacteria 2519103095 2519461389 529
751 iso_pu_bacteria 2582581311 2585290830 529
752 iso_pu_bacteria 2599185239 2599734648 529
753 iso_pu_bacteria 2599185240 2599745531 529
754 iso_pu_bacteria 2599185355 2600207438 529
755 iso_pu_bacteria 2600255067 2600812425 529
756 iso_pu_bacteria 2675903129 2676741253 529
757 iso_pu_bacteria 2816332253 2817258296 529
758 iso_pu_bacteria 2816332256 2817281290 529
759 iso_pu_bacteria 2816332286 2817452022 529
760 iso_pu_bacteria 2818991452 2819634448 529
761 iso_pu_bacteria 2857576091 2857580018 529
762 iso_pu_bacteria 2863421361 2863426740 529
763 iso_pu_bacteria 2870068957 2870075237 529
764 iso_pu_bacteria 2904564687 2904570640 529
765 iso_pu_bacteria 2904571731 2904577817 529
766 iso_pu_bacteria 2928157003 2928159018 529
767 iso_pu_bacteria 2928163908 2928167841 529
768 iso_pu_bacteria 2928170801 2928178087 529
769 iso_pu_bacteria 2928536128 2928537972 529
770 iso_pu_bacteria 2981990288 2981992395 529
771 iso_pu_bacteria 641736154 642418261 529
772 iso_pu_bacteria 8018845410 8018846591 529
773 iso_pu_bacteria 8020807995 8020810347 529
774 iso_pu_bacteria 8020938398 8020941779 529
775 iso_pu_bacteria 8020945358 8020945655 529
776 iso_pu_bacteria 8020953355 8020958746 529
777 iso_pu_bacteria 8021120328 8021121679 529
778 iso_pu_bacteria 8039098773 8039103865 529
779 iso_pu_bacteria 8040167225 8040167390 529
780 iso_pu_bacteria 8040173305 8040175401 529
781 3300002987 JGI25159J45721_1000407 JGI25159J45721_100040710 530
782 3300003354 JGI25160J50197_1000172 JGI25160J50197_100017240 530
783 3300003374 JGI25161J50226_1000007 JGI25161J50226_100000789 530
784 3300003758 Ga0055532_1000743 Ga0055532_10007432 530
785 3300003760 Ga0055527_1002267 Ga0055527_10022673 530
786 3300003790 Ga0055528_1002706 Ga0055528_10027066 530
787 3300004625 Ga0055543_1003014 Ga0055543_10030142 530
788 3300005339 Ga0070660_100000013 Ga0070660_10000001344 530
789 3300005366 Ga0070659_100000028 Ga0070659_10000002856 530
790 3300005455 Ga0070663_100001036 Ga0070663_10000103611 530
791 3300005614 Ga0068856_100040417 Ga0068856_1000404175 530
792 3300005616 Ga0068852_100012681 Ga0068852_1000126817 530
793 3300009011 Ga0105251_10000167 Ga0105251_100001674 530
794 3300009036 Ga0105244_10024403 Ga0105244_100244031 530
795 3300009093 Ga0105240_10226211 Ga0105240_102262112 530
796 3300009551 Ga0105238_10024386 Ga0105238_100243863 530
797 3300010375 Ga0105239_10003889 Ga0105239_1000388915 530
798 3300025208 Ga0209436_103175 Ga0209436_1031754 530
799 3300025225 Ga0209566_100293 Ga0209566_10029337 530
800 3300025228 Ga0209672_100067 Ga0209672_10006789 530
801 3300025228 Ga0209672_100079 Ga0209672_10007964 530
802 3300025229 Ga0209147_100012 Ga0209147_100012438 530
803 3300025229 Ga0209147_100061 Ga0209147_10006153 530
804 3300025229 Ga0209147_100107 Ga0209147_10010764 530
805 3300025254 Ga0209148_1000022 Ga0209148_1000022189 530
806 3300025272 Ga0209455_1000024 Ga0209455_1000024434 530
807 3300025273 Ga0209673_1000021 Ga0209673_1000021143 530
808 3300025284 Ga0209130_1000245 Ga0209130_100024510 530
809 3300025295 Ga0209564_1015536 Ga0209564_10155363 530
810 3300025302 Ga0207426_1000091 Ga0207426_1000091130 530
811 3300025302 Ga0207426_1001819 Ga0207426_100181914 530
812 3300025735 Ga0207713_1002977 Ga0207713_10029775 530
813 3300025904 Ga0207647_10004607 Ga0207647_100046074 530
814 3300025913 Ga0207695_10000255 Ga0207695_1000025585 530
815 3300025919 Ga0207657_10000017 Ga0207657_10000017113 530
816 3300025932 Ga0207690_10000009 Ga0207690_10000009206 530
817 3300025949 Ga0207667_10022191 Ga0207667_100221915 530
818 3300026067 Ga0207678_10001300 Ga0207678_1000130013 530
819 3300027312 Ga0209371_1000128 Ga0209371_10001288 530
820 3300028794 Ga0307515_10098268 Ga0307515_100982682 530
821 3300030500 Ga0268256_1000152 Ga0268256_100015276 530
822 3300031456 Ga0307513_10002571 Ga0307513_1000257119 530
823 3300044694 Ga0466963_0008691 Ga0466963_0008691_3235_4848 530
824 3300044735 Ga0466968_0015285 Ga0466968_0015285_210_1823 530
825 3300045049 Ga0466959_0003452 Ga0466959_0003452_6914_8527 530
826 3300046457 Ga0495590_0001138 Ga0495590_0001138_8019_9611 530
827 3300046529 Ga0495652_0071817 Ga0495652_0071817_587_2179 530
828 3300046542 Ga0495597_0013073 Ga0495597_0013073_1847_3439 530
829 3300046543 Ga0495645_0013558 Ga0495645_0013558_62_1654 530
830 3300046679 Ga0495623_0039922 Ga0495623_0039922_1099_2691 530
831 3300047323 Ga0495683_0001826 Ga0495683_0001826_5549_7141 530
832 3300048904 Ga0496101_0011169 Ga0496101_0011169_4229_5821 530
833 3300048905 Ga0496102_0017869 Ga0496102_0017869_3599_5191 530
834 3300048906 Ga0496103_0001958 Ga0496103_0001958_3769_5361 530
835 3300048910 Ga0496107_0006509 Ga0496107_0006509_5649_7241 530
836 3300048913 Ga0496110_0005772 Ga0496110_0005772_8053_9645 530
837 3300048915 Ga0496112_0005092 Ga0496112_0005092_4144_5736 530
838 3300048916 Ga0496113_0005982 Ga0496113_0005982_1562_3154 530
839 3300048918 Ga0496115_0143225 Ga0496115_0143225_147_1739 530
840 3300048920 Ga0496117_0011016 Ga0496117_0011016_1423_3015 530
841 3300048922 Ga0496119_0075822 Ga0496119_0075822_336_1928 530
842 3300048925 Ga0496122_0004444 Ga0496122_0004444_11916_13508 530
843 3300048927 Ga0496124_0011004 Ga0496124_0011004_3738_5330 530
844 3300048928 Ga0496125_0005452 Ga0496125_0005452_717_2309 530
845 3300048929 Ga0496126_0126507 Ga0496126_0126507_351_1943 530
846 3300049822 Ga0501035_0031397 Ga0501035_0031397_1577_3280 530
847 iso_pu_bacteria 2597490356 2599105070 530
848 iso_pu_bacteria 2757320392 2757569799 530
849 iso_pu_bacteria 2818991450 2819622916 530
850 iso_pu_bacteria 2846952575 2846955254 530
851 iso_pu_bacteria 2848858292 2848860974 530
852 iso_pu_bacteria 2928108538 2928113427 530
853 iso_pu_bacteria 2928135762 2928140586 530
854 iso_pu_bacteria 2928503688 2928507326 530
855 3300005548 Ga0070665_100018024 Ga0070665_1000180245 531
856 3300005841 Ga0068863_100132868 Ga0068863_1001328681 531
857 3300006237 Ga0097621_100011117 Ga0097621_1000111176 531
858 3300013297 Ga0157378_10206315 Ga0157378_102063151 531
859 3300026088 Ga0207641_10040449 Ga0207641_100404493 531
860 3300037471 Ga0395905_0041876 Ga0395905_0041876_677_2272 531
861 iso_pu_bacteria 2508501125 2509126608 531
862 iso_pu_bacteria 2511231002 2511245290 531
863 iso_pu_bacteria 2512047030 2512352480 531
864 iso_pu_bacteria 2513237082 2513556726 531
865 iso_pu_bacteria 2513237151 2513958107 531
866 iso_pu_bacteria 2513237166 2514046562 531
867 iso_pu_bacteria 2515154122 2515683697 531
868 iso_pu_bacteria 2526164713 2527075822 531
869 iso_pu_bacteria 2562617112 2563060483 531
870 iso_pu_bacteria 2711768613 2713475657 531
871 iso_pu_bacteria 2738541296 2738819387 531
872 iso_pu_bacteria 2738541298 2738831866 531
873 iso_pu_bacteria 2738541306 2738873394 531
874 iso_pu_bacteria 2738543002 2739185024 531
875 iso_pu_bacteria 2738543008 2739219993 531
876 iso_pu_bacteria 2791355137 2792833340 531
877 iso_pu_bacteria 2885270888 2885280020 531
878 iso_pu_bacteria 2900634093 2900639892 531
879 iso_pu_bacteria 2902682994 2902688551 531
880 iso_pu_bacteria 2904483920 2904490273 531
881 iso_pu_bacteria 2904615490 2904615840 531
882 iso_pu_bacteria 2919527303 2919533444 531
883 iso_pu_bacteria 2921643360 2921653896 531
884 iso_pu_bacteria 2945934425 2945940401 531
885 iso_pu_bacteria 2990703756 2990707529 531
886 iso_pu_bacteria 641736151 642423970 531
887 iso_pu_bacteria 642555112 642595766 531
888 iso_pu_bacteria 642555113 642617356 531
889 iso_pu_bacteria 8055266321 8055270940 531
890 iso_pu_bacteria 8055301274 8055307137 531
891 iso_pu_bacteria 8056875544 8056876278 531
892 3300002704 JGI25155J39150_1000323 JGI25155J39150_10003236 532
893 3300002738 JGI25154J39366_1000657 JGI25154J39366_100065710 532
894 3300002741 JGI25157J39369_1000791 JGI25157J39369_100079110 532
895 3300002987 JGI25159J45721_1001213 JGI25159J45721_10012139 532
896 3300003771 Ga0055526_1003358 Ga0055526_10033583 532
897 3300003771 Ga0055526_1003566 Ga0055526_10035668 532
898 3300003773 Ga0055537_1000356 Ga0055537_100035612 532
899 3300003775 Ga0055524_1000213 Ga0055524_100021321 532
900 3300003781 Ga0055536_1005112 Ga0055536_10051123 532
901 3300003781 Ga0055536_1005115 Ga0055536_10051153 532
902 3300003784 Ga0055534_1001441 Ga0055534_10014413 532
903 3300003790 Ga0055528_1004586 Ga0055528_10045862 532
904 3300003791 Ga0055530_10000763 Ga0055530_100007637 532
905 3300003791 Ga0055530_10001299 Ga0055530_1000129910 532
906 3300003792 Ga0055540_1000504 Ga0055540_100050422 532
907 3300005293 Ga0065715_10125569 Ga0065715_101255692 532
908 3300005328 Ga0070676_10005120 Ga0070676_100051205 532
909 3300005331 Ga0070670_100002139 Ga0070670_1000021394 532
910 3300005334 Ga0068869_100000007 Ga0068869_10000000716 532
911 3300005338 Ga0068868_100018350 Ga0068868_1000183502 532
912 3300005347 Ga0070668_100005031 Ga0070668_1000050318 532
913 3300005364 Ga0070673_100007422 Ga0070673_1000074223 532
914 3300005367 Ga0070667_100001939 Ga0070667_10000193911 532
915 3300005455 Ga0070663_100134410 Ga0070663_1001344102 532
916 3300005459 Ga0068867_100005604 Ga0068867_1000056047 532
917 3300005577 Ga0068857_100000676 Ga0068857_10000067616 532
918 3300005617 Ga0068859_100003514 Ga0068859_10000351414 532
919 3300005618 Ga0068864_100001466 Ga0068864_10000146620 532
920 3300005719 Ga0068861_100001688 Ga0068861_10000168815 532
921 3300005841 Ga0068863_100014934 Ga0068863_1000149343 532
922 3300005843 Ga0068860_100005878 Ga0068860_1000058787 532
923 3300005844 Ga0068862_100002922 Ga0068862_10000292213 532
924 3300006051 Ga0075364_10007527 Ga0075364_100075271 532
925 3300006931 Ga0097620_100003514 Ga0097620_10000351414 532
926 3300009177 Ga0105248_10001664 Ga0105248_1000166415 532
927 3300011119 Ga0105246_10080402 Ga0105246_100804022 532
928 3300013297 Ga0157378_10030049 Ga0157378_100300492 532
929 3300013308 Ga0157375_10035782 Ga0157375_100357823 532
930 3300014968 Ga0157379_10000142 Ga0157379_1000014249 532
931 3300025246 Ga0209646_1000038 Ga0209646_1000038123 532
932 3300025263 Ga0209565_1000041 Ga0209565_100004131 532
933 3300025263 Ga0209565_1000333 Ga0209565_100033311 532
934 3300025273 Ga0209673_1000364 Ga0209673_100036422 532
935 3300025284 Ga0209130_1000708 Ga0209130_100070821 532
936 3300025291 Ga0209675_1003873 Ga0209675_10038731 532
937 3300025291 Ga0209675_1004518 Ga0209675_10045183 532
938 3300025292 Ga0209676_1000013 Ga0209676_1000013266 532
939 3300025292 Ga0209676_1002248 Ga0209676_10022483 532
940 3300025294 Ga0209025_1004718 Ga0209025_10047185 532
941 3300025294 Ga0209025_1009265 Ga0209025_10092656 532
942 3300025294 Ga0209025_1015698 Ga0209025_10156984 532
943 3300025295 Ga0209564_1000875 Ga0209564_10008757 532
944 3300025295 Ga0209564_1002543 Ga0209564_10025438 532
945 3300025298 Ga0209050_1000008 Ga0209050_1000008266 532
946 3300025299 Ga0209256_1000003 Ga0209256_1000003135 532
947 3300025302 Ga0207426_1003492 Ga0207426_10034924 532
948 3300025303 Ga0209051_1000005 Ga0209051_1000005266 532
949 3300025304 Ga0209257_1000048 Ga0209257_1000048266 532
950 3300025304 Ga0209257_1005759 Ga0209257_10057595 532
951 3300025903 Ga0207680_10016485 Ga0207680_100164853 532
952 3300025907 Ga0207645_10009537 Ga0207645_100095373 532
953 3300025942 Ga0207689_10000142 Ga0207689_1000014234 532
954 3300025949 Ga0207667_10096331 Ga0207667_100963313 532
955 3300025972 Ga0207668_10007922 Ga0207668_100079225 532
956 3300025986 Ga0207658_10018094 Ga0207658_100180943 532
957 3300026023 Ga0207677_10163746 Ga0207677_101637461 532
958 3300026035 Ga0207703_10000195 Ga0207703_100001957 532
959 3300026089 Ga0207648_10005172 Ga0207648_1000517210 532
960 3300026095 Ga0207676_10002462 Ga0207676_1000246211 532
961 3300026118 Ga0207675_100004037 Ga0207675_10000403714 532
962 3300028380 Ga0268265_10002425 Ga0268265_100024256 532
963 3300028380 Ga0268265_10099182 Ga0268265_100991822 532
964 3300028381 Ga0268264_10000606 Ga0268264_1000060628 532
965 3300028794 Ga0307515_10003849 Ga0307515_1000384920 532
966 3300031456 Ga0307513_10048134 Ga0307513_100481344 532
967 3300031649 Ga0307514_10004553 Ga0307514_1000455312 532
968 3300048905 Ga0496102_0020537 Ga0496102_0020537_2923_4533 532
969 3300048929 Ga0496126_0000965 Ga0496126_0000965_22241_23848 532
970 3300050489 nmdc:mga03683_8314_c1 nmdc:mga03683_8314_c1_750_2354 532
971 3300053088 Ga0500644_0000824 Ga0500644_0000824_6595_8199 532
972 3300053730 Ga0500645_000042 Ga0500645_000042_102365_104056 532
973 3300055283 Ga0500661_000314 Ga0500661_000314_3394_5004 532
974 iso_pu_bacteria 2687453129 2687578957 532
975 3300005328 Ga0070676_10067579 Ga0070676_100675792 533
976 3300005331 Ga0070670_100007600 Ga0070670_1000076002 533
977 3300005331 Ga0070670_100010144 Ga0070670_1000101443 533
978 3300005334 Ga0068869_100011980 Ga0068869_1000119805 533
979 3300005347 Ga0070668_100005135 Ga0070668_1000051357 533
980 3300005347 Ga0070668_100061481 Ga0070668_1000614812 533
981 3300005364 Ga0070673_100014047 Ga0070673_1000140474 533
982 3300005365 Ga0070688_100045766 Ga0070688_1000457662 533
983 3300005367 Ga0070667_100058752 Ga0070667_1000587523 533
984 3300005441 Ga0070700_100031085 Ga0070700_1000310853 533
985 3300005457 Ga0070662_100008004 Ga0070662_1000080045 533
986 3300005459 Ga0068867_100018855 Ga0068867_1000188552 533
987 3300005618 Ga0068864_100014538 Ga0068864_1000145384 533
988 3300005840 Ga0068870_10015499 Ga0068870_100154992 533
989 3300005841 Ga0068863_100008080 Ga0068863_1000080802 533
990 3300005843 Ga0068860_100011434 Ga0068860_1000114343 533
991 3300005844 Ga0068862_100016544 Ga0068862_1000165443 533
992 3300006844 Ga0075428_100054216 Ga0075428_1000542162 533
993 3300006881 Ga0068865_100111894 Ga0068865_1001118942 533
994 3300013306 Ga0163162_10047742 Ga0163162_100477424 533
995 3300013308 Ga0157375_10001469 Ga0157375_100014697 533
996 3300014325 Ga0163163_10001547 Ga0163163_100015479 533
997 3300025923 Ga0207681_10025853 Ga0207681_100258533 533
998 3300025925 Ga0207650_10016713 Ga0207650_100167132 533
999 3300025925 Ga0207650_10074523 Ga0207650_100745232 533
1000 3300025926 Ga0207659_10071265 Ga0207659_100712652 533
1001 3300025933 Ga0207706_10021471 Ga0207706_100214712 533
1002 3300025940 Ga0207691_10000111 Ga0207691_1000011141 533
1003 3300025940 Ga0207691_10035480 Ga0207691_100354804 533
1004 3300025960 Ga0207651_10008045 Ga0207651_100080454 533
1005 3300026075 Ga0207708_10026709 Ga0207708_100267093 533
1006 3300026088 Ga0207641_10006316 Ga0207641_100063165 533
1007 3300026089 Ga0207648_10016833 Ga0207648_100168332 533
1008 3300026095 Ga0207676_10001696 Ga0207676_1000169612 533
1009 3300026095 Ga0207676_10044252 Ga0207676_100442523 533
1010 3300026121 Ga0207683_10021988 Ga0207683_100219883 533
1011 3300042876 Ga0451577_0146198 Ga0451577_0146198_159_1802 533
1012 3300046477 Ga0495664_0058045 Ga0495664_0058045_278_1879 533
1013 3300047319 Ga0495674_0026569 Ga0495674_0026569_1636_3237 533
1014 3300047443 Ga0495687_000022 Ga0495687_000022_6613_8214 533
1015 3300009011 Ga0105251_10000498 Ga0105251_100004986 534
1016 3300015262 Ga0182007_10005970 Ga0182007_100059703 534
1017 3300025735 Ga0207713_1003310 Ga0207713_10033106 534
1018 3300025904 Ga0207647_10005725 Ga0207647_100057253 534
1019 3300048921 Ga0496118_0001660 Ga0496118_0001660_18363_19967 534
1020 3300001979 JGI24740J21852_10010600 JGI24740J21852_100106003 535
1021 3300002075 JGI24738J21930_10000994 JGI24738J21930_100009946 535
1022 3300002705 JGI25156J39149_1000542 JGI25156J39149_100054215 535
1023 3300002705 JGI25156J39149_1000553 JGI25156J39149_10005537 535
1024 3300003214 JGI25165J46597_1000508 JGI25165J46597_10005085 535
1025 3300003756 Ga0055533_1000188 Ga0055533_100018832 535
1026 3300003758 Ga0055532_1000069 Ga0055532_1000069114 535
1027 3300003760 Ga0055527_1000034 Ga0055527_1000034114 535
1028 3300003761 Ga0055535_1000049 Ga0055535_1000049114 535
1029 3300003762 Ga0055542_1000077 Ga0055542_100007720 535
1030 3300003763 Ga0055529_1000090 Ga0055529_1000090113 535
1031 3300003763 Ga0055529_1001109 Ga0055529_100110912 535
1032 3300005327 Ga0070658_10148830 Ga0070658_101488301 535
1033 3300005339 Ga0070660_100042870 Ga0070660_1000428701 535
1034 3300005563 Ga0068855_100067537 Ga0068855_1000675373 535
1035 3300009093 Ga0105240_10089219 Ga0105240_100892192 535
1036 3300009177 Ga0105248_10069635 Ga0105248_100696355 535
1037 3300013306 Ga0163162_10007957 Ga0163162_1000795711 535
1038 3300016635 Ga0183361_10002 Ga0183361_10002407 535
1039 3300025225 Ga0209566_102656 Ga0209566_1026562 535
1040 3300025226 Ga0209674_100139 Ga0209674_10013920 535
1041 3300025226 Ga0209674_100155 Ga0209674_10015545 535
1042 3300025228 Ga0209672_100002 Ga0209672_1000021455 535
1043 3300025229 Ga0209147_100003 Ga0209147_1000031455 535
1044 3300025230 Ga0209563_101073 Ga0209563_1010735 535
1045 3300025231 Ga0207427_100494 Ga0207427_10049410 535
1046 3300025242 Ga0209258_100077 Ga0209258_100077110 535
1047 3300025254 Ga0209148_1000006 Ga0209148_10000061455 535
1048 3300025256 Ga0209759_1000138 Ga0209759_100013878 535
1049 3300025256 Ga0209759_1000170 Ga0209759_100017020 535
1050 3300025261 Ga0209233_1000177 Ga0209233_100017720 535
1051 3300025272 Ga0209455_1000140 Ga0209455_100014020 535
1052 3300025272 Ga0209455_1000534 Ga0209455_100053412 535
1053 3300025904 Ga0207647_10008189 Ga0207647_100081897 535
1054 3300025904 Ga0207647_10021580 Ga0207647_100215804 535
1055 3300025941 Ga0207711_10057548 Ga0207711_100575482 535
1056 3300025949 Ga0207667_10000690 Ga0207667_1000069038 535
1057 3300027312 Ga0209371_1014361 Ga0209371_10143612 535
1058 3300030500 Ga0268256_1015923 Ga0268256_10159232 535
1059 3300031911 Ga0307412_10000166 Ga0307412_1000016622 535
1060 3300046459 Ga0495629_0011880 Ga0495629_0011880_4636_6243 535
1061 3300046472 Ga0495580_0076658 Ga0495580_0076658_690_2297 535
1062 3300046500 Ga0495596_0007099 Ga0495596_0007099_160_1767 535
1063 3300046512 Ga0495610_0000678 Ga0495610_0000678_10382_11989 535
1064 3300046694 Ga0495649_0001816 Ga0495649_0001816_916_2523 535
1065 3300047323 Ga0495683_0016234 Ga0495683_0016234_494_2101 535
1066 3300047443 Ga0495687_005628 Ga0495687_005628_5919_7526 535
1067 3300047472 Ga0495686_0000002 Ga0495686_0000002_821975_823582 535
1068 3300047472 Ga0495686_0079555 Ga0495686_0079555_307_1914 535
1069 3300048909 Ga0496106_0000016 Ga0496106_0000016_113045_114655 535
1070 3300048920 Ga0496117_0009987 Ga0496117_0009987_6455_8062 535
1071 3300048921 Ga0496118_0026013 Ga0496118_0026013_1103_2710 535
1072 3300048924 Ga0496121_0013461 Ga0496121_0013461_1970_3580 535
1073 3300048927 Ga0496124_0093714 Ga0496124_0093714_172_1782 535
1074 3300049822 Ga0501035_0006648 Ga0501035_0006648_1334_2944 535
1075 3300049823 Ga0501044_0000185 Ga0501044_0000185_50577_52187 535

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00496

SBP_bac_5

Bacterial extracellular solute-binding proteins, family 5 Middle

108

479

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4o-assembly1.cif.gz_A-2 a 2.05a x-ray structureof a bacterial extracellular solute-binding protein, family 5 for bacillus anthracis str. ames 0.9164 33 534
5u4o-assembly1.cif.gz_A-2 a 2.05a x-ray structureof a bacterial extracellular solute-binding protein, family 5 for bacillus anthracis str. ames 0.9146 33 534
6i3g-assembly1.cif.gz_A crystal structure of a putative peptide binding protein appa from clostridium difficile 0.8922 37 534
6i3g-assembly1.cif.gz_A crystal structure of a putative peptide binding protein appa from clostridium difficile 0.8869 37 534
1uqw-assembly2.cif.gz_B crystal structure of ylib protein from escherichia coi 0.8773 33 534
ID Description Score Start End Superfamily
4qfkA03 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.9011 287 503 3.10.105.10
5f1qB03 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.8945 286 502 3.10.105.10
4oeuB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8935 203 288 3.40.190.10
3tpaA03 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.8923 287 503 3.10.105.10
4qfkA03 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.8895 287 503 3.10.105.10
ID Description Score Start End GO Terms
AF-A0A529HN05-F1-model_v4 ABC transporter substrate-binding protein 0.9936 295 426 GO:0015833
GO:1904680
AF-A0A211ZN59-F1-model_v4 Peptide ABC transporter substrate-binding protein 0.9757 28 533 GO:0015833
GO:0030288
GO:0043190
GO:1904680
AF-A0A2W7QIK8-F1-model_v4 Peptide/nickel transport system substrate-binding protein 0.9747 23 534 GO:0015833
GO:0030288
GO:0043190
GO:1904680
AF-A0A4Q2XGR4-F1-model_v4 deleted 0.9732 92 534
AF-A0A529NRT9-F1-model_v4 ABC transporter substrate-binding protein 0.9703 270 464 GO:0015031
GO:0015833
GO:0030313
GO:1904680

Feature Viewer

pLDDT pTM Quality
92.52 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map