F489489

General Info

Members Datasets Scaffolds Average Seq Length
1071 418 968 282

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_1051396|Ga0436360_1051396_11_928
Length 305
Sequence MSPIVSVNLPSPHTRPGGPRWSRMRPRLAITGAGGFLGRHLVRALRGADVEITLAVRDARRVAGFPGRFDVVELDLASPGPRAFDRLGRPDIVVHLAWGGLPNYRSMHHFETELPRHYAFLRDLVADGLKSVVVTGTCFEYGMQSGPLGEDLPCRPSSPYGLAKHALCRALEFLQATAPFDLVWARVFYVFGEGQAEQSLWSQLNRAVAEGRPRFEMSGGEQLRDFLPVTELAAYLAKLALIRRNLGAINVCSGRPQSVRGLVEGWIRQRGWSIELDLGRYPYPDYEPMAFWGTRDKLDAVLRLA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231006 Pseudomonas sp. GM17 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231008 Pseudomonas sp. GM21 Isolate Nodule
8 2511231010 Pseudomonas sp. GM25 Isolate Nodule
9 2511231011 Pseudomonas sp. GM30 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231018 Pseudomonas sp. GM60 Isolate Nodule
12 2511231020 Pseudomonas sp. GM74 Isolate Nodule
13 2511231022 Pseudomonas sp. GM79 Isolate Nodule
14 2511231023 Pseudomonas sp. GM80 Isolate Nodule
15 2511231031 Pseudomonas sp. GM16 Isolate Nodule
16 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
17 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
18 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
19 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
20 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
21 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
22 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
23 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
24 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
25 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
26 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
27 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
28 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
29 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
30 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
31 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
32 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
33 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
34 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
35 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
36 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
37 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
38 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
39 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
40 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
41 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
42 2643221718 Rhizobium sp. Root268 Isolate Unclassified
43 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
44 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
45 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
46 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
47 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
48 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
49 2734482264 Dyella sp. AD052 Isolate Unclassified
50 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
51 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
52 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
53 2765235841 Pseudomonas putida AA7 Isolate Unclassified
54 2773857670 Pseudomonas sp. 478 Isolate Unclassified
55 2773857673 Pseudomonas sp. 443 Isolate Unclassified
56 2784132063 Pseudomonas sp. 424 Isolate Unclassified
57 2784132072 Pseudomonas sp. 460 Isolate Unclassified
58 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
59 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
60 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
61 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
62 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
63 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
64 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
65 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
66 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
67 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
68 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
69 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
70 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
71 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
72 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
73 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
74 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
75 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
76 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
77 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
78 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
79 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
80 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
81 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
82 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
83 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
84 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
85 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
86 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
87 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
88 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
89 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
90 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
91 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
92 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
93 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
94 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
95 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
96 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
97 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
98 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
99 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
100 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
101 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
102 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
103 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
104 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
105 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
106 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
107 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
108 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
109 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
110 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
111 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
112 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
113 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
114 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
115 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
116 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
117 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
118 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
119 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
120 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
121 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
122 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
123 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
124 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
125 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
126 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
127 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
128 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
129 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
130 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
131 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
132 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
133 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
134 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
135 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
136 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
137 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
138 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
139 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
140 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
141 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
142 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
143 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
144 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
145 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
146 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
148 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
149 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
151 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
152 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
153 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
154 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
156 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
157 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
160 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
172 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
173 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
174 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
175 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
176 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
181 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
234 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
235 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
236 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
237 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
254 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
255 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
256 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
257 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
258 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
261 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
262 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
263 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
264 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
265 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
266 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
267 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
268 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
269 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
270 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
271 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
272 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
273 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
274 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
275 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
276 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
277 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
278 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
279 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
280 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
281 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
282 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
283 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
284 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
285 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
286 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
287 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
290 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
293 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
294 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
295 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
296 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
299 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
302 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
303 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
304 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
305 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
308 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
309 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
310 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
311 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
312 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
313 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
314 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
315 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
316 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
317 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
318 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
319 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
320 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
321 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
322 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
323 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
324 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
325 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
326 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
331 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
332 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
333 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
334 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
338 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
339 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
340 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
341 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
342 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
347 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
348 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
349 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
350 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
351 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
352 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
353 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
354 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
355 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
356 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
357 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
358 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
359 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
360 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
361 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
362 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
363 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
364 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
365 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
366 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
367 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
368 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
369 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
370 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
371 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
372 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
373 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
374 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
375 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
376 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
377 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
378 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
379 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
380 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
381 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
382 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
383 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
384 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
385 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
386 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
387 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
388 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
389 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
390 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
391 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
392 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
393 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
394 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
395 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
396 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
397 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
398 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
399 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
400 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
404 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
405 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
406 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
407 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
408 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
409 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
410 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
411 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
412 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
413 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
414 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
415 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
416 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
417 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
418 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.38
Metatranscriptomes 0
Isolates 9.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 1.96
Rhizoplane 2.99
Rhizosphere 82.35
Stem 0
Stem Tuber 0
Unclassified 8.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_523 2124908027 Bacteria 3119
2 MRS2a_Contig_9 2124908027 Bacteria 55585
3 SwRhRL2b_contig_2050723 2162886007 Bacteria 2951
4 MRS1b_contig_3223266 2162886011 Bacteria 2209
5 JGI25162J39368_1000037 3300002737 Bacteria 179339
6 JGI25163J39215_1000160 3300002771 Bacteria 26649
7 JGI25164J39214_1000020 3300002772 Bacteria 179339
8 JGI25165J46597_1000077 3300003214 Bacteria 179339
9 Ga0055536_1000041 3300003781 Bacteria 127266
10 Ga0055536_1000042 3300003781 Bacteria 125029
11 Ga0055536_1000441 3300003781 Bacteria 29203
12 Ga0055536_1000537 3300003781 Bacteria 26032
13 Ga0055530_10000063 3300003791 Bacteria 94619
14 Ga0055530_10000725 3300003791 Bacteria 27618
15 Ga0055540_1000501 3300003792 Bacteria 29848
16 Ga0055540_1000604 3300003792 Bacteria 25761
17 Ga0055531_10001274 3300003794 Bacteria 19001
18 Ga0065714_10000129 3300005288 Bacteria 12472
19 Ga0065714_10004405 3300005288 Bacteria 6412
20 Ga0065714_10004572 3300005288 Bacteria 6669
21 Ga0065704_10070547 3300005289 Bacteria 20984
22 Ga0065712_10000532 3300005290 Bacteria 15100
23 Ga0065715_10005656 3300005293 Bacteria 5768
24 Ga0070658_10139878 3300005327 Bacteria 2022
25 Ga0070658_10178264 3300005327 Bacteria 1788
26 Ga0070676_10011992 3300005328 Bacteria 4723
27 Ga0070676_10112682 3300005328 Bacteria 1696
28 Ga0070670_100002229 3300005331 Bacteria 15929
29 Ga0070670_100005687 3300005331 Bacteria 10530
30 Ga0070670_100024039 3300005331 Bacteria 5242
31 Ga0070670_100070010 3300005331 Bacteria 3011
32 Ga0070670_100273102 3300005331 Bacteria 1475
33 Ga0070677_10019981 3300005333 Bacteria 2434
34 Ga0070677_10023911 3300005333 Bacteria 2267
35 Ga0070677_10156006 3300005333 Bacteria 1067
36 Ga0068869_100039304 3300005334 Bacteria 3378
37 Ga0070666_10057619 3300005335 Bacteria 2625
38 Ga0068868_100066155 3300005338 Bacteria 2873
39 Ga0070661_100071883 3300005344 Bacteria 2546
40 Ga0070668_100001828 3300005347 Bacteria 15488
41 Ga0070669_100014691 3300005353 Bacteria 5573
42 Ga0070669_100029331 3300005353 Bacteria 3965
43 Ga0070669_100057759 3300005353 Bacteria 2847
44 Ga0070675_100007942 3300005354 Bacteria 8224
45 Ga0070675_100017439 3300005354 Bacteria 5705
46 Ga0070675_100063411 3300005354 Bacteria 3055
47 Ga0070675_100067337 3300005354 Bacteria 2963
48 Ga0070675_100093099 3300005354 Bacteria 2527
49 Ga0070675_100124059 3300005354 Bacteria 2196
50 Ga0070675_100298356 3300005354 Bacteria 1419
51 Ga0070671_100009709 3300005355 Bacteria 7732
52 Ga0070671_100030658 3300005355 Bacteria 4438
53 Ga0070671_100127077 3300005355 Bacteria 2147
54 Ga0070671_100152663 3300005355 Bacteria 1950
55 Ga0070674_100004695 3300005356 Bacteria 7810
56 Ga0070674_100373974 3300005356 Bacteria 1157
57 Ga0070673_100006275 3300005364 Bacteria 7712
58 Ga0070673_100067395 3300005364 Bacteria 2862
59 Ga0070659_100037609 3300005366 Bacteria 3774
60 Ga0070667_100012425 3300005367 Bacteria 7046
61 Ga0070667_100259701 3300005367 Bacteria 1555
62 Ga0070700_100043934 3300005441 Bacteria 2750
63 Ga0070678_100027482 3300005456 Bacteria 3863
64 Ga0070678_100144557 3300005456 Bacteria 1907
65 Ga0070678_100329309 3300005456 Bacteria 1307
66 Ga0070662_100002799 3300005457 Bacteria 10806
67 Ga0070662_100023071 3300005457 Bacteria 4270
68 Ga0070662_100041744 3300005457 Bacteria 3274
69 Ga0068867_100007420 3300005459 Bacteria 7754
70 Ga0068867_100009150 3300005459 Bacteria 6989
71 Ga0070684_100301644 3300005535 Bacteria 1470
72 Ga0070697_100082439 3300005536 Bacteria 2651
73 Ga0070672_100002981 3300005543 Bacteria 10904
74 Ga0070672_100005989 3300005543 Bacteria 8115
75 Ga0070696_100049229 3300005546 Bacteria 2927
76 Ga0070665_100140278 3300005548 Bacteria 2420
77 Ga0070665_100287230 3300005548 Bacteria 1647
78 Ga0068852_100066561 3300005616 Bacteria 3146
79 Ga0068852_100587130 3300005616 Bacteria 1117
80 Ga0068859_100040184 3300005617 Bacteria 4695
81 Ga0068864_100005858 3300005618 Bacteria 10072
82 Ga0068864_100072176 3300005618 Bacteria 3008
83 Ga0068866_10007584 3300005718 Bacteria 4549
84 Ga0068861_100004142 3300005719 Bacteria 9724
85 Ga0068851_10108670 3300005834 Bacteria 1479
86 Ga0068863_100003514 3300005841 Bacteria 15465
87 Ga0068863_100018571 3300005841 Bacteria 6654
88 Ga0068863_100105651 3300005841 Bacteria 2678
89 Ga0068858_100185585 3300005842 Bacteria 1964
90 Ga0068860_100036706 3300005843 Bacteria 4693
91 Ga0075364_10207418 3300006051 Bacteria 1329
92 Ga0075432_10000422 3300006058 Bacteria 12333
93 Ga0075432_10002595 3300006058 Bacteria 6032
94 Ga0075362_10081188 3300006177 Bacteria 1495
95 Ga0075369_10024983 3300006186 Bacteria 2481
96 Ga0075366_10013980 3300006195 Bacteria 4579
97 Ga0097621_100015345 3300006237 Bacteria 5762
98 Ga0097621_100069375 3300006237 Bacteria 2911
99 Ga0097621_100189366 3300006237 Bacteria 1781
100 Ga0068871_100001760 3300006358 Bacteria 14588
101 Ga0068871_100025548 3300006358 Bacteria 4597
102 Ga0075436_100033025 3300006914 Bacteria 3565
103 Ga0097620_100040185 3300006931 Bacteria 4695
104 Ga0079104_1003979 3300006946 Bacteria 6577
105 Ga0105251_10000060 3300009011 Bacteria 102799
106 Ga0105251_10000630 3300009011 Bacteria 32361
107 Ga0105251_10002026 3300009011 Bacteria 16435
108 Ga0105251_10004603 3300009011 Bacteria 9314
109 Ga0105251_10014831 3300009011 Bacteria 4284
110 Ga0105251_10039338 3300009011 Bacteria 2311
111 Ga0105251_10052192 3300009011 Bacteria 1947
112 Ga0105251_10083917 3300009011 Bacteria 1470
113 Ga0105244_10002159 3300009036 Bacteria 15083
114 Ga0105244_10002763 3300009036 Bacteria 13090
115 Ga0105244_10004488 3300009036 Bacteria 9585
116 Ga0105244_10018701 3300009036 Bacteria 3880
117 Ga0105244_10138646 3300009036 Bacteria 1171
118 Ga0105244_10151655 3300009036 Bacteria 1110
119 Ga0105250_10000979 3300009092 Bacteria 16634
120 Ga0105250_10001081 3300009092 Bacteria 15436
121 Ga0105250_10002986 3300009092 Bacteria 8213
122 Ga0105250_10007464 3300009092 Bacteria 4694
123 Ga0111539_10007100 3300009094 Bacteria 14354
124 Ga0105245_10020891 3300009098 Bacteria 5740
125 Ga0105243_10000162 3300009148 Bacteria 75904
126 Ga0105243_10022667 3300009148 Bacteria 4775
127 Ga0105248_10102314 3300009177 Bacteria 3229
128 Ga0105248_10647280 3300009177 Unclassified 1192
129 Ga0105246_10008116 3300011119 Bacteria 6444
130 Ga0157373_10001457 3300013100 Bacteria 18087
131 Ga0157373_10002764 3300013100 Bacteria 13273
132 Ga0157373_10008956 3300013100 Bacteria 7404
133 Ga0157373_10013196 3300013100 Bacteria 6064
134 Ga0157373_10014392 3300013100 Bacteria 5799
135 Ga0157371_10002880 3300013102 Bacteria 16085
136 Ga0157371_10003491 3300013102 Bacteria 14221
137 Ga0157371_10020080 3300013102 Bacteria 4920
138 Ga0157371_10070073 3300013102 Bacteria 2482
139 Ga0157370_10004442 3300013104 Bacteria 16069
140 Ga0157370_10008202 3300013104 Bacteria 11287
141 Ga0157370_10056197 3300013104 Bacteria 3746
142 Ga0157370_10086299 3300013104 Bacteria 2949
143 Ga0157370_10285461 3300013104 Bacteria 1525
144 Ga0157369_10008420 3300013105 Bacteria 11827
145 Ga0157369_10030650 3300013105 Bacteria 5931
146 Ga0157369_10293281 3300013105 Bacteria 1693
147 Ga0163162_10001271 3300013306 Bacteria 23584
148 Ga0163162_10004598 3300013306 Bacteria 13296
149 Ga0163162_10006558 3300013306 Bacteria 11276
150 Ga0163162_10018673 3300013306 Bacteria 6794
151 Ga0163162_10074928 3300013306 Bacteria 3444
152 Ga0163162_10095782 3300013306 Bacteria 3055
153 Ga0163162_10369762 3300013306 Bacteria 1567
154 Ga0163162_10506589 3300013306 Bacteria 1337
155 Ga0157372_10001365 3300013307 Bacteria 26415
156 Ga0157372_10182322 3300013307 Bacteria 2431
157 Ga0157375_10010475 3300013308 Bacteria 8160
158 Ga0157375_10046742 3300013308 Bacteria 4223
159 Ga0157375_10129766 3300013308 Bacteria 2639
160 Ga0157375_10231695 3300013308 Bacteria 2006
161 Ga0157375_10714532 3300013308 Bacteria 1155
162 Ga0157375_10738008 3300013308 Bacteria 1137
163 Ga0163163_10150092 3300014325 Bacteria 2375
164 Ga0163163_10179646 3300014325 Bacteria 2163
165 Ga0157380_10010808 3300014326 Bacteria 6581
166 Ga0157380_10040339 3300014326 Unclassified 3636
167 Ga0182008_10002027 3300014497 Bacteria 12993
168 Ga0182008_10004747 3300014497 Bacteria 7868
169 Ga0182008_10004863 3300014497 Bacteria 7762
170 Ga0182008_10006302 3300014497 Bacteria 6654
171 Ga0182008_10078408 3300014497 Bacteria 1625
172 Ga0157379_10009072 3300014968 Bacteria 8667
173 Ga0157376_10002090 3300014969 Bacteria 13430
174 Ga0157376_10003642 3300014969 Bacteria 10634
175 Ga0157376_10043120 3300014969 Bacteria 3701
176 Ga0182006_1001020 3300015261 Bacteria 18304
177 Ga0182006_1002669 3300015261 Bacteria 9601
178 Ga0182006_1055688 3300015261 Bacteria 1509
179 Ga0182007_10000729 3300015262 Bacteria 18597
180 Ga0182005_1003133 3300015265 Bacteria 5689
181 Ga0182005_1003396 3300015265 Bacteria 5417
182 Ga0182005_1018428 3300015265 Bacteria 1929
183 Ga0182005_1022877 3300015265 Bacteria 1710
184 Ga0182005_1023064 3300015265 Bacteria 1703
185 Ga0182005_1026198 3300015265 Bacteria 1591
186 Ga0163161_10002333 3300017792 Bacteria 13603
187 Ga0163161_10015126 3300017792 Bacteria 5378
188 Ga0163161_10021069 3300017792 Bacteria 4582
189 Ga0163161_10036517 3300017792 Bacteria 3519
190 Ga0163161_10040626 3300017792 Bacteria 3341
191 Ga0213876_10019248 3300021384 Bacteria 3606
192 Ga0209760_100053 3300025207 Bacteria 103438
193 Ga0209563_100535 3300025230 Bacteria 12790
194 Ga0207427_100001 3300025231 Bacteria 1410763
195 Ga0209437_100003 3300025233 Bacteria 1517827
196 Ga0209233_1000007 3300025261 Bacteria 1411234
197 Ga0209675_1002483 3300025291 Bacteria 9447
198 Ga0209676_1000016 3300025292 Bacteria 655561
199 Ga0209676_1000021 3300025292 Bacteria 609534
200 Ga0209676_1000033 3300025292 Bacteria 463236
201 Ga0209050_1000036 3300025298 Bacteria 423070
202 Ga0209050_1000107 3300025298 Bacteria 223303
203 Ga0209051_1000043 3300025303 Bacteria 305473
204 Ga0209051_1000474 3300025303 Bacteria 52139
205 Ga0209051_1047940 3300025303 Bacteria 1454
206 Ga0209257_1000098 3300025304 Bacteria 256390
207 Ga0209257_1015245 3300025304 Bacteria 3217
208 Ga0207697_10064968 3300025315 Bacteria 1522
209 Ga0207656_10069336 3300025321 Bacteria 1564
210 Ga0207696_1000101 3300025711 Bacteria 170899
211 Ga0207696_1000818 3300025711 Bacteria 20016
212 Ga0207696_1000979 3300025711 Bacteria 17265
213 Ga0207696_1002197 3300025711 Bacteria 9779
214 Ga0207655_1000402 3300025728 Bacteria 59961
215 Ga0207655_1001937 3300025728 Bacteria 17700
216 Ga0207655_1002976 3300025728 Bacteria 13005
217 Ga0207655_1008548 3300025728 Bacteria 6478
218 Ga0207655_1019806 3300025728 Bacteria 3494
219 Ga0207655_1026603 3300025728 Bacteria 2775
220 Ga0207655_1038191 3300025728 Bacteria 2103
221 Ga0207713_1000150 3300025735 Bacteria 105170
222 Ga0207713_1005386 3300025735 Bacteria 8024
223 Ga0207713_1006998 3300025735 Bacteria 6761
224 Ga0207713_1039279 3300025735 Bacteria 1998
225 Ga0207713_1040943 3300025735 Bacteria 1939
226 Ga0207682_10012514 3300025893 Bacteria 3311
227 Ga0207682_10017480 3300025893 Bacteria 2801
228 Ga0207682_10048593 3300025893 Bacteria 1749
229 Ga0207642_10033859 3300025899 Bacteria 2166
230 Ga0207688_10157340 3300025901 Bacteria 1345
231 Ga0207680_10064526 3300025903 Bacteria 2245
232 Ga0207680_10314395 3300025903 Bacteria 1094
233 Ga0207645_10004107 3300025907 Bacteria 10831
234 Ga0207643_10054378 3300025908 Bacteria 2275
235 Ga0207662_10044865 3300025918 Bacteria 2611
236 Ga0207649_10055026 3300025920 Bacteria 2479
237 Ga0207646_10002099 3300025922 Bacteria 23898
238 Ga0207681_10011566 3300025923 Bacteria 5422
239 Ga0207681_10024126 3300025923 Bacteria 3900
240 Ga0207650_10001201 3300025925 Bacteria 19013
241 Ga0207650_10002944 3300025925 Bacteria 11746
242 Ga0207650_10008268 3300025925 Bacteria 7104
243 Ga0207650_10042469 3300025925 Bacteria 3336
244 Ga0207650_10229608 3300025925 Bacteria 1496
245 Ga0207659_10017831 3300025926 Bacteria 4645
246 Ga0207659_10047638 3300025926 Bacteria 3033
247 Ga0207659_10056637 3300025926 Bacteria 2808
248 Ga0207659_10116093 3300025926 Bacteria 2043
249 Ga0207659_10153911 3300025926 Unclassified 1798
250 Ga0207644_10012599 3300025931 Bacteria 5620
251 Ga0207644_10160245 3300025931 Bacteria 1748
252 Ga0207690_10320643 3300025932 Bacteria 1218
253 Ga0207706_10008925 3300025933 Bacteria 9227
254 Ga0207706_10035537 3300025933 Bacteria 4429
255 Ga0207709_10000053 3300025935 Bacteria 225514
256 Ga0207709_10019377 3300025935 Bacteria 3825
257 Ga0207670_10067725 3300025936 Bacteria 2457
258 Ga0207669_10005768 3300025937 Bacteria 5591
259 Ga0207704_10172954 3300025938 Bacteria 1551
260 Ga0207691_10000964 3300025940 Bacteria 28552
261 Ga0207691_10025170 3300025940 Bacteria 5589
262 Ga0207691_10070219 3300025940 Bacteria 3163
263 Ga0207691_10118545 3300025940 Bacteria 2348
264 Ga0207711_10082130 3300025941 Bacteria 2816
265 Ga0207711_10196189 3300025941 Bacteria 1841
266 Ga0207689_10010069 3300025942 Bacteria 8148
267 Ga0207679_10421162 3300025945 Bacteria 1178
268 Ga0207651_10001048 3300025960 Bacteria 12244
269 Ga0207651_10055966 3300025960 Bacteria 2712
270 Ga0207712_10018024 3300025961 Bacteria 4594
271 Ga0207640_10284192 3300025981 Bacteria 1301
272 Ga0207658_10028783 3300025986 Bacteria 3916
273 Ga0207658_10080727 3300025986 Bacteria 2492
274 Ga0207677_10169222 3300026023 Bacteria 1707
275 Ga0207703_10039834 3300026035 Bacteria 3758
276 Ga0207639_10081823 3300026041 Bacteria 2558
277 Ga0207641_10007595 3300026088 Bacteria 9017
278 Ga0207641_10014579 3300026088 Bacteria 6444
279 Ga0207641_10133945 3300026088 Bacteria 2228
280 Ga0207648_10020407 3300026089 Bacteria 5966
281 Ga0207648_10034632 3300026089 Bacteria 4451
282 Ga0207648_10049136 3300026089 Bacteria 3693
283 Ga0207676_10121560 3300026095 Bacteria 2203
284 Ga0207674_10143439 3300026116 Bacteria 2347
285 Ga0207675_100006516 3300026118 Bacteria 11049
286 Ga0207683_10032674 3300026121 Bacteria 4520
287 Ga0207683_10048104 3300026121 Bacteria 3735
288 Ga0207683_10074060 3300026121 Bacteria 3013
289 Ga0207683_10190295 3300026121 Bacteria 1863
290 Ga0207698_10029360 3300026142 Bacteria 3938
291 Ga0209281_1004437 3300027111 Bacteria 4201
292 Ga0207428_10073217 3300027907 Bacteria 2688
293 Ga0207428_10080653 3300027907 Bacteria 2542
294 Ga0268266_10054016 3300028379 Bacteria 3452
295 Ga0268266_10149169 3300028379 Bacteria 2106
296 Ga0268266_10218183 3300028379 Bacteria 1752
297 Ga0268265_10062451 3300028380 Bacteria 2862
298 Ga0268264_10010901 3300028381 Bacteria 7510
299 Ga0307515_10000180 3300028794 Bacteria 156173
300 Ga0307515_10155775 3300028794 Bacteria 2359
301 Ga0265324_10000032 3300029957 Bacteria 125653
302 Ga0316181_1060393 3300030744 Bacteria 4243
303 Ga0265332_10000004 3300031238 Bacteria 426592
304 Ga0265331_10024250 3300031250 Bacteria 3071
305 Ga0307408_100002045 3300031548 Bacteria 14522
306 Ga0307408_100002790 3300031548 Bacteria 12127
307 Ga0307408_100021941 3300031548 Bacteria 4330
308 Ga0307408_100295151 3300031548 Bacteria 1355
309 Ga0307408_100499494 3300031548 Bacteria 1064
310 Ga0265314_10010534 3300031711 Bacteria 7698
311 Ga0307405_10001772 3300031731 Bacteria 9241
312 Ga0307405_10006846 3300031731 Bacteria 5651
313 Ga0307413_10022187 3300031824 Bacteria 3416
314 Ga0307406_10002886 3300031901 Bacteria 9361
315 Ga0307412_10001193 3300031911 Bacteria 14815
316 Ga0307412_10003158 3300031911 Bacteria 9150
317 Ga0307412_10007173 3300031911 Bacteria 6326
318 Ga0307412_10100642 3300031911 Bacteria 2043
319 Ga0307412_10632622 3300031911 Bacteria 910
320 Ga0307409_100000746 3300031995 Bacteria 14658
321 Ga0307416_100011193 3300032002 Bacteria 5963
322 Ga0307416_100062975 3300032002 Bacteria 3035
323 Ga0307416_100070403 3300032002 Bacteria 2900
324 Ga0307416_100180371 3300032002 Bacteria 1978
325 Ga0307414_10029301 3300032004 Bacteria 3581
326 Ga0307414_10068668 3300032004 Bacteria 2544
327 Ga0307411_10005587 3300032005 Bacteria 6195
328 Ga0307411_10189722 3300032005 Bacteria 1568
329 Ga0307510_10005583 3300033180 Bacteria 14990
330 Ga0373953_0062927 3300035117 Bacteria 1520
331 Ga0373937_0038014 3300036401 Bacteria 4387
332 Ga0373937_0057084 3300036401 Bacteria 3586
333 Ga0373937_0063401 3300036401 Bacteria 3399
334 Ga0436365_1450265 3300039437 Bacteria 5822
335 Ga0436360_1051396 3300039438 Bacteria 1307
336 Ga0436363_1071075 3300039450 Bacteria 3782
337 Ga0439438_000562 3300041405 Bacteria 16896
338 Ga0439438_000735 3300041405 Bacteria 14715
339 Ga0439438_000802 3300041405 Bacteria 14035
340 Ga0439438_002175 3300041405 Bacteria 8448
341 Ga0439438_003910 3300041405 Bacteria 5864
342 Ga0439438_010537 3300041405 Bacteria 2917
343 Ga0439447_000425 3300041407 Bacteria 15732
344 Ga0439447_002399 3300041407 Bacteria 6847
345 Ga0439447_004257 3300041407 Bacteria 4960
346 Ga0439447_009600 3300041407 Bacteria 2921
347 Ga0439447_025666 3300041407 Bacteria 1516
348 Ga0439447_036537 3300041407 Bacteria 1213
349 Ga0439466_0000563 3300041411 Bacteria 13959
350 Ga0439466_0000841 3300041411 Bacteria 11679
351 Ga0439466_0005342 3300041411 Bacteria 4911
352 Ga0439466_0012552 3300041411 Bacteria 3118
353 Ga0439466_0013241 3300041411 Bacteria 3021
354 Ga0439466_0014195 3300041411 Bacteria 2904
355 Ga0439465_0011279 3300041413 Bacteria 2804
356 Ga0439465_0125953 3300041413 Bacteria 901
357 Ga0451795_1645496 3300041456 Bacteria 1533
358 Ga0451853_1460144 3300041512 Bacteria 1441
359 Ga0439431_0001457 3300041997 Bacteria 5221
360 Ga0439445_0005750 3300042004 Bacteria 2833
361 Ga0439445_0013812 3300042004 Bacteria 1958
362 Ga0439432_001707 3300042006 Bacteria 8217
363 Ga0439432_003625 3300042006 Bacteria 5714
364 Ga0439432_011449 3300042006 Bacteria 3057
365 Ga0439432_014115 3300042006 Bacteria 2706
366 Ga0439432_027166 3300042006 Bacteria 1870
367 Ga0439432_031711 3300042006 Bacteria 1707
368 Ga0439451_000102 3300042009 Bacteria 15228
369 Ga0439451_000661 3300042009 Bacteria 6532
370 Ga0439451_002603 3300042009 Bacteria 3666
371 Ga0439451_007124 3300042009 Bacteria 2285
372 Ga0439451_038558 3300042009 Bacteria 959
373 Ga0439452_000346 3300042010 Bacteria 28745
374 Ga0439452_001509 3300042010 Bacteria 9418
375 Ga0439452_002656 3300042010 Bacteria 6504
376 Ga0439452_003450 3300042010 Bacteria 5527
377 Ga0439452_004522 3300042010 Bacteria 4651
378 Ga0439452_006238 3300042010 Bacteria 3749
379 Ga0439452_007239 3300042010 Bacteria 3412
380 Ga0439456_000497 3300042013 Bacteria 8476
381 Ga0439456_000503 3300042013 Bacteria 8414
382 Ga0439456_001748 3300042013 Bacteria 4394
383 Ga0439456_005305 3300042013 Bacteria 2617
384 Ga0439456_005912 3300042013 Bacteria 2490
385 Ga0439456_019207 3300042013 Bacteria 1436
386 Ga0439456_037794 3300042013 Bacteria 1043
387 Ga0439463_000413 3300042016 Bacteria 11870
388 Ga0439463_002586 3300042016 Bacteria 4591
389 Ga0439463_006040 3300042016 Bacteria 3008
390 Ga0439463_026429 3300042016 Bacteria 1458
391 Ga0439463_036985 3300042016 Bacteria 1237
392 Ga0450911_000142 3300042115 Bacteria 29194
393 Ga0450911_001259 3300042115 Bacteria 6064
394 Ga0450911_004427 3300042115 Bacteria 2304
395 Ga0450890_000374 3300042127 Bacteria 6519
396 Ga0450891_000894 3300042129 Bacteria 3120
397 Ga0450900_000041 3300042136 Bacteria 5773
398 Ga0450902_002552 3300042137 Bacteria 2588
399 Ga0450902_006507 3300042137 Bacteria 1789
400 Ga0450903_004423 3300042138 Bacteria 2395
401 Ga0450903_006832 3300042138 Bacteria 1888
402 Ga0450903_007371 3300042138 Bacteria 1812
403 Ga0450903_012148 3300042138 Bacteria 1377
404 Ga0450904_001612 3300042139 Bacteria 3055
405 Ga0450905_000228 3300042142 Bacteria 6434
406 Ga0450905_011848 3300042142 Bacteria 1223
407 Ga0450889_006595 3300042144 Bacteria 1166
408 Ga0450906_000168 3300042145 Bacteria 12261
409 Ga0450907_006358 3300042146 Bacteria 1972
410 Ga0450907_010806 3300042146 Bacteria 1515
411 Ga0450910_000525 3300042147 Bacteria 4560
412 Ga0450910_003111 3300042147 Bacteria 2192
413 Ga0439446_0002357 3300042156 Bacteria 4522
414 Ga0439446_0011777 3300042156 Bacteria 2379
415 Ga0450908_002485 3300042184 Bacteria 3605
416 Ga0450909_000239 3300042185 Bacteria 6543
417 Ga0439434_0015160 3300042435 Bacteria 2297
418 Ga0439464_0016065 3300042439 Bacteria 2023
419 Ga0439460_0001455 3300042461 Bacteria 5591
420 Ga0439460_0001896 3300042461 Bacteria 4992
421 Ga0450918_004793 3300042531 Bacteria 2448
422 Ga0450893_0003582 3300042532 Bacteria 2447
423 Ga0450893_0004680 3300042532 Bacteria 2182
424 Ga0439440_0017354 3300042993 Bacteria 1584
425 Ga0453684_0116111 3300044712 Bacteria 3242
426 Ga0495617_000328 3300046452 Bacteria 26666
427 Ga0495617_010227 3300046452 Bacteria 3213
428 Ga0495617_018016 3300046452 Bacteria 2387
429 Ga0495617_020665 3300046452 Bacteria 2225
430 Ga0495617_031546 3300046452 Bacteria 1779
431 Ga0495627_001228 3300046453 Bacteria 15983
432 Ga0495627_003513 3300046453 Bacteria 6869
433 Ga0495627_004102 3300046453 Bacteria 6190
434 Ga0495627_004134 3300046453 Bacteria 6157
435 Ga0495627_010317 3300046453 Bacteria 3401
436 Ga0495627_030443 3300046453 Bacteria 1710
437 Ga0495592_0013417 3300046454 Bacteria 6234
438 Ga0495603_0000519 3300046455 Bacteria 21413
439 Ga0495603_0007925 3300046455 Bacteria 6408
440 Ga0495590_0002661 3300046457 Bacteria 7382
441 Ga0495590_0002663 3300046457 Bacteria 7379
442 Ga0495590_0003209 3300046457 Bacteria 6683
443 Ga0495590_0003906 3300046457 Bacteria 6064
444 Ga0495590_0029613 3300046457 Bacteria 1918
445 Ga0495591_000256 3300046458 Bacteria 50723
446 Ga0495591_001026 3300046458 Bacteria 18885
447 Ga0495591_001411 3300046458 Bacteria 14972
448 Ga0495591_002226 3300046458 Bacteria 11056
449 Ga0495591_003670 3300046458 Bacteria 7806
450 Ga0495591_019789 3300046458 Bacteria 2243
451 Ga0495591_021687 3300046458 Bacteria 2091
452 Ga0495591_026058 3300046458 Bacteria 1824
453 Ga0495591_044566 3300046458 Bacteria 1241
454 Ga0495629_0005998 3300046459 Bacteria 9035
455 Ga0495629_0106403 3300046459 Bacteria 1957
456 Ga0495629_0130859 3300046459 Bacteria 1748
457 Ga0495638_0000059 3300046460 Bacteria 191461
458 Ga0495638_0007805 3300046460 Bacteria 7641
459 Ga0495638_0008730 3300046460 Bacteria 7162
460 Ga0495638_0010285 3300046460 Bacteria 6507
461 Ga0495638_0044002 3300046460 Bacteria 2814
462 Ga0495638_0044050 3300046460 Bacteria 2812
463 Ga0495638_0070716 3300046460 Bacteria 2136
464 Ga0495638_0181745 3300046460 Bacteria 1199
465 Ga0495653_0003581 3300046463 Bacteria 12522
466 Ga0495653_0005114 3300046463 Bacteria 10644
467 Ga0495653_0015400 3300046463 Bacteria 6232
468 Ga0495653_0030146 3300046463 Bacteria 4323
469 Ga0495653_0202670 3300046463 Bacteria 1345
470 Ga0495653_0259776 3300046463 Bacteria 1149
471 Ga0495650_0001778 3300046471 Bacteria 19540
472 Ga0495650_0005113 3300046471 Bacteria 8668
473 Ga0495650_0007214 3300046471 Bacteria 6735
474 Ga0495650_0018563 3300046471 Bacteria 3450
475 Ga0495650_0021962 3300046471 Bacteria 3069
476 Ga0495605_0000032 3300046474 Bacteria 210550
477 Ga0495605_0000857 3300046474 Bacteria 21145
478 Ga0495605_0001277 3300046474 Bacteria 16686
479 Ga0495605_0001888 3300046474 Bacteria 13393
480 Ga0495605_0002198 3300046474 Bacteria 12184
481 Ga0495605_0002521 3300046474 Bacteria 11299
482 Ga0495605_0006105 3300046474 Bacteria 6950
483 Ga0495605_0007807 3300046474 Bacteria 6062
484 Ga0495605_0014566 3300046474 Bacteria 4301
485 Ga0495605_0018889 3300046474 Bacteria 3690
486 Ga0495605_0024838 3300046474 Bacteria 3130
487 Ga0495605_0036323 3300046474 Bacteria 2484
488 Ga0495605_0052299 3300046474 Bacteria 1985
489 Ga0495639_0000241 3300046475 Bacteria 27157
490 Ga0495639_0003322 3300046475 Bacteria 6970
491 Ga0495664_0159173 3300046477 Bacteria 1370
492 Ga0495664_0295119 3300046477 Bacteria 979
493 Ga0495584_0001923 3300046491 Bacteria 11941
494 Ga0495584_0002126 3300046491 Bacteria 11350
495 Ga0495584_0002304 3300046491 Bacteria 10892
496 Ga0495584_0003690 3300046491 Bacteria 8341
497 Ga0495584_0010843 3300046491 Bacteria 4677
498 Ga0495584_0019174 3300046491 Bacteria 3474
499 Ga0495584_0027976 3300046491 Bacteria 2856
500 Ga0495585_0001287 3300046492 Bacteria 19986
501 Ga0495585_0002592 3300046492 Bacteria 12784
502 Ga0495585_0009763 3300046492 Bacteria 5743
503 Ga0495585_0013045 3300046492 Bacteria 4875
504 Ga0495585_0035974 3300046492 Bacteria 2796
505 Ga0495585_0041146 3300046492 Bacteria 2592
506 Ga0495585_0041191 3300046492 Bacteria 2591
507 Ga0495594_0001279 3300046499 Bacteria 13157
508 Ga0495594_0007038 3300046499 Bacteria 5782
509 Ga0495594_0037845 3300046499 Bacteria 2633
510 Ga0495594_0039263 3300046499 Bacteria 2588
511 Ga0495596_0054128 3300046500 Bacteria 1570
512 Ga0495607_0000121 3300046501 Bacteria 82194
513 Ga0495607_0000563 3300046501 Bacteria 36192
514 Ga0495607_0001138 3300046501 Bacteria 24105
515 Ga0495607_0001754 3300046501 Bacteria 18561
516 Ga0495607_0002115 3300046501 Bacteria 16578
517 Ga0495607_0003276 3300046501 Bacteria 12455
518 Ga0495607_0006139 3300046501 Bacteria 8501
519 Ga0495607_0007248 3300046501 Bacteria 7698
520 Ga0495607_0007895 3300046501 Bacteria 7319
521 Ga0495607_0008577 3300046501 Bacteria 6979
522 Ga0495607_0008832 3300046501 Bacteria 6860
523 Ga0495607_0009002 3300046501 Bacteria 6789
524 Ga0495607_0009248 3300046501 Bacteria 6691
525 Ga0495607_0009800 3300046501 Bacteria 6469
526 Ga0495607_0011881 3300046501 Bacteria 5768
527 Ga0495607_0012597 3300046501 Bacteria 5573
528 Ga0495607_0025600 3300046501 Bacteria 3668
529 Ga0495607_0045804 3300046501 Bacteria 2570
530 Ga0495607_0074277 3300046501 Bacteria 1887
531 Ga0495583_0000052 3300046506 Bacteria 211902
532 Ga0495583_0001042 3300046506 Bacteria 31294
533 Ga0495583_0001955 3300046506 Bacteria 18959
534 Ga0495583_0043477 3300046506 Bacteria 2091
535 Ga0495583_0115354 3300046506 Bacteria 1135
536 Ga0495606_0001451 3300046507 Bacteria 31744
537 Ga0495606_0013096 3300046507 Bacteria 6587
538 Ga0495606_0025197 3300046507 Bacteria 4266
539 Ga0495606_0027499 3300046507 Bacteria 4031
540 Ga0495610_0000720 3300046512 Bacteria 31450
541 Ga0495610_0002376 3300046512 Bacteria 15885
542 Ga0495610_0019617 3300046512 Bacteria 3776
543 Ga0495610_0019910 3300046512 Bacteria 3740
544 Ga0495610_0031497 3300046512 Bacteria 2766
545 Ga0495610_0039683 3300046512 Bacteria 2378
546 Ga0495610_0073402 3300046512 Bacteria 1590
547 Ga0495610_0074105 3300046512 Bacteria 1580
548 Ga0495616_0000377 3300046513 Bacteria 34744
549 Ga0495616_0001708 3300046513 Bacteria 14982
550 Ga0495616_0002074 3300046513 Bacteria 13465
551 Ga0495616_0002254 3300046513 Bacteria 12909
552 Ga0495616_0006526 3300046513 Bacteria 7046
553 Ga0495616_0006718 3300046513 Bacteria 6938
554 Ga0495616_0008680 3300046513 Bacteria 5996
555 Ga0495616_0018577 3300046513 Bacteria 3813
556 Ga0495616_0019845 3300046513 Bacteria 3663
557 Ga0495616_0095736 3300046513 Bacteria 1399
558 Ga0495620_0000019 3300046515 Bacteria 150014
559 Ga0495620_0000338 3300046515 Bacteria 32631
560 Ga0495620_0005406 3300046515 Bacteria 7129
561 Ga0495620_0008361 3300046515 Bacteria 5560
562 Ga0495620_0020743 3300046515 Bacteria 3203
563 Ga0495620_0036333 3300046515 Bacteria 2205
564 Ga0495620_0040610 3300046515 Bacteria 2046
565 Ga0495628_0114971 3300046516 Bacteria 2067
566 Ga0495630_0045820 3300046517 Bacteria 3268
567 Ga0495631_0000638 3300046518 Bacteria 22896
568 Ga0495631_0002043 3300046518 Bacteria 11752
569 Ga0495631_0005944 3300046518 Bacteria 6349
570 Ga0495631_0006154 3300046518 Bacteria 6219
571 Ga0495631_0031299 3300046518 Bacteria 2408
572 Ga0495632_0001741 3300046519 Bacteria 17649
573 Ga0495632_0002607 3300046519 Bacteria 13584
574 Ga0495632_0003111 3300046519 Bacteria 12021
575 Ga0495632_0010529 3300046519 Bacteria 5465
576 Ga0495632_0031822 3300046519 Bacteria 2723
577 Ga0495632_0034404 3300046519 Bacteria 2593
578 Ga0495632_0047592 3300046519 Bacteria 2126
579 Ga0495637_0000428 3300046520 Bacteria 30739
580 Ga0495637_0000625 3300046520 Bacteria 24990
581 Ga0495637_0000898 3300046520 Bacteria 19215
582 Ga0495637_0001294 3300046520 Bacteria 15043
583 Ga0495637_0005171 3300046520 Bacteria 6683
584 Ga0495637_0005398 3300046520 Bacteria 6529
585 Ga0495637_0005684 3300046520 Bacteria 6326
586 Ga0495637_0006580 3300046520 Bacteria 5813
587 Ga0495637_0017508 3300046520 Bacteria 3337
588 Ga0495637_0019929 3300046520 Bacteria 3093
589 Ga0495637_0070533 3300046520 Bacteria 1411
590 Ga0495643_0002218 3300046522 Bacteria 15787
591 Ga0495643_0002334 3300046522 Bacteria 15240
592 Ga0495643_0002599 3300046522 Bacteria 14076
593 Ga0495643_0002768 3300046522 Bacteria 13410
594 Ga0495643_0008430 3300046522 Bacteria 6523
595 Ga0495643_0009655 3300046522 Bacteria 5977
596 Ga0495643_0058493 3300046522 Bacteria 2051
597 Ga0495644_0002414 3300046523 Bacteria 7452
598 Ga0495644_0003490 3300046523 Bacteria 6221
599 Ga0495644_0038159 3300046523 Bacteria 1812
600 Ga0495644_0059060 3300046523 Bacteria 1442
601 Ga0495648_0000997 3300046524 Bacteria 29079
602 Ga0495648_0002902 3300046524 Bacteria 15418
603 Ga0495648_0004415 3300046524 Bacteria 12017
604 Ga0495648_0005728 3300046524 Bacteria 10253
605 Ga0495648_0015869 3300046524 Bacteria 5445
606 Ga0495648_0017162 3300046524 Bacteria 5186
607 Ga0495648_0037432 3300046524 Bacteria 3117
608 Ga0495648_0044124 3300046524 Bacteria 2786
609 Ga0495648_0066505 3300046524 Bacteria 2113
610 Ga0495648_0073176 3300046524 Bacteria 1980
611 Ga0495648_0095192 3300046524 Bacteria 1657
612 Ga0495648_0115944 3300046524 Bacteria 1448
613 Ga0495666_0008015 3300046526 Bacteria 5291
614 Ga0495666_0033192 3300046526 Bacteria 2523
615 Ga0495666_0041523 3300046526 Bacteria 2227
616 Ga0495666_0046452 3300046526 Bacteria 2093
617 Ga0495666_0069736 3300046526 Bacteria 1672
618 Ga0495642_0000151 3300046528 Bacteria 40418
619 Ga0495642_0000506 3300046528 Bacteria 20118
620 Ga0495642_0001115 3300046528 Bacteria 12392
621 Ga0495654_0000663 3300046530 Bacteria 27117
622 Ga0495654_0000819 3300046530 Bacteria 23673
623 Ga0495654_0001683 3300046530 Bacteria 14893
624 Ga0495654_0004044 3300046530 Bacteria 8810
625 Ga0495654_0020931 3300046530 Bacteria 3406
626 Ga0495654_0024144 3300046530 Bacteria 3143
627 Ga0495654_0031806 3300046530 Bacteria 2677
628 Ga0495654_0033304 3300046530 Bacteria 2608
629 Ga0495654_0087861 3300046530 Bacteria 1446
630 Ga0495654_0110325 3300046530 Bacteria 1256
631 Ga0495587_0001556 3300046536 Bacteria 15262
632 Ga0495587_0004482 3300046536 Bacteria 9185
633 Ga0495587_0051964 3300046536 Bacteria 2420
634 Ga0495598_0021050 3300046537 Bacteria 1730
635 Ga0495609_0000032 3300046538 Bacteria 211021
636 Ga0495609_0001044 3300046538 Bacteria 19418
637 Ga0495609_0001602 3300046538 Bacteria 14792
638 Ga0495609_0003586 3300046538 Bacteria 8821
639 Ga0495609_0003790 3300046538 Bacteria 8511
640 Ga0495609_0004832 3300046538 Bacteria 7268
641 Ga0495609_0011106 3300046538 Bacteria 4299
642 Ga0495609_0019776 3300046538 Bacteria 3113
643 Ga0495609_0026373 3300046538 Bacteria 2661
644 Ga0495609_0029567 3300046538 Bacteria 2494
645 Ga0495609_0044311 3300046538 Bacteria 1996
646 Ga0495609_0092297 3300046538 Bacteria 1316
647 Ga0495597_0000852 3300046542 Bacteria 23978
648 Ga0495597_0003440 3300046542 Bacteria 9242
649 Ga0495597_0005741 3300046542 Bacteria 6520
650 Ga0495597_0037447 3300046542 Bacteria 2177
651 Ga0495597_0049710 3300046542 Bacteria 1852
652 Ga0495645_0013574 3300046543 Bacteria 5765
653 Ga0495645_0033134 3300046543 Bacteria 3769
654 Ga0495622_0000294 3300046557 Bacteria 37526
655 Ga0495622_0000418 3300046557 Bacteria 28124
656 Ga0495622_0010785 3300046557 Bacteria 4215
657 Ga0495622_0044666 3300046557 Bacteria 2059
658 Ga0495633_0000040 3300046558 Bacteria 177876
659 Ga0495633_0003735 3300046558 Bacteria 10021
660 Ga0495633_0007547 3300046558 Bacteria 6243
661 Ga0495633_0066898 3300046558 Bacteria 1678
662 Ga0495667_0227340 3300046559 Bacteria 1190
663 Ga0495656_0028388 3300046615 Bacteria 2244
664 Ga0495656_0059671 3300046615 Bacteria 1660
665 Ga0495668_0001353 3300046616 Bacteria 24063
666 Ga0495668_0032107 3300046616 Bacteria 2956
667 Ga0495668_0050697 3300046616 Bacteria 2299
668 Ga0495668_0096456 3300046616 Bacteria 1618
669 Ga0495634_0008936 3300046642 Bacteria 7418
670 Ga0495634_0010361 3300046642 Bacteria 6830
671 Ga0495611_0000001 3300046648 Bacteria 2628469
672 Ga0495611_0000027 3300046648 Bacteria 116663
673 Ga0495611_0000918 3300046648 Bacteria 15934
674 Ga0495611_0003256 3300046648 Bacteria 7178
675 Ga0495611_0003539 3300046648 Bacteria 6868
676 Ga0495611_0007338 3300046648 Bacteria 4680
677 Ga0495611_0019423 3300046648 Bacteria 2919
678 Ga0495611_0084838 3300046648 Bacteria 1460
679 Ga0495625_0000037 3300046660 Bacteria 219383
680 Ga0495625_0002110 3300046660 Bacteria 22195
681 Ga0495625_0004836 3300046660 Bacteria 12576
682 Ga0495625_0014674 3300046660 Bacteria 6240
683 Ga0495625_0017547 3300046660 Bacteria 5603
684 Ga0495625_0058085 3300046660 Bacteria 2749
685 Ga0495625_0058410 3300046660 Bacteria 2741
686 Ga0495625_0090300 3300046660 Bacteria 2119
687 Ga0495625_0101294 3300046660 Bacteria 1978
688 Ga0495625_0175066 3300046660 Bacteria 1430
689 Ga0495635_0009714 3300046663 Bacteria 6724
690 Ga0495635_0079253 3300046663 Bacteria 2248
691 Ga0495635_0086663 3300046663 Unclassified 2143
692 Ga0495635_0210353 3300046663 Bacteria 1317
693 Ga0495659_0000883 3300046664 Bacteria 10659
694 Ga0495659_0032182 3300046664 Bacteria 1834
695 Ga0495659_0035335 3300046664 Bacteria 1761
696 Ga0495661_0000037 3300046665 Bacteria 164234
697 Ga0495661_0003926 3300046665 Bacteria 10855
698 Ga0495661_0007526 3300046665 Bacteria 7591
699 Ga0495661_0010570 3300046665 Bacteria 6293
700 Ga0495661_0011316 3300046665 Bacteria 6054
701 Ga0495661_0011493 3300046665 Bacteria 6006
702 Ga0495661_0048213 3300046665 Bacteria 2589
703 Ga0495661_0059485 3300046665 Bacteria 2274
704 Ga0495661_0064341 3300046665 Bacteria 2164
705 Ga0495661_0088173 3300046665 Bacteria 1772
706 Ga0495588_0012636 3300046674 Bacteria 3996
707 Ga0495588_0018140 3300046674 Bacteria 3427
708 Ga0495588_0053688 3300046674 Bacteria 2078
709 Ga0495588_0102262 3300046674 Bacteria 1506
710 Ga0495588_0133269 3300046674 Bacteria 1311
711 Ga0495599_0380902 3300046678 Bacteria 842
712 Ga0495623_0009046 3300046679 Bacteria 6460
713 Ga0495646_0000953 3300046680 Bacteria 16510
714 Ga0495646_0059661 3300046680 Bacteria 2278
715 Ga0495646_0163730 3300046680 Bacteria 1230
716 Ga0495658_0031488 3300046683 Bacteria 2890
717 Ga0495669_0001725 3300046684 Bacteria 8942
718 Ga0495669_0003637 3300046684 Bacteria 6349
719 Ga0495613_0012226 3300046689 Bacteria 6379
720 Ga0495613_0032289 3300046689 Bacteria 3888
721 Ga0495613_0048129 3300046689 Bacteria 3148
722 Ga0495613_0066682 3300046689 Bacteria 2628
723 Ga0495624_0001882 3300046690 Bacteria 15976
724 Ga0495670_0000709 3300046691 Bacteria 15882
725 Ga0495670_0004374 3300046691 Bacteria 6927
726 Ga0495670_0005236 3300046691 Bacteria 6382
727 Ga0495670_0023737 3300046691 Bacteria 3027
728 Ga0495670_0032594 3300046691 Bacteria 2591
729 Ga0495670_0043751 3300046691 Bacteria 2235
730 Ga0495670_0050965 3300046691 Bacteria 2072
731 Ga0495670_0065327 3300046691 Bacteria 1834
732 Ga0495671_0001424 3300046692 Bacteria 16086
733 Ga0495671_0001841 3300046692 Bacteria 13642
734 Ga0495671_0002352 3300046692 Bacteria 12007
735 Ga0495671_0005900 3300046692 Bacteria 7127
736 Ga0495671_0012431 3300046692 Bacteria 4650
737 Ga0495671_0020650 3300046692 Bacteria 3468
738 Ga0495671_0021664 3300046692 Bacteria 3372
739 Ga0495671_0032052 3300046692 Bacteria 2684
740 Ga0495671_0040679 3300046692 Bacteria 2343
741 Ga0495671_0115570 3300046692 Bacteria 1310
742 Ga0495649_0002234 3300046694 Bacteria 13781
743 Ga0495649_0002275 3300046694 Bacteria 13644
744 Ga0495649_0005634 3300046694 Bacteria 7913
745 Ga0495649_0008096 3300046694 Bacteria 6343
746 Ga0495649_0009798 3300046694 Bacteria 5671
747 Ga0495649_0037996 3300046694 Bacteria 2642
748 Ga0495649_0067181 3300046694 Bacteria 1923
749 Ga0495589_0000263 3300046794 Bacteria 42994
750 Ga0495589_0000366 3300046794 Bacteria 35102
751 Ga0495589_0000858 3300046794 Bacteria 19063
752 Ga0495589_0002405 3300046794 Bacteria 10516
753 Ga0495589_0003745 3300046794 Bacteria 8185
754 Ga0495589_0004393 3300046794 Bacteria 7512
755 Ga0495589_0007845 3300046794 Bacteria 5587
756 Ga0495589_0008973 3300046794 Bacteria 5202
757 Ga0495600_0018471 3300046809 Bacteria 4443
758 Ga0495660_0002590 3300046810 Bacteria 11489
759 Ga0495660_0006354 3300046810 Bacteria 7001
760 Ga0495660_0007978 3300046810 Bacteria 6218
761 Ga0495660_0011063 3300046810 Bacteria 5240
762 Ga0495660_0016204 3300046810 Bacteria 4299
763 Ga0495660_0038082 3300046810 Bacteria 2675
764 Ga0495660_0051280 3300046810 Bacteria 2245
765 Ga0495660_0052074 3300046810 Bacteria 2225
766 Ga0495660_0084381 3300046810 Bacteria 1661
767 Ga0495660_0139464 3300046810 Bacteria 1208
768 Ga0495660_0156035 3300046810 Bacteria 1123
769 Ga0495581_0007326 3300047315 Bacteria 6383
770 Ga0495581_0022149 3300047315 Bacteria 3682
771 Ga0495604_0012312 3300047317 Bacteria 6799
772 Ga0495604_0015482 3300047317 Bacteria 6087
773 Ga0495604_0159090 3300047317 Bacteria 1597
774 Ga0495636_0000753 3300047318 Bacteria 11926
775 Ga0495636_0002077 3300047318 Bacteria 7690
776 Ga0495674_0021739 3300047319 Bacteria 5928
777 Ga0495672_0001393 3300047320 Bacteria 23788
778 Ga0495672_0001568 3300047320 Bacteria 22385
779 Ga0495672_0002587 3300047320 Bacteria 16424
780 Ga0495672_0002676 3300047320 Bacteria 16048
781 Ga0495672_0003479 3300047320 Bacteria 13465
782 Ga0495672_0003814 3300047320 Bacteria 12683
783 Ga0495672_0013604 3300047320 Bacteria 5604
784 Ga0495672_0013933 3300047320 Bacteria 5527
785 Ga0495676_0004271 3300047321 Bacteria 13039
786 Ga0495676_0015854 3300047321 Bacteria 6697
787 Ga0495680_0012930 3300047322 Bacteria 7314
788 Ga0495680_0015919 3300047322 Bacteria 6474
789 Ga0495680_0017679 3300047322 Bacteria 6076
790 Ga0495680_0022647 3300047322 Bacteria 5233
791 Ga0495683_0000011 3300047323 Bacteria 212053
792 Ga0495683_0000784 3300047323 Bacteria 22657
793 Ga0495683_0004075 3300047323 Bacteria 8371
794 Ga0495683_0005637 3300047323 Bacteria 6933
795 Ga0495683_0005732 3300047323 Bacteria 6848
796 Ga0495683_0006421 3300047323 Bacteria 6428
797 Ga0495683_0028039 3300047323 Bacteria 2878
798 Ga0495683_0031292 3300047323 Bacteria 2711
799 Ga0495683_0040156 3300047323 Bacteria 2364
800 Ga0495683_0040907 3300047323 Bacteria 2340
801 Ga0495683_0082517 3300047323 Bacteria 1566
802 Ga0495687_002112 3300047443 Bacteria 16655
803 Ga0495687_008543 3300047443 Bacteria 5852
804 Ga0495675_0013975 3300047444 Bacteria 5077
805 Ga0495675_0014655 3300047444 Bacteria 4953
806 Ga0495677_0000393 3300047445 Bacteria 18673
807 Ga0495679_000001 3300047446 Bacteria 1607568
808 Ga0495679_000176 3300047446 Bacteria 57881
809 Ga0495679_003695 3300047446 Bacteria 7288
810 Ga0495679_004059 3300047446 Bacteria 6866
811 Ga0495679_004736 3300047446 Bacteria 6176
812 Ga0495679_018686 3300047446 Bacteria 2454
813 Ga0495685_001024 3300047447 Bacteria 8524
814 Ga0495685_025697 3300047447 Bacteria 2026
815 Ga0495673_0000607 3300047469 Bacteria 35637
816 Ga0495673_0001083 3300047469 Bacteria 23778
817 Ga0495673_0001179 3300047469 Bacteria 22083
818 Ga0495673_0001247 3300047469 Bacteria 21037
819 Ga0495673_0002001 3300047469 Bacteria 14995
820 Ga0495673_0002223 3300047469 Bacteria 13941
821 Ga0495673_0006626 3300047469 Bacteria 6787
822 Ga0495673_0006858 3300047469 Bacteria 6640
823 Ga0495673_0007482 3300047469 Bacteria 6270
824 Ga0495673_0007539 3300047469 Bacteria 6234
825 Ga0495673_0019067 3300047469 Bacteria 3443
826 Ga0495673_0023705 3300047469 Bacteria 2979
827 Ga0495673_0023870 3300047469 Bacteria 2965
828 Ga0495673_0026076 3300047469 Bacteria 2799
829 Ga0495673_0031248 3300047469 Bacteria 2494
830 Ga0495673_0047147 3300047469 Bacteria 1905
831 Ga0495673_0059595 3300047469 Bacteria 1640
832 Ga0495673_0110398 3300047469 Bacteria 1100
833 Ga0495681_0000536 3300047470 Bacteria 29078
834 Ga0495681_0001815 3300047470 Bacteria 15694
835 Ga0495681_0041658 3300047470 Bacteria 2228
836 Ga0495681_0052239 3300047470 Bacteria 1918
837 Ga0495681_0059785 3300047470 Bacteria 1761
838 Ga0495681_0118806 3300047470 Bacteria 1136
839 Ga0495686_0004152 3300047472 Bacteria 12056
840 Ga0495686_0007204 3300047472 Bacteria 8376
841 Ga0495686_0012958 3300047472 Bacteria 5809
842 Ga0495686_0033662 3300047472 Bacteria 3307
843 Ga0495593_0003966 3300047673 Bacteria 8834
844 Ga0495593_0009549 3300047673 Bacteria 5629
845 Ga0495593_0013731 3300047673 Bacteria 4612
846 Ga0495602_0016910 3300048088 Bacteria 7319
847 Ga0495614_0083515 3300048089 Bacteria 1385
848 Ga0495626_0001557 3300048091 Bacteria 18006
849 Ga0495626_0002243 3300048091 Bacteria 13850
850 Ga0495626_0002531 3300048091 Bacteria 12566
851 Ga0495626_0005293 3300048091 Bacteria 7617
852 Ga0495626_0005902 3300048091 Bacteria 7050
853 Ga0495626_0006059 3300048091 Bacteria 6948
854 Ga0495626_0006581 3300048091 Bacteria 6588
855 Ga0495626_0008233 3300048091 Bacteria 5739
856 Ga0495626_0025111 3300048091 Bacteria 2916
857 Ga0495626_0103881 3300048091 Bacteria 1236
858 Ga0496100_0102358 3300048903 Bacteria 1976
859 Ga0496101_0062377 3300048904 Bacteria 2710
860 Ga0496102_0000604 3300048905 Bacteria 37459
861 Ga0496102_0104440 3300048905 Bacteria 2635
862 Ga0496103_0006912 3300048906 Bacteria 6777
863 Ga0496103_0102586 3300048906 Bacteria 1811
864 Ga0496108_0027022 3300048911 Bacteria 4736
865 Ga0496110_0006365 3300048913 Bacteria 9334
866 Ga0496110_0014430 3300048913 Bacteria 6560
867 Ga0496110_0045914 3300048913 Bacteria 3820
868 Ga0496110_0243113 3300048913 Bacteria 1638
869 Ga0496110_0492637 3300048913 Bacteria 1116
870 Ga0496116_0003029 3300048919 Bacteria 17013
871 Ga0496116_0004538 3300048919 Bacteria 13188
872 Ga0496116_0013152 3300048919 Bacteria 6697
873 Ga0496116_0013391 3300048919 Bacteria 6618
874 Ga0496116_0076126 3300048919 Bacteria 2103
875 Ga0496116_0149135 3300048919 Bacteria 1302
876 Ga0496117_0001815 3300048920 Bacteria 29016
877 Ga0496117_0015165 3300048920 Bacteria 6591
878 Ga0496117_0015909 3300048920 Bacteria 6373
879 Ga0496117_0016327 3300048920 Bacteria 6270
880 Ga0496117_0022217 3300048920 Bacteria 5093
881 Ga0496117_0042483 3300048920 Bacteria 3316
882 Ga0496117_0042485 3300048920 Bacteria 3316
883 Ga0496118_0002174 3300048921 Bacteria 27294
884 Ga0496118_0016288 3300048921 Bacteria 6826
885 Ga0496118_0018025 3300048921 Bacteria 6393
886 Ga0496118_0026191 3300048921 Bacteria 4974
887 Ga0496118_0072065 3300048921 Bacteria 2483
888 Ga0496118_0091257 3300048921 Bacteria 2095
889 Ga0496118_0108002 3300048921 Bacteria 1856
890 Ga0496118_0138970 3300048921 Bacteria 1544
891 Ga0496119_0013863 3300048922 Bacteria 6364
892 Ga0496119_0014255 3300048922 Bacteria 6240
893 Ga0496119_0071686 3300048922 Bacteria 2027
894 Ga0496120_0063200 3300048923 Bacteria 2060
895 Ga0496120_0108804 3300048923 Bacteria 1451
896 Ga0496121_0001008 3300048924 Bacteria 50302
897 Ga0496121_0002419 3300048924 Bacteria 28592
898 Ga0496121_0002497 3300048924 Bacteria 27960
899 Ga0496121_0018103 3300048924 Bacteria 7127
900 Ga0496121_0029665 3300048924 Bacteria 5049
901 Ga0496121_0092180 3300048924 Bacteria 2362
902 Ga0496121_0104954 3300048924 Bacteria 2169
903 Ga0496121_0158374 3300048924 Bacteria 1658
904 Ga0496121_0174369 3300048924 Bacteria 1558
905 Ga0496122_0000945 3300048925 Bacteria 52642
906 Ga0496122_0018845 3300048925 Bacteria 6343
907 Ga0496122_0019180 3300048925 Bacteria 6263
908 Ga0496122_0180157 3300048925 Bacteria 1261
909 Ga0496123_0000888 3300048926 Bacteria 47314
910 Ga0496123_0005883 3300048926 Bacteria 12128
911 Ga0496123_0050801 3300048926 Bacteria 2767
912 Ga0496123_0098019 3300048926 Bacteria 1715
913 Ga0496124_0002611 3300048927 Bacteria 23246
914 Ga0496124_0004905 3300048927 Bacteria 15378
915 Ga0496124_0010228 3300048927 Bacteria 9528
916 Ga0496124_0102260 3300048927 Bacteria 2319
917 Ga0496124_0114546 3300048927 Bacteria 2165
918 Ga0496124_0162257 3300048927 Bacteria 1740
919 Ga0496124_0185723 3300048927 Bacteria 1595
920 Ga0496125_0005661 3300048928 Bacteria 13790
921 Ga0496125_0007915 3300048928 Bacteria 11221
922 Ga0496125_0012895 3300048928 Bacteria 8255
923 Ga0496125_0018010 3300048928 Bacteria 6714
924 Ga0496125_0033034 3300048928 Bacteria 4586
925 Ga0496125_0061124 3300048928 Bacteria 3023
926 Ga0496125_0087911 3300048928 Bacteria 2345
927 Ga0496126_0002379 3300048929 Bacteria 25600
928 Ga0496126_0133150 3300048929 Bacteria 2146
929 Ga0496126_0167695 3300048929 Bacteria 1873
930 Ga0495678_000028 3300049459 Bacteria 220080
931 Ga0495678_000033 3300049459 Bacteria 211804
932 Ga0495678_000311 3300049459 Bacteria 52388
933 Ga0495678_002317 3300049459 Bacteria 13124
934 Ga0495678_002782 3300049459 Bacteria 11424
935 Ga0495678_003313 3300049459 Bacteria 10048
936 Ga0495678_004804 3300049459 Bacteria 7689
937 Ga0495678_005647 3300049459 Bacteria 6828
938 Ga0495678_008179 3300049459 Bacteria 5312
939 Ga0495678_041489 3300049459 Bacteria 1841
940 Ga0495678_046636 3300049459 Bacteria 1702
941 Ga0495678_057442 3300049459 Bacteria 1474
942 Ga0495682_0000072 3300049460 Bacteria 93119
943 Ga0495682_0000265 3300049460 Bacteria 41386
944 Ga0495682_0001293 3300049460 Bacteria 13941
945 Ga0495682_0002849 3300049460 Bacteria 7970
946 Ga0495682_0003811 3300049460 Bacteria 6628
947 Ga0495682_0017809 3300049460 Bacteria 2677
948 Ga0495682_0018489 3300049460 Bacteria 2624
949 Ga0495682_0019820 3300049460 Bacteria 2527
950 Ga0495682_0020861 3300049460 Bacteria 2457
951 Ga0495682_0041754 3300049460 Bacteria 1681
952 Ga0501222_000921 3300049662 Bacteria 4224
953 Ga0501241_000864 3300049758 Bacteria 6443
954 Ga0501269_002850 3300049766 Bacteria 2108
955 Ga0501226_000988 3300049853 Bacteria 3737
956 nmdc:mga03683_111520_c1 3300050489 Bacteria 1210
957 nmdc:mga00v17_147598_c1 3300050491 Bacteria 1510
958 nmdc:mga00v17_153323_c1 3300050491 Bacteria 1481
959 nmdc:mga0k408_78_c1 3300050493 Bacteria 45819
960 nmdc:mga08x19_70088_c1 3300050514 Bacteria 2284
961 nmdc:mga0sz30_6379_c1 3300050516 Bacteria 4378
962 Ga0495601_0038246 3300053077 Bacteria 3000
963 Ga0495612_0178938 3300053078 Bacteria 931
964 Ga0495619_0149469 3300053085 Bacteria 1611
965 Ga0495619_0336777 3300053085 Bacteria 1044
966 Ga0500643_000053 3300053087 Bacteria 142202
967 Ga0500555_000867 3300053103 Bacteria 10782
968 Ga0500586_003095 3300053145 Bacteria 3876

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053085 Ga0495619_0149469 Ga0495619_0149469_841_1545 230
2 iso_pu_bacteria 2513237305 2514422866 233
3 3300046678 Ga0495599_0380902 Ga0495599_0380902_115_828 237
4 3300028379 Ga0268266_10149169 Ga0268266_101491693 239
5 3300025728 Ga0207655_1038191 Ga0207655_10381912 244
6 3300046513 Ga0495616_0095736 Ga0495616_0095736_647_1381 244
7 3300046526 Ga0495666_0041523 Ga0495666_0041523_1045_1779 244
8 3300046543 Ga0495645_0013574 Ga0495645_0013574_5012_5746 244
9 3300046663 Ga0495635_0210353 Ga0495635_0210353_352_1086 244
10 3300046674 Ga0495588_0053688 Ga0495588_0053688_489_1223 244
11 3300047321 Ga0495676_0015854 Ga0495676_0015854_5119_5853 244
12 3300047322 Ga0495680_0012930 Ga0495680_0012930_5241_5975 244
13 3300047469 Ga0495673_0110398 Ga0495673_0110398_15_749 244
14 3300047673 Ga0495593_0013731 Ga0495593_0013731_1123_1857 244
15 3300048088 Ga0495602_0016910 Ga0495602_0016910_1315_2049 244
16 3300003781 Ga0055536_1000537 Ga0055536_10005378 245
17 3300025292 Ga0209676_1000033 Ga0209676_1000033288 245
18 3300047470 Ga0495681_0118806 Ga0495681_0118806_360_1100 245
19 3300041405 Ga0439438_003910 Ga0439438_003910_1517_2257 246
20 3300041407 Ga0439447_025666 Ga0439447_025666_705_1445 246
21 3300041411 Ga0439466_0005342 Ga0439466_0005342_2734_3474 246
22 3300041997 Ga0439431_0001457 Ga0439431_0001457_2978_3718 246
23 3300042004 Ga0439445_0005750 Ga0439445_0005750_1321_2061 246
24 3300042006 Ga0439432_003625 Ga0439432_003625_1346_2086 246
25 3300042010 Ga0439452_004522 Ga0439452_004522_2632_3372 246
26 3300042147 Ga0450910_000525 Ga0450910_000525_946_1686 246
27 3300042156 Ga0439446_0011777 Ga0439446_0011777_962_1702 246
28 3300042142 Ga0450905_011848 Ga0450905_011848_434_1204 256
29 3300048089 Ga0495614_0083515 Ga0495614_0083515_590_1360 256
30 3300013104 Ga0157370_10008202 Ga0157370_1000820211 259
31 3300042013 Ga0439456_019207 Ga0439456_019207_15_794 259
32 3300048913 Ga0496110_0492637 Ga0496110_0492637_126_938 260
33 3300046460 Ga0495638_0070716 Ga0495638_0070716_143_1000 261
34 3300046615 Ga0495656_0028388 Ga0495656_0028388_226_1092 265
35 3300013104 Ga0157370_10056197 Ga0157370_100561972 266
36 3300041456 Ga0451795_1645496 Ga0451795_1645496_523_1383 266
37 3300046460 Ga0495638_0000059 Ga0495638_0000059_56412_57263 266
38 3300046501 Ga0495607_0000121 Ga0495607_0000121_8152_9006 266
39 3300046513 Ga0495616_0000377 Ga0495616_0000377_15391_16245 266
40 3300046538 Ga0495609_0003790 Ga0495609_0003790_6852_7703 266
41 3300046648 Ga0495611_0000001 Ga0495611_0000001_190575_191426 266
42 3300046648 Ga0495611_0000027 Ga0495611_0000027_82297_83151 266
43 3300046660 Ga0495625_0000037 Ga0495625_0000037_100578_101429 266
44 3300046660 Ga0495625_0002110 Ga0495625_0002110_16311_17165 266
45 3300046665 Ga0495661_0088173 Ga0495661_0088173_351_1202 266
46 3300046691 Ga0495670_0005236 Ga0495670_0005236_3016_3867 266
47 3300046794 Ga0495589_0000366 Ga0495589_0000366_19159_20010 266
48 3300047446 Ga0495679_000001 Ga0495679_000001_1399390_1400241 266
49 3300047469 Ga0495673_0000607 Ga0495673_0000607_15094_15945 266
50 3300048924 Ga0496121_0002419 Ga0496121_0002419_13196_14050 266
51 3300049459 Ga0495678_000028 Ga0495678_000028_128804_129655 266
52 3300049460 Ga0495682_0000265 Ga0495682_0000265_16614_17465 266
53 3300053087 Ga0500643_000053 Ga0500643_000053_90372_91223 266
54 3300053103 Ga0500555_000867 Ga0500555_000867_8928_9779 266
55 iso_pu_bacteria 2734482264 2735835980 266
56 3300025903 Ga0207680_10314395 Ga0207680_103143952 268
57 3300046524 Ga0495648_0005728 Ga0495648_0005728_6637_7461 268
58 3300042139 Ga0450904_001612 Ga0450904_001612_1145_2017 269
59 3300046458 Ga0495591_026058 Ga0495591_026058_745_1596 269
60 3300046501 Ga0495607_0008577 Ga0495607_0008577_5135_5986 269
61 3300046512 Ga0495610_0002376 Ga0495610_0002376_13893_14744 269
62 3300046519 Ga0495632_0031822 Ga0495632_0031822_1365_2216 269
63 3300046520 Ga0495637_0005684 Ga0495637_0005684_697_1548 269
64 3300046616 Ga0495668_0032107 Ga0495668_0032107_839_1690 269
65 3300046648 Ga0495611_0000918 Ga0495611_0000918_13889_14740 269
66 3300046665 Ga0495661_0010570 Ga0495661_0010570_585_1436 269
67 3300047323 Ga0495683_0005732 Ga0495683_0005732_949_1800 269
68 3300047469 Ga0495673_0026076 Ga0495673_0026076_1332_2183 269
69 3300025304 Ga0209257_1015245 Ga0209257_10152452 270
70 iso_pu_bacteria 2643221637 2644206907 270
71 iso_pu_bacteria 2643221718 2644650555 270
72 3300005841 Ga0068863_100105651 Ga0068863_1001056511 271
73 3300014326 Ga0157380_10040339 Ga0157380_100403394 271
74 3300046458 Ga0495591_001026 Ga0495591_001026_12723_13580 271
75 3300046512 Ga0495610_0000720 Ga0495610_0000720_16690_17547 271
76 3300046530 Ga0495654_0024144 Ga0495654_0024144_989_1846 271
77 3300046616 Ga0495668_0001353 Ga0495668_0001353_12837_13694 271
78 3300048091 Ga0495626_0002243 Ga0495626_0002243_7401_8258 271
79 iso_pu_bacteria 2740891818 2740995010 271
80 3300047472 Ga0495686_0007204 Ga0495686_0007204_3469_4311 272
81 3300014497 Ga0182008_10078408 Ga0182008_100784082 273
82 3300031238 Ga0265332_10000004 Ga0265332_10000004336 273
83 3300031250 Ga0265331_10024250 Ga0265331_100242502 273
84 iso_pu_bacteria 2721755686 2723577651 273
85 iso_pu_bacteria 2876392853 2876398832 273
86 iso_pu_bacteria 2881161766 2881163045 273
87 iso_pu_bacteria 2904659560 2904665364 273
88 iso_pu_bacteria 2961114664 2961120364 273
89 iso_pu_bacteria 2968110612 2968116831 273
90 3300005327 Ga0070658_10178264 Ga0070658_101782642 274
91 3300005328 Ga0070676_10011992 Ga0070676_100119922 274
92 3300005331 Ga0070670_100070010 Ga0070670_1000700102 274
93 3300005331 Ga0070670_100273102 Ga0070670_1002731022 274
94 3300005333 Ga0070677_10023911 Ga0070677_100239112 274
95 3300005333 Ga0070677_10156006 Ga0070677_101560062 274
96 3300005334 Ga0068869_100039304 Ga0068869_1000393042 274
97 3300005335 Ga0070666_10057619 Ga0070666_100576192 274
98 3300005347 Ga0070668_100001828 Ga0070668_10000182811 274
99 3300005353 Ga0070669_100057759 Ga0070669_1000577592 274
100 3300005354 Ga0070675_100063411 Ga0070675_1000634112 274
101 3300005354 Ga0070675_100093099 Ga0070675_1000930991 274
102 3300005354 Ga0070675_100124059 Ga0070675_1001240592 274
103 3300005355 Ga0070671_100127077 Ga0070671_1001270772 274
104 3300005356 Ga0070674_100004695 Ga0070674_1000046952 274
105 3300005366 Ga0070659_100037609 Ga0070659_1000376093 274
106 3300005367 Ga0070667_100012425 Ga0070667_1000124256 274
107 3300005441 Ga0070700_100043934 Ga0070700_1000439342 274
108 3300005456 Ga0070678_100144557 Ga0070678_1001445572 274
109 3300005456 Ga0070678_100329309 Ga0070678_1003293092 274
110 3300005457 Ga0070662_100041744 Ga0070662_1000417442 274
111 3300005459 Ga0068867_100009150 Ga0068867_1000091505 274
112 3300005535 Ga0070684_100301644 Ga0070684_1003016442 274
113 3300005616 Ga0068852_100066561 Ga0068852_1000665614 274
114 3300005616 Ga0068852_100587130 Ga0068852_1005871302 274
115 3300005617 Ga0068859_100040184 Ga0068859_1000401845 274
116 3300005718 Ga0068866_10007584 Ga0068866_100075842 274
117 3300005719 Ga0068861_100004142 Ga0068861_1000041425 274
118 3300005841 Ga0068863_100018571 Ga0068863_1000185714 274
119 3300005842 Ga0068858_100185585 Ga0068858_1001855852 274
120 3300005843 Ga0068860_100036706 Ga0068860_1000367065 274
121 3300006931 Ga0097620_100040185 Ga0097620_1000401855 274
122 3300009098 Ga0105245_10020891 Ga0105245_100208913 274
123 3300009148 Ga0105243_10022667 Ga0105243_100226674 274
124 3300009177 Ga0105248_10102314 Ga0105248_101023143 274
125 3300009177 Ga0105248_10647280 Ga0105248_106472802 274
126 3300013102 Ga0157371_10070073 Ga0157371_100700732 274
127 3300013105 Ga0157369_10293281 Ga0157369_102932812 274
128 3300013306 Ga0163162_10006558 Ga0163162_100065586 274
129 3300013307 Ga0157372_10182322 Ga0157372_101823222 274
130 3300013308 Ga0157375_10129766 Ga0157375_101297662 274
131 3300013308 Ga0157375_10231695 Ga0157375_102316952 274
132 3300014326 Ga0157380_10010808 Ga0157380_100108087 274
133 3300014968 Ga0157379_10009072 Ga0157379_100090727 274
134 3300017792 Ga0163161_10036517 Ga0163161_100365172 274
135 3300025315 Ga0207697_10064968 Ga0207697_100649682 274
136 3300025893 Ga0207682_10017480 Ga0207682_100174802 274
137 3300025893 Ga0207682_10048593 Ga0207682_100485932 274
138 3300025899 Ga0207642_10033859 Ga0207642_100338592 274
139 3300025901 Ga0207688_10157340 Ga0207688_101573402 274
140 3300025903 Ga0207680_10064526 Ga0207680_100645262 274
141 3300025907 Ga0207645_10004107 Ga0207645_100041076 274
142 3300025908 Ga0207643_10054378 Ga0207643_100543782 274
143 3300025918 Ga0207662_10044865 Ga0207662_100448652 274
144 3300025922 Ga0207646_10002099 Ga0207646_100020995 274
145 3300025923 Ga0207681_10011566 Ga0207681_100115662 274
146 3300025925 Ga0207650_10008268 Ga0207650_100082687 274
147 3300025925 Ga0207650_10229608 Ga0207650_102296082 274
148 3300025926 Ga0207659_10047638 Ga0207659_100476382 274
149 3300025926 Ga0207659_10153911 Ga0207659_101539112 274
150 3300025932 Ga0207690_10320643 Ga0207690_103206432 274
151 3300025933 Ga0207706_10035537 Ga0207706_100355373 274
152 3300025935 Ga0207709_10019377 Ga0207709_100193772 274
153 3300025936 Ga0207670_10067725 Ga0207670_100677252 274
154 3300025938 Ga0207704_10172954 Ga0207704_101729542 274
155 3300025940 Ga0207691_10025170 Ga0207691_100251705 274
156 3300025940 Ga0207691_10070219 Ga0207691_100702192 274
157 3300025941 Ga0207711_10082130 Ga0207711_100821303 274
158 3300025941 Ga0207711_10196189 Ga0207711_101961892 274
159 3300025942 Ga0207689_10010069 Ga0207689_100100698 274
160 3300025945 Ga0207679_10421162 Ga0207679_104211622 274
161 3300025961 Ga0207712_10018024 Ga0207712_100180242 274
162 3300025981 Ga0207640_10284192 Ga0207640_102841922 274
163 3300025986 Ga0207658_10028783 Ga0207658_100287832 274
164 3300026023 Ga0207677_10169222 Ga0207677_101692222 274
165 3300026035 Ga0207703_10039834 Ga0207703_100398342 274
166 3300026041 Ga0207639_10081823 Ga0207639_100818232 274
167 3300026088 Ga0207641_10007595 Ga0207641_100075957 274
168 3300026089 Ga0207648_10034632 Ga0207648_100346324 274
169 3300026089 Ga0207648_10049136 Ga0207648_100491362 274
170 3300026116 Ga0207674_10143439 Ga0207674_101434392 274
171 3300026118 Ga0207675_100006516 Ga0207675_1000065168 274
172 3300026121 Ga0207683_10032674 Ga0207683_100326742 274
173 3300026121 Ga0207683_10190295 Ga0207683_101902952 274
174 3300026142 Ga0207698_10029360 Ga0207698_100293602 274
175 3300028380 Ga0268265_10062451 Ga0268265_100624513 274
176 3300028381 Ga0268264_10010901 Ga0268264_100109018 274
177 3300035117 Ga0373953_0062927 Ga0373953_0062927_57_902 274
178 3300036401 Ga0373937_0038014 Ga0373937_0038014_1839_2675 274
179 3300036401 Ga0373937_0063401 Ga0373937_0063401_1931_2776 274
180 3300041512 Ga0451853_1460144 Ga0451853_1460144_561_1397 274
181 3300046459 Ga0495629_0106403 Ga0495629_0106403_62_898 274
182 3300046463 Ga0495653_0259776 Ga0495653_0259776_254_1099 274
183 3300046477 Ga0495664_0295119 Ga0495664_0295119_88_933 274
184 3300046516 Ga0495628_0114971 Ga0495628_0114971_63_899 274
185 3300046537 Ga0495598_0021050 Ga0495598_0021050_377_1213 274
186 3300046559 Ga0495667_0227340 Ga0495667_0227340_224_1069 274
187 3300046663 Ga0495635_0079253 Ga0495635_0079253_1156_1992 274
188 3300046680 Ga0495646_0163730 Ga0495646_0163730_261_1097 274
189 3300046683 Ga0495658_0031488 Ga0495658_0031488_893_1738 274
190 3300047322 Ga0495680_0017679 Ga0495680_0017679_3585_4421 274
191 3300053077 Ga0495601_0038246 Ga0495601_0038246_1266_2111 274
192 3300053078 Ga0495612_0178938 Ga0495612_0178938_51_896 274
193 3300053085 Ga0495619_0336777 Ga0495619_0336777_94_930 274
194 iso_pu_bacteria 2582581866 2585392061 274
195 3300005327 Ga0070658_10139878 Ga0070658_101398782 275
196 3300005328 Ga0070676_10112682 Ga0070676_101126822 275
197 3300005331 Ga0070670_100002229 Ga0070670_10000222915 275
198 3300005331 Ga0070670_100005687 Ga0070670_1000056875 275
199 3300005333 Ga0070677_10019981 Ga0070677_100199812 275
200 3300005338 Ga0068868_100066155 Ga0068868_1000661553 275
201 3300005344 Ga0070661_100071883 Ga0070661_1000718832 275
202 3300005353 Ga0070669_100014691 Ga0070669_1000146916 275
203 3300005354 Ga0070675_100007942 Ga0070675_1000079423 275
204 3300005354 Ga0070675_100017439 Ga0070675_1000174393 275
205 3300005355 Ga0070671_100009709 Ga0070671_1000097097 275
206 3300005355 Ga0070671_100030658 Ga0070671_1000306583 275
207 3300005355 Ga0070671_100152663 Ga0070671_1001526632 275
208 3300005364 Ga0070673_100006275 Ga0070673_1000062754 275
209 3300005364 Ga0070673_100067395 Ga0070673_1000673952 275
210 3300005367 Ga0070667_100259701 Ga0070667_1002597012 275
211 3300005456 Ga0070678_100027482 Ga0070678_1000274822 275
212 3300005459 Ga0068867_100007420 Ga0068867_1000074206 275
213 3300005543 Ga0070672_100002981 Ga0070672_1000029817 275
214 3300005543 Ga0070672_100005989 Ga0070672_1000059892 275
215 3300005618 Ga0068864_100005858 Ga0068864_1000058587 275
216 3300005834 Ga0068851_10108670 Ga0068851_101086702 275
217 3300006237 Ga0097621_100015345 Ga0097621_1000153454 275
218 3300006237 Ga0097621_100069375 Ga0097621_1000693752 275
219 3300006358 Ga0068871_100025548 Ga0068871_1000255485 275
220 3300013306 Ga0163162_10095782 Ga0163162_100957821 275
221 3300013308 Ga0157375_10046742 Ga0157375_100467422 275
222 3300013308 Ga0157375_10714532 Ga0157375_107145322 275
223 3300014325 Ga0163163_10150092 Ga0163163_101500922 275
224 3300014969 Ga0157376_10003642 Ga0157376_100036429 275
225 3300014969 Ga0157376_10043120 Ga0157376_100431202 275
226 3300025321 Ga0207656_10069336 Ga0207656_100693362 275
227 3300025893 Ga0207682_10012514 Ga0207682_100125144 275
228 3300025920 Ga0207649_10055026 Ga0207649_100550262 275
229 3300025923 Ga0207681_10024126 Ga0207681_100241262 275
230 3300025925 Ga0207650_10001201 Ga0207650_1000120115 275
231 3300025925 Ga0207650_10002944 Ga0207650_1000294410 275
232 3300025926 Ga0207659_10017831 Ga0207659_100178311 275
233 3300025926 Ga0207659_10056637 Ga0207659_100566373 275
234 3300025931 Ga0207644_10012599 Ga0207644_100125996 275
235 3300025931 Ga0207644_10160245 Ga0207644_101602452 275
236 3300025937 Ga0207669_10005768 Ga0207669_100057686 275
237 3300025940 Ga0207691_10000964 Ga0207691_100009644 275
238 3300025940 Ga0207691_10118545 Ga0207691_101185452 275
239 3300025960 Ga0207651_10001048 Ga0207651_1000104810 275
240 3300025960 Ga0207651_10055966 Ga0207651_100559662 275
241 3300025986 Ga0207658_10080727 Ga0207658_100807272 275
242 3300026088 Ga0207641_10133945 Ga0207641_101339453 275
243 3300026089 Ga0207648_10020407 Ga0207648_100204073 275
244 3300026095 Ga0207676_10121560 Ga0207676_101215602 275
245 3300026121 Ga0207683_10048104 Ga0207683_100481044 275
246 3300031731 Ga0307405_10006846 Ga0307405_100068465 275
247 3300031911 Ga0307412_10632622 Ga0307412_106326221 275
248 3300031995 Ga0307409_100000746 Ga0307409_1000007467 275
249 3300032002 Ga0307416_100011193 Ga0307416_1000111933 275
250 3300039438 Ga0436360_1051396 Ga0436360_1051396_11_928 275
251 3300044712 Ga0453684_0116111 Ga0453684_0116111_216_1070 275
252 3300046543 Ga0495645_0033134 Ga0495645_0033134_908_1750 275
253 3300048911 Ga0496108_0027022 Ga0496108_0027022_2097_2936 275
254 3300005457 Ga0070662_100002799 Ga0070662_1000027999 276
255 3300025933 Ga0207706_10008925 Ga0207706_100089254 276
256 3300026121 Ga0207683_10074060 Ga0207683_100740602 276
257 3300028794 Ga0307515_10155775 Ga0307515_101557752 276
258 3300036401 Ga0373937_0057084 Ga0373937_0057084_1772_2617 276
259 3300005536 Ga0070697_100082439 Ga0070697_1000824393 277
260 3300005546 Ga0070696_100049229 Ga0070696_1000492292 277
261 3300021384 Ga0213876_10019248 Ga0213876_100192483 277
262 3300025728 Ga0207655_1019806 Ga0207655_10198062 277
263 3300029957 Ga0265324_10000032 Ga0265324_1000003245 277
264 3300033180 Ga0307510_10005583 Ga0307510_1000558313 277
265 3300039437 Ga0436365_1450265 Ga0436365_1450265_3059_3952 277
266 3300039450 Ga0436363_1071075 Ga0436363_1071075_1406_2299 277
267 iso_pu_bacteria 2511231007 2511272029 277
268 iso_pu_bacteria 2599185307 2599971532 278
269 3300017792 Ga0163161_10040626 Ga0163161_100406263 279
270 iso_pu_bacteria 2511231010 2511292052 279
271 iso_pu_bacteria 2511231020 2511352289 279
272 iso_pu_bacteria 2511231031 2511416363 279
273 iso_pu_bacteria 2600255318 2601795427 279
274 iso_pu_bacteria 2603880185 2606075495 279
275 iso_pu_bacteria 2603880199 2606128593 279
276 iso_pu_bacteria 2713897149 2715754929 279
277 iso_pu_bacteria 2718217725 2718633205 279
278 iso_pu_bacteria 2738543025 2739316102 279
279 iso_pu_bacteria 2765235841 2765582760 279
280 iso_pu_bacteria 2784132063 2784259872 279
281 iso_pu_bacteria 2852657418 2852658840 279
282 iso_pu_bacteria 2878029506 2878031367 279
283 iso_pu_bacteria 2880230671 2880232229 279
284 iso_pu_bacteria 2919063839 2919064163 279
285 iso_pu_bacteria 2919385768 2919386327 279
286 iso_pu_bacteria 2969304461 2969306148 279
287 iso_pu_bacteria 3007718800 3007722869 279
288 iso_pu_bacteria 8056137416 8056141439 279
289 3300028794 Ga0307515_10000180 Ga0307515_10000180101 280
290 iso_pu_bacteria 2511231011 2511296747 280
291 iso_pu_bacteria 2773857673 2774137518 280
292 iso_pu_bacteria 2818991456 2819654083 280
293 iso_pu_bacteria 2904518522 2904521874 280
294 iso_pu_bacteria 2974289157 2974292202 280
295 iso_pu_bacteria 3007614139 3007614559 280
296 iso_pu_bacteria 8056166840 8056169448 280
297 3300006058 Ga0075432_10002595 Ga0075432_100025953 281
298 3300027907 Ga0207428_10080653 Ga0207428_100806532 281
299 3300046458 Ga0495591_002226 Ga0495591_002226_9983_10828 281
300 3300046471 Ga0495650_0018563 Ga0495650_0018563_1733_2578 281
301 3300046492 Ga0495585_0035974 Ga0495585_0035974_1120_1992 281
302 3300046500 Ga0495596_0054128 Ga0495596_0054128_462_1307 281
303 3300046501 Ga0495607_0007895 Ga0495607_0007895_5261_6106 281
304 3300046501 Ga0495607_0074277 Ga0495607_0074277_358_1239 281
305 3300046506 Ga0495583_0001955 Ga0495583_0001955_3410_4291 281
306 3300046512 Ga0495610_0074105 Ga0495610_0074105_369_1214 281
307 3300046513 Ga0495616_0008680 Ga0495616_0008680_1034_1879 281
308 3300046518 Ga0495631_0000638 Ga0495631_0000638_17943_18788 281
309 3300046518 Ga0495631_0006154 Ga0495631_0006154_1846_2727 281
310 3300046519 Ga0495632_0003111 Ga0495632_0003111_9983_10828 281
311 3300046519 Ga0495632_0010529 Ga0495632_0010529_4010_4891 281
312 3300046520 Ga0495637_0000428 Ga0495637_0000428_10156_11001 281
313 3300046520 Ga0495637_0000625 Ga0495637_0000625_9704_10585 281
314 3300046520 Ga0495637_0006580 Ga0495637_0006580_1198_2043 281
315 3300046522 Ga0495643_0009655 Ga0495643_0009655_4134_4979 281
316 3300046524 Ga0495648_0000997 Ga0495648_0000997_15337_16218 281
317 3300046524 Ga0495648_0015869 Ga0495648_0015869_830_1675 281
318 3300046524 Ga0495648_0037432 Ga0495648_0037432_769_1614 281
319 3300046526 Ga0495666_0008015 Ga0495666_0008015_2361_3206 281
320 3300046530 Ga0495654_0004044 Ga0495654_0004044_1680_2561 281
321 3300046530 Ga0495654_0020931 Ga0495654_0020931_1975_2820 281
322 3300046536 Ga0495587_0004482 Ga0495587_0004482_3597_4442 281
323 3300046538 Ga0495609_0044311 Ga0495609_0044311_719_1564 281
324 3300046648 Ga0495611_0007338 Ga0495611_0007338_592_1473 281
325 3300046660 Ga0495625_0004836 Ga0495625_0004836_9387_10232 281
326 3300046663 Ga0495635_0009714 Ga0495635_0009714_787_1632 281
327 3300046665 Ga0495661_0011316 Ga0495661_0011316_1981_2862 281
328 3300046692 Ga0495671_0012431 Ga0495671_0012431_1451_2332 281
329 3300046794 Ga0495589_0007845 Ga0495589_0007845_3771_4616 281
330 3300047319 Ga0495674_0021739 Ga0495674_0021739_72_917 281
331 3300047320 Ga0495672_0002587 Ga0495672_0002587_7111_7992 281
332 3300047320 Ga0495672_0013604 Ga0495672_0013604_4114_4959 281
333 3300047323 Ga0495683_0000784 Ga0495683_0000784_4450_5295 281
334 3300047469 Ga0495673_0001083 Ga0495673_0001083_15732_16577 281
335 3300047469 Ga0495673_0019067 Ga0495673_0019067_2031_2912 281
336 3300047469 Ga0495673_0023705 Ga0495673_0023705_68_949 281
337 3300047472 Ga0495686_0012958 Ga0495686_0012958_970_1815 281
338 3300047472 Ga0495686_0033662 Ga0495686_0033662_1972_2853 281
339 3300048920 Ga0496117_0022217 Ga0496117_0022217_3913_4761 281
340 3300048921 Ga0496118_0026191 Ga0496118_0026191_3921_4769 281
341 3300048928 Ga0496125_0033034 Ga0496125_0033034_3068_3913 281
342 3300049459 Ga0495678_000311 Ga0495678_000311_29221_30102 281
343 iso_pu_bacteria 2511231004 2511252423 281
344 iso_pu_bacteria 2511231008 2511280489 281
345 iso_pu_bacteria 2511231016 2511324466 281
346 iso_pu_bacteria 2511231018 2511341429 281
347 iso_pu_bacteria 2511231022 2511363612 281
348 iso_pu_bacteria 2599185188 2599504026 281
349 iso_pu_bacteria 2599185289 2599887679 281
350 iso_pu_bacteria 2599185291 2599899842 281
351 iso_pu_bacteria 2599185300 2599931982 281
352 iso_pu_bacteria 2599185305 2599960419 281
353 iso_pu_bacteria 2599185310 2599988021 281
354 iso_pu_bacteria 2599185315 2600017541 281
355 iso_pu_bacteria 2599185317 2600030336 281
356 iso_pu_bacteria 2599185321 2600052365 281
357 iso_pu_bacteria 2600254930 2600360768 281
358 iso_pu_bacteria 2623620446 2624493644 281
359 iso_pu_bacteria 2643221633 2644187228 281
360 iso_pu_bacteria 2667528170 2671090340 281
361 iso_pu_bacteria 2773857670 2774122805 281
362 iso_pu_bacteria 2784132072 2784315163 281
363 iso_pu_bacteria 2808606377 2808931816 281
364 iso_pu_bacteria 2808606381 2808953936 281
365 iso_pu_bacteria 2842854478 2842854510 281
366 iso_pu_bacteria 2860339153 2860340093 281
367 iso_pu_bacteria 2904550169 2904553271 281
368 iso_pu_bacteria 2919456309 2919457181 281
369 iso_pu_bacteria 2919481497 2919481707 281
370 iso_pu_bacteria 2919697872 2919702944 281
371 iso_pu_bacteria 2931396565 2931400015 281
372 iso_pu_bacteria 2984286254 2984290822 281
373 iso_pu_bacteria 2988728565 2988733424 281
374 iso_pu_bacteria 8019775933 8019780175 281
375 iso_pu_bacteria 8056155041 8056156713 281
376 iso_pu_bacteria 8056172158 8056175627 281
377 3300005331 Ga0070670_100024039 Ga0070670_1000240392 282
378 3300005354 Ga0070675_100298356 Ga0070675_1002983562 282
379 3300006195 Ga0075366_10013980 Ga0075366_100139803 282
380 3300009094 Ga0111539_10007100 Ga0111539_100071004 282
381 3300025925 Ga0207650_10042469 Ga0207650_100424691 282
382 3300027907 Ga0207428_10073217 Ga0207428_100732173 282
383 3300050493 nmdc:mga0k408_78_c1 nmdc:mga0k408_78_c1_43627_44484 282
384 3300003781 Ga0055536_1000441 Ga0055536_100044111 283
385 3300003791 Ga0055530_10000725 Ga0055530_1000072511 283
386 3300003792 Ga0055540_1000501 Ga0055540_100050113 283
387 3300003794 Ga0055531_10001274 Ga0055531_100012747 283
388 3300005353 Ga0070669_100029331 Ga0070669_1000293314 283
389 3300005354 Ga0070675_100067337 Ga0070675_1000673372 283
390 3300005356 Ga0070674_100373974 Ga0070674_1003739741 283
391 3300005457 Ga0070662_100023071 Ga0070662_1000230712 283
392 3300005548 Ga0070665_100140278 Ga0070665_1001402782 283
393 3300005548 Ga0070665_100287230 Ga0070665_1002872302 283
394 3300005618 Ga0068864_100072176 Ga0068864_1000721764 283
395 3300005841 Ga0068863_100003514 Ga0068863_1000035147 283
396 3300006051 Ga0075364_10207418 Ga0075364_102074182 283
397 3300006058 Ga0075432_10000422 Ga0075432_100004229 283
398 3300006177 Ga0075362_10081188 Ga0075362_100811882 283
399 3300006186 Ga0075369_10024983 Ga0075369_100249832 283
400 3300006237 Ga0097621_100189366 Ga0097621_1001893662 283
401 3300006358 Ga0068871_100001760 Ga0068871_1000017606 283
402 3300006914 Ga0075436_100033025 Ga0075436_1000330252 283
403 3300006946 Ga0079104_1003979 Ga0079104_10039793 283
404 3300009011 Ga0105251_10052192 Ga0105251_100521922 283
405 3300009011 Ga0105251_10083917 Ga0105251_100839172 283
406 3300009036 Ga0105244_10018701 Ga0105244_100187012 283
407 3300009036 Ga0105244_10138646 Ga0105244_101386461 283
408 3300009036 Ga0105244_10151655 Ga0105244_101516552 283
409 3300009092 Ga0105250_10001081 Ga0105250_100010815 283
410 3300009092 Ga0105250_10007464 Ga0105250_100074644 283
411 3300009148 Ga0105243_10000162 Ga0105243_1000016264 283
412 3300011119 Ga0105246_10008116 Ga0105246_100081165 283
413 3300013100 Ga0157373_10002764 Ga0157373_1000276411 283
414 3300013100 Ga0157373_10008956 Ga0157373_100089562 283
415 3300013104 Ga0157370_10285461 Ga0157370_102854612 283
416 3300013105 Ga0157369_10008420 Ga0157369_100084209 283
417 3300013306 Ga0163162_10004598 Ga0163162_1000459811 283
418 3300013306 Ga0163162_10369762 Ga0163162_103697622 283
419 3300013306 Ga0163162_10506589 Ga0163162_105065892 283
420 3300013307 Ga0157372_10001365 Ga0157372_1000136514 283
421 3300014325 Ga0163163_10179646 Ga0163163_101796462 283
422 3300014497 Ga0182008_10004863 Ga0182008_100048633 283
423 3300014497 Ga0182008_10006302 Ga0182008_100063022 283
424 3300014969 Ga0157376_10002090 Ga0157376_1000209010 283
425 3300015261 Ga0182006_1055688 Ga0182006_10556882 283
426 3300015265 Ga0182005_1026198 Ga0182005_10261982 283
427 3300017792 Ga0163161_10021069 Ga0163161_100210693 283
428 3300025230 Ga0209563_100535 Ga0209563_1005359 283
429 3300025291 Ga0209675_1002483 Ga0209675_10024835 283
430 3300025292 Ga0209676_1000016 Ga0209676_1000016466 283
431 3300025298 Ga0209050_1000036 Ga0209050_100003692 283
432 3300025303 Ga0209051_1000043 Ga0209051_1000043164 283
433 3300025304 Ga0209257_1000098 Ga0209257_1000098149 283
434 3300025711 Ga0207696_1000101 Ga0207696_1000101103 283
435 3300025711 Ga0207696_1000979 Ga0207696_100097913 283
436 3300025728 Ga0207655_1000402 Ga0207655_100040243 283
437 3300025728 Ga0207655_1026603 Ga0207655_10266033 283
438 3300025735 Ga0207713_1039279 Ga0207713_10392792 283
439 3300025735 Ga0207713_1040943 Ga0207713_10409431 283
440 3300025926 Ga0207659_10116093 Ga0207659_101160932 283
441 3300025935 Ga0207709_10000053 Ga0207709_1000005361 283
442 3300026088 Ga0207641_10014579 Ga0207641_100145794 283
443 3300028379 Ga0268266_10054016 Ga0268266_100540162 283
444 3300028379 Ga0268266_10218183 Ga0268266_102181832 283
445 3300031548 Ga0307408_100002790 Ga0307408_1000027906 283
446 3300031548 Ga0307408_100499494 Ga0307408_1004994942 283
447 3300031911 Ga0307412_10007173 Ga0307412_100071736 283
448 3300031911 Ga0307412_10100642 Ga0307412_101006422 283
449 3300032002 Ga0307416_100062975 Ga0307416_1000629754 283
450 3300032002 Ga0307416_100180371 Ga0307416_1001803712 283
451 3300032004 Ga0307414_10029301 Ga0307414_100293012 283
452 3300032004 Ga0307414_10068668 Ga0307414_100686683 283
453 3300032005 Ga0307411_10189722 Ga0307411_101897222 283
454 3300041405 Ga0439438_002175 Ga0439438_002175_6721_7572 283
455 3300041407 Ga0439447_004257 Ga0439447_004257_3392_4243 283
456 3300041407 Ga0439447_036537 Ga0439447_036537_47_898 283
457 3300041411 Ga0439466_0014195 Ga0439466_0014195_690_1541 283
458 3300041413 Ga0439465_0125953 Ga0439465_0125953_40_891 283
459 3300042006 Ga0439432_027166 Ga0439432_027166_821_1672 283
460 3300042010 Ga0439452_000346 Ga0439452_000346_12420_13271 283
461 3300042010 Ga0439452_003450 Ga0439452_003450_3845_4696 283
462 3300042013 Ga0439456_005912 Ga0439456_005912_1303_2154 283
463 3300042016 Ga0439463_026429 Ga0439463_026429_325_1176 283
464 3300042138 Ga0450903_006832 Ga0450903_006832_747_1598 283
465 3300042142 Ga0450905_000228 Ga0450905_000228_481_1332 283
466 3300042144 Ga0450889_006595 Ga0450889_006595_93_944 283
467 3300042145 Ga0450906_000168 Ga0450906_000168_670_1521 283
468 3300042532 Ga0450893_0004680 Ga0450893_0004680_358_1209 283
469 3300046452 Ga0495617_018016 Ga0495617_018016_975_1826 283
470 3300046452 Ga0495617_020665 Ga0495617_020665_980_1831 283
471 3300046452 Ga0495617_031546 Ga0495617_031546_821_1672 283
472 3300046453 Ga0495627_001228 Ga0495627_001228_13874_14725 283
473 3300046454 Ga0495592_0013417 Ga0495592_0013417_364_1215 283
474 3300046457 Ga0495590_0002663 Ga0495590_0002663_1178_2029 283
475 3300046457 Ga0495590_0003209 Ga0495590_0003209_651_1502 283
476 3300046457 Ga0495590_0003906 Ga0495590_0003906_4807_5658 283
477 3300046458 Ga0495591_019789 Ga0495591_019789_745_1596 283
478 3300046458 Ga0495591_021687 Ga0495591_021687_825_1676 283
479 3300046460 Ga0495638_0007805 Ga0495638_0007805_660_1511 283
480 3300046460 Ga0495638_0010285 Ga0495638_0010285_719_1570 283
481 3300046460 Ga0495638_0044002 Ga0495638_0044002_859_1710 283
482 3300046463 Ga0495653_0003581 Ga0495653_0003581_10455_11306 283
483 3300046463 Ga0495653_0202670 Ga0495653_0202670_231_1082 283
484 3300046471 Ga0495650_0007214 Ga0495650_0007214_5126_5977 283
485 3300046474 Ga0495605_0014566 Ga0495605_0014566_2206_3057 283
486 3300046474 Ga0495605_0024838 Ga0495605_0024838_1674_2525 283
487 3300046491 Ga0495584_0019174 Ga0495584_0019174_1138_1989 283
488 3300046491 Ga0495584_0027976 Ga0495584_0027976_1309_2160 283
489 3300046492 Ga0495585_0002592 Ga0495585_0002592_10742_11593 283
490 3300046492 Ga0495585_0041146 Ga0495585_0041146_1067_1918 283
491 3300046492 Ga0495585_0041191 Ga0495585_0041191_642_1493 283
492 3300046501 Ga0495607_0000563 Ga0495607_0000563_66_917 283
493 3300046501 Ga0495607_0001138 Ga0495607_0001138_13891_14742 283
494 3300046501 Ga0495607_0009248 Ga0495607_0009248_5170_6021 283
495 3300046501 Ga0495607_0045804 Ga0495607_0045804_1093_1944 283
496 3300046507 Ga0495606_0025197 Ga0495606_0025197_3302_4153 283
497 3300046512 Ga0495610_0019617 Ga0495610_0019617_678_1529 283
498 3300046512 Ga0495610_0019910 Ga0495610_0019910_1647_2498 283
499 3300046512 Ga0495610_0073402 Ga0495610_0073402_573_1424 283
500 3300046513 Ga0495616_0006718 Ga0495616_0006718_954_1805 283
501 3300046515 Ga0495620_0000338 Ga0495620_0000338_18961_19812 283
502 3300046515 Ga0495620_0020743 Ga0495620_0020743_1190_2041 283
503 3300046519 Ga0495632_0047592 Ga0495632_0047592_417_1268 283
504 3300046520 Ga0495637_0005398 Ga0495637_0005398_555_1406 283
505 3300046522 Ga0495643_0008430 Ga0495643_0008430_715_1566 283
506 3300046523 Ga0495644_0003490 Ga0495644_0003490_5027_5878 283
507 3300046524 Ga0495648_0004415 Ga0495648_0004415_9932_10783 283
508 3300046524 Ga0495648_0073176 Ga0495648_0073176_628_1479 283
509 3300046528 Ga0495642_0000506 Ga0495642_0000506_1274_2125 283
510 3300046530 Ga0495654_0031806 Ga0495654_0031806_489_1340 283
511 3300046530 Ga0495654_0033304 Ga0495654_0033304_538_1389 283
512 3300046536 Ga0495587_0051964 Ga0495587_0051964_508_1359 283
513 3300046538 Ga0495609_0004832 Ga0495609_0004832_1115_1966 283
514 3300046538 Ga0495609_0092297 Ga0495609_0092297_165_1016 283
515 3300046542 Ga0495597_0049710 Ga0495597_0049710_676_1527 283
516 3300046557 Ga0495622_0044666 Ga0495622_0044666_610_1461 283
517 3300046616 Ga0495668_0050697 Ga0495668_0050697_1258_2109 283
518 3300046616 Ga0495668_0096456 Ga0495668_0096456_441_1292 283
519 3300046642 Ga0495634_0010361 Ga0495634_0010361_935_1786 283
520 3300046648 Ga0495611_0019423 Ga0495611_0019423_488_1339 283
521 3300046648 Ga0495611_0084838 Ga0495611_0084838_592_1443 283
522 3300046660 Ga0495625_0175066 Ga0495625_0175066_237_1088 283
523 3300046663 Ga0495635_0086663 Ga0495635_0086663_835_1692 283
524 3300046665 Ga0495661_0003926 Ga0495661_0003926_6691_7542 283
525 3300046665 Ga0495661_0064341 Ga0495661_0064341_786_1637 283
526 3300046674 Ga0495588_0018140 Ga0495588_0018140_1921_2772 283
527 3300046684 Ga0495669_0003637 Ga0495669_0003637_459_1310 283
528 3300046689 Ga0495613_0012226 Ga0495613_0012226_5019_5870 283
529 3300046689 Ga0495613_0048129 Ga0495613_0048129_1157_2008 283
530 3300046690 Ga0495624_0001882 Ga0495624_0001882_13897_14748 283
531 3300046691 Ga0495670_0000709 Ga0495670_0000709_1158_2009 283
532 3300046692 Ga0495671_0005900 Ga0495671_0005900_1195_2046 283
533 3300046692 Ga0495671_0021664 Ga0495671_0021664_490_1341 283
534 3300046692 Ga0495671_0032052 Ga0495671_0032052_1125_1976 283
535 3300046694 Ga0495649_0008096 Ga0495649_0008096_668_1519 283
536 3300046694 Ga0495649_0009798 Ga0495649_0009798_4345_5196 283
537 3300046694 Ga0495649_0037996 Ga0495649_0037996_1633_2484 283
538 3300046794 Ga0495589_0008973 Ga0495589_0008973_4193_5044 283
539 3300046810 Ga0495660_0011063 Ga0495660_0011063_3206_4057 283
540 3300046810 Ga0495660_0084381 Ga0495660_0084381_435_1286 283
541 3300047317 Ga0495604_0015482 Ga0495604_0015482_1157_2008 283
542 3300047320 Ga0495672_0002676 Ga0495672_0002676_1263_2114 283
543 3300047320 Ga0495672_0003814 Ga0495672_0003814_1266_2117 283
544 3300047321 Ga0495676_0004271 Ga0495676_0004271_685_1536 283
545 3300047323 Ga0495683_0040156 Ga0495683_0040156_621_1472 283
546 3300047323 Ga0495683_0040907 Ga0495683_0040907_510_1361 283
547 3300047323 Ga0495683_0082517 Ga0495683_0082517_115_966 283
548 3300047446 Ga0495679_004059 Ga0495679_004059_5331_6182 283
549 3300047446 Ga0495679_018686 Ga0495679_018686_1027_1878 283
550 3300047469 Ga0495673_0001179 Ga0495673_0001179_8695_9546 283
551 3300047469 Ga0495673_0002223 Ga0495673_0002223_8742_9593 283
552 3300047469 Ga0495673_0031248 Ga0495673_0031248_617_1468 283
553 3300047469 Ga0495673_0047147 Ga0495673_0047147_815_1666 283
554 3300047470 Ga0495681_0000536 Ga0495681_0000536_10971_11822 283
555 3300047470 Ga0495681_0001815 Ga0495681_0001815_13890_14741 283
556 3300048091 Ga0495626_0005902 Ga0495626_0005902_1092_1943 283
557 3300048903 Ga0496100_0102358 Ga0496100_0102358_736_1587 283
558 3300048906 Ga0496103_0102586 Ga0496103_0102586_236_1087 283
559 3300048913 Ga0496110_0006365 Ga0496110_0006365_464_1315 283
560 3300048919 Ga0496116_0003029 Ga0496116_0003029_4642_5493 283
561 3300048919 Ga0496116_0004538 Ga0496116_0004538_1236_2087 283
562 3300048919 Ga0496116_0013152 Ga0496116_0013152_5229_6080 283
563 3300048919 Ga0496116_0149135 Ga0496116_0149135_224_1075 283
564 3300048920 Ga0496117_0015909 Ga0496117_0015909_568_1419 283
565 3300048920 Ga0496117_0016327 Ga0496117_0016327_464_1315 283
566 3300048920 Ga0496117_0042483 Ga0496117_0042483_1065_1916 283
567 3300048920 Ga0496117_0042485 Ga0496117_0042485_1401_2252 283
568 3300048921 Ga0496118_0018025 Ga0496118_0018025_581_1432 283
569 3300048921 Ga0496118_0072065 Ga0496118_0072065_53_904 283
570 3300048921 Ga0496118_0091257 Ga0496118_0091257_197_1048 283
571 3300048921 Ga0496118_0108002 Ga0496118_0108002_953_1804 283
572 3300048921 Ga0496118_0138970 Ga0496118_0138970_223_1074 283
573 3300048922 Ga0496119_0013863 Ga0496119_0013863_4898_5749 283
574 3300048922 Ga0496119_0014255 Ga0496119_0014255_492_1343 283
575 3300048923 Ga0496120_0063200 Ga0496120_0063200_25_876 283
576 3300048923 Ga0496120_0108804 Ga0496120_0108804_385_1236 283
577 3300048924 Ga0496121_0018103 Ga0496121_0018103_5137_5988 283
578 3300048924 Ga0496121_0104954 Ga0496121_0104954_727_1578 283
579 3300048924 Ga0496121_0158374 Ga0496121_0158374_224_1075 283
580 3300048924 Ga0496121_0174369 Ga0496121_0174369_224_1075 283
581 3300048925 Ga0496122_0018845 Ga0496122_0018845_284_1135 283
582 3300048925 Ga0496122_0019180 Ga0496122_0019180_471_1322 283
583 3300048926 Ga0496123_0005883 Ga0496123_0005883_9548_10402 283
584 3300048926 Ga0496123_0098019 Ga0496123_0098019_585_1436 283
585 3300048927 Ga0496124_0010228 Ga0496124_0010228_8082_8933 283
586 3300048927 Ga0496124_0102260 Ga0496124_0102260_460_1311 283
587 3300048927 Ga0496124_0162257 Ga0496124_0162257_583_1434 283
588 3300048927 Ga0496124_0185723 Ga0496124_0185723_438_1289 283
589 3300048928 Ga0496125_0012895 Ga0496125_0012895_4210_5061 283
590 3300048928 Ga0496125_0087911 Ga0496125_0087911_364_1215 283
591 3300048929 Ga0496126_0167695 Ga0496126_0167695_375_1226 283
592 3300049459 Ga0495678_041489 Ga0495678_041489_343_1194 283
593 3300049460 Ga0495682_0003811 Ga0495682_0003811_722_1573 283
594 3300049460 Ga0495682_0041754 Ga0495682_0041754_492_1343 283
595 3300049766 Ga0501269_002850 Ga0501269_002850_119_970 283
596 3300050489 nmdc:mga03683_111520_c1 nmdc:mga03683_111520_c1_35_886 283
597 3300050491 nmdc:mga00v17_147598_c1 nmdc:mga00v17_147598_c1_343_1194 283
598 3300050491 nmdc:mga00v17_153323_c1 nmdc:mga00v17_153323_c1_256_1107 283
599 3300050514 nmdc:mga08x19_70088_c1 nmdc:mga08x19_70088_c1_1032_1883 283
600 3300050516 nmdc:mga0sz30_6379_c1 nmdc:mga0sz30_6379_c1_3140_3991 283
601 iso_pu_bacteria 8054929484 8054931023 283
602 2162886007 SwRhRL2b_contig_2050723 SwRhRL2b_0917.00001790 284
603 3300005289 Ga0065704_10070547 Ga0065704_1007054711 284
604 3300013100 Ga0157373_10013196 Ga0157373_100131962 284
605 3300013100 Ga0157373_10014392 Ga0157373_100143922 284
606 3300013102 Ga0157371_10003491 Ga0157371_1000349112 284
607 3300013105 Ga0157369_10030650 Ga0157369_100306504 284
608 3300013306 Ga0163162_10001271 Ga0163162_1000127116 284
609 3300015261 Ga0182006_1002669 Ga0182006_10026697 284
610 3300015265 Ga0182005_1003396 Ga0182005_10033962 284
611 3300017792 Ga0163161_10015126 Ga0163161_100151265 284
612 3300025303 Ga0209051_1047940 Ga0209051_10479402 284
613 3300031548 Ga0307408_100021941 Ga0307408_1000219414 284
614 3300031711 Ga0265314_10010534 Ga0265314_100105345 284
615 3300041405 Ga0439438_000562 Ga0439438_000562_6731_7588 284
616 3300042004 Ga0439445_0013812 Ga0439445_0013812_585_1442 284
617 3300042006 Ga0439432_014115 Ga0439432_014115_207_1064 284
618 3300042009 Ga0439451_007124 Ga0439451_007124_440_1297 284
619 3300042010 Ga0439452_002656 Ga0439452_002656_4470_5327 284
620 3300042016 Ga0439463_006040 Ga0439463_006040_271_1128 284
621 3300042138 Ga0450903_004423 Ga0450903_004423_289_1146 284
622 3300046453 Ga0495627_004102 Ga0495627_004102_4127_4984 284
623 3300046458 Ga0495591_001411 Ga0495591_001411_12860_13717 284
624 3300046463 Ga0495653_0015400 Ga0495653_0015400_1248_2105 284
625 3300046474 Ga0495605_0007807 Ga0495605_0007807_1068_1925 284
626 3300046491 Ga0495584_0010843 Ga0495584_0010843_507_1364 284
627 3300046492 Ga0495585_0013045 Ga0495585_0013045_627_1484 284
628 3300046501 Ga0495607_0012597 Ga0495607_0012597_3892_4749 284
629 3300046513 Ga0495616_0001708 Ga0495616_0001708_12857_13714 284
630 3300046515 Ga0495620_0008361 Ga0495620_0008361_623_1480 284
631 3300046515 Ga0495620_0036333 Ga0495620_0036333_828_1685 284
632 3300046519 Ga0495632_0034404 Ga0495632_0034404_827_1684 284
633 3300046520 Ga0495637_0070533 Ga0495637_0070533_232_1089 284
634 3300046524 Ga0495648_0017162 Ga0495648_0017162_189_1046 284
635 3300046530 Ga0495654_0000663 Ga0495654_0000663_12882_13739 284
636 3300046538 Ga0495609_0029567 Ga0495609_0029567_1052_1909 284
637 3300046660 Ga0495625_0014674 Ga0495625_0014674_1262_2119 284
638 3300046660 Ga0495625_0090300 Ga0495625_0090300_289_1146 284
639 3300046692 Ga0495671_0020650 Ga0495671_0020650_948_1805 284
640 3300046694 Ga0495649_0002234 Ga0495649_0002234_12847_13704 284
641 3300046810 Ga0495660_0007978 Ga0495660_0007978_1263_2120 284
642 3300046810 Ga0495660_0051280 Ga0495660_0051280_1254_2111 284
643 3300047323 Ga0495683_0028039 Ga0495683_0028039_1389_2246 284
644 3300047446 Ga0495679_004736 Ga0495679_004736_1216_2073 284
645 3300047469 Ga0495673_0002001 Ga0495673_0002001_12857_13714 284
646 3300047472 Ga0495686_0004152 Ga0495686_0004152_9974_10831 284
647 3300048091 Ga0495626_0002531 Ga0495626_0002531_1254_2111 284
648 3300048091 Ga0495626_0008233 Ga0495626_0008233_807_1664 284
649 3300048920 Ga0496117_0001815 Ga0496117_0001815_11620_12495 284
650 3300048921 Ga0496118_0002174 Ga0496118_0002174_9899_10774 284
651 3300048924 Ga0496121_0002497 Ga0496121_0002497_16519_17394 284
652 3300048927 Ga0496124_0004905 Ga0496124_0004905_6019_6894 284
653 3300048928 Ga0496125_0007915 Ga0496125_0007915_7793_8668 284
654 3300048929 Ga0496126_0002379 Ga0496126_0002379_8355_9230 284
655 3300049459 Ga0495678_002317 Ga0495678_002317_2296_3153 284
656 3300049459 Ga0495678_004804 Ga0495678_004804_4114_4971 284
657 3300049459 Ga0495678_008179 Ga0495678_008179_4092_4949 284
658 3300049459 Ga0495678_057442 Ga0495678_057442_96_953 284
659 3300049758 Ga0501241_000864 Ga0501241_000864_4751_5608 284
660 iso_pu_bacteria 2511231006 2511263984 284
661 iso_pu_bacteria 2512047018 2512324956 284
662 iso_pu_bacteria 2582580891 2583791081 284
663 iso_pu_bacteria 2597489887 2597856774 284
664 iso_pu_bacteria 2599185185 2599483797 284
665 iso_pu_bacteria 2599185257 2599801443 284
666 iso_pu_bacteria 2600254931 2600365744 284
667 iso_pu_bacteria 2671180172 2671768392 284
668 iso_pu_bacteria 2740892503 2743736202 284
669 iso_pu_bacteria 2844665904 2844669106 284
670 iso_pu_bacteria 2923153595 2923155216 284
671 iso_pu_bacteria 8015687852 8015689437 284
672 iso_pu_bacteria 8019769354 8019774155 284
673 iso_pu_bacteria 8055770955 8055772571 284
674 iso_pu_bacteria 8057798959 8057798999 284
675 2124908027 MRS2a_Contig_523 MRS2a_00404000 285
676 2124908027 MRS2a_Contig_9 MRS2a_00742050 285
677 2162886011 MRS1b_contig_3223266 MRS1b_0426.00000200 285
678 3300002737 JGI25162J39368_1000037 JGI25162J39368_100003793 285
679 3300002771 JGI25163J39215_1000160 JGI25163J39215_100016012 285
680 3300002772 JGI25164J39214_1000020 JGI25164J39214_100002093 285
681 3300003214 JGI25165J46597_1000077 JGI25165J46597_100007793 285
682 3300003781 Ga0055536_1000041 Ga0055536_10000415 285
683 3300003781 Ga0055536_1000042 Ga0055536_100004245 285
684 3300003791 Ga0055530_10000063 Ga0055530_1000006374 285
685 3300003792 Ga0055540_1000604 Ga0055540_100060415 285
686 3300005288 Ga0065714_10000129 Ga0065714_100001296 285
687 3300005288 Ga0065714_10004405 Ga0065714_100044052 285
688 3300005288 Ga0065714_10004572 Ga0065714_100045725 285
689 3300005290 Ga0065712_10000532 Ga0065712_100005329 285
690 3300005293 Ga0065715_10005656 Ga0065715_100056564 285
691 3300009011 Ga0105251_10000060 Ga0105251_1000006017 285
692 3300009011 Ga0105251_10000630 Ga0105251_1000063019 285
693 3300009011 Ga0105251_10002026 Ga0105251_100020266 285
694 3300009011 Ga0105251_10004603 Ga0105251_100046034 285
695 3300009011 Ga0105251_10014831 Ga0105251_100148313 285
696 3300009011 Ga0105251_10039338 Ga0105251_100393382 285
697 3300009036 Ga0105244_10002159 Ga0105244_100021594 285
698 3300009036 Ga0105244_10002763 Ga0105244_100027638 285
699 3300009036 Ga0105244_10004488 Ga0105244_100044886 285
700 3300009092 Ga0105250_10000979 Ga0105250_100009795 285
701 3300009092 Ga0105250_10002986 Ga0105250_100029862 285
702 3300013100 Ga0157373_10001457 Ga0157373_1000145710 285
703 3300013102 Ga0157371_10002880 Ga0157371_100028806 285
704 3300013102 Ga0157371_10020080 Ga0157371_100200802 285
705 3300013104 Ga0157370_10004442 Ga0157370_100044428 285
706 3300013104 Ga0157370_10086299 Ga0157370_100862992 285
707 3300013306 Ga0163162_10018673 Ga0163162_100186735 285
708 3300013306 Ga0163162_10074928 Ga0163162_100749284 285
709 3300013308 Ga0157375_10010475 Ga0157375_100104754 285
710 3300013308 Ga0157375_10738008 Ga0157375_107380082 285
711 3300014497 Ga0182008_10002027 Ga0182008_100020277 285
712 3300014497 Ga0182008_10004747 Ga0182008_100047472 285
713 3300015261 Ga0182006_1001020 Ga0182006_10010205 285
714 3300015262 Ga0182007_10000729 Ga0182007_100007295 285
715 3300015265 Ga0182005_1003133 Ga0182005_10031333 285
716 3300015265 Ga0182005_1018428 Ga0182005_10184282 285
717 3300015265 Ga0182005_1022877 Ga0182005_10228772 285
718 3300015265 Ga0182005_1023064 Ga0182005_10230642 285
719 3300017792 Ga0163161_10002333 Ga0163161_100023337 285
720 3300025207 Ga0209760_100053 Ga0209760_10005375 285
721 3300025231 Ga0207427_100001 Ga0207427_100001863 285
722 3300025233 Ga0209437_100003 Ga0209437_100003509 285
723 3300025261 Ga0209233_1000007 Ga0209233_1000007863 285
724 3300025292 Ga0209676_1000021 Ga0209676_1000021163 285
725 3300025298 Ga0209050_1000107 Ga0209050_1000107162 285
726 3300025303 Ga0209051_1000474 Ga0209051_10004748 285
727 3300025711 Ga0207696_1000818 Ga0207696_10008188 285
728 3300025711 Ga0207696_1002197 Ga0207696_10021976 285
729 3300025728 Ga0207655_1001937 Ga0207655_10019376 285
730 3300025728 Ga0207655_1002976 Ga0207655_10029764 285
731 3300025728 Ga0207655_1008548 Ga0207655_10085486 285
732 3300025735 Ga0207713_1000150 Ga0207713_100015083 285
733 3300025735 Ga0207713_1005386 Ga0207713_10053866 285
734 3300025735 Ga0207713_1006998 Ga0207713_10069986 285
735 3300027111 Ga0209281_1004437 Ga0209281_10044374 285
736 3300030744 Ga0316181_1060393 Ga0316181_10603932 285
737 3300031548 Ga0307408_100002045 Ga0307408_1000020457 285
738 3300031548 Ga0307408_100295151 Ga0307408_1002951512 285
739 3300031731 Ga0307405_10001772 Ga0307405_100017725 285
740 3300031824 Ga0307413_10022187 Ga0307413_100221872 285
741 3300031901 Ga0307406_10002886 Ga0307406_100028864 285
742 3300031911 Ga0307412_10001193 Ga0307412_100011935 285
743 3300031911 Ga0307412_10003158 Ga0307412_100031585 285
744 3300032002 Ga0307416_100070403 Ga0307416_1000704033 285
745 3300032005 Ga0307411_10005587 Ga0307411_100055875 285
746 3300041405 Ga0439438_000735 Ga0439438_000735_10963_11835 285
747 3300041405 Ga0439438_000802 Ga0439438_000802_5856_6734 285
748 3300041405 Ga0439438_010537 Ga0439438_010537_1863_2720 285
749 3300041407 Ga0439447_000425 Ga0439447_000425_6867_7724 285
750 3300041407 Ga0439447_002399 Ga0439447_002399_5248_6105 285
751 3300041407 Ga0439447_009600 Ga0439447_009600_715_1572 285
752 3300041411 Ga0439466_0000563 Ga0439466_0000563_2541_3398 285
753 3300041411 Ga0439466_0000841 Ga0439466_0000841_8421_9278 285
754 3300041411 Ga0439466_0012552 Ga0439466_0012552_1426_2283 285
755 3300041411 Ga0439466_0013241 Ga0439466_0013241_1788_2645 285
756 3300041413 Ga0439465_0011279 Ga0439465_0011279_1401_2258 285
757 3300042006 Ga0439432_001707 Ga0439432_001707_5952_6809 285
758 3300042006 Ga0439432_011449 Ga0439432_011449_339_1196 285
759 3300042006 Ga0439432_031711 Ga0439432_031711_24_896 285
760 3300042009 Ga0439451_000102 Ga0439451_000102_9276_10133 285
761 3300042009 Ga0439451_000661 Ga0439451_000661_4993_5850 285
762 3300042009 Ga0439451_002603 Ga0439451_002603_2024_2881 285
763 3300042009 Ga0439451_038558 Ga0439451_038558_39_896 285
764 3300042010 Ga0439452_001509 Ga0439452_001509_7436_8293 285
765 3300042010 Ga0439452_006238 Ga0439452_006238_55_912 285
766 3300042010 Ga0439452_007239 Ga0439452_007239_1234_2091 285
767 3300042013 Ga0439456_000497 Ga0439456_000497_5303_6160 285
768 3300042013 Ga0439456_000503 Ga0439456_000503_663_1535 285
769 3300042013 Ga0439456_001748 Ga0439456_001748_2496_3353 285
770 3300042013 Ga0439456_005305 Ga0439456_005305_1469_2326 285
771 3300042013 Ga0439456_037794 Ga0439456_037794_80_937 285
772 3300042016 Ga0439463_000413 Ga0439463_000413_663_1529 285
773 3300042016 Ga0439463_002586 Ga0439463_002586_3502_4374 285
774 3300042016 Ga0439463_036985 Ga0439463_036985_183_1040 285
775 3300042115 Ga0450911_000142 Ga0450911_000142_14409_15281 285
776 3300042115 Ga0450911_001259 Ga0450911_001259_541_1398 285
777 3300042115 Ga0450911_004427 Ga0450911_004427_425_1285 285
778 3300042127 Ga0450890_000374 Ga0450890_000374_5081_5938 285
779 3300042129 Ga0450891_000894 Ga0450891_000894_883_1740 285
780 3300042136 Ga0450900_000041 Ga0450900_000041_1148_2020 285
781 3300042137 Ga0450902_002552 Ga0450902_002552_1434_2306 285
782 3300042137 Ga0450902_006507 Ga0450902_006507_387_1244 285
783 3300042138 Ga0450903_007371 Ga0450903_007371_669_1541 285
784 3300042138 Ga0450903_012148 Ga0450903_012148_182_1039 285
785 3300042146 Ga0450907_006358 Ga0450907_006358_473_1330 285
786 3300042146 Ga0450907_010806 Ga0450907_010806_209_1066 285
787 3300042147 Ga0450910_003111 Ga0450910_003111_677_1534 285
788 3300042156 Ga0439446_0002357 Ga0439446_0002357_602_1459 285
789 3300042184 Ga0450908_002485 Ga0450908_002485_771_1628 285
790 3300042185 Ga0450909_000239 Ga0450909_000239_5632_6489 285
791 3300042435 Ga0439434_0015160 Ga0439434_0015160_397_1254 285
792 3300042439 Ga0439464_0016065 Ga0439464_0016065_436_1293 285
793 3300042461 Ga0439460_0001455 Ga0439460_0001455_3221_4078 285
794 3300042461 Ga0439460_0001896 Ga0439460_0001896_1602_2459 285
795 3300042531 Ga0450918_004793 Ga0450918_004793_896_1768 285
796 3300042532 Ga0450893_0003582 Ga0450893_0003582_765_1637 285
797 3300042993 Ga0439440_0017354 Ga0439440_0017354_348_1205 285
798 3300046452 Ga0495617_000328 Ga0495617_000328_13984_14856 285
799 3300046452 Ga0495617_010227 Ga0495617_010227_577_1434 285
800 3300046453 Ga0495627_003513 Ga0495627_003513_5642_6520 285
801 3300046453 Ga0495627_004134 Ga0495627_004134_911_1768 285
802 3300046453 Ga0495627_010317 Ga0495627_010317_2044_2901 285
803 3300046453 Ga0495627_030443 Ga0495627_030443_333_1190 285
804 3300046455 Ga0495603_0000519 Ga0495603_0000519_10284_11141 285
805 3300046455 Ga0495603_0007925 Ga0495603_0007925_1930_2787 285
806 3300046457 Ga0495590_0002661 Ga0495590_0002661_1547_2404 285
807 3300046457 Ga0495590_0029613 Ga0495590_0029613_308_1165 285
808 3300046458 Ga0495591_000256 Ga0495591_000256_13135_14001 285
809 3300046458 Ga0495591_003670 Ga0495591_003670_1759_2616 285
810 3300046458 Ga0495591_044566 Ga0495591_044566_62_919 285
811 3300046459 Ga0495629_0005998 Ga0495629_0005998_6655_7512 285
812 3300046459 Ga0495629_0130859 Ga0495629_0130859_617_1474 285
813 3300046460 Ga0495638_0008730 Ga0495638_0008730_814_1671 285
814 3300046460 Ga0495638_0044050 Ga0495638_0044050_479_1336 285
815 3300046460 Ga0495638_0181745 Ga0495638_0181745_303_1160 285
816 3300046463 Ga0495653_0005114 Ga0495653_0005114_4295_5152 285
817 3300046463 Ga0495653_0030146 Ga0495653_0030146_840_1697 285
818 3300046471 Ga0495650_0001778 Ga0495650_0001778_7932_8789 285
819 3300046471 Ga0495650_0005113 Ga0495650_0005113_4375_5232 285
820 3300046471 Ga0495650_0021962 Ga0495650_0021962_1145_2017 285
821 3300046474 Ga0495605_0000032 Ga0495605_0000032_85852_86709 285
822 3300046474 Ga0495605_0000857 Ga0495605_0000857_1235_2092 285
823 3300046474 Ga0495605_0001277 Ga0495605_0001277_13267_14133 285
824 3300046474 Ga0495605_0001888 Ga0495605_0001888_7827_8684 285
825 3300046474 Ga0495605_0002198 Ga0495605_0002198_9047_9919 285
826 3300046474 Ga0495605_0002521 Ga0495605_0002521_4795_5652 285
827 3300046474 Ga0495605_0006105 Ga0495605_0006105_964_1821 285
828 3300046474 Ga0495605_0018889 Ga0495605_0018889_1823_2680 285
829 3300046474 Ga0495605_0036323 Ga0495605_0036323_379_1236 285
830 3300046474 Ga0495605_0052299 Ga0495605_0052299_23_880 285
831 3300046475 Ga0495639_0000241 Ga0495639_0000241_3656_4513 285
832 3300046475 Ga0495639_0003322 Ga0495639_0003322_546_1403 285
833 3300046477 Ga0495664_0159173 Ga0495664_0159173_419_1276 285
834 3300046491 Ga0495584_0001923 Ga0495584_0001923_4795_5652 285
835 3300046491 Ga0495584_0002126 Ga0495584_0002126_5191_6048 285
836 3300046491 Ga0495584_0002304 Ga0495584_0002304_4792_5649 285
837 3300046491 Ga0495584_0003690 Ga0495584_0003690_5401_6258 285
838 3300046492 Ga0495585_0001287 Ga0495585_0001287_13113_13970 285
839 3300046492 Ga0495585_0009763 Ga0495585_0009763_4128_4985 285
840 3300046499 Ga0495594_0001279 Ga0495594_0001279_449_1306 285
841 3300046499 Ga0495594_0007038 Ga0495594_0007038_92_949 285
842 3300046499 Ga0495594_0037845 Ga0495594_0037845_1131_1988 285
843 3300046499 Ga0495594_0039263 Ga0495594_0039263_1331_2188 285
844 3300046501 Ga0495607_0001754 Ga0495607_0001754_15375_16247 285
845 3300046501 Ga0495607_0002115 Ga0495607_0002115_11317_12183 285
846 3300046501 Ga0495607_0003276 Ga0495607_0003276_5068_5931 285
847 3300046501 Ga0495607_0006139 Ga0495607_0006139_602_1459 285
848 3300046501 Ga0495607_0007248 Ga0495607_0007248_4906_5763 285
849 3300046501 Ga0495607_0008832 Ga0495607_0008832_807_1664 285
850 3300046501 Ga0495607_0009002 Ga0495607_0009002_5171_6028 285
851 3300046501 Ga0495607_0009800 Ga0495607_0009800_570_1436 285
852 3300046501 Ga0495607_0011881 Ga0495607_0011881_1916_2782 285
853 3300046501 Ga0495607_0025600 Ga0495607_0025600_1286_2143 285
854 3300046506 Ga0495583_0000052 Ga0495583_0000052_86580_87437 285
855 3300046506 Ga0495583_0001042 Ga0495583_0001042_13712_14575 285
856 3300046506 Ga0495583_0043477 Ga0495583_0043477_326_1183 285
857 3300046506 Ga0495583_0115354 Ga0495583_0115354_221_1093 285
858 3300046507 Ga0495606_0001451 Ga0495606_0001451_13900_14757 285
859 3300046507 Ga0495606_0013096 Ga0495606_0013096_1415_2281 285
860 3300046507 Ga0495606_0027499 Ga0495606_0027499_2449_3306 285
861 3300046512 Ga0495610_0031497 Ga0495610_0031497_1869_2726 285
862 3300046512 Ga0495610_0039683 Ga0495610_0039683_1488_2345 285
863 3300046513 Ga0495616_0002074 Ga0495616_0002074_7817_8674 285
864 3300046513 Ga0495616_0002254 Ga0495616_0002254_830_1687 285
865 3300046513 Ga0495616_0006526 Ga0495616_0006526_3190_4047 285
866 3300046513 Ga0495616_0018577 Ga0495616_0018577_863_1720 285
867 3300046513 Ga0495616_0019845 Ga0495616_0019845_650_1507 285
868 3300046515 Ga0495620_0000019 Ga0495620_0000019_85895_86752 285
869 3300046515 Ga0495620_0005406 Ga0495620_0005406_1005_1862 285
870 3300046515 Ga0495620_0040610 Ga0495620_0040610_1052_1918 285
871 3300046517 Ga0495630_0045820 Ga0495630_0045820_1550_2407 285
872 3300046518 Ga0495631_0002043 Ga0495631_0002043_1020_1877 285
873 3300046518 Ga0495631_0005944 Ga0495631_0005944_4837_5694 285
874 3300046518 Ga0495631_0031299 Ga0495631_0031299_193_1050 285
875 3300046519 Ga0495632_0001741 Ga0495632_0001741_12465_13322 285
876 3300046519 Ga0495632_0002607 Ga0495632_0002607_1200_2057 285
877 3300046520 Ga0495637_0000898 Ga0495637_0000898_10555_11412 285
878 3300046520 Ga0495637_0001294 Ga0495637_0001294_1095_1952 285
879 3300046520 Ga0495637_0005171 Ga0495637_0005171_5146_6003 285
880 3300046520 Ga0495637_0017508 Ga0495637_0017508_1971_2828 285
881 3300046520 Ga0495637_0019929 Ga0495637_0019929_640_1497 285
882 3300046522 Ga0495643_0002218 Ga0495643_0002218_9831_10688 285
883 3300046522 Ga0495643_0002334 Ga0495643_0002334_9312_10169 285
884 3300046522 Ga0495643_0002599 Ga0495643_0002599_9604_10461 285
885 3300046522 Ga0495643_0002768 Ga0495643_0002768_10237_11109 285
886 3300046522 Ga0495643_0058493 Ga0495643_0058493_173_1030 285
887 3300046523 Ga0495644_0002414 Ga0495644_0002414_5161_6018 285
888 3300046523 Ga0495644_0038159 Ga0495644_0038159_944_1801 285
889 3300046523 Ga0495644_0059060 Ga0495644_0059060_117_974 285
890 3300046524 Ga0495648_0002902 Ga0495648_0002902_6822_7679 285
891 3300046524 Ga0495648_0044124 Ga0495648_0044124_540_1397 285
892 3300046524 Ga0495648_0066505 Ga0495648_0066505_744_1601 285
893 3300046524 Ga0495648_0095192 Ga0495648_0095192_170_1027 285
894 3300046524 Ga0495648_0115944 Ga0495648_0115944_226_1083 285
895 3300046526 Ga0495666_0033192 Ga0495666_0033192_1006_1863 285
896 3300046526 Ga0495666_0046452 Ga0495666_0046452_834_1691 285
897 3300046526 Ga0495666_0069736 Ga0495666_0069736_217_1074 285
898 3300046528 Ga0495642_0000151 Ga0495642_0000151_13210_14067 285
899 3300046528 Ga0495642_0001115 Ga0495642_0001115_1000_1857 285
900 3300046530 Ga0495654_0000819 Ga0495654_0000819_9213_10070 285
901 3300046530 Ga0495654_0001683 Ga0495654_0001683_5570_6442 285
902 3300046530 Ga0495654_0087861 Ga0495654_0087861_163_1020 285
903 3300046530 Ga0495654_0110325 Ga0495654_0110325_68_925 285
904 3300046536 Ga0495587_0001556 Ga0495587_0001556_14186_15043 285
905 3300046538 Ga0495609_0000032 Ga0495609_0000032_124458_125315 285
906 3300046538 Ga0495609_0001044 Ga0495609_0001044_8025_8888 285
907 3300046538 Ga0495609_0001602 Ga0495609_0001602_8014_8871 285
908 3300046538 Ga0495609_0003586 Ga0495609_0003586_2304_3176 285
909 3300046538 Ga0495609_0011106 Ga0495609_0011106_164_1021 285
910 3300046538 Ga0495609_0019776 Ga0495609_0019776_1196_2053 285
911 3300046538 Ga0495609_0026373 Ga0495609_0026373_598_1455 285
912 3300046542 Ga0495597_0000852 Ga0495597_0000852_14282_15139 285
913 3300046542 Ga0495597_0003440 Ga0495597_0003440_2770_3627 285
914 3300046542 Ga0495597_0005741 Ga0495597_0005741_760_1617 285
915 3300046542 Ga0495597_0037447 Ga0495597_0037447_610_1467 285
916 3300046557 Ga0495622_0000294 Ga0495622_0000294_21660_22517 285
917 3300046557 Ga0495622_0000418 Ga0495622_0000418_12270_13127 285
918 3300046557 Ga0495622_0010785 Ga0495622_0010785_290_1147 285
919 3300046558 Ga0495633_0000040 Ga0495633_0000040_90783_91640 285
920 3300046558 Ga0495633_0003735 Ga0495633_0003735_5183_6040 285
921 3300046558 Ga0495633_0007547 Ga0495633_0007547_559_1416 285
922 3300046558 Ga0495633_0066898 Ga0495633_0066898_262_1119 285
923 3300046615 Ga0495656_0059671 Ga0495656_0059671_226_1083 285
924 3300046642 Ga0495634_0008936 Ga0495634_0008936_5074_5931 285
925 3300046648 Ga0495611_0003256 Ga0495611_0003256_1088_1960 285
926 3300046648 Ga0495611_0003539 Ga0495611_0003539_1044_1901 285
927 3300046660 Ga0495625_0017547 Ga0495625_0017547_4082_4939 285
928 3300046660 Ga0495625_0058085 Ga0495625_0058085_520_1377 285
929 3300046660 Ga0495625_0058410 Ga0495625_0058410_657_1514 285
930 3300046660 Ga0495625_0101294 Ga0495625_0101294_545_1402 285
931 3300046664 Ga0495659_0000883 Ga0495659_0000883_4606_5463 285
932 3300046664 Ga0495659_0032182 Ga0495659_0032182_628_1485 285
933 3300046664 Ga0495659_0035335 Ga0495659_0035335_77_949 285
934 3300046665 Ga0495661_0000037 Ga0495661_0000037_84633_85490 285
935 3300046665 Ga0495661_0007526 Ga0495661_0007526_1683_2540 285
936 3300046665 Ga0495661_0011493 Ga0495661_0011493_4764_5621 285
937 3300046665 Ga0495661_0048213 Ga0495661_0048213_476_1333 285
938 3300046665 Ga0495661_0059485 Ga0495661_0059485_637_1494 285
939 3300046674 Ga0495588_0012636 Ga0495588_0012636_2198_3055 285
940 3300046674 Ga0495588_0102262 Ga0495588_0102262_520_1377 285
941 3300046674 Ga0495588_0133269 Ga0495588_0133269_358_1215 285
942 3300046679 Ga0495623_0009046 Ga0495623_0009046_523_1380 285
943 3300046680 Ga0495646_0000953 Ga0495646_0000953_12580_13437 285
944 3300046680 Ga0495646_0059661 Ga0495646_0059661_103_960 285
945 3300046684 Ga0495669_0001725 Ga0495669_0001725_4955_5812 285
946 3300046689 Ga0495613_0032289 Ga0495613_0032289_2773_3630 285
947 3300046689 Ga0495613_0066682 Ga0495613_0066682_557_1414 285
948 3300046691 Ga0495670_0004374 Ga0495670_0004374_5449_6306 285
949 3300046691 Ga0495670_0023737 Ga0495670_0023737_1260_2117 285
950 3300046691 Ga0495670_0032594 Ga0495670_0032594_1142_1999 285
951 3300046691 Ga0495670_0043751 Ga0495670_0043751_610_1488 285
952 3300046691 Ga0495670_0050965 Ga0495670_0050965_1003_1860 285
953 3300046691 Ga0495670_0065327 Ga0495670_0065327_583_1455 285
954 3300046692 Ga0495671_0001424 Ga0495671_0001424_9966_10823 285
955 3300046692 Ga0495671_0001841 Ga0495671_0001841_7806_8663 285
956 3300046692 Ga0495671_0002352 Ga0495671_0002352_2274_3146 285
957 3300046692 Ga0495671_0040679 Ga0495671_0040679_1136_1993 285
958 3300046692 Ga0495671_0115570 Ga0495671_0115570_223_1080 285
959 3300046694 Ga0495649_0002275 Ga0495649_0002275_1260_2117 285
960 3300046694 Ga0495649_0005634 Ga0495649_0005634_963_1820 285
961 3300046694 Ga0495649_0067181 Ga0495649_0067181_1007_1879 285
962 3300046794 Ga0495589_0000263 Ga0495589_0000263_20246_21103 285
963 3300046794 Ga0495589_0000858 Ga0495589_0000858_9879_10736 285
964 3300046794 Ga0495589_0002405 Ga0495589_0002405_8684_9556 285
965 3300046794 Ga0495589_0003745 Ga0495589_0003745_274_1131 285
966 3300046794 Ga0495589_0004393 Ga0495589_0004393_1201_2058 285
967 3300046809 Ga0495600_0018471 Ga0495600_0018471_638_1495 285
968 3300046810 Ga0495660_0002590 Ga0495660_0002590_5486_6343 285
969 3300046810 Ga0495660_0006354 Ga0495660_0006354_5446_6303 285
970 3300046810 Ga0495660_0016204 Ga0495660_0016204_638_1495 285
971 3300046810 Ga0495660_0038082 Ga0495660_0038082_1162_2019 285
972 3300046810 Ga0495660_0052074 Ga0495660_0052074_870_1727 285
973 3300046810 Ga0495660_0139464 Ga0495660_0139464_164_1021 285
974 3300046810 Ga0495660_0156035 Ga0495660_0156035_228_1085 285
975 3300047315 Ga0495581_0007326 Ga0495581_0007326_5043_5900 285
976 3300047315 Ga0495581_0022149 Ga0495581_0022149_1249_2106 285
977 3300047317 Ga0495604_0012312 Ga0495604_0012312_684_1541 285
978 3300047317 Ga0495604_0159090 Ga0495604_0159090_32_889 285
979 3300047318 Ga0495636_0000753 Ga0495636_0000753_8662_9534 285
980 3300047318 Ga0495636_0002077 Ga0495636_0002077_5619_6476 285
981 3300047320 Ga0495672_0001393 Ga0495672_0001393_8662_9534 285
982 3300047320 Ga0495672_0001568 Ga0495672_0001568_14429_15286 285
983 3300047320 Ga0495672_0003479 Ga0495672_0003479_4792_5649 285
984 3300047320 Ga0495672_0013933 Ga0495672_0013933_847_1704 285
985 3300047322 Ga0495680_0015919 Ga0495680_0015919_4849_5706 285
986 3300047322 Ga0495680_0022647 Ga0495680_0022647_901_1758 285
987 3300047323 Ga0495683_0000011 Ga0495683_0000011_86743_87600 285
988 3300047323 Ga0495683_0004075 Ga0495683_0004075_2595_3452 285
989 3300047323 Ga0495683_0005637 Ga0495683_0005637_5013_5870 285
990 3300047323 Ga0495683_0006421 Ga0495683_0006421_5012_5869 285
991 3300047323 Ga0495683_0031292 Ga0495683_0031292_1149_2006 285
992 3300047443 Ga0495687_002112 Ga0495687_002112_759_1616 285
993 3300047443 Ga0495687_008543 Ga0495687_008543_79_936 285
994 3300047444 Ga0495675_0013975 Ga0495675_0013975_763_1620 285
995 3300047444 Ga0495675_0014655 Ga0495675_0014655_221_1078 285
996 3300047445 Ga0495677_0000393 Ga0495677_0000393_12168_13025 285
997 3300047446 Ga0495679_000176 Ga0495679_000176_27343_28200 285
998 3300047446 Ga0495679_003695 Ga0495679_003695_4885_5742 285
999 3300047447 Ga0495685_001024 Ga0495685_001024_4920_5777 285
1000 3300047447 Ga0495685_025697 Ga0495685_025697_890_1747 285
1001 3300047469 Ga0495673_0001247 Ga0495673_0001247_13508_14380 285
1002 3300047469 Ga0495673_0006626 Ga0495673_0006626_723_1580 285
1003 3300047469 Ga0495673_0006858 Ga0495673_0006858_4855_5721 285
1004 3300047469 Ga0495673_0007482 Ga0495673_0007482_510_1367 285
1005 3300047469 Ga0495673_0007539 Ga0495673_0007539_3065_3922 285
1006 3300047469 Ga0495673_0023870 Ga0495673_0023870_2053_2910 285
1007 3300047469 Ga0495673_0059595 Ga0495673_0059595_224_1081 285
1008 3300047470 Ga0495681_0041658 Ga0495681_0041658_292_1149 285
1009 3300047470 Ga0495681_0052239 Ga0495681_0052239_922_1779 285
1010 3300047470 Ga0495681_0059785 Ga0495681_0059785_64_921 285
1011 3300047673 Ga0495593_0003966 Ga0495593_0003966_1034_1891 285
1012 3300047673 Ga0495593_0009549 Ga0495593_0009549_2050_2907 285
1013 3300048091 Ga0495626_0001557 Ga0495626_0001557_11247_12104 285
1014 3300048091 Ga0495626_0005293 Ga0495626_0005293_3800_4657 285
1015 3300048091 Ga0495626_0006059 Ga0495626_0006059_1168_2040 285
1016 3300048091 Ga0495626_0006581 Ga0495626_0006581_648_1505 285
1017 3300048091 Ga0495626_0025111 Ga0495626_0025111_999_1856 285
1018 3300048091 Ga0495626_0103881 Ga0495626_0103881_117_974 285
1019 3300048904 Ga0496101_0062377 Ga0496101_0062377_1265_2137 285
1020 3300048905 Ga0496102_0000604 Ga0496102_0000604_5259_6116 285
1021 3300048905 Ga0496102_0104440 Ga0496102_0104440_1171_2037 285
1022 3300048906 Ga0496103_0006912 Ga0496103_0006912_851_1708 285
1023 3300048913 Ga0496110_0014430 Ga0496110_0014430_764_1621 285
1024 3300048913 Ga0496110_0045914 Ga0496110_0045914_2642_3511 285
1025 3300048913 Ga0496110_0243113 Ga0496110_0243113_551_1408 285
1026 3300048919 Ga0496116_0013391 Ga0496116_0013391_5043_5900 285
1027 3300048919 Ga0496116_0076126 Ga0496116_0076126_358_1215 285
1028 3300048920 Ga0496117_0015165 Ga0496117_0015165_5057_5914 285
1029 3300048921 Ga0496118_0016288 Ga0496118_0016288_874_1731 285
1030 3300048922 Ga0496119_0071686 Ga0496119_0071686_614_1471 285
1031 3300048924 Ga0496121_0001008 Ga0496121_0001008_31795_32667 285
1032 3300048924 Ga0496121_0029665 Ga0496121_0029665_3638_4495 285
1033 3300048924 Ga0496121_0092180 Ga0496121_0092180_836_1693 285
1034 3300048925 Ga0496122_0000945 Ga0496122_0000945_47303_48175 285
1035 3300048925 Ga0496122_0180157 Ga0496122_0180157_364_1221 285
1036 3300048926 Ga0496123_0000888 Ga0496123_0000888_4278_5150 285
1037 3300048926 Ga0496123_0050801 Ga0496123_0050801_1407_2264 285
1038 3300048927 Ga0496124_0002611 Ga0496124_0002611_17051_17920 285
1039 3300048927 Ga0496124_0114546 Ga0496124_0114546_795_1652 285
1040 3300048928 Ga0496125_0005661 Ga0496125_0005661_2913_3782 285
1041 3300048928 Ga0496125_0018010 Ga0496125_0018010_5086_5943 285
1042 3300048928 Ga0496125_0061124 Ga0496125_0061124_1529_2386 285
1043 3300048929 Ga0496126_0133150 Ga0496126_0133150_486_1343 285
1044 3300049459 Ga0495678_000033 Ga0495678_000033_125044_125901 285
1045 3300049459 Ga0495678_002782 Ga0495678_002782_5021_5878 285
1046 3300049459 Ga0495678_003313 Ga0495678_003313_4079_4936 285
1047 3300049459 Ga0495678_005647 Ga0495678_005647_680_1537 285
1048 3300049459 Ga0495678_046636 Ga0495678_046636_319_1176 285
1049 3300049460 Ga0495682_0000072 Ga0495682_0000072_48853_49719 285
1050 3300049460 Ga0495682_0001293 Ga0495682_0001293_5414_6271 285
1051 3300049460 Ga0495682_0002849 Ga0495682_0002849_3866_4723 285
1052 3300049460 Ga0495682_0017809 Ga0495682_0017809_1711_2568 285
1053 3300049460 Ga0495682_0018489 Ga0495682_0018489_1162_2019 285
1054 3300049460 Ga0495682_0019820 Ga0495682_0019820_767_1639 285
1055 3300049460 Ga0495682_0020861 Ga0495682_0020861_677_1534 285
1056 3300049662 Ga0501222_000921 Ga0501222_000921_2193_3050 285
1057 3300049853 Ga0501226_000988 Ga0501226_000988_1278_2135 285
1058 3300053145 Ga0500586_003095 Ga0500586_003095_2126_2998 285
1059 iso_pu_bacteria 2511231023 2511366544 285
1060 iso_pu_bacteria 2511231156 2511823530 285
1061 iso_pu_bacteria 2713897148 2715751880 285
1062 iso_pu_bacteria 2791355520 2794596258 285
1063 iso_pu_bacteria 2808606445 2809216306 285
1064 iso_pu_bacteria 2842832357 2842832769 285
1065 iso_pu_bacteria 2842843487 2842848143 285
1066 iso_pu_bacteria 2919487758 2919491397 285
1067 iso_pu_bacteria 2998139840 2998141538 285
1068 iso_pu_bacteria 3007619802 3007622416 285
1069 iso_pu_bacteria 3007861166 3007863222 285
1070 iso_pu_bacteria 8029995093 8029999210 285
1071 iso_pu_bacteria 8056143049 8056147404 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

28

252

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kvq-assembly1.cif.gz_A-2 udp-galactose 4-epimerase complexed with udp-phenol 0.9009 1 280
7kn1-assembly2.cif.gz_B crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound nad and formylated udp-arabinopyranose 0.8999 2 280
3m2p-assembly2.cif.gz_C the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8983 2 280
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8925 1 280
1kvu-assembly1.cif.gz_A-2 udp-galactose 4-epimerase complexed with udp-phenol 0.8852 1 280
ID Description Score Start End Superfamily
5twcA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9058 2 34 3.50.50.60
af_F4JRN8_123_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8888 1 74 3.40.50.720
3i3lA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8863 2 34 3.50.50.60
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8821 3 34 3.50.50.60
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8714 122 280 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1G0MWY4-F1-model_v4 Epimerase 0.9867 1 279
AF-A0A1G0CXL0-F1-model_v4 Epimerase 0.9814 49 281
AF-A0A1W6E4R5-F1-model_v4 deleted 0.9763 1 278
AF-A0A1M3H5E6-F1-model_v4 Epimerase 0.9726 2 280
AF-A0A1F9BJB4-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9712 1 284

Feature Viewer

pLDDT pTM Quality
95.5 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map