F489489
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1071 | 418 | 968 | 282 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_1051396|Ga0436360_1051396_11_928 |
| Length | 305 |
| Sequence | MSPIVSVNLPSPHTRPGGPRWSRMRPRLAITGAGGFLGRHLVRALRGADVEITLAVRDARRVAGFPGRFDVVELDLASPGPRAFDRLGRPDIVVHLAWGGLPNYRSMHHFETELPRHYAFLRDLVADGLKSVVVTGTCFEYGMQSGPLGEDLPCRPSSPYGLAKHALCRALEFLQATAPFDLVWARVFYVFGEGQAEQSLWSQLNRAVAEGRPRFEMSGGEQLRDFLPVTELAAYLAKLALIRRNLGAINVCSGRPQSVRGLVEGWIRQRGWSIELDLGRYPYPDYEPMAFWGTRDKLDAVLRLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 5 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 6 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 7 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 8 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 9 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 10 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 11 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 12 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 13 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 14 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 15 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 16 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 17 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 18 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 19 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 20 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 21 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 22 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 23 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 24 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 25 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 26 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 27 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 28 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 29 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 30 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 31 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 32 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 33 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 34 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 35 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 36 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 37 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 38 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 39 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 40 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 41 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 42 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 43 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 44 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 45 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 46 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 47 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 48 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 49 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 50 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 51 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 52 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 53 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 54 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 55 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 56 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 57 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 58 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 59 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 60 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 61 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 62 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 63 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 64 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 65 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 66 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 67 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 68 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 69 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 70 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 71 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 72 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 73 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 74 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 75 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 76 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 77 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 78 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 79 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 80 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 81 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 82 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 83 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 84 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 85 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 86 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 87 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 88 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 89 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 90 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 91 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 92 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 93 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 94 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 95 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 96 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 97 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 98 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 99 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 100 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 101 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 102 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 103 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 104 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 105 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 106 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 107 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 112 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 114 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 127 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 128 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 133 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 134 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 135 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 136 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 137 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 138 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 139 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 140 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 141 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 142 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 143 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 144 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 145 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 146 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 148 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 149 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 151 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 169 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 172 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 176 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 234 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 236 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 245 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 246 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 247 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 248 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 249 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 253 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 254 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 255 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 256 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 257 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 258 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 260 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 261 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 262 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 263 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 264 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 265 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 266 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 267 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 268 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 269 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 270 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 271 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 272 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 273 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 274 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 275 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 276 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 277 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 278 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 279 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 280 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 281 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 282 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 283 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 284 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 285 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 286 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 287 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 376 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 377 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 379 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 380 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 381 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 382 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 383 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 384 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 385 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 386 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 387 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 388 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 389 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 390 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 393 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 394 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 395 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 396 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 399 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 401 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 405 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 406 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 407 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 408 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 409 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 410 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 411 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 412 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 413 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 414 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 415 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 416 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 417 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 418 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.38 |
| Metatranscriptomes | 0 |
| Isolates | 9.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.83 |
| Nodule | 1.96 |
| Rhizoplane | 2.99 |
| Rhizosphere | 82.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_523 | 2124908027 | Bacteria | 3119 |
| 2 | MRS2a_Contig_9 | 2124908027 | Bacteria | 55585 |
| 3 | SwRhRL2b_contig_2050723 | 2162886007 | Bacteria | 2951 |
| 4 | MRS1b_contig_3223266 | 2162886011 | Bacteria | 2209 |
| 5 | JGI25162J39368_1000037 | 3300002737 | Bacteria | 179339 |
| 6 | JGI25163J39215_1000160 | 3300002771 | Bacteria | 26649 |
| 7 | JGI25164J39214_1000020 | 3300002772 | Bacteria | 179339 |
| 8 | JGI25165J46597_1000077 | 3300003214 | Bacteria | 179339 |
| 9 | Ga0055536_1000041 | 3300003781 | Bacteria | 127266 |
| 10 | Ga0055536_1000042 | 3300003781 | Bacteria | 125029 |
| 11 | Ga0055536_1000441 | 3300003781 | Bacteria | 29203 |
| 12 | Ga0055536_1000537 | 3300003781 | Bacteria | 26032 |
| 13 | Ga0055530_10000063 | 3300003791 | Bacteria | 94619 |
| 14 | Ga0055530_10000725 | 3300003791 | Bacteria | 27618 |
| 15 | Ga0055540_1000501 | 3300003792 | Bacteria | 29848 |
| 16 | Ga0055540_1000604 | 3300003792 | Bacteria | 25761 |
| 17 | Ga0055531_10001274 | 3300003794 | Bacteria | 19001 |
| 18 | Ga0065714_10000129 | 3300005288 | Bacteria | 12472 |
| 19 | Ga0065714_10004405 | 3300005288 | Bacteria | 6412 |
| 20 | Ga0065714_10004572 | 3300005288 | Bacteria | 6669 |
| 21 | Ga0065704_10070547 | 3300005289 | Bacteria | 20984 |
| 22 | Ga0065712_10000532 | 3300005290 | Bacteria | 15100 |
| 23 | Ga0065715_10005656 | 3300005293 | Bacteria | 5768 |
| 24 | Ga0070658_10139878 | 3300005327 | Bacteria | 2022 |
| 25 | Ga0070658_10178264 | 3300005327 | Bacteria | 1788 |
| 26 | Ga0070676_10011992 | 3300005328 | Bacteria | 4723 |
| 27 | Ga0070676_10112682 | 3300005328 | Bacteria | 1696 |
| 28 | Ga0070670_100002229 | 3300005331 | Bacteria | 15929 |
| 29 | Ga0070670_100005687 | 3300005331 | Bacteria | 10530 |
| 30 | Ga0070670_100024039 | 3300005331 | Bacteria | 5242 |
| 31 | Ga0070670_100070010 | 3300005331 | Bacteria | 3011 |
| 32 | Ga0070670_100273102 | 3300005331 | Bacteria | 1475 |
| 33 | Ga0070677_10019981 | 3300005333 | Bacteria | 2434 |
| 34 | Ga0070677_10023911 | 3300005333 | Bacteria | 2267 |
| 35 | Ga0070677_10156006 | 3300005333 | Bacteria | 1067 |
| 36 | Ga0068869_100039304 | 3300005334 | Bacteria | 3378 |
| 37 | Ga0070666_10057619 | 3300005335 | Bacteria | 2625 |
| 38 | Ga0068868_100066155 | 3300005338 | Bacteria | 2873 |
| 39 | Ga0070661_100071883 | 3300005344 | Bacteria | 2546 |
| 40 | Ga0070668_100001828 | 3300005347 | Bacteria | 15488 |
| 41 | Ga0070669_100014691 | 3300005353 | Bacteria | 5573 |
| 42 | Ga0070669_100029331 | 3300005353 | Bacteria | 3965 |
| 43 | Ga0070669_100057759 | 3300005353 | Bacteria | 2847 |
| 44 | Ga0070675_100007942 | 3300005354 | Bacteria | 8224 |
| 45 | Ga0070675_100017439 | 3300005354 | Bacteria | 5705 |
| 46 | Ga0070675_100063411 | 3300005354 | Bacteria | 3055 |
| 47 | Ga0070675_100067337 | 3300005354 | Bacteria | 2963 |
| 48 | Ga0070675_100093099 | 3300005354 | Bacteria | 2527 |
| 49 | Ga0070675_100124059 | 3300005354 | Bacteria | 2196 |
| 50 | Ga0070675_100298356 | 3300005354 | Bacteria | 1419 |
| 51 | Ga0070671_100009709 | 3300005355 | Bacteria | 7732 |
| 52 | Ga0070671_100030658 | 3300005355 | Bacteria | 4438 |
| 53 | Ga0070671_100127077 | 3300005355 | Bacteria | 2147 |
| 54 | Ga0070671_100152663 | 3300005355 | Bacteria | 1950 |
| 55 | Ga0070674_100004695 | 3300005356 | Bacteria | 7810 |
| 56 | Ga0070674_100373974 | 3300005356 | Bacteria | 1157 |
| 57 | Ga0070673_100006275 | 3300005364 | Bacteria | 7712 |
| 58 | Ga0070673_100067395 | 3300005364 | Bacteria | 2862 |
| 59 | Ga0070659_100037609 | 3300005366 | Bacteria | 3774 |
| 60 | Ga0070667_100012425 | 3300005367 | Bacteria | 7046 |
| 61 | Ga0070667_100259701 | 3300005367 | Bacteria | 1555 |
| 62 | Ga0070700_100043934 | 3300005441 | Bacteria | 2750 |
| 63 | Ga0070678_100027482 | 3300005456 | Bacteria | 3863 |
| 64 | Ga0070678_100144557 | 3300005456 | Bacteria | 1907 |
| 65 | Ga0070678_100329309 | 3300005456 | Bacteria | 1307 |
| 66 | Ga0070662_100002799 | 3300005457 | Bacteria | 10806 |
| 67 | Ga0070662_100023071 | 3300005457 | Bacteria | 4270 |
| 68 | Ga0070662_100041744 | 3300005457 | Bacteria | 3274 |
| 69 | Ga0068867_100007420 | 3300005459 | Bacteria | 7754 |
| 70 | Ga0068867_100009150 | 3300005459 | Bacteria | 6989 |
| 71 | Ga0070684_100301644 | 3300005535 | Bacteria | 1470 |
| 72 | Ga0070697_100082439 | 3300005536 | Bacteria | 2651 |
| 73 | Ga0070672_100002981 | 3300005543 | Bacteria | 10904 |
| 74 | Ga0070672_100005989 | 3300005543 | Bacteria | 8115 |
| 75 | Ga0070696_100049229 | 3300005546 | Bacteria | 2927 |
| 76 | Ga0070665_100140278 | 3300005548 | Bacteria | 2420 |
| 77 | Ga0070665_100287230 | 3300005548 | Bacteria | 1647 |
| 78 | Ga0068852_100066561 | 3300005616 | Bacteria | 3146 |
| 79 | Ga0068852_100587130 | 3300005616 | Bacteria | 1117 |
| 80 | Ga0068859_100040184 | 3300005617 | Bacteria | 4695 |
| 81 | Ga0068864_100005858 | 3300005618 | Bacteria | 10072 |
| 82 | Ga0068864_100072176 | 3300005618 | Bacteria | 3008 |
| 83 | Ga0068866_10007584 | 3300005718 | Bacteria | 4549 |
| 84 | Ga0068861_100004142 | 3300005719 | Bacteria | 9724 |
| 85 | Ga0068851_10108670 | 3300005834 | Bacteria | 1479 |
| 86 | Ga0068863_100003514 | 3300005841 | Bacteria | 15465 |
| 87 | Ga0068863_100018571 | 3300005841 | Bacteria | 6654 |
| 88 | Ga0068863_100105651 | 3300005841 | Bacteria | 2678 |
| 89 | Ga0068858_100185585 | 3300005842 | Bacteria | 1964 |
| 90 | Ga0068860_100036706 | 3300005843 | Bacteria | 4693 |
| 91 | Ga0075364_10207418 | 3300006051 | Bacteria | 1329 |
| 92 | Ga0075432_10000422 | 3300006058 | Bacteria | 12333 |
| 93 | Ga0075432_10002595 | 3300006058 | Bacteria | 6032 |
| 94 | Ga0075362_10081188 | 3300006177 | Bacteria | 1495 |
| 95 | Ga0075369_10024983 | 3300006186 | Bacteria | 2481 |
| 96 | Ga0075366_10013980 | 3300006195 | Bacteria | 4579 |
| 97 | Ga0097621_100015345 | 3300006237 | Bacteria | 5762 |
| 98 | Ga0097621_100069375 | 3300006237 | Bacteria | 2911 |
| 99 | Ga0097621_100189366 | 3300006237 | Bacteria | 1781 |
| 100 | Ga0068871_100001760 | 3300006358 | Bacteria | 14588 |
| 101 | Ga0068871_100025548 | 3300006358 | Bacteria | 4597 |
| 102 | Ga0075436_100033025 | 3300006914 | Bacteria | 3565 |
| 103 | Ga0097620_100040185 | 3300006931 | Bacteria | 4695 |
| 104 | Ga0079104_1003979 | 3300006946 | Bacteria | 6577 |
| 105 | Ga0105251_10000060 | 3300009011 | Bacteria | 102799 |
| 106 | Ga0105251_10000630 | 3300009011 | Bacteria | 32361 |
| 107 | Ga0105251_10002026 | 3300009011 | Bacteria | 16435 |
| 108 | Ga0105251_10004603 | 3300009011 | Bacteria | 9314 |
| 109 | Ga0105251_10014831 | 3300009011 | Bacteria | 4284 |
| 110 | Ga0105251_10039338 | 3300009011 | Bacteria | 2311 |
| 111 | Ga0105251_10052192 | 3300009011 | Bacteria | 1947 |
| 112 | Ga0105251_10083917 | 3300009011 | Bacteria | 1470 |
| 113 | Ga0105244_10002159 | 3300009036 | Bacteria | 15083 |
| 114 | Ga0105244_10002763 | 3300009036 | Bacteria | 13090 |
| 115 | Ga0105244_10004488 | 3300009036 | Bacteria | 9585 |
| 116 | Ga0105244_10018701 | 3300009036 | Bacteria | 3880 |
| 117 | Ga0105244_10138646 | 3300009036 | Bacteria | 1171 |
| 118 | Ga0105244_10151655 | 3300009036 | Bacteria | 1110 |
| 119 | Ga0105250_10000979 | 3300009092 | Bacteria | 16634 |
| 120 | Ga0105250_10001081 | 3300009092 | Bacteria | 15436 |
| 121 | Ga0105250_10002986 | 3300009092 | Bacteria | 8213 |
| 122 | Ga0105250_10007464 | 3300009092 | Bacteria | 4694 |
| 123 | Ga0111539_10007100 | 3300009094 | Bacteria | 14354 |
| 124 | Ga0105245_10020891 | 3300009098 | Bacteria | 5740 |
| 125 | Ga0105243_10000162 | 3300009148 | Bacteria | 75904 |
| 126 | Ga0105243_10022667 | 3300009148 | Bacteria | 4775 |
| 127 | Ga0105248_10102314 | 3300009177 | Bacteria | 3229 |
| 128 | Ga0105248_10647280 | 3300009177 | Unclassified | 1192 |
| 129 | Ga0105246_10008116 | 3300011119 | Bacteria | 6444 |
| 130 | Ga0157373_10001457 | 3300013100 | Bacteria | 18087 |
| 131 | Ga0157373_10002764 | 3300013100 | Bacteria | 13273 |
| 132 | Ga0157373_10008956 | 3300013100 | Bacteria | 7404 |
| 133 | Ga0157373_10013196 | 3300013100 | Bacteria | 6064 |
| 134 | Ga0157373_10014392 | 3300013100 | Bacteria | 5799 |
| 135 | Ga0157371_10002880 | 3300013102 | Bacteria | 16085 |
| 136 | Ga0157371_10003491 | 3300013102 | Bacteria | 14221 |
| 137 | Ga0157371_10020080 | 3300013102 | Bacteria | 4920 |
| 138 | Ga0157371_10070073 | 3300013102 | Bacteria | 2482 |
| 139 | Ga0157370_10004442 | 3300013104 | Bacteria | 16069 |
| 140 | Ga0157370_10008202 | 3300013104 | Bacteria | 11287 |
| 141 | Ga0157370_10056197 | 3300013104 | Bacteria | 3746 |
| 142 | Ga0157370_10086299 | 3300013104 | Bacteria | 2949 |
| 143 | Ga0157370_10285461 | 3300013104 | Bacteria | 1525 |
| 144 | Ga0157369_10008420 | 3300013105 | Bacteria | 11827 |
| 145 | Ga0157369_10030650 | 3300013105 | Bacteria | 5931 |
| 146 | Ga0157369_10293281 | 3300013105 | Bacteria | 1693 |
| 147 | Ga0163162_10001271 | 3300013306 | Bacteria | 23584 |
| 148 | Ga0163162_10004598 | 3300013306 | Bacteria | 13296 |
| 149 | Ga0163162_10006558 | 3300013306 | Bacteria | 11276 |
| 150 | Ga0163162_10018673 | 3300013306 | Bacteria | 6794 |
| 151 | Ga0163162_10074928 | 3300013306 | Bacteria | 3444 |
| 152 | Ga0163162_10095782 | 3300013306 | Bacteria | 3055 |
| 153 | Ga0163162_10369762 | 3300013306 | Bacteria | 1567 |
| 154 | Ga0163162_10506589 | 3300013306 | Bacteria | 1337 |
| 155 | Ga0157372_10001365 | 3300013307 | Bacteria | 26415 |
| 156 | Ga0157372_10182322 | 3300013307 | Bacteria | 2431 |
| 157 | Ga0157375_10010475 | 3300013308 | Bacteria | 8160 |
| 158 | Ga0157375_10046742 | 3300013308 | Bacteria | 4223 |
| 159 | Ga0157375_10129766 | 3300013308 | Bacteria | 2639 |
| 160 | Ga0157375_10231695 | 3300013308 | Bacteria | 2006 |
| 161 | Ga0157375_10714532 | 3300013308 | Bacteria | 1155 |
| 162 | Ga0157375_10738008 | 3300013308 | Bacteria | 1137 |
| 163 | Ga0163163_10150092 | 3300014325 | Bacteria | 2375 |
| 164 | Ga0163163_10179646 | 3300014325 | Bacteria | 2163 |
| 165 | Ga0157380_10010808 | 3300014326 | Bacteria | 6581 |
| 166 | Ga0157380_10040339 | 3300014326 | Unclassified | 3636 |
| 167 | Ga0182008_10002027 | 3300014497 | Bacteria | 12993 |
| 168 | Ga0182008_10004747 | 3300014497 | Bacteria | 7868 |
| 169 | Ga0182008_10004863 | 3300014497 | Bacteria | 7762 |
| 170 | Ga0182008_10006302 | 3300014497 | Bacteria | 6654 |
| 171 | Ga0182008_10078408 | 3300014497 | Bacteria | 1625 |
| 172 | Ga0157379_10009072 | 3300014968 | Bacteria | 8667 |
| 173 | Ga0157376_10002090 | 3300014969 | Bacteria | 13430 |
| 174 | Ga0157376_10003642 | 3300014969 | Bacteria | 10634 |
| 175 | Ga0157376_10043120 | 3300014969 | Bacteria | 3701 |
| 176 | Ga0182006_1001020 | 3300015261 | Bacteria | 18304 |
| 177 | Ga0182006_1002669 | 3300015261 | Bacteria | 9601 |
| 178 | Ga0182006_1055688 | 3300015261 | Bacteria | 1509 |
| 179 | Ga0182007_10000729 | 3300015262 | Bacteria | 18597 |
| 180 | Ga0182005_1003133 | 3300015265 | Bacteria | 5689 |
| 181 | Ga0182005_1003396 | 3300015265 | Bacteria | 5417 |
| 182 | Ga0182005_1018428 | 3300015265 | Bacteria | 1929 |
| 183 | Ga0182005_1022877 | 3300015265 | Bacteria | 1710 |
| 184 | Ga0182005_1023064 | 3300015265 | Bacteria | 1703 |
| 185 | Ga0182005_1026198 | 3300015265 | Bacteria | 1591 |
| 186 | Ga0163161_10002333 | 3300017792 | Bacteria | 13603 |
| 187 | Ga0163161_10015126 | 3300017792 | Bacteria | 5378 |
| 188 | Ga0163161_10021069 | 3300017792 | Bacteria | 4582 |
| 189 | Ga0163161_10036517 | 3300017792 | Bacteria | 3519 |
| 190 | Ga0163161_10040626 | 3300017792 | Bacteria | 3341 |
| 191 | Ga0213876_10019248 | 3300021384 | Bacteria | 3606 |
| 192 | Ga0209760_100053 | 3300025207 | Bacteria | 103438 |
| 193 | Ga0209563_100535 | 3300025230 | Bacteria | 12790 |
| 194 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 195 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 196 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 197 | Ga0209675_1002483 | 3300025291 | Bacteria | 9447 |
| 198 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 199 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 200 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 201 | Ga0209050_1000036 | 3300025298 | Bacteria | 423070 |
| 202 | Ga0209050_1000107 | 3300025298 | Bacteria | 223303 |
| 203 | Ga0209051_1000043 | 3300025303 | Bacteria | 305473 |
| 204 | Ga0209051_1000474 | 3300025303 | Bacteria | 52139 |
| 205 | Ga0209051_1047940 | 3300025303 | Bacteria | 1454 |
| 206 | Ga0209257_1000098 | 3300025304 | Bacteria | 256390 |
| 207 | Ga0209257_1015245 | 3300025304 | Bacteria | 3217 |
| 208 | Ga0207697_10064968 | 3300025315 | Bacteria | 1522 |
| 209 | Ga0207656_10069336 | 3300025321 | Bacteria | 1564 |
| 210 | Ga0207696_1000101 | 3300025711 | Bacteria | 170899 |
| 211 | Ga0207696_1000818 | 3300025711 | Bacteria | 20016 |
| 212 | Ga0207696_1000979 | 3300025711 | Bacteria | 17265 |
| 213 | Ga0207696_1002197 | 3300025711 | Bacteria | 9779 |
| 214 | Ga0207655_1000402 | 3300025728 | Bacteria | 59961 |
| 215 | Ga0207655_1001937 | 3300025728 | Bacteria | 17700 |
| 216 | Ga0207655_1002976 | 3300025728 | Bacteria | 13005 |
| 217 | Ga0207655_1008548 | 3300025728 | Bacteria | 6478 |
| 218 | Ga0207655_1019806 | 3300025728 | Bacteria | 3494 |
| 219 | Ga0207655_1026603 | 3300025728 | Bacteria | 2775 |
| 220 | Ga0207655_1038191 | 3300025728 | Bacteria | 2103 |
| 221 | Ga0207713_1000150 | 3300025735 | Bacteria | 105170 |
| 222 | Ga0207713_1005386 | 3300025735 | Bacteria | 8024 |
| 223 | Ga0207713_1006998 | 3300025735 | Bacteria | 6761 |
| 224 | Ga0207713_1039279 | 3300025735 | Bacteria | 1998 |
| 225 | Ga0207713_1040943 | 3300025735 | Bacteria | 1939 |
| 226 | Ga0207682_10012514 | 3300025893 | Bacteria | 3311 |
| 227 | Ga0207682_10017480 | 3300025893 | Bacteria | 2801 |
| 228 | Ga0207682_10048593 | 3300025893 | Bacteria | 1749 |
| 229 | Ga0207642_10033859 | 3300025899 | Bacteria | 2166 |
| 230 | Ga0207688_10157340 | 3300025901 | Bacteria | 1345 |
| 231 | Ga0207680_10064526 | 3300025903 | Bacteria | 2245 |
| 232 | Ga0207680_10314395 | 3300025903 | Bacteria | 1094 |
| 233 | Ga0207645_10004107 | 3300025907 | Bacteria | 10831 |
| 234 | Ga0207643_10054378 | 3300025908 | Bacteria | 2275 |
| 235 | Ga0207662_10044865 | 3300025918 | Bacteria | 2611 |
| 236 | Ga0207649_10055026 | 3300025920 | Bacteria | 2479 |
| 237 | Ga0207646_10002099 | 3300025922 | Bacteria | 23898 |
| 238 | Ga0207681_10011566 | 3300025923 | Bacteria | 5422 |
| 239 | Ga0207681_10024126 | 3300025923 | Bacteria | 3900 |
| 240 | Ga0207650_10001201 | 3300025925 | Bacteria | 19013 |
| 241 | Ga0207650_10002944 | 3300025925 | Bacteria | 11746 |
| 242 | Ga0207650_10008268 | 3300025925 | Bacteria | 7104 |
| 243 | Ga0207650_10042469 | 3300025925 | Bacteria | 3336 |
| 244 | Ga0207650_10229608 | 3300025925 | Bacteria | 1496 |
| 245 | Ga0207659_10017831 | 3300025926 | Bacteria | 4645 |
| 246 | Ga0207659_10047638 | 3300025926 | Bacteria | 3033 |
| 247 | Ga0207659_10056637 | 3300025926 | Bacteria | 2808 |
| 248 | Ga0207659_10116093 | 3300025926 | Bacteria | 2043 |
| 249 | Ga0207659_10153911 | 3300025926 | Unclassified | 1798 |
| 250 | Ga0207644_10012599 | 3300025931 | Bacteria | 5620 |
| 251 | Ga0207644_10160245 | 3300025931 | Bacteria | 1748 |
| 252 | Ga0207690_10320643 | 3300025932 | Bacteria | 1218 |
| 253 | Ga0207706_10008925 | 3300025933 | Bacteria | 9227 |
| 254 | Ga0207706_10035537 | 3300025933 | Bacteria | 4429 |
| 255 | Ga0207709_10000053 | 3300025935 | Bacteria | 225514 |
| 256 | Ga0207709_10019377 | 3300025935 | Bacteria | 3825 |
| 257 | Ga0207670_10067725 | 3300025936 | Bacteria | 2457 |
| 258 | Ga0207669_10005768 | 3300025937 | Bacteria | 5591 |
| 259 | Ga0207704_10172954 | 3300025938 | Bacteria | 1551 |
| 260 | Ga0207691_10000964 | 3300025940 | Bacteria | 28552 |
| 261 | Ga0207691_10025170 | 3300025940 | Bacteria | 5589 |
| 262 | Ga0207691_10070219 | 3300025940 | Bacteria | 3163 |
| 263 | Ga0207691_10118545 | 3300025940 | Bacteria | 2348 |
| 264 | Ga0207711_10082130 | 3300025941 | Bacteria | 2816 |
| 265 | Ga0207711_10196189 | 3300025941 | Bacteria | 1841 |
| 266 | Ga0207689_10010069 | 3300025942 | Bacteria | 8148 |
| 267 | Ga0207679_10421162 | 3300025945 | Bacteria | 1178 |
| 268 | Ga0207651_10001048 | 3300025960 | Bacteria | 12244 |
| 269 | Ga0207651_10055966 | 3300025960 | Bacteria | 2712 |
| 270 | Ga0207712_10018024 | 3300025961 | Bacteria | 4594 |
| 271 | Ga0207640_10284192 | 3300025981 | Bacteria | 1301 |
| 272 | Ga0207658_10028783 | 3300025986 | Bacteria | 3916 |
| 273 | Ga0207658_10080727 | 3300025986 | Bacteria | 2492 |
| 274 | Ga0207677_10169222 | 3300026023 | Bacteria | 1707 |
| 275 | Ga0207703_10039834 | 3300026035 | Bacteria | 3758 |
| 276 | Ga0207639_10081823 | 3300026041 | Bacteria | 2558 |
| 277 | Ga0207641_10007595 | 3300026088 | Bacteria | 9017 |
| 278 | Ga0207641_10014579 | 3300026088 | Bacteria | 6444 |
| 279 | Ga0207641_10133945 | 3300026088 | Bacteria | 2228 |
| 280 | Ga0207648_10020407 | 3300026089 | Bacteria | 5966 |
| 281 | Ga0207648_10034632 | 3300026089 | Bacteria | 4451 |
| 282 | Ga0207648_10049136 | 3300026089 | Bacteria | 3693 |
| 283 | Ga0207676_10121560 | 3300026095 | Bacteria | 2203 |
| 284 | Ga0207674_10143439 | 3300026116 | Bacteria | 2347 |
| 285 | Ga0207675_100006516 | 3300026118 | Bacteria | 11049 |
| 286 | Ga0207683_10032674 | 3300026121 | Bacteria | 4520 |
| 287 | Ga0207683_10048104 | 3300026121 | Bacteria | 3735 |
| 288 | Ga0207683_10074060 | 3300026121 | Bacteria | 3013 |
| 289 | Ga0207683_10190295 | 3300026121 | Bacteria | 1863 |
| 290 | Ga0207698_10029360 | 3300026142 | Bacteria | 3938 |
| 291 | Ga0209281_1004437 | 3300027111 | Bacteria | 4201 |
| 292 | Ga0207428_10073217 | 3300027907 | Bacteria | 2688 |
| 293 | Ga0207428_10080653 | 3300027907 | Bacteria | 2542 |
| 294 | Ga0268266_10054016 | 3300028379 | Bacteria | 3452 |
| 295 | Ga0268266_10149169 | 3300028379 | Bacteria | 2106 |
| 296 | Ga0268266_10218183 | 3300028379 | Bacteria | 1752 |
| 297 | Ga0268265_10062451 | 3300028380 | Bacteria | 2862 |
| 298 | Ga0268264_10010901 | 3300028381 | Bacteria | 7510 |
| 299 | Ga0307515_10000180 | 3300028794 | Bacteria | 156173 |
| 300 | Ga0307515_10155775 | 3300028794 | Bacteria | 2359 |
| 301 | Ga0265324_10000032 | 3300029957 | Bacteria | 125653 |
| 302 | Ga0316181_1060393 | 3300030744 | Bacteria | 4243 |
| 303 | Ga0265332_10000004 | 3300031238 | Bacteria | 426592 |
| 304 | Ga0265331_10024250 | 3300031250 | Bacteria | 3071 |
| 305 | Ga0307408_100002045 | 3300031548 | Bacteria | 14522 |
| 306 | Ga0307408_100002790 | 3300031548 | Bacteria | 12127 |
| 307 | Ga0307408_100021941 | 3300031548 | Bacteria | 4330 |
| 308 | Ga0307408_100295151 | 3300031548 | Bacteria | 1355 |
| 309 | Ga0307408_100499494 | 3300031548 | Bacteria | 1064 |
| 310 | Ga0265314_10010534 | 3300031711 | Bacteria | 7698 |
| 311 | Ga0307405_10001772 | 3300031731 | Bacteria | 9241 |
| 312 | Ga0307405_10006846 | 3300031731 | Bacteria | 5651 |
| 313 | Ga0307413_10022187 | 3300031824 | Bacteria | 3416 |
| 314 | Ga0307406_10002886 | 3300031901 | Bacteria | 9361 |
| 315 | Ga0307412_10001193 | 3300031911 | Bacteria | 14815 |
| 316 | Ga0307412_10003158 | 3300031911 | Bacteria | 9150 |
| 317 | Ga0307412_10007173 | 3300031911 | Bacteria | 6326 |
| 318 | Ga0307412_10100642 | 3300031911 | Bacteria | 2043 |
| 319 | Ga0307412_10632622 | 3300031911 | Bacteria | 910 |
| 320 | Ga0307409_100000746 | 3300031995 | Bacteria | 14658 |
| 321 | Ga0307416_100011193 | 3300032002 | Bacteria | 5963 |
| 322 | Ga0307416_100062975 | 3300032002 | Bacteria | 3035 |
| 323 | Ga0307416_100070403 | 3300032002 | Bacteria | 2900 |
| 324 | Ga0307416_100180371 | 3300032002 | Bacteria | 1978 |
| 325 | Ga0307414_10029301 | 3300032004 | Bacteria | 3581 |
| 326 | Ga0307414_10068668 | 3300032004 | Bacteria | 2544 |
| 327 | Ga0307411_10005587 | 3300032005 | Bacteria | 6195 |
| 328 | Ga0307411_10189722 | 3300032005 | Bacteria | 1568 |
| 329 | Ga0307510_10005583 | 3300033180 | Bacteria | 14990 |
| 330 | Ga0373953_0062927 | 3300035117 | Bacteria | 1520 |
| 331 | Ga0373937_0038014 | 3300036401 | Bacteria | 4387 |
| 332 | Ga0373937_0057084 | 3300036401 | Bacteria | 3586 |
| 333 | Ga0373937_0063401 | 3300036401 | Bacteria | 3399 |
| 334 | Ga0436365_1450265 | 3300039437 | Bacteria | 5822 |
| 335 | Ga0436360_1051396 | 3300039438 | Bacteria | 1307 |
| 336 | Ga0436363_1071075 | 3300039450 | Bacteria | 3782 |
| 337 | Ga0439438_000562 | 3300041405 | Bacteria | 16896 |
| 338 | Ga0439438_000735 | 3300041405 | Bacteria | 14715 |
| 339 | Ga0439438_000802 | 3300041405 | Bacteria | 14035 |
| 340 | Ga0439438_002175 | 3300041405 | Bacteria | 8448 |
| 341 | Ga0439438_003910 | 3300041405 | Bacteria | 5864 |
| 342 | Ga0439438_010537 | 3300041405 | Bacteria | 2917 |
| 343 | Ga0439447_000425 | 3300041407 | Bacteria | 15732 |
| 344 | Ga0439447_002399 | 3300041407 | Bacteria | 6847 |
| 345 | Ga0439447_004257 | 3300041407 | Bacteria | 4960 |
| 346 | Ga0439447_009600 | 3300041407 | Bacteria | 2921 |
| 347 | Ga0439447_025666 | 3300041407 | Bacteria | 1516 |
| 348 | Ga0439447_036537 | 3300041407 | Bacteria | 1213 |
| 349 | Ga0439466_0000563 | 3300041411 | Bacteria | 13959 |
| 350 | Ga0439466_0000841 | 3300041411 | Bacteria | 11679 |
| 351 | Ga0439466_0005342 | 3300041411 | Bacteria | 4911 |
| 352 | Ga0439466_0012552 | 3300041411 | Bacteria | 3118 |
| 353 | Ga0439466_0013241 | 3300041411 | Bacteria | 3021 |
| 354 | Ga0439466_0014195 | 3300041411 | Bacteria | 2904 |
| 355 | Ga0439465_0011279 | 3300041413 | Bacteria | 2804 |
| 356 | Ga0439465_0125953 | 3300041413 | Bacteria | 901 |
| 357 | Ga0451795_1645496 | 3300041456 | Bacteria | 1533 |
| 358 | Ga0451853_1460144 | 3300041512 | Bacteria | 1441 |
| 359 | Ga0439431_0001457 | 3300041997 | Bacteria | 5221 |
| 360 | Ga0439445_0005750 | 3300042004 | Bacteria | 2833 |
| 361 | Ga0439445_0013812 | 3300042004 | Bacteria | 1958 |
| 362 | Ga0439432_001707 | 3300042006 | Bacteria | 8217 |
| 363 | Ga0439432_003625 | 3300042006 | Bacteria | 5714 |
| 364 | Ga0439432_011449 | 3300042006 | Bacteria | 3057 |
| 365 | Ga0439432_014115 | 3300042006 | Bacteria | 2706 |
| 366 | Ga0439432_027166 | 3300042006 | Bacteria | 1870 |
| 367 | Ga0439432_031711 | 3300042006 | Bacteria | 1707 |
| 368 | Ga0439451_000102 | 3300042009 | Bacteria | 15228 |
| 369 | Ga0439451_000661 | 3300042009 | Bacteria | 6532 |
| 370 | Ga0439451_002603 | 3300042009 | Bacteria | 3666 |
| 371 | Ga0439451_007124 | 3300042009 | Bacteria | 2285 |
| 372 | Ga0439451_038558 | 3300042009 | Bacteria | 959 |
| 373 | Ga0439452_000346 | 3300042010 | Bacteria | 28745 |
| 374 | Ga0439452_001509 | 3300042010 | Bacteria | 9418 |
| 375 | Ga0439452_002656 | 3300042010 | Bacteria | 6504 |
| 376 | Ga0439452_003450 | 3300042010 | Bacteria | 5527 |
| 377 | Ga0439452_004522 | 3300042010 | Bacteria | 4651 |
| 378 | Ga0439452_006238 | 3300042010 | Bacteria | 3749 |
| 379 | Ga0439452_007239 | 3300042010 | Bacteria | 3412 |
| 380 | Ga0439456_000497 | 3300042013 | Bacteria | 8476 |
| 381 | Ga0439456_000503 | 3300042013 | Bacteria | 8414 |
| 382 | Ga0439456_001748 | 3300042013 | Bacteria | 4394 |
| 383 | Ga0439456_005305 | 3300042013 | Bacteria | 2617 |
| 384 | Ga0439456_005912 | 3300042013 | Bacteria | 2490 |
| 385 | Ga0439456_019207 | 3300042013 | Bacteria | 1436 |
| 386 | Ga0439456_037794 | 3300042013 | Bacteria | 1043 |
| 387 | Ga0439463_000413 | 3300042016 | Bacteria | 11870 |
| 388 | Ga0439463_002586 | 3300042016 | Bacteria | 4591 |
| 389 | Ga0439463_006040 | 3300042016 | Bacteria | 3008 |
| 390 | Ga0439463_026429 | 3300042016 | Bacteria | 1458 |
| 391 | Ga0439463_036985 | 3300042016 | Bacteria | 1237 |
| 392 | Ga0450911_000142 | 3300042115 | Bacteria | 29194 |
| 393 | Ga0450911_001259 | 3300042115 | Bacteria | 6064 |
| 394 | Ga0450911_004427 | 3300042115 | Bacteria | 2304 |
| 395 | Ga0450890_000374 | 3300042127 | Bacteria | 6519 |
| 396 | Ga0450891_000894 | 3300042129 | Bacteria | 3120 |
| 397 | Ga0450900_000041 | 3300042136 | Bacteria | 5773 |
| 398 | Ga0450902_002552 | 3300042137 | Bacteria | 2588 |
| 399 | Ga0450902_006507 | 3300042137 | Bacteria | 1789 |
| 400 | Ga0450903_004423 | 3300042138 | Bacteria | 2395 |
| 401 | Ga0450903_006832 | 3300042138 | Bacteria | 1888 |
| 402 | Ga0450903_007371 | 3300042138 | Bacteria | 1812 |
| 403 | Ga0450903_012148 | 3300042138 | Bacteria | 1377 |
| 404 | Ga0450904_001612 | 3300042139 | Bacteria | 3055 |
| 405 | Ga0450905_000228 | 3300042142 | Bacteria | 6434 |
| 406 | Ga0450905_011848 | 3300042142 | Bacteria | 1223 |
| 407 | Ga0450889_006595 | 3300042144 | Bacteria | 1166 |
| 408 | Ga0450906_000168 | 3300042145 | Bacteria | 12261 |
| 409 | Ga0450907_006358 | 3300042146 | Bacteria | 1972 |
| 410 | Ga0450907_010806 | 3300042146 | Bacteria | 1515 |
| 411 | Ga0450910_000525 | 3300042147 | Bacteria | 4560 |
| 412 | Ga0450910_003111 | 3300042147 | Bacteria | 2192 |
| 413 | Ga0439446_0002357 | 3300042156 | Bacteria | 4522 |
| 414 | Ga0439446_0011777 | 3300042156 | Bacteria | 2379 |
| 415 | Ga0450908_002485 | 3300042184 | Bacteria | 3605 |
| 416 | Ga0450909_000239 | 3300042185 | Bacteria | 6543 |
| 417 | Ga0439434_0015160 | 3300042435 | Bacteria | 2297 |
| 418 | Ga0439464_0016065 | 3300042439 | Bacteria | 2023 |
| 419 | Ga0439460_0001455 | 3300042461 | Bacteria | 5591 |
| 420 | Ga0439460_0001896 | 3300042461 | Bacteria | 4992 |
| 421 | Ga0450918_004793 | 3300042531 | Bacteria | 2448 |
| 422 | Ga0450893_0003582 | 3300042532 | Bacteria | 2447 |
| 423 | Ga0450893_0004680 | 3300042532 | Bacteria | 2182 |
| 424 | Ga0439440_0017354 | 3300042993 | Bacteria | 1584 |
| 425 | Ga0453684_0116111 | 3300044712 | Bacteria | 3242 |
| 426 | Ga0495617_000328 | 3300046452 | Bacteria | 26666 |
| 427 | Ga0495617_010227 | 3300046452 | Bacteria | 3213 |
| 428 | Ga0495617_018016 | 3300046452 | Bacteria | 2387 |
| 429 | Ga0495617_020665 | 3300046452 | Bacteria | 2225 |
| 430 | Ga0495617_031546 | 3300046452 | Bacteria | 1779 |
| 431 | Ga0495627_001228 | 3300046453 | Bacteria | 15983 |
| 432 | Ga0495627_003513 | 3300046453 | Bacteria | 6869 |
| 433 | Ga0495627_004102 | 3300046453 | Bacteria | 6190 |
| 434 | Ga0495627_004134 | 3300046453 | Bacteria | 6157 |
| 435 | Ga0495627_010317 | 3300046453 | Bacteria | 3401 |
| 436 | Ga0495627_030443 | 3300046453 | Bacteria | 1710 |
| 437 | Ga0495592_0013417 | 3300046454 | Bacteria | 6234 |
| 438 | Ga0495603_0000519 | 3300046455 | Bacteria | 21413 |
| 439 | Ga0495603_0007925 | 3300046455 | Bacteria | 6408 |
| 440 | Ga0495590_0002661 | 3300046457 | Bacteria | 7382 |
| 441 | Ga0495590_0002663 | 3300046457 | Bacteria | 7379 |
| 442 | Ga0495590_0003209 | 3300046457 | Bacteria | 6683 |
| 443 | Ga0495590_0003906 | 3300046457 | Bacteria | 6064 |
| 444 | Ga0495590_0029613 | 3300046457 | Bacteria | 1918 |
| 445 | Ga0495591_000256 | 3300046458 | Bacteria | 50723 |
| 446 | Ga0495591_001026 | 3300046458 | Bacteria | 18885 |
| 447 | Ga0495591_001411 | 3300046458 | Bacteria | 14972 |
| 448 | Ga0495591_002226 | 3300046458 | Bacteria | 11056 |
| 449 | Ga0495591_003670 | 3300046458 | Bacteria | 7806 |
| 450 | Ga0495591_019789 | 3300046458 | Bacteria | 2243 |
| 451 | Ga0495591_021687 | 3300046458 | Bacteria | 2091 |
| 452 | Ga0495591_026058 | 3300046458 | Bacteria | 1824 |
| 453 | Ga0495591_044566 | 3300046458 | Bacteria | 1241 |
| 454 | Ga0495629_0005998 | 3300046459 | Bacteria | 9035 |
| 455 | Ga0495629_0106403 | 3300046459 | Bacteria | 1957 |
| 456 | Ga0495629_0130859 | 3300046459 | Bacteria | 1748 |
| 457 | Ga0495638_0000059 | 3300046460 | Bacteria | 191461 |
| 458 | Ga0495638_0007805 | 3300046460 | Bacteria | 7641 |
| 459 | Ga0495638_0008730 | 3300046460 | Bacteria | 7162 |
| 460 | Ga0495638_0010285 | 3300046460 | Bacteria | 6507 |
| 461 | Ga0495638_0044002 | 3300046460 | Bacteria | 2814 |
| 462 | Ga0495638_0044050 | 3300046460 | Bacteria | 2812 |
| 463 | Ga0495638_0070716 | 3300046460 | Bacteria | 2136 |
| 464 | Ga0495638_0181745 | 3300046460 | Bacteria | 1199 |
| 465 | Ga0495653_0003581 | 3300046463 | Bacteria | 12522 |
| 466 | Ga0495653_0005114 | 3300046463 | Bacteria | 10644 |
| 467 | Ga0495653_0015400 | 3300046463 | Bacteria | 6232 |
| 468 | Ga0495653_0030146 | 3300046463 | Bacteria | 4323 |
| 469 | Ga0495653_0202670 | 3300046463 | Bacteria | 1345 |
| 470 | Ga0495653_0259776 | 3300046463 | Bacteria | 1149 |
| 471 | Ga0495650_0001778 | 3300046471 | Bacteria | 19540 |
| 472 | Ga0495650_0005113 | 3300046471 | Bacteria | 8668 |
| 473 | Ga0495650_0007214 | 3300046471 | Bacteria | 6735 |
| 474 | Ga0495650_0018563 | 3300046471 | Bacteria | 3450 |
| 475 | Ga0495650_0021962 | 3300046471 | Bacteria | 3069 |
| 476 | Ga0495605_0000032 | 3300046474 | Bacteria | 210550 |
| 477 | Ga0495605_0000857 | 3300046474 | Bacteria | 21145 |
| 478 | Ga0495605_0001277 | 3300046474 | Bacteria | 16686 |
| 479 | Ga0495605_0001888 | 3300046474 | Bacteria | 13393 |
| 480 | Ga0495605_0002198 | 3300046474 | Bacteria | 12184 |
| 481 | Ga0495605_0002521 | 3300046474 | Bacteria | 11299 |
| 482 | Ga0495605_0006105 | 3300046474 | Bacteria | 6950 |
| 483 | Ga0495605_0007807 | 3300046474 | Bacteria | 6062 |
| 484 | Ga0495605_0014566 | 3300046474 | Bacteria | 4301 |
| 485 | Ga0495605_0018889 | 3300046474 | Bacteria | 3690 |
| 486 | Ga0495605_0024838 | 3300046474 | Bacteria | 3130 |
| 487 | Ga0495605_0036323 | 3300046474 | Bacteria | 2484 |
| 488 | Ga0495605_0052299 | 3300046474 | Bacteria | 1985 |
| 489 | Ga0495639_0000241 | 3300046475 | Bacteria | 27157 |
| 490 | Ga0495639_0003322 | 3300046475 | Bacteria | 6970 |
| 491 | Ga0495664_0159173 | 3300046477 | Bacteria | 1370 |
| 492 | Ga0495664_0295119 | 3300046477 | Bacteria | 979 |
| 493 | Ga0495584_0001923 | 3300046491 | Bacteria | 11941 |
| 494 | Ga0495584_0002126 | 3300046491 | Bacteria | 11350 |
| 495 | Ga0495584_0002304 | 3300046491 | Bacteria | 10892 |
| 496 | Ga0495584_0003690 | 3300046491 | Bacteria | 8341 |
| 497 | Ga0495584_0010843 | 3300046491 | Bacteria | 4677 |
| 498 | Ga0495584_0019174 | 3300046491 | Bacteria | 3474 |
| 499 | Ga0495584_0027976 | 3300046491 | Bacteria | 2856 |
| 500 | Ga0495585_0001287 | 3300046492 | Bacteria | 19986 |
| 501 | Ga0495585_0002592 | 3300046492 | Bacteria | 12784 |
| 502 | Ga0495585_0009763 | 3300046492 | Bacteria | 5743 |
| 503 | Ga0495585_0013045 | 3300046492 | Bacteria | 4875 |
| 504 | Ga0495585_0035974 | 3300046492 | Bacteria | 2796 |
| 505 | Ga0495585_0041146 | 3300046492 | Bacteria | 2592 |
| 506 | Ga0495585_0041191 | 3300046492 | Bacteria | 2591 |
| 507 | Ga0495594_0001279 | 3300046499 | Bacteria | 13157 |
| 508 | Ga0495594_0007038 | 3300046499 | Bacteria | 5782 |
| 509 | Ga0495594_0037845 | 3300046499 | Bacteria | 2633 |
| 510 | Ga0495594_0039263 | 3300046499 | Bacteria | 2588 |
| 511 | Ga0495596_0054128 | 3300046500 | Bacteria | 1570 |
| 512 | Ga0495607_0000121 | 3300046501 | Bacteria | 82194 |
| 513 | Ga0495607_0000563 | 3300046501 | Bacteria | 36192 |
| 514 | Ga0495607_0001138 | 3300046501 | Bacteria | 24105 |
| 515 | Ga0495607_0001754 | 3300046501 | Bacteria | 18561 |
| 516 | Ga0495607_0002115 | 3300046501 | Bacteria | 16578 |
| 517 | Ga0495607_0003276 | 3300046501 | Bacteria | 12455 |
| 518 | Ga0495607_0006139 | 3300046501 | Bacteria | 8501 |
| 519 | Ga0495607_0007248 | 3300046501 | Bacteria | 7698 |
| 520 | Ga0495607_0007895 | 3300046501 | Bacteria | 7319 |
| 521 | Ga0495607_0008577 | 3300046501 | Bacteria | 6979 |
| 522 | Ga0495607_0008832 | 3300046501 | Bacteria | 6860 |
| 523 | Ga0495607_0009002 | 3300046501 | Bacteria | 6789 |
| 524 | Ga0495607_0009248 | 3300046501 | Bacteria | 6691 |
| 525 | Ga0495607_0009800 | 3300046501 | Bacteria | 6469 |
| 526 | Ga0495607_0011881 | 3300046501 | Bacteria | 5768 |
| 527 | Ga0495607_0012597 | 3300046501 | Bacteria | 5573 |
| 528 | Ga0495607_0025600 | 3300046501 | Bacteria | 3668 |
| 529 | Ga0495607_0045804 | 3300046501 | Bacteria | 2570 |
| 530 | Ga0495607_0074277 | 3300046501 | Bacteria | 1887 |
| 531 | Ga0495583_0000052 | 3300046506 | Bacteria | 211902 |
| 532 | Ga0495583_0001042 | 3300046506 | Bacteria | 31294 |
| 533 | Ga0495583_0001955 | 3300046506 | Bacteria | 18959 |
| 534 | Ga0495583_0043477 | 3300046506 | Bacteria | 2091 |
| 535 | Ga0495583_0115354 | 3300046506 | Bacteria | 1135 |
| 536 | Ga0495606_0001451 | 3300046507 | Bacteria | 31744 |
| 537 | Ga0495606_0013096 | 3300046507 | Bacteria | 6587 |
| 538 | Ga0495606_0025197 | 3300046507 | Bacteria | 4266 |
| 539 | Ga0495606_0027499 | 3300046507 | Bacteria | 4031 |
| 540 | Ga0495610_0000720 | 3300046512 | Bacteria | 31450 |
| 541 | Ga0495610_0002376 | 3300046512 | Bacteria | 15885 |
| 542 | Ga0495610_0019617 | 3300046512 | Bacteria | 3776 |
| 543 | Ga0495610_0019910 | 3300046512 | Bacteria | 3740 |
| 544 | Ga0495610_0031497 | 3300046512 | Bacteria | 2766 |
| 545 | Ga0495610_0039683 | 3300046512 | Bacteria | 2378 |
| 546 | Ga0495610_0073402 | 3300046512 | Bacteria | 1590 |
| 547 | Ga0495610_0074105 | 3300046512 | Bacteria | 1580 |
| 548 | Ga0495616_0000377 | 3300046513 | Bacteria | 34744 |
| 549 | Ga0495616_0001708 | 3300046513 | Bacteria | 14982 |
| 550 | Ga0495616_0002074 | 3300046513 | Bacteria | 13465 |
| 551 | Ga0495616_0002254 | 3300046513 | Bacteria | 12909 |
| 552 | Ga0495616_0006526 | 3300046513 | Bacteria | 7046 |
| 553 | Ga0495616_0006718 | 3300046513 | Bacteria | 6938 |
| 554 | Ga0495616_0008680 | 3300046513 | Bacteria | 5996 |
| 555 | Ga0495616_0018577 | 3300046513 | Bacteria | 3813 |
| 556 | Ga0495616_0019845 | 3300046513 | Bacteria | 3663 |
| 557 | Ga0495616_0095736 | 3300046513 | Bacteria | 1399 |
| 558 | Ga0495620_0000019 | 3300046515 | Bacteria | 150014 |
| 559 | Ga0495620_0000338 | 3300046515 | Bacteria | 32631 |
| 560 | Ga0495620_0005406 | 3300046515 | Bacteria | 7129 |
| 561 | Ga0495620_0008361 | 3300046515 | Bacteria | 5560 |
| 562 | Ga0495620_0020743 | 3300046515 | Bacteria | 3203 |
| 563 | Ga0495620_0036333 | 3300046515 | Bacteria | 2205 |
| 564 | Ga0495620_0040610 | 3300046515 | Bacteria | 2046 |
| 565 | Ga0495628_0114971 | 3300046516 | Bacteria | 2067 |
| 566 | Ga0495630_0045820 | 3300046517 | Bacteria | 3268 |
| 567 | Ga0495631_0000638 | 3300046518 | Bacteria | 22896 |
| 568 | Ga0495631_0002043 | 3300046518 | Bacteria | 11752 |
| 569 | Ga0495631_0005944 | 3300046518 | Bacteria | 6349 |
| 570 | Ga0495631_0006154 | 3300046518 | Bacteria | 6219 |
| 571 | Ga0495631_0031299 | 3300046518 | Bacteria | 2408 |
| 572 | Ga0495632_0001741 | 3300046519 | Bacteria | 17649 |
| 573 | Ga0495632_0002607 | 3300046519 | Bacteria | 13584 |
| 574 | Ga0495632_0003111 | 3300046519 | Bacteria | 12021 |
| 575 | Ga0495632_0010529 | 3300046519 | Bacteria | 5465 |
| 576 | Ga0495632_0031822 | 3300046519 | Bacteria | 2723 |
| 577 | Ga0495632_0034404 | 3300046519 | Bacteria | 2593 |
| 578 | Ga0495632_0047592 | 3300046519 | Bacteria | 2126 |
| 579 | Ga0495637_0000428 | 3300046520 | Bacteria | 30739 |
| 580 | Ga0495637_0000625 | 3300046520 | Bacteria | 24990 |
| 581 | Ga0495637_0000898 | 3300046520 | Bacteria | 19215 |
| 582 | Ga0495637_0001294 | 3300046520 | Bacteria | 15043 |
| 583 | Ga0495637_0005171 | 3300046520 | Bacteria | 6683 |
| 584 | Ga0495637_0005398 | 3300046520 | Bacteria | 6529 |
| 585 | Ga0495637_0005684 | 3300046520 | Bacteria | 6326 |
| 586 | Ga0495637_0006580 | 3300046520 | Bacteria | 5813 |
| 587 | Ga0495637_0017508 | 3300046520 | Bacteria | 3337 |
| 588 | Ga0495637_0019929 | 3300046520 | Bacteria | 3093 |
| 589 | Ga0495637_0070533 | 3300046520 | Bacteria | 1411 |
| 590 | Ga0495643_0002218 | 3300046522 | Bacteria | 15787 |
| 591 | Ga0495643_0002334 | 3300046522 | Bacteria | 15240 |
| 592 | Ga0495643_0002599 | 3300046522 | Bacteria | 14076 |
| 593 | Ga0495643_0002768 | 3300046522 | Bacteria | 13410 |
| 594 | Ga0495643_0008430 | 3300046522 | Bacteria | 6523 |
| 595 | Ga0495643_0009655 | 3300046522 | Bacteria | 5977 |
| 596 | Ga0495643_0058493 | 3300046522 | Bacteria | 2051 |
| 597 | Ga0495644_0002414 | 3300046523 | Bacteria | 7452 |
| 598 | Ga0495644_0003490 | 3300046523 | Bacteria | 6221 |
| 599 | Ga0495644_0038159 | 3300046523 | Bacteria | 1812 |
| 600 | Ga0495644_0059060 | 3300046523 | Bacteria | 1442 |
| 601 | Ga0495648_0000997 | 3300046524 | Bacteria | 29079 |
| 602 | Ga0495648_0002902 | 3300046524 | Bacteria | 15418 |
| 603 | Ga0495648_0004415 | 3300046524 | Bacteria | 12017 |
| 604 | Ga0495648_0005728 | 3300046524 | Bacteria | 10253 |
| 605 | Ga0495648_0015869 | 3300046524 | Bacteria | 5445 |
| 606 | Ga0495648_0017162 | 3300046524 | Bacteria | 5186 |
| 607 | Ga0495648_0037432 | 3300046524 | Bacteria | 3117 |
| 608 | Ga0495648_0044124 | 3300046524 | Bacteria | 2786 |
| 609 | Ga0495648_0066505 | 3300046524 | Bacteria | 2113 |
| 610 | Ga0495648_0073176 | 3300046524 | Bacteria | 1980 |
| 611 | Ga0495648_0095192 | 3300046524 | Bacteria | 1657 |
| 612 | Ga0495648_0115944 | 3300046524 | Bacteria | 1448 |
| 613 | Ga0495666_0008015 | 3300046526 | Bacteria | 5291 |
| 614 | Ga0495666_0033192 | 3300046526 | Bacteria | 2523 |
| 615 | Ga0495666_0041523 | 3300046526 | Bacteria | 2227 |
| 616 | Ga0495666_0046452 | 3300046526 | Bacteria | 2093 |
| 617 | Ga0495666_0069736 | 3300046526 | Bacteria | 1672 |
| 618 | Ga0495642_0000151 | 3300046528 | Bacteria | 40418 |
| 619 | Ga0495642_0000506 | 3300046528 | Bacteria | 20118 |
| 620 | Ga0495642_0001115 | 3300046528 | Bacteria | 12392 |
| 621 | Ga0495654_0000663 | 3300046530 | Bacteria | 27117 |
| 622 | Ga0495654_0000819 | 3300046530 | Bacteria | 23673 |
| 623 | Ga0495654_0001683 | 3300046530 | Bacteria | 14893 |
| 624 | Ga0495654_0004044 | 3300046530 | Bacteria | 8810 |
| 625 | Ga0495654_0020931 | 3300046530 | Bacteria | 3406 |
| 626 | Ga0495654_0024144 | 3300046530 | Bacteria | 3143 |
| 627 | Ga0495654_0031806 | 3300046530 | Bacteria | 2677 |
| 628 | Ga0495654_0033304 | 3300046530 | Bacteria | 2608 |
| 629 | Ga0495654_0087861 | 3300046530 | Bacteria | 1446 |
| 630 | Ga0495654_0110325 | 3300046530 | Bacteria | 1256 |
| 631 | Ga0495587_0001556 | 3300046536 | Bacteria | 15262 |
| 632 | Ga0495587_0004482 | 3300046536 | Bacteria | 9185 |
| 633 | Ga0495587_0051964 | 3300046536 | Bacteria | 2420 |
| 634 | Ga0495598_0021050 | 3300046537 | Bacteria | 1730 |
| 635 | Ga0495609_0000032 | 3300046538 | Bacteria | 211021 |
| 636 | Ga0495609_0001044 | 3300046538 | Bacteria | 19418 |
| 637 | Ga0495609_0001602 | 3300046538 | Bacteria | 14792 |
| 638 | Ga0495609_0003586 | 3300046538 | Bacteria | 8821 |
| 639 | Ga0495609_0003790 | 3300046538 | Bacteria | 8511 |
| 640 | Ga0495609_0004832 | 3300046538 | Bacteria | 7268 |
| 641 | Ga0495609_0011106 | 3300046538 | Bacteria | 4299 |
| 642 | Ga0495609_0019776 | 3300046538 | Bacteria | 3113 |
| 643 | Ga0495609_0026373 | 3300046538 | Bacteria | 2661 |
| 644 | Ga0495609_0029567 | 3300046538 | Bacteria | 2494 |
| 645 | Ga0495609_0044311 | 3300046538 | Bacteria | 1996 |
| 646 | Ga0495609_0092297 | 3300046538 | Bacteria | 1316 |
| 647 | Ga0495597_0000852 | 3300046542 | Bacteria | 23978 |
| 648 | Ga0495597_0003440 | 3300046542 | Bacteria | 9242 |
| 649 | Ga0495597_0005741 | 3300046542 | Bacteria | 6520 |
| 650 | Ga0495597_0037447 | 3300046542 | Bacteria | 2177 |
| 651 | Ga0495597_0049710 | 3300046542 | Bacteria | 1852 |
| 652 | Ga0495645_0013574 | 3300046543 | Bacteria | 5765 |
| 653 | Ga0495645_0033134 | 3300046543 | Bacteria | 3769 |
| 654 | Ga0495622_0000294 | 3300046557 | Bacteria | 37526 |
| 655 | Ga0495622_0000418 | 3300046557 | Bacteria | 28124 |
| 656 | Ga0495622_0010785 | 3300046557 | Bacteria | 4215 |
| 657 | Ga0495622_0044666 | 3300046557 | Bacteria | 2059 |
| 658 | Ga0495633_0000040 | 3300046558 | Bacteria | 177876 |
| 659 | Ga0495633_0003735 | 3300046558 | Bacteria | 10021 |
| 660 | Ga0495633_0007547 | 3300046558 | Bacteria | 6243 |
| 661 | Ga0495633_0066898 | 3300046558 | Bacteria | 1678 |
| 662 | Ga0495667_0227340 | 3300046559 | Bacteria | 1190 |
| 663 | Ga0495656_0028388 | 3300046615 | Bacteria | 2244 |
| 664 | Ga0495656_0059671 | 3300046615 | Bacteria | 1660 |
| 665 | Ga0495668_0001353 | 3300046616 | Bacteria | 24063 |
| 666 | Ga0495668_0032107 | 3300046616 | Bacteria | 2956 |
| 667 | Ga0495668_0050697 | 3300046616 | Bacteria | 2299 |
| 668 | Ga0495668_0096456 | 3300046616 | Bacteria | 1618 |
| 669 | Ga0495634_0008936 | 3300046642 | Bacteria | 7418 |
| 670 | Ga0495634_0010361 | 3300046642 | Bacteria | 6830 |
| 671 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 672 | Ga0495611_0000027 | 3300046648 | Bacteria | 116663 |
| 673 | Ga0495611_0000918 | 3300046648 | Bacteria | 15934 |
| 674 | Ga0495611_0003256 | 3300046648 | Bacteria | 7178 |
| 675 | Ga0495611_0003539 | 3300046648 | Bacteria | 6868 |
| 676 | Ga0495611_0007338 | 3300046648 | Bacteria | 4680 |
| 677 | Ga0495611_0019423 | 3300046648 | Bacteria | 2919 |
| 678 | Ga0495611_0084838 | 3300046648 | Bacteria | 1460 |
| 679 | Ga0495625_0000037 | 3300046660 | Bacteria | 219383 |
| 680 | Ga0495625_0002110 | 3300046660 | Bacteria | 22195 |
| 681 | Ga0495625_0004836 | 3300046660 | Bacteria | 12576 |
| 682 | Ga0495625_0014674 | 3300046660 | Bacteria | 6240 |
| 683 | Ga0495625_0017547 | 3300046660 | Bacteria | 5603 |
| 684 | Ga0495625_0058085 | 3300046660 | Bacteria | 2749 |
| 685 | Ga0495625_0058410 | 3300046660 | Bacteria | 2741 |
| 686 | Ga0495625_0090300 | 3300046660 | Bacteria | 2119 |
| 687 | Ga0495625_0101294 | 3300046660 | Bacteria | 1978 |
| 688 | Ga0495625_0175066 | 3300046660 | Bacteria | 1430 |
| 689 | Ga0495635_0009714 | 3300046663 | Bacteria | 6724 |
| 690 | Ga0495635_0079253 | 3300046663 | Bacteria | 2248 |
| 691 | Ga0495635_0086663 | 3300046663 | Unclassified | 2143 |
| 692 | Ga0495635_0210353 | 3300046663 | Bacteria | 1317 |
| 693 | Ga0495659_0000883 | 3300046664 | Bacteria | 10659 |
| 694 | Ga0495659_0032182 | 3300046664 | Bacteria | 1834 |
| 695 | Ga0495659_0035335 | 3300046664 | Bacteria | 1761 |
| 696 | Ga0495661_0000037 | 3300046665 | Bacteria | 164234 |
| 697 | Ga0495661_0003926 | 3300046665 | Bacteria | 10855 |
| 698 | Ga0495661_0007526 | 3300046665 | Bacteria | 7591 |
| 699 | Ga0495661_0010570 | 3300046665 | Bacteria | 6293 |
| 700 | Ga0495661_0011316 | 3300046665 | Bacteria | 6054 |
| 701 | Ga0495661_0011493 | 3300046665 | Bacteria | 6006 |
| 702 | Ga0495661_0048213 | 3300046665 | Bacteria | 2589 |
| 703 | Ga0495661_0059485 | 3300046665 | Bacteria | 2274 |
| 704 | Ga0495661_0064341 | 3300046665 | Bacteria | 2164 |
| 705 | Ga0495661_0088173 | 3300046665 | Bacteria | 1772 |
| 706 | Ga0495588_0012636 | 3300046674 | Bacteria | 3996 |
| 707 | Ga0495588_0018140 | 3300046674 | Bacteria | 3427 |
| 708 | Ga0495588_0053688 | 3300046674 | Bacteria | 2078 |
| 709 | Ga0495588_0102262 | 3300046674 | Bacteria | 1506 |
| 710 | Ga0495588_0133269 | 3300046674 | Bacteria | 1311 |
| 711 | Ga0495599_0380902 | 3300046678 | Bacteria | 842 |
| 712 | Ga0495623_0009046 | 3300046679 | Bacteria | 6460 |
| 713 | Ga0495646_0000953 | 3300046680 | Bacteria | 16510 |
| 714 | Ga0495646_0059661 | 3300046680 | Bacteria | 2278 |
| 715 | Ga0495646_0163730 | 3300046680 | Bacteria | 1230 |
| 716 | Ga0495658_0031488 | 3300046683 | Bacteria | 2890 |
| 717 | Ga0495669_0001725 | 3300046684 | Bacteria | 8942 |
| 718 | Ga0495669_0003637 | 3300046684 | Bacteria | 6349 |
| 719 | Ga0495613_0012226 | 3300046689 | Bacteria | 6379 |
| 720 | Ga0495613_0032289 | 3300046689 | Bacteria | 3888 |
| 721 | Ga0495613_0048129 | 3300046689 | Bacteria | 3148 |
| 722 | Ga0495613_0066682 | 3300046689 | Bacteria | 2628 |
| 723 | Ga0495624_0001882 | 3300046690 | Bacteria | 15976 |
| 724 | Ga0495670_0000709 | 3300046691 | Bacteria | 15882 |
| 725 | Ga0495670_0004374 | 3300046691 | Bacteria | 6927 |
| 726 | Ga0495670_0005236 | 3300046691 | Bacteria | 6382 |
| 727 | Ga0495670_0023737 | 3300046691 | Bacteria | 3027 |
| 728 | Ga0495670_0032594 | 3300046691 | Bacteria | 2591 |
| 729 | Ga0495670_0043751 | 3300046691 | Bacteria | 2235 |
| 730 | Ga0495670_0050965 | 3300046691 | Bacteria | 2072 |
| 731 | Ga0495670_0065327 | 3300046691 | Bacteria | 1834 |
| 732 | Ga0495671_0001424 | 3300046692 | Bacteria | 16086 |
| 733 | Ga0495671_0001841 | 3300046692 | Bacteria | 13642 |
| 734 | Ga0495671_0002352 | 3300046692 | Bacteria | 12007 |
| 735 | Ga0495671_0005900 | 3300046692 | Bacteria | 7127 |
| 736 | Ga0495671_0012431 | 3300046692 | Bacteria | 4650 |
| 737 | Ga0495671_0020650 | 3300046692 | Bacteria | 3468 |
| 738 | Ga0495671_0021664 | 3300046692 | Bacteria | 3372 |
| 739 | Ga0495671_0032052 | 3300046692 | Bacteria | 2684 |
| 740 | Ga0495671_0040679 | 3300046692 | Bacteria | 2343 |
| 741 | Ga0495671_0115570 | 3300046692 | Bacteria | 1310 |
| 742 | Ga0495649_0002234 | 3300046694 | Bacteria | 13781 |
| 743 | Ga0495649_0002275 | 3300046694 | Bacteria | 13644 |
| 744 | Ga0495649_0005634 | 3300046694 | Bacteria | 7913 |
| 745 | Ga0495649_0008096 | 3300046694 | Bacteria | 6343 |
| 746 | Ga0495649_0009798 | 3300046694 | Bacteria | 5671 |
| 747 | Ga0495649_0037996 | 3300046694 | Bacteria | 2642 |
| 748 | Ga0495649_0067181 | 3300046694 | Bacteria | 1923 |
| 749 | Ga0495589_0000263 | 3300046794 | Bacteria | 42994 |
| 750 | Ga0495589_0000366 | 3300046794 | Bacteria | 35102 |
| 751 | Ga0495589_0000858 | 3300046794 | Bacteria | 19063 |
| 752 | Ga0495589_0002405 | 3300046794 | Bacteria | 10516 |
| 753 | Ga0495589_0003745 | 3300046794 | Bacteria | 8185 |
| 754 | Ga0495589_0004393 | 3300046794 | Bacteria | 7512 |
| 755 | Ga0495589_0007845 | 3300046794 | Bacteria | 5587 |
| 756 | Ga0495589_0008973 | 3300046794 | Bacteria | 5202 |
| 757 | Ga0495600_0018471 | 3300046809 | Bacteria | 4443 |
| 758 | Ga0495660_0002590 | 3300046810 | Bacteria | 11489 |
| 759 | Ga0495660_0006354 | 3300046810 | Bacteria | 7001 |
| 760 | Ga0495660_0007978 | 3300046810 | Bacteria | 6218 |
| 761 | Ga0495660_0011063 | 3300046810 | Bacteria | 5240 |
| 762 | Ga0495660_0016204 | 3300046810 | Bacteria | 4299 |
| 763 | Ga0495660_0038082 | 3300046810 | Bacteria | 2675 |
| 764 | Ga0495660_0051280 | 3300046810 | Bacteria | 2245 |
| 765 | Ga0495660_0052074 | 3300046810 | Bacteria | 2225 |
| 766 | Ga0495660_0084381 | 3300046810 | Bacteria | 1661 |
| 767 | Ga0495660_0139464 | 3300046810 | Bacteria | 1208 |
| 768 | Ga0495660_0156035 | 3300046810 | Bacteria | 1123 |
| 769 | Ga0495581_0007326 | 3300047315 | Bacteria | 6383 |
| 770 | Ga0495581_0022149 | 3300047315 | Bacteria | 3682 |
| 771 | Ga0495604_0012312 | 3300047317 | Bacteria | 6799 |
| 772 | Ga0495604_0015482 | 3300047317 | Bacteria | 6087 |
| 773 | Ga0495604_0159090 | 3300047317 | Bacteria | 1597 |
| 774 | Ga0495636_0000753 | 3300047318 | Bacteria | 11926 |
| 775 | Ga0495636_0002077 | 3300047318 | Bacteria | 7690 |
| 776 | Ga0495674_0021739 | 3300047319 | Bacteria | 5928 |
| 777 | Ga0495672_0001393 | 3300047320 | Bacteria | 23788 |
| 778 | Ga0495672_0001568 | 3300047320 | Bacteria | 22385 |
| 779 | Ga0495672_0002587 | 3300047320 | Bacteria | 16424 |
| 780 | Ga0495672_0002676 | 3300047320 | Bacteria | 16048 |
| 781 | Ga0495672_0003479 | 3300047320 | Bacteria | 13465 |
| 782 | Ga0495672_0003814 | 3300047320 | Bacteria | 12683 |
| 783 | Ga0495672_0013604 | 3300047320 | Bacteria | 5604 |
| 784 | Ga0495672_0013933 | 3300047320 | Bacteria | 5527 |
| 785 | Ga0495676_0004271 | 3300047321 | Bacteria | 13039 |
| 786 | Ga0495676_0015854 | 3300047321 | Bacteria | 6697 |
| 787 | Ga0495680_0012930 | 3300047322 | Bacteria | 7314 |
| 788 | Ga0495680_0015919 | 3300047322 | Bacteria | 6474 |
| 789 | Ga0495680_0017679 | 3300047322 | Bacteria | 6076 |
| 790 | Ga0495680_0022647 | 3300047322 | Bacteria | 5233 |
| 791 | Ga0495683_0000011 | 3300047323 | Bacteria | 212053 |
| 792 | Ga0495683_0000784 | 3300047323 | Bacteria | 22657 |
| 793 | Ga0495683_0004075 | 3300047323 | Bacteria | 8371 |
| 794 | Ga0495683_0005637 | 3300047323 | Bacteria | 6933 |
| 795 | Ga0495683_0005732 | 3300047323 | Bacteria | 6848 |
| 796 | Ga0495683_0006421 | 3300047323 | Bacteria | 6428 |
| 797 | Ga0495683_0028039 | 3300047323 | Bacteria | 2878 |
| 798 | Ga0495683_0031292 | 3300047323 | Bacteria | 2711 |
| 799 | Ga0495683_0040156 | 3300047323 | Bacteria | 2364 |
| 800 | Ga0495683_0040907 | 3300047323 | Bacteria | 2340 |
| 801 | Ga0495683_0082517 | 3300047323 | Bacteria | 1566 |
| 802 | Ga0495687_002112 | 3300047443 | Bacteria | 16655 |
| 803 | Ga0495687_008543 | 3300047443 | Bacteria | 5852 |
| 804 | Ga0495675_0013975 | 3300047444 | Bacteria | 5077 |
| 805 | Ga0495675_0014655 | 3300047444 | Bacteria | 4953 |
| 806 | Ga0495677_0000393 | 3300047445 | Bacteria | 18673 |
| 807 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 808 | Ga0495679_000176 | 3300047446 | Bacteria | 57881 |
| 809 | Ga0495679_003695 | 3300047446 | Bacteria | 7288 |
| 810 | Ga0495679_004059 | 3300047446 | Bacteria | 6866 |
| 811 | Ga0495679_004736 | 3300047446 | Bacteria | 6176 |
| 812 | Ga0495679_018686 | 3300047446 | Bacteria | 2454 |
| 813 | Ga0495685_001024 | 3300047447 | Bacteria | 8524 |
| 814 | Ga0495685_025697 | 3300047447 | Bacteria | 2026 |
| 815 | Ga0495673_0000607 | 3300047469 | Bacteria | 35637 |
| 816 | Ga0495673_0001083 | 3300047469 | Bacteria | 23778 |
| 817 | Ga0495673_0001179 | 3300047469 | Bacteria | 22083 |
| 818 | Ga0495673_0001247 | 3300047469 | Bacteria | 21037 |
| 819 | Ga0495673_0002001 | 3300047469 | Bacteria | 14995 |
| 820 | Ga0495673_0002223 | 3300047469 | Bacteria | 13941 |
| 821 | Ga0495673_0006626 | 3300047469 | Bacteria | 6787 |
| 822 | Ga0495673_0006858 | 3300047469 | Bacteria | 6640 |
| 823 | Ga0495673_0007482 | 3300047469 | Bacteria | 6270 |
| 824 | Ga0495673_0007539 | 3300047469 | Bacteria | 6234 |
| 825 | Ga0495673_0019067 | 3300047469 | Bacteria | 3443 |
| 826 | Ga0495673_0023705 | 3300047469 | Bacteria | 2979 |
| 827 | Ga0495673_0023870 | 3300047469 | Bacteria | 2965 |
| 828 | Ga0495673_0026076 | 3300047469 | Bacteria | 2799 |
| 829 | Ga0495673_0031248 | 3300047469 | Bacteria | 2494 |
| 830 | Ga0495673_0047147 | 3300047469 | Bacteria | 1905 |
| 831 | Ga0495673_0059595 | 3300047469 | Bacteria | 1640 |
| 832 | Ga0495673_0110398 | 3300047469 | Bacteria | 1100 |
| 833 | Ga0495681_0000536 | 3300047470 | Bacteria | 29078 |
| 834 | Ga0495681_0001815 | 3300047470 | Bacteria | 15694 |
| 835 | Ga0495681_0041658 | 3300047470 | Bacteria | 2228 |
| 836 | Ga0495681_0052239 | 3300047470 | Bacteria | 1918 |
| 837 | Ga0495681_0059785 | 3300047470 | Bacteria | 1761 |
| 838 | Ga0495681_0118806 | 3300047470 | Bacteria | 1136 |
| 839 | Ga0495686_0004152 | 3300047472 | Bacteria | 12056 |
| 840 | Ga0495686_0007204 | 3300047472 | Bacteria | 8376 |
| 841 | Ga0495686_0012958 | 3300047472 | Bacteria | 5809 |
| 842 | Ga0495686_0033662 | 3300047472 | Bacteria | 3307 |
| 843 | Ga0495593_0003966 | 3300047673 | Bacteria | 8834 |
| 844 | Ga0495593_0009549 | 3300047673 | Bacteria | 5629 |
| 845 | Ga0495593_0013731 | 3300047673 | Bacteria | 4612 |
| 846 | Ga0495602_0016910 | 3300048088 | Bacteria | 7319 |
| 847 | Ga0495614_0083515 | 3300048089 | Bacteria | 1385 |
| 848 | Ga0495626_0001557 | 3300048091 | Bacteria | 18006 |
| 849 | Ga0495626_0002243 | 3300048091 | Bacteria | 13850 |
| 850 | Ga0495626_0002531 | 3300048091 | Bacteria | 12566 |
| 851 | Ga0495626_0005293 | 3300048091 | Bacteria | 7617 |
| 852 | Ga0495626_0005902 | 3300048091 | Bacteria | 7050 |
| 853 | Ga0495626_0006059 | 3300048091 | Bacteria | 6948 |
| 854 | Ga0495626_0006581 | 3300048091 | Bacteria | 6588 |
| 855 | Ga0495626_0008233 | 3300048091 | Bacteria | 5739 |
| 856 | Ga0495626_0025111 | 3300048091 | Bacteria | 2916 |
| 857 | Ga0495626_0103881 | 3300048091 | Bacteria | 1236 |
| 858 | Ga0496100_0102358 | 3300048903 | Bacteria | 1976 |
| 859 | Ga0496101_0062377 | 3300048904 | Bacteria | 2710 |
| 860 | Ga0496102_0000604 | 3300048905 | Bacteria | 37459 |
| 861 | Ga0496102_0104440 | 3300048905 | Bacteria | 2635 |
| 862 | Ga0496103_0006912 | 3300048906 | Bacteria | 6777 |
| 863 | Ga0496103_0102586 | 3300048906 | Bacteria | 1811 |
| 864 | Ga0496108_0027022 | 3300048911 | Bacteria | 4736 |
| 865 | Ga0496110_0006365 | 3300048913 | Bacteria | 9334 |
| 866 | Ga0496110_0014430 | 3300048913 | Bacteria | 6560 |
| 867 | Ga0496110_0045914 | 3300048913 | Bacteria | 3820 |
| 868 | Ga0496110_0243113 | 3300048913 | Bacteria | 1638 |
| 869 | Ga0496110_0492637 | 3300048913 | Bacteria | 1116 |
| 870 | Ga0496116_0003029 | 3300048919 | Bacteria | 17013 |
| 871 | Ga0496116_0004538 | 3300048919 | Bacteria | 13188 |
| 872 | Ga0496116_0013152 | 3300048919 | Bacteria | 6697 |
| 873 | Ga0496116_0013391 | 3300048919 | Bacteria | 6618 |
| 874 | Ga0496116_0076126 | 3300048919 | Bacteria | 2103 |
| 875 | Ga0496116_0149135 | 3300048919 | Bacteria | 1302 |
| 876 | Ga0496117_0001815 | 3300048920 | Bacteria | 29016 |
| 877 | Ga0496117_0015165 | 3300048920 | Bacteria | 6591 |
| 878 | Ga0496117_0015909 | 3300048920 | Bacteria | 6373 |
| 879 | Ga0496117_0016327 | 3300048920 | Bacteria | 6270 |
| 880 | Ga0496117_0022217 | 3300048920 | Bacteria | 5093 |
| 881 | Ga0496117_0042483 | 3300048920 | Bacteria | 3316 |
| 882 | Ga0496117_0042485 | 3300048920 | Bacteria | 3316 |
| 883 | Ga0496118_0002174 | 3300048921 | Bacteria | 27294 |
| 884 | Ga0496118_0016288 | 3300048921 | Bacteria | 6826 |
| 885 | Ga0496118_0018025 | 3300048921 | Bacteria | 6393 |
| 886 | Ga0496118_0026191 | 3300048921 | Bacteria | 4974 |
| 887 | Ga0496118_0072065 | 3300048921 | Bacteria | 2483 |
| 888 | Ga0496118_0091257 | 3300048921 | Bacteria | 2095 |
| 889 | Ga0496118_0108002 | 3300048921 | Bacteria | 1856 |
| 890 | Ga0496118_0138970 | 3300048921 | Bacteria | 1544 |
| 891 | Ga0496119_0013863 | 3300048922 | Bacteria | 6364 |
| 892 | Ga0496119_0014255 | 3300048922 | Bacteria | 6240 |
| 893 | Ga0496119_0071686 | 3300048922 | Bacteria | 2027 |
| 894 | Ga0496120_0063200 | 3300048923 | Bacteria | 2060 |
| 895 | Ga0496120_0108804 | 3300048923 | Bacteria | 1451 |
| 896 | Ga0496121_0001008 | 3300048924 | Bacteria | 50302 |
| 897 | Ga0496121_0002419 | 3300048924 | Bacteria | 28592 |
| 898 | Ga0496121_0002497 | 3300048924 | Bacteria | 27960 |
| 899 | Ga0496121_0018103 | 3300048924 | Bacteria | 7127 |
| 900 | Ga0496121_0029665 | 3300048924 | Bacteria | 5049 |
| 901 | Ga0496121_0092180 | 3300048924 | Bacteria | 2362 |
| 902 | Ga0496121_0104954 | 3300048924 | Bacteria | 2169 |
| 903 | Ga0496121_0158374 | 3300048924 | Bacteria | 1658 |
| 904 | Ga0496121_0174369 | 3300048924 | Bacteria | 1558 |
| 905 | Ga0496122_0000945 | 3300048925 | Bacteria | 52642 |
| 906 | Ga0496122_0018845 | 3300048925 | Bacteria | 6343 |
| 907 | Ga0496122_0019180 | 3300048925 | Bacteria | 6263 |
| 908 | Ga0496122_0180157 | 3300048925 | Bacteria | 1261 |
| 909 | Ga0496123_0000888 | 3300048926 | Bacteria | 47314 |
| 910 | Ga0496123_0005883 | 3300048926 | Bacteria | 12128 |
| 911 | Ga0496123_0050801 | 3300048926 | Bacteria | 2767 |
| 912 | Ga0496123_0098019 | 3300048926 | Bacteria | 1715 |
| 913 | Ga0496124_0002611 | 3300048927 | Bacteria | 23246 |
| 914 | Ga0496124_0004905 | 3300048927 | Bacteria | 15378 |
| 915 | Ga0496124_0010228 | 3300048927 | Bacteria | 9528 |
| 916 | Ga0496124_0102260 | 3300048927 | Bacteria | 2319 |
| 917 | Ga0496124_0114546 | 3300048927 | Bacteria | 2165 |
| 918 | Ga0496124_0162257 | 3300048927 | Bacteria | 1740 |
| 919 | Ga0496124_0185723 | 3300048927 | Bacteria | 1595 |
| 920 | Ga0496125_0005661 | 3300048928 | Bacteria | 13790 |
| 921 | Ga0496125_0007915 | 3300048928 | Bacteria | 11221 |
| 922 | Ga0496125_0012895 | 3300048928 | Bacteria | 8255 |
| 923 | Ga0496125_0018010 | 3300048928 | Bacteria | 6714 |
| 924 | Ga0496125_0033034 | 3300048928 | Bacteria | 4586 |
| 925 | Ga0496125_0061124 | 3300048928 | Bacteria | 3023 |
| 926 | Ga0496125_0087911 | 3300048928 | Bacteria | 2345 |
| 927 | Ga0496126_0002379 | 3300048929 | Bacteria | 25600 |
| 928 | Ga0496126_0133150 | 3300048929 | Bacteria | 2146 |
| 929 | Ga0496126_0167695 | 3300048929 | Bacteria | 1873 |
| 930 | Ga0495678_000028 | 3300049459 | Bacteria | 220080 |
| 931 | Ga0495678_000033 | 3300049459 | Bacteria | 211804 |
| 932 | Ga0495678_000311 | 3300049459 | Bacteria | 52388 |
| 933 | Ga0495678_002317 | 3300049459 | Bacteria | 13124 |
| 934 | Ga0495678_002782 | 3300049459 | Bacteria | 11424 |
| 935 | Ga0495678_003313 | 3300049459 | Bacteria | 10048 |
| 936 | Ga0495678_004804 | 3300049459 | Bacteria | 7689 |
| 937 | Ga0495678_005647 | 3300049459 | Bacteria | 6828 |
| 938 | Ga0495678_008179 | 3300049459 | Bacteria | 5312 |
| 939 | Ga0495678_041489 | 3300049459 | Bacteria | 1841 |
| 940 | Ga0495678_046636 | 3300049459 | Bacteria | 1702 |
| 941 | Ga0495678_057442 | 3300049459 | Bacteria | 1474 |
| 942 | Ga0495682_0000072 | 3300049460 | Bacteria | 93119 |
| 943 | Ga0495682_0000265 | 3300049460 | Bacteria | 41386 |
| 944 | Ga0495682_0001293 | 3300049460 | Bacteria | 13941 |
| 945 | Ga0495682_0002849 | 3300049460 | Bacteria | 7970 |
| 946 | Ga0495682_0003811 | 3300049460 | Bacteria | 6628 |
| 947 | Ga0495682_0017809 | 3300049460 | Bacteria | 2677 |
| 948 | Ga0495682_0018489 | 3300049460 | Bacteria | 2624 |
| 949 | Ga0495682_0019820 | 3300049460 | Bacteria | 2527 |
| 950 | Ga0495682_0020861 | 3300049460 | Bacteria | 2457 |
| 951 | Ga0495682_0041754 | 3300049460 | Bacteria | 1681 |
| 952 | Ga0501222_000921 | 3300049662 | Bacteria | 4224 |
| 953 | Ga0501241_000864 | 3300049758 | Bacteria | 6443 |
| 954 | Ga0501269_002850 | 3300049766 | Bacteria | 2108 |
| 955 | Ga0501226_000988 | 3300049853 | Bacteria | 3737 |
| 956 | nmdc:mga03683_111520_c1 | 3300050489 | Bacteria | 1210 |
| 957 | nmdc:mga00v17_147598_c1 | 3300050491 | Bacteria | 1510 |
| 958 | nmdc:mga00v17_153323_c1 | 3300050491 | Bacteria | 1481 |
| 959 | nmdc:mga0k408_78_c1 | 3300050493 | Bacteria | 45819 |
| 960 | nmdc:mga08x19_70088_c1 | 3300050514 | Bacteria | 2284 |
| 961 | nmdc:mga0sz30_6379_c1 | 3300050516 | Bacteria | 4378 |
| 962 | Ga0495601_0038246 | 3300053077 | Bacteria | 3000 |
| 963 | Ga0495612_0178938 | 3300053078 | Bacteria | 931 |
| 964 | Ga0495619_0149469 | 3300053085 | Bacteria | 1611 |
| 965 | Ga0495619_0336777 | 3300053085 | Bacteria | 1044 |
| 966 | Ga0500643_000053 | 3300053087 | Bacteria | 142202 |
| 967 | Ga0500555_000867 | 3300053103 | Bacteria | 10782 |
| 968 | Ga0500586_003095 | 3300053145 | Bacteria | 3876 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053085 | Ga0495619_0149469 | Ga0495619_0149469_841_1545 | 230 |
| 2 | iso_pu_bacteria | 2513237305 | 2514422866 | 233 |
| 3 | 3300046678 | Ga0495599_0380902 | Ga0495599_0380902_115_828 | 237 |
| 4 | 3300028379 | Ga0268266_10149169 | Ga0268266_101491693 | 239 |
| 5 | 3300025728 | Ga0207655_1038191 | Ga0207655_10381912 | 244 |
| 6 | 3300046513 | Ga0495616_0095736 | Ga0495616_0095736_647_1381 | 244 |
| 7 | 3300046526 | Ga0495666_0041523 | Ga0495666_0041523_1045_1779 | 244 |
| 8 | 3300046543 | Ga0495645_0013574 | Ga0495645_0013574_5012_5746 | 244 |
| 9 | 3300046663 | Ga0495635_0210353 | Ga0495635_0210353_352_1086 | 244 |
| 10 | 3300046674 | Ga0495588_0053688 | Ga0495588_0053688_489_1223 | 244 |
| 11 | 3300047321 | Ga0495676_0015854 | Ga0495676_0015854_5119_5853 | 244 |
| 12 | 3300047322 | Ga0495680_0012930 | Ga0495680_0012930_5241_5975 | 244 |
| 13 | 3300047469 | Ga0495673_0110398 | Ga0495673_0110398_15_749 | 244 |
| 14 | 3300047673 | Ga0495593_0013731 | Ga0495593_0013731_1123_1857 | 244 |
| 15 | 3300048088 | Ga0495602_0016910 | Ga0495602_0016910_1315_2049 | 244 |
| 16 | 3300003781 | Ga0055536_1000537 | Ga0055536_10005378 | 245 |
| 17 | 3300025292 | Ga0209676_1000033 | Ga0209676_1000033288 | 245 |
| 18 | 3300047470 | Ga0495681_0118806 | Ga0495681_0118806_360_1100 | 245 |
| 19 | 3300041405 | Ga0439438_003910 | Ga0439438_003910_1517_2257 | 246 |
| 20 | 3300041407 | Ga0439447_025666 | Ga0439447_025666_705_1445 | 246 |
| 21 | 3300041411 | Ga0439466_0005342 | Ga0439466_0005342_2734_3474 | 246 |
| 22 | 3300041997 | Ga0439431_0001457 | Ga0439431_0001457_2978_3718 | 246 |
| 23 | 3300042004 | Ga0439445_0005750 | Ga0439445_0005750_1321_2061 | 246 |
| 24 | 3300042006 | Ga0439432_003625 | Ga0439432_003625_1346_2086 | 246 |
| 25 | 3300042010 | Ga0439452_004522 | Ga0439452_004522_2632_3372 | 246 |
| 26 | 3300042147 | Ga0450910_000525 | Ga0450910_000525_946_1686 | 246 |
| 27 | 3300042156 | Ga0439446_0011777 | Ga0439446_0011777_962_1702 | 246 |
| 28 | 3300042142 | Ga0450905_011848 | Ga0450905_011848_434_1204 | 256 |
| 29 | 3300048089 | Ga0495614_0083515 | Ga0495614_0083515_590_1360 | 256 |
| 30 | 3300013104 | Ga0157370_10008202 | Ga0157370_1000820211 | 259 |
| 31 | 3300042013 | Ga0439456_019207 | Ga0439456_019207_15_794 | 259 |
| 32 | 3300048913 | Ga0496110_0492637 | Ga0496110_0492637_126_938 | 260 |
| 33 | 3300046460 | Ga0495638_0070716 | Ga0495638_0070716_143_1000 | 261 |
| 34 | 3300046615 | Ga0495656_0028388 | Ga0495656_0028388_226_1092 | 265 |
| 35 | 3300013104 | Ga0157370_10056197 | Ga0157370_100561972 | 266 |
| 36 | 3300041456 | Ga0451795_1645496 | Ga0451795_1645496_523_1383 | 266 |
| 37 | 3300046460 | Ga0495638_0000059 | Ga0495638_0000059_56412_57263 | 266 |
| 38 | 3300046501 | Ga0495607_0000121 | Ga0495607_0000121_8152_9006 | 266 |
| 39 | 3300046513 | Ga0495616_0000377 | Ga0495616_0000377_15391_16245 | 266 |
| 40 | 3300046538 | Ga0495609_0003790 | Ga0495609_0003790_6852_7703 | 266 |
| 41 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_190575_191426 | 266 |
| 42 | 3300046648 | Ga0495611_0000027 | Ga0495611_0000027_82297_83151 | 266 |
| 43 | 3300046660 | Ga0495625_0000037 | Ga0495625_0000037_100578_101429 | 266 |
| 44 | 3300046660 | Ga0495625_0002110 | Ga0495625_0002110_16311_17165 | 266 |
| 45 | 3300046665 | Ga0495661_0088173 | Ga0495661_0088173_351_1202 | 266 |
| 46 | 3300046691 | Ga0495670_0005236 | Ga0495670_0005236_3016_3867 | 266 |
| 47 | 3300046794 | Ga0495589_0000366 | Ga0495589_0000366_19159_20010 | 266 |
| 48 | 3300047446 | Ga0495679_000001 | Ga0495679_000001_1399390_1400241 | 266 |
| 49 | 3300047469 | Ga0495673_0000607 | Ga0495673_0000607_15094_15945 | 266 |
| 50 | 3300048924 | Ga0496121_0002419 | Ga0496121_0002419_13196_14050 | 266 |
| 51 | 3300049459 | Ga0495678_000028 | Ga0495678_000028_128804_129655 | 266 |
| 52 | 3300049460 | Ga0495682_0000265 | Ga0495682_0000265_16614_17465 | 266 |
| 53 | 3300053087 | Ga0500643_000053 | Ga0500643_000053_90372_91223 | 266 |
| 54 | 3300053103 | Ga0500555_000867 | Ga0500555_000867_8928_9779 | 266 |
| 55 | iso_pu_bacteria | 2734482264 | 2735835980 | 266 |
| 56 | 3300025903 | Ga0207680_10314395 | Ga0207680_103143952 | 268 |
| 57 | 3300046524 | Ga0495648_0005728 | Ga0495648_0005728_6637_7461 | 268 |
| 58 | 3300042139 | Ga0450904_001612 | Ga0450904_001612_1145_2017 | 269 |
| 59 | 3300046458 | Ga0495591_026058 | Ga0495591_026058_745_1596 | 269 |
| 60 | 3300046501 | Ga0495607_0008577 | Ga0495607_0008577_5135_5986 | 269 |
| 61 | 3300046512 | Ga0495610_0002376 | Ga0495610_0002376_13893_14744 | 269 |
| 62 | 3300046519 | Ga0495632_0031822 | Ga0495632_0031822_1365_2216 | 269 |
| 63 | 3300046520 | Ga0495637_0005684 | Ga0495637_0005684_697_1548 | 269 |
| 64 | 3300046616 | Ga0495668_0032107 | Ga0495668_0032107_839_1690 | 269 |
| 65 | 3300046648 | Ga0495611_0000918 | Ga0495611_0000918_13889_14740 | 269 |
| 66 | 3300046665 | Ga0495661_0010570 | Ga0495661_0010570_585_1436 | 269 |
| 67 | 3300047323 | Ga0495683_0005732 | Ga0495683_0005732_949_1800 | 269 |
| 68 | 3300047469 | Ga0495673_0026076 | Ga0495673_0026076_1332_2183 | 269 |
| 69 | 3300025304 | Ga0209257_1015245 | Ga0209257_10152452 | 270 |
| 70 | iso_pu_bacteria | 2643221637 | 2644206907 | 270 |
| 71 | iso_pu_bacteria | 2643221718 | 2644650555 | 270 |
| 72 | 3300005841 | Ga0068863_100105651 | Ga0068863_1001056511 | 271 |
| 73 | 3300014326 | Ga0157380_10040339 | Ga0157380_100403394 | 271 |
| 74 | 3300046458 | Ga0495591_001026 | Ga0495591_001026_12723_13580 | 271 |
| 75 | 3300046512 | Ga0495610_0000720 | Ga0495610_0000720_16690_17547 | 271 |
| 76 | 3300046530 | Ga0495654_0024144 | Ga0495654_0024144_989_1846 | 271 |
| 77 | 3300046616 | Ga0495668_0001353 | Ga0495668_0001353_12837_13694 | 271 |
| 78 | 3300048091 | Ga0495626_0002243 | Ga0495626_0002243_7401_8258 | 271 |
| 79 | iso_pu_bacteria | 2740891818 | 2740995010 | 271 |
| 80 | 3300047472 | Ga0495686_0007204 | Ga0495686_0007204_3469_4311 | 272 |
| 81 | 3300014497 | Ga0182008_10078408 | Ga0182008_100784082 | 273 |
| 82 | 3300031238 | Ga0265332_10000004 | Ga0265332_10000004336 | 273 |
| 83 | 3300031250 | Ga0265331_10024250 | Ga0265331_100242502 | 273 |
| 84 | iso_pu_bacteria | 2721755686 | 2723577651 | 273 |
| 85 | iso_pu_bacteria | 2876392853 | 2876398832 | 273 |
| 86 | iso_pu_bacteria | 2881161766 | 2881163045 | 273 |
| 87 | iso_pu_bacteria | 2904659560 | 2904665364 | 273 |
| 88 | iso_pu_bacteria | 2961114664 | 2961120364 | 273 |
| 89 | iso_pu_bacteria | 2968110612 | 2968116831 | 273 |
| 90 | 3300005327 | Ga0070658_10178264 | Ga0070658_101782642 | 274 |
| 91 | 3300005328 | Ga0070676_10011992 | Ga0070676_100119922 | 274 |
| 92 | 3300005331 | Ga0070670_100070010 | Ga0070670_1000700102 | 274 |
| 93 | 3300005331 | Ga0070670_100273102 | Ga0070670_1002731022 | 274 |
| 94 | 3300005333 | Ga0070677_10023911 | Ga0070677_100239112 | 274 |
| 95 | 3300005333 | Ga0070677_10156006 | Ga0070677_101560062 | 274 |
| 96 | 3300005334 | Ga0068869_100039304 | Ga0068869_1000393042 | 274 |
| 97 | 3300005335 | Ga0070666_10057619 | Ga0070666_100576192 | 274 |
| 98 | 3300005347 | Ga0070668_100001828 | Ga0070668_10000182811 | 274 |
| 99 | 3300005353 | Ga0070669_100057759 | Ga0070669_1000577592 | 274 |
| 100 | 3300005354 | Ga0070675_100063411 | Ga0070675_1000634112 | 274 |
| 101 | 3300005354 | Ga0070675_100093099 | Ga0070675_1000930991 | 274 |
| 102 | 3300005354 | Ga0070675_100124059 | Ga0070675_1001240592 | 274 |
| 103 | 3300005355 | Ga0070671_100127077 | Ga0070671_1001270772 | 274 |
| 104 | 3300005356 | Ga0070674_100004695 | Ga0070674_1000046952 | 274 |
| 105 | 3300005366 | Ga0070659_100037609 | Ga0070659_1000376093 | 274 |
| 106 | 3300005367 | Ga0070667_100012425 | Ga0070667_1000124256 | 274 |
| 107 | 3300005441 | Ga0070700_100043934 | Ga0070700_1000439342 | 274 |
| 108 | 3300005456 | Ga0070678_100144557 | Ga0070678_1001445572 | 274 |
| 109 | 3300005456 | Ga0070678_100329309 | Ga0070678_1003293092 | 274 |
| 110 | 3300005457 | Ga0070662_100041744 | Ga0070662_1000417442 | 274 |
| 111 | 3300005459 | Ga0068867_100009150 | Ga0068867_1000091505 | 274 |
| 112 | 3300005535 | Ga0070684_100301644 | Ga0070684_1003016442 | 274 |
| 113 | 3300005616 | Ga0068852_100066561 | Ga0068852_1000665614 | 274 |
| 114 | 3300005616 | Ga0068852_100587130 | Ga0068852_1005871302 | 274 |
| 115 | 3300005617 | Ga0068859_100040184 | Ga0068859_1000401845 | 274 |
| 116 | 3300005718 | Ga0068866_10007584 | Ga0068866_100075842 | 274 |
| 117 | 3300005719 | Ga0068861_100004142 | Ga0068861_1000041425 | 274 |
| 118 | 3300005841 | Ga0068863_100018571 | Ga0068863_1000185714 | 274 |
| 119 | 3300005842 | Ga0068858_100185585 | Ga0068858_1001855852 | 274 |
| 120 | 3300005843 | Ga0068860_100036706 | Ga0068860_1000367065 | 274 |
| 121 | 3300006931 | Ga0097620_100040185 | Ga0097620_1000401855 | 274 |
| 122 | 3300009098 | Ga0105245_10020891 | Ga0105245_100208913 | 274 |
| 123 | 3300009148 | Ga0105243_10022667 | Ga0105243_100226674 | 274 |
| 124 | 3300009177 | Ga0105248_10102314 | Ga0105248_101023143 | 274 |
| 125 | 3300009177 | Ga0105248_10647280 | Ga0105248_106472802 | 274 |
| 126 | 3300013102 | Ga0157371_10070073 | Ga0157371_100700732 | 274 |
| 127 | 3300013105 | Ga0157369_10293281 | Ga0157369_102932812 | 274 |
| 128 | 3300013306 | Ga0163162_10006558 | Ga0163162_100065586 | 274 |
| 129 | 3300013307 | Ga0157372_10182322 | Ga0157372_101823222 | 274 |
| 130 | 3300013308 | Ga0157375_10129766 | Ga0157375_101297662 | 274 |
| 131 | 3300013308 | Ga0157375_10231695 | Ga0157375_102316952 | 274 |
| 132 | 3300014326 | Ga0157380_10010808 | Ga0157380_100108087 | 274 |
| 133 | 3300014968 | Ga0157379_10009072 | Ga0157379_100090727 | 274 |
| 134 | 3300017792 | Ga0163161_10036517 | Ga0163161_100365172 | 274 |
| 135 | 3300025315 | Ga0207697_10064968 | Ga0207697_100649682 | 274 |
| 136 | 3300025893 | Ga0207682_10017480 | Ga0207682_100174802 | 274 |
| 137 | 3300025893 | Ga0207682_10048593 | Ga0207682_100485932 | 274 |
| 138 | 3300025899 | Ga0207642_10033859 | Ga0207642_100338592 | 274 |
| 139 | 3300025901 | Ga0207688_10157340 | Ga0207688_101573402 | 274 |
| 140 | 3300025903 | Ga0207680_10064526 | Ga0207680_100645262 | 274 |
| 141 | 3300025907 | Ga0207645_10004107 | Ga0207645_100041076 | 274 |
| 142 | 3300025908 | Ga0207643_10054378 | Ga0207643_100543782 | 274 |
| 143 | 3300025918 | Ga0207662_10044865 | Ga0207662_100448652 | 274 |
| 144 | 3300025922 | Ga0207646_10002099 | Ga0207646_100020995 | 274 |
| 145 | 3300025923 | Ga0207681_10011566 | Ga0207681_100115662 | 274 |
| 146 | 3300025925 | Ga0207650_10008268 | Ga0207650_100082687 | 274 |
| 147 | 3300025925 | Ga0207650_10229608 | Ga0207650_102296082 | 274 |
| 148 | 3300025926 | Ga0207659_10047638 | Ga0207659_100476382 | 274 |
| 149 | 3300025926 | Ga0207659_10153911 | Ga0207659_101539112 | 274 |
| 150 | 3300025932 | Ga0207690_10320643 | Ga0207690_103206432 | 274 |
| 151 | 3300025933 | Ga0207706_10035537 | Ga0207706_100355373 | 274 |
| 152 | 3300025935 | Ga0207709_10019377 | Ga0207709_100193772 | 274 |
| 153 | 3300025936 | Ga0207670_10067725 | Ga0207670_100677252 | 274 |
| 154 | 3300025938 | Ga0207704_10172954 | Ga0207704_101729542 | 274 |
| 155 | 3300025940 | Ga0207691_10025170 | Ga0207691_100251705 | 274 |
| 156 | 3300025940 | Ga0207691_10070219 | Ga0207691_100702192 | 274 |
| 157 | 3300025941 | Ga0207711_10082130 | Ga0207711_100821303 | 274 |
| 158 | 3300025941 | Ga0207711_10196189 | Ga0207711_101961892 | 274 |
| 159 | 3300025942 | Ga0207689_10010069 | Ga0207689_100100698 | 274 |
| 160 | 3300025945 | Ga0207679_10421162 | Ga0207679_104211622 | 274 |
| 161 | 3300025961 | Ga0207712_10018024 | Ga0207712_100180242 | 274 |
| 162 | 3300025981 | Ga0207640_10284192 | Ga0207640_102841922 | 274 |
| 163 | 3300025986 | Ga0207658_10028783 | Ga0207658_100287832 | 274 |
| 164 | 3300026023 | Ga0207677_10169222 | Ga0207677_101692222 | 274 |
| 165 | 3300026035 | Ga0207703_10039834 | Ga0207703_100398342 | 274 |
| 166 | 3300026041 | Ga0207639_10081823 | Ga0207639_100818232 | 274 |
| 167 | 3300026088 | Ga0207641_10007595 | Ga0207641_100075957 | 274 |
| 168 | 3300026089 | Ga0207648_10034632 | Ga0207648_100346324 | 274 |
| 169 | 3300026089 | Ga0207648_10049136 | Ga0207648_100491362 | 274 |
| 170 | 3300026116 | Ga0207674_10143439 | Ga0207674_101434392 | 274 |
| 171 | 3300026118 | Ga0207675_100006516 | Ga0207675_1000065168 | 274 |
| 172 | 3300026121 | Ga0207683_10032674 | Ga0207683_100326742 | 274 |
| 173 | 3300026121 | Ga0207683_10190295 | Ga0207683_101902952 | 274 |
| 174 | 3300026142 | Ga0207698_10029360 | Ga0207698_100293602 | 274 |
| 175 | 3300028380 | Ga0268265_10062451 | Ga0268265_100624513 | 274 |
| 176 | 3300028381 | Ga0268264_10010901 | Ga0268264_100109018 | 274 |
| 177 | 3300035117 | Ga0373953_0062927 | Ga0373953_0062927_57_902 | 274 |
| 178 | 3300036401 | Ga0373937_0038014 | Ga0373937_0038014_1839_2675 | 274 |
| 179 | 3300036401 | Ga0373937_0063401 | Ga0373937_0063401_1931_2776 | 274 |
| 180 | 3300041512 | Ga0451853_1460144 | Ga0451853_1460144_561_1397 | 274 |
| 181 | 3300046459 | Ga0495629_0106403 | Ga0495629_0106403_62_898 | 274 |
| 182 | 3300046463 | Ga0495653_0259776 | Ga0495653_0259776_254_1099 | 274 |
| 183 | 3300046477 | Ga0495664_0295119 | Ga0495664_0295119_88_933 | 274 |
| 184 | 3300046516 | Ga0495628_0114971 | Ga0495628_0114971_63_899 | 274 |
| 185 | 3300046537 | Ga0495598_0021050 | Ga0495598_0021050_377_1213 | 274 |
| 186 | 3300046559 | Ga0495667_0227340 | Ga0495667_0227340_224_1069 | 274 |
| 187 | 3300046663 | Ga0495635_0079253 | Ga0495635_0079253_1156_1992 | 274 |
| 188 | 3300046680 | Ga0495646_0163730 | Ga0495646_0163730_261_1097 | 274 |
| 189 | 3300046683 | Ga0495658_0031488 | Ga0495658_0031488_893_1738 | 274 |
| 190 | 3300047322 | Ga0495680_0017679 | Ga0495680_0017679_3585_4421 | 274 |
| 191 | 3300053077 | Ga0495601_0038246 | Ga0495601_0038246_1266_2111 | 274 |
| 192 | 3300053078 | Ga0495612_0178938 | Ga0495612_0178938_51_896 | 274 |
| 193 | 3300053085 | Ga0495619_0336777 | Ga0495619_0336777_94_930 | 274 |
| 194 | iso_pu_bacteria | 2582581866 | 2585392061 | 274 |
| 195 | 3300005327 | Ga0070658_10139878 | Ga0070658_101398782 | 275 |
| 196 | 3300005328 | Ga0070676_10112682 | Ga0070676_101126822 | 275 |
| 197 | 3300005331 | Ga0070670_100002229 | Ga0070670_10000222915 | 275 |
| 198 | 3300005331 | Ga0070670_100005687 | Ga0070670_1000056875 | 275 |
| 199 | 3300005333 | Ga0070677_10019981 | Ga0070677_100199812 | 275 |
| 200 | 3300005338 | Ga0068868_100066155 | Ga0068868_1000661553 | 275 |
| 201 | 3300005344 | Ga0070661_100071883 | Ga0070661_1000718832 | 275 |
| 202 | 3300005353 | Ga0070669_100014691 | Ga0070669_1000146916 | 275 |
| 203 | 3300005354 | Ga0070675_100007942 | Ga0070675_1000079423 | 275 |
| 204 | 3300005354 | Ga0070675_100017439 | Ga0070675_1000174393 | 275 |
| 205 | 3300005355 | Ga0070671_100009709 | Ga0070671_1000097097 | 275 |
| 206 | 3300005355 | Ga0070671_100030658 | Ga0070671_1000306583 | 275 |
| 207 | 3300005355 | Ga0070671_100152663 | Ga0070671_1001526632 | 275 |
| 208 | 3300005364 | Ga0070673_100006275 | Ga0070673_1000062754 | 275 |
| 209 | 3300005364 | Ga0070673_100067395 | Ga0070673_1000673952 | 275 |
| 210 | 3300005367 | Ga0070667_100259701 | Ga0070667_1002597012 | 275 |
| 211 | 3300005456 | Ga0070678_100027482 | Ga0070678_1000274822 | 275 |
| 212 | 3300005459 | Ga0068867_100007420 | Ga0068867_1000074206 | 275 |
| 213 | 3300005543 | Ga0070672_100002981 | Ga0070672_1000029817 | 275 |
| 214 | 3300005543 | Ga0070672_100005989 | Ga0070672_1000059892 | 275 |
| 215 | 3300005618 | Ga0068864_100005858 | Ga0068864_1000058587 | 275 |
| 216 | 3300005834 | Ga0068851_10108670 | Ga0068851_101086702 | 275 |
| 217 | 3300006237 | Ga0097621_100015345 | Ga0097621_1000153454 | 275 |
| 218 | 3300006237 | Ga0097621_100069375 | Ga0097621_1000693752 | 275 |
| 219 | 3300006358 | Ga0068871_100025548 | Ga0068871_1000255485 | 275 |
| 220 | 3300013306 | Ga0163162_10095782 | Ga0163162_100957821 | 275 |
| 221 | 3300013308 | Ga0157375_10046742 | Ga0157375_100467422 | 275 |
| 222 | 3300013308 | Ga0157375_10714532 | Ga0157375_107145322 | 275 |
| 223 | 3300014325 | Ga0163163_10150092 | Ga0163163_101500922 | 275 |
| 224 | 3300014969 | Ga0157376_10003642 | Ga0157376_100036429 | 275 |
| 225 | 3300014969 | Ga0157376_10043120 | Ga0157376_100431202 | 275 |
| 226 | 3300025321 | Ga0207656_10069336 | Ga0207656_100693362 | 275 |
| 227 | 3300025893 | Ga0207682_10012514 | Ga0207682_100125144 | 275 |
| 228 | 3300025920 | Ga0207649_10055026 | Ga0207649_100550262 | 275 |
| 229 | 3300025923 | Ga0207681_10024126 | Ga0207681_100241262 | 275 |
| 230 | 3300025925 | Ga0207650_10001201 | Ga0207650_1000120115 | 275 |
| 231 | 3300025925 | Ga0207650_10002944 | Ga0207650_1000294410 | 275 |
| 232 | 3300025926 | Ga0207659_10017831 | Ga0207659_100178311 | 275 |
| 233 | 3300025926 | Ga0207659_10056637 | Ga0207659_100566373 | 275 |
| 234 | 3300025931 | Ga0207644_10012599 | Ga0207644_100125996 | 275 |
| 235 | 3300025931 | Ga0207644_10160245 | Ga0207644_101602452 | 275 |
| 236 | 3300025937 | Ga0207669_10005768 | Ga0207669_100057686 | 275 |
| 237 | 3300025940 | Ga0207691_10000964 | Ga0207691_100009644 | 275 |
| 238 | 3300025940 | Ga0207691_10118545 | Ga0207691_101185452 | 275 |
| 239 | 3300025960 | Ga0207651_10001048 | Ga0207651_1000104810 | 275 |
| 240 | 3300025960 | Ga0207651_10055966 | Ga0207651_100559662 | 275 |
| 241 | 3300025986 | Ga0207658_10080727 | Ga0207658_100807272 | 275 |
| 242 | 3300026088 | Ga0207641_10133945 | Ga0207641_101339453 | 275 |
| 243 | 3300026089 | Ga0207648_10020407 | Ga0207648_100204073 | 275 |
| 244 | 3300026095 | Ga0207676_10121560 | Ga0207676_101215602 | 275 |
| 245 | 3300026121 | Ga0207683_10048104 | Ga0207683_100481044 | 275 |
| 246 | 3300031731 | Ga0307405_10006846 | Ga0307405_100068465 | 275 |
| 247 | 3300031911 | Ga0307412_10632622 | Ga0307412_106326221 | 275 |
| 248 | 3300031995 | Ga0307409_100000746 | Ga0307409_1000007467 | 275 |
| 249 | 3300032002 | Ga0307416_100011193 | Ga0307416_1000111933 | 275 |
| 250 | 3300039438 | Ga0436360_1051396 | Ga0436360_1051396_11_928 | 275 |
| 251 | 3300044712 | Ga0453684_0116111 | Ga0453684_0116111_216_1070 | 275 |
| 252 | 3300046543 | Ga0495645_0033134 | Ga0495645_0033134_908_1750 | 275 |
| 253 | 3300048911 | Ga0496108_0027022 | Ga0496108_0027022_2097_2936 | 275 |
| 254 | 3300005457 | Ga0070662_100002799 | Ga0070662_1000027999 | 276 |
| 255 | 3300025933 | Ga0207706_10008925 | Ga0207706_100089254 | 276 |
| 256 | 3300026121 | Ga0207683_10074060 | Ga0207683_100740602 | 276 |
| 257 | 3300028794 | Ga0307515_10155775 | Ga0307515_101557752 | 276 |
| 258 | 3300036401 | Ga0373937_0057084 | Ga0373937_0057084_1772_2617 | 276 |
| 259 | 3300005536 | Ga0070697_100082439 | Ga0070697_1000824393 | 277 |
| 260 | 3300005546 | Ga0070696_100049229 | Ga0070696_1000492292 | 277 |
| 261 | 3300021384 | Ga0213876_10019248 | Ga0213876_100192483 | 277 |
| 262 | 3300025728 | Ga0207655_1019806 | Ga0207655_10198062 | 277 |
| 263 | 3300029957 | Ga0265324_10000032 | Ga0265324_1000003245 | 277 |
| 264 | 3300033180 | Ga0307510_10005583 | Ga0307510_1000558313 | 277 |
| 265 | 3300039437 | Ga0436365_1450265 | Ga0436365_1450265_3059_3952 | 277 |
| 266 | 3300039450 | Ga0436363_1071075 | Ga0436363_1071075_1406_2299 | 277 |
| 267 | iso_pu_bacteria | 2511231007 | 2511272029 | 277 |
| 268 | iso_pu_bacteria | 2599185307 | 2599971532 | 278 |
| 269 | 3300017792 | Ga0163161_10040626 | Ga0163161_100406263 | 279 |
| 270 | iso_pu_bacteria | 2511231010 | 2511292052 | 279 |
| 271 | iso_pu_bacteria | 2511231020 | 2511352289 | 279 |
| 272 | iso_pu_bacteria | 2511231031 | 2511416363 | 279 |
| 273 | iso_pu_bacteria | 2600255318 | 2601795427 | 279 |
| 274 | iso_pu_bacteria | 2603880185 | 2606075495 | 279 |
| 275 | iso_pu_bacteria | 2603880199 | 2606128593 | 279 |
| 276 | iso_pu_bacteria | 2713897149 | 2715754929 | 279 |
| 277 | iso_pu_bacteria | 2718217725 | 2718633205 | 279 |
| 278 | iso_pu_bacteria | 2738543025 | 2739316102 | 279 |
| 279 | iso_pu_bacteria | 2765235841 | 2765582760 | 279 |
| 280 | iso_pu_bacteria | 2784132063 | 2784259872 | 279 |
| 281 | iso_pu_bacteria | 2852657418 | 2852658840 | 279 |
| 282 | iso_pu_bacteria | 2878029506 | 2878031367 | 279 |
| 283 | iso_pu_bacteria | 2880230671 | 2880232229 | 279 |
| 284 | iso_pu_bacteria | 2919063839 | 2919064163 | 279 |
| 285 | iso_pu_bacteria | 2919385768 | 2919386327 | 279 |
| 286 | iso_pu_bacteria | 2969304461 | 2969306148 | 279 |
| 287 | iso_pu_bacteria | 3007718800 | 3007722869 | 279 |
| 288 | iso_pu_bacteria | 8056137416 | 8056141439 | 279 |
| 289 | 3300028794 | Ga0307515_10000180 | Ga0307515_10000180101 | 280 |
| 290 | iso_pu_bacteria | 2511231011 | 2511296747 | 280 |
| 291 | iso_pu_bacteria | 2773857673 | 2774137518 | 280 |
| 292 | iso_pu_bacteria | 2818991456 | 2819654083 | 280 |
| 293 | iso_pu_bacteria | 2904518522 | 2904521874 | 280 |
| 294 | iso_pu_bacteria | 2974289157 | 2974292202 | 280 |
| 295 | iso_pu_bacteria | 3007614139 | 3007614559 | 280 |
| 296 | iso_pu_bacteria | 8056166840 | 8056169448 | 280 |
| 297 | 3300006058 | Ga0075432_10002595 | Ga0075432_100025953 | 281 |
| 298 | 3300027907 | Ga0207428_10080653 | Ga0207428_100806532 | 281 |
| 299 | 3300046458 | Ga0495591_002226 | Ga0495591_002226_9983_10828 | 281 |
| 300 | 3300046471 | Ga0495650_0018563 | Ga0495650_0018563_1733_2578 | 281 |
| 301 | 3300046492 | Ga0495585_0035974 | Ga0495585_0035974_1120_1992 | 281 |
| 302 | 3300046500 | Ga0495596_0054128 | Ga0495596_0054128_462_1307 | 281 |
| 303 | 3300046501 | Ga0495607_0007895 | Ga0495607_0007895_5261_6106 | 281 |
| 304 | 3300046501 | Ga0495607_0074277 | Ga0495607_0074277_358_1239 | 281 |
| 305 | 3300046506 | Ga0495583_0001955 | Ga0495583_0001955_3410_4291 | 281 |
| 306 | 3300046512 | Ga0495610_0074105 | Ga0495610_0074105_369_1214 | 281 |
| 307 | 3300046513 | Ga0495616_0008680 | Ga0495616_0008680_1034_1879 | 281 |
| 308 | 3300046518 | Ga0495631_0000638 | Ga0495631_0000638_17943_18788 | 281 |
| 309 | 3300046518 | Ga0495631_0006154 | Ga0495631_0006154_1846_2727 | 281 |
| 310 | 3300046519 | Ga0495632_0003111 | Ga0495632_0003111_9983_10828 | 281 |
| 311 | 3300046519 | Ga0495632_0010529 | Ga0495632_0010529_4010_4891 | 281 |
| 312 | 3300046520 | Ga0495637_0000428 | Ga0495637_0000428_10156_11001 | 281 |
| 313 | 3300046520 | Ga0495637_0000625 | Ga0495637_0000625_9704_10585 | 281 |
| 314 | 3300046520 | Ga0495637_0006580 | Ga0495637_0006580_1198_2043 | 281 |
| 315 | 3300046522 | Ga0495643_0009655 | Ga0495643_0009655_4134_4979 | 281 |
| 316 | 3300046524 | Ga0495648_0000997 | Ga0495648_0000997_15337_16218 | 281 |
| 317 | 3300046524 | Ga0495648_0015869 | Ga0495648_0015869_830_1675 | 281 |
| 318 | 3300046524 | Ga0495648_0037432 | Ga0495648_0037432_769_1614 | 281 |
| 319 | 3300046526 | Ga0495666_0008015 | Ga0495666_0008015_2361_3206 | 281 |
| 320 | 3300046530 | Ga0495654_0004044 | Ga0495654_0004044_1680_2561 | 281 |
| 321 | 3300046530 | Ga0495654_0020931 | Ga0495654_0020931_1975_2820 | 281 |
| 322 | 3300046536 | Ga0495587_0004482 | Ga0495587_0004482_3597_4442 | 281 |
| 323 | 3300046538 | Ga0495609_0044311 | Ga0495609_0044311_719_1564 | 281 |
| 324 | 3300046648 | Ga0495611_0007338 | Ga0495611_0007338_592_1473 | 281 |
| 325 | 3300046660 | Ga0495625_0004836 | Ga0495625_0004836_9387_10232 | 281 |
| 326 | 3300046663 | Ga0495635_0009714 | Ga0495635_0009714_787_1632 | 281 |
| 327 | 3300046665 | Ga0495661_0011316 | Ga0495661_0011316_1981_2862 | 281 |
| 328 | 3300046692 | Ga0495671_0012431 | Ga0495671_0012431_1451_2332 | 281 |
| 329 | 3300046794 | Ga0495589_0007845 | Ga0495589_0007845_3771_4616 | 281 |
| 330 | 3300047319 | Ga0495674_0021739 | Ga0495674_0021739_72_917 | 281 |
| 331 | 3300047320 | Ga0495672_0002587 | Ga0495672_0002587_7111_7992 | 281 |
| 332 | 3300047320 | Ga0495672_0013604 | Ga0495672_0013604_4114_4959 | 281 |
| 333 | 3300047323 | Ga0495683_0000784 | Ga0495683_0000784_4450_5295 | 281 |
| 334 | 3300047469 | Ga0495673_0001083 | Ga0495673_0001083_15732_16577 | 281 |
| 335 | 3300047469 | Ga0495673_0019067 | Ga0495673_0019067_2031_2912 | 281 |
| 336 | 3300047469 | Ga0495673_0023705 | Ga0495673_0023705_68_949 | 281 |
| 337 | 3300047472 | Ga0495686_0012958 | Ga0495686_0012958_970_1815 | 281 |
| 338 | 3300047472 | Ga0495686_0033662 | Ga0495686_0033662_1972_2853 | 281 |
| 339 | 3300048920 | Ga0496117_0022217 | Ga0496117_0022217_3913_4761 | 281 |
| 340 | 3300048921 | Ga0496118_0026191 | Ga0496118_0026191_3921_4769 | 281 |
| 341 | 3300048928 | Ga0496125_0033034 | Ga0496125_0033034_3068_3913 | 281 |
| 342 | 3300049459 | Ga0495678_000311 | Ga0495678_000311_29221_30102 | 281 |
| 343 | iso_pu_bacteria | 2511231004 | 2511252423 | 281 |
| 344 | iso_pu_bacteria | 2511231008 | 2511280489 | 281 |
| 345 | iso_pu_bacteria | 2511231016 | 2511324466 | 281 |
| 346 | iso_pu_bacteria | 2511231018 | 2511341429 | 281 |
| 347 | iso_pu_bacteria | 2511231022 | 2511363612 | 281 |
| 348 | iso_pu_bacteria | 2599185188 | 2599504026 | 281 |
| 349 | iso_pu_bacteria | 2599185289 | 2599887679 | 281 |
| 350 | iso_pu_bacteria | 2599185291 | 2599899842 | 281 |
| 351 | iso_pu_bacteria | 2599185300 | 2599931982 | 281 |
| 352 | iso_pu_bacteria | 2599185305 | 2599960419 | 281 |
| 353 | iso_pu_bacteria | 2599185310 | 2599988021 | 281 |
| 354 | iso_pu_bacteria | 2599185315 | 2600017541 | 281 |
| 355 | iso_pu_bacteria | 2599185317 | 2600030336 | 281 |
| 356 | iso_pu_bacteria | 2599185321 | 2600052365 | 281 |
| 357 | iso_pu_bacteria | 2600254930 | 2600360768 | 281 |
| 358 | iso_pu_bacteria | 2623620446 | 2624493644 | 281 |
| 359 | iso_pu_bacteria | 2643221633 | 2644187228 | 281 |
| 360 | iso_pu_bacteria | 2667528170 | 2671090340 | 281 |
| 361 | iso_pu_bacteria | 2773857670 | 2774122805 | 281 |
| 362 | iso_pu_bacteria | 2784132072 | 2784315163 | 281 |
| 363 | iso_pu_bacteria | 2808606377 | 2808931816 | 281 |
| 364 | iso_pu_bacteria | 2808606381 | 2808953936 | 281 |
| 365 | iso_pu_bacteria | 2842854478 | 2842854510 | 281 |
| 366 | iso_pu_bacteria | 2860339153 | 2860340093 | 281 |
| 367 | iso_pu_bacteria | 2904550169 | 2904553271 | 281 |
| 368 | iso_pu_bacteria | 2919456309 | 2919457181 | 281 |
| 369 | iso_pu_bacteria | 2919481497 | 2919481707 | 281 |
| 370 | iso_pu_bacteria | 2919697872 | 2919702944 | 281 |
| 371 | iso_pu_bacteria | 2931396565 | 2931400015 | 281 |
| 372 | iso_pu_bacteria | 2984286254 | 2984290822 | 281 |
| 373 | iso_pu_bacteria | 2988728565 | 2988733424 | 281 |
| 374 | iso_pu_bacteria | 8019775933 | 8019780175 | 281 |
| 375 | iso_pu_bacteria | 8056155041 | 8056156713 | 281 |
| 376 | iso_pu_bacteria | 8056172158 | 8056175627 | 281 |
| 377 | 3300005331 | Ga0070670_100024039 | Ga0070670_1000240392 | 282 |
| 378 | 3300005354 | Ga0070675_100298356 | Ga0070675_1002983562 | 282 |
| 379 | 3300006195 | Ga0075366_10013980 | Ga0075366_100139803 | 282 |
| 380 | 3300009094 | Ga0111539_10007100 | Ga0111539_100071004 | 282 |
| 381 | 3300025925 | Ga0207650_10042469 | Ga0207650_100424691 | 282 |
| 382 | 3300027907 | Ga0207428_10073217 | Ga0207428_100732173 | 282 |
| 383 | 3300050493 | nmdc:mga0k408_78_c1 | nmdc:mga0k408_78_c1_43627_44484 | 282 |
| 384 | 3300003781 | Ga0055536_1000441 | Ga0055536_100044111 | 283 |
| 385 | 3300003791 | Ga0055530_10000725 | Ga0055530_1000072511 | 283 |
| 386 | 3300003792 | Ga0055540_1000501 | Ga0055540_100050113 | 283 |
| 387 | 3300003794 | Ga0055531_10001274 | Ga0055531_100012747 | 283 |
| 388 | 3300005353 | Ga0070669_100029331 | Ga0070669_1000293314 | 283 |
| 389 | 3300005354 | Ga0070675_100067337 | Ga0070675_1000673372 | 283 |
| 390 | 3300005356 | Ga0070674_100373974 | Ga0070674_1003739741 | 283 |
| 391 | 3300005457 | Ga0070662_100023071 | Ga0070662_1000230712 | 283 |
| 392 | 3300005548 | Ga0070665_100140278 | Ga0070665_1001402782 | 283 |
| 393 | 3300005548 | Ga0070665_100287230 | Ga0070665_1002872302 | 283 |
| 394 | 3300005618 | Ga0068864_100072176 | Ga0068864_1000721764 | 283 |
| 395 | 3300005841 | Ga0068863_100003514 | Ga0068863_1000035147 | 283 |
| 396 | 3300006051 | Ga0075364_10207418 | Ga0075364_102074182 | 283 |
| 397 | 3300006058 | Ga0075432_10000422 | Ga0075432_100004229 | 283 |
| 398 | 3300006177 | Ga0075362_10081188 | Ga0075362_100811882 | 283 |
| 399 | 3300006186 | Ga0075369_10024983 | Ga0075369_100249832 | 283 |
| 400 | 3300006237 | Ga0097621_100189366 | Ga0097621_1001893662 | 283 |
| 401 | 3300006358 | Ga0068871_100001760 | Ga0068871_1000017606 | 283 |
| 402 | 3300006914 | Ga0075436_100033025 | Ga0075436_1000330252 | 283 |
| 403 | 3300006946 | Ga0079104_1003979 | Ga0079104_10039793 | 283 |
| 404 | 3300009011 | Ga0105251_10052192 | Ga0105251_100521922 | 283 |
| 405 | 3300009011 | Ga0105251_10083917 | Ga0105251_100839172 | 283 |
| 406 | 3300009036 | Ga0105244_10018701 | Ga0105244_100187012 | 283 |
| 407 | 3300009036 | Ga0105244_10138646 | Ga0105244_101386461 | 283 |
| 408 | 3300009036 | Ga0105244_10151655 | Ga0105244_101516552 | 283 |
| 409 | 3300009092 | Ga0105250_10001081 | Ga0105250_100010815 | 283 |
| 410 | 3300009092 | Ga0105250_10007464 | Ga0105250_100074644 | 283 |
| 411 | 3300009148 | Ga0105243_10000162 | Ga0105243_1000016264 | 283 |
| 412 | 3300011119 | Ga0105246_10008116 | Ga0105246_100081165 | 283 |
| 413 | 3300013100 | Ga0157373_10002764 | Ga0157373_1000276411 | 283 |
| 414 | 3300013100 | Ga0157373_10008956 | Ga0157373_100089562 | 283 |
| 415 | 3300013104 | Ga0157370_10285461 | Ga0157370_102854612 | 283 |
| 416 | 3300013105 | Ga0157369_10008420 | Ga0157369_100084209 | 283 |
| 417 | 3300013306 | Ga0163162_10004598 | Ga0163162_1000459811 | 283 |
| 418 | 3300013306 | Ga0163162_10369762 | Ga0163162_103697622 | 283 |
| 419 | 3300013306 | Ga0163162_10506589 | Ga0163162_105065892 | 283 |
| 420 | 3300013307 | Ga0157372_10001365 | Ga0157372_1000136514 | 283 |
| 421 | 3300014325 | Ga0163163_10179646 | Ga0163163_101796462 | 283 |
| 422 | 3300014497 | Ga0182008_10004863 | Ga0182008_100048633 | 283 |
| 423 | 3300014497 | Ga0182008_10006302 | Ga0182008_100063022 | 283 |
| 424 | 3300014969 | Ga0157376_10002090 | Ga0157376_1000209010 | 283 |
| 425 | 3300015261 | Ga0182006_1055688 | Ga0182006_10556882 | 283 |
| 426 | 3300015265 | Ga0182005_1026198 | Ga0182005_10261982 | 283 |
| 427 | 3300017792 | Ga0163161_10021069 | Ga0163161_100210693 | 283 |
| 428 | 3300025230 | Ga0209563_100535 | Ga0209563_1005359 | 283 |
| 429 | 3300025291 | Ga0209675_1002483 | Ga0209675_10024835 | 283 |
| 430 | 3300025292 | Ga0209676_1000016 | Ga0209676_1000016466 | 283 |
| 431 | 3300025298 | Ga0209050_1000036 | Ga0209050_100003692 | 283 |
| 432 | 3300025303 | Ga0209051_1000043 | Ga0209051_1000043164 | 283 |
| 433 | 3300025304 | Ga0209257_1000098 | Ga0209257_1000098149 | 283 |
| 434 | 3300025711 | Ga0207696_1000101 | Ga0207696_1000101103 | 283 |
| 435 | 3300025711 | Ga0207696_1000979 | Ga0207696_100097913 | 283 |
| 436 | 3300025728 | Ga0207655_1000402 | Ga0207655_100040243 | 283 |
| 437 | 3300025728 | Ga0207655_1026603 | Ga0207655_10266033 | 283 |
| 438 | 3300025735 | Ga0207713_1039279 | Ga0207713_10392792 | 283 |
| 439 | 3300025735 | Ga0207713_1040943 | Ga0207713_10409431 | 283 |
| 440 | 3300025926 | Ga0207659_10116093 | Ga0207659_101160932 | 283 |
| 441 | 3300025935 | Ga0207709_10000053 | Ga0207709_1000005361 | 283 |
| 442 | 3300026088 | Ga0207641_10014579 | Ga0207641_100145794 | 283 |
| 443 | 3300028379 | Ga0268266_10054016 | Ga0268266_100540162 | 283 |
| 444 | 3300028379 | Ga0268266_10218183 | Ga0268266_102181832 | 283 |
| 445 | 3300031548 | Ga0307408_100002790 | Ga0307408_1000027906 | 283 |
| 446 | 3300031548 | Ga0307408_100499494 | Ga0307408_1004994942 | 283 |
| 447 | 3300031911 | Ga0307412_10007173 | Ga0307412_100071736 | 283 |
| 448 | 3300031911 | Ga0307412_10100642 | Ga0307412_101006422 | 283 |
| 449 | 3300032002 | Ga0307416_100062975 | Ga0307416_1000629754 | 283 |
| 450 | 3300032002 | Ga0307416_100180371 | Ga0307416_1001803712 | 283 |
| 451 | 3300032004 | Ga0307414_10029301 | Ga0307414_100293012 | 283 |
| 452 | 3300032004 | Ga0307414_10068668 | Ga0307414_100686683 | 283 |
| 453 | 3300032005 | Ga0307411_10189722 | Ga0307411_101897222 | 283 |
| 454 | 3300041405 | Ga0439438_002175 | Ga0439438_002175_6721_7572 | 283 |
| 455 | 3300041407 | Ga0439447_004257 | Ga0439447_004257_3392_4243 | 283 |
| 456 | 3300041407 | Ga0439447_036537 | Ga0439447_036537_47_898 | 283 |
| 457 | 3300041411 | Ga0439466_0014195 | Ga0439466_0014195_690_1541 | 283 |
| 458 | 3300041413 | Ga0439465_0125953 | Ga0439465_0125953_40_891 | 283 |
| 459 | 3300042006 | Ga0439432_027166 | Ga0439432_027166_821_1672 | 283 |
| 460 | 3300042010 | Ga0439452_000346 | Ga0439452_000346_12420_13271 | 283 |
| 461 | 3300042010 | Ga0439452_003450 | Ga0439452_003450_3845_4696 | 283 |
| 462 | 3300042013 | Ga0439456_005912 | Ga0439456_005912_1303_2154 | 283 |
| 463 | 3300042016 | Ga0439463_026429 | Ga0439463_026429_325_1176 | 283 |
| 464 | 3300042138 | Ga0450903_006832 | Ga0450903_006832_747_1598 | 283 |
| 465 | 3300042142 | Ga0450905_000228 | Ga0450905_000228_481_1332 | 283 |
| 466 | 3300042144 | Ga0450889_006595 | Ga0450889_006595_93_944 | 283 |
| 467 | 3300042145 | Ga0450906_000168 | Ga0450906_000168_670_1521 | 283 |
| 468 | 3300042532 | Ga0450893_0004680 | Ga0450893_0004680_358_1209 | 283 |
| 469 | 3300046452 | Ga0495617_018016 | Ga0495617_018016_975_1826 | 283 |
| 470 | 3300046452 | Ga0495617_020665 | Ga0495617_020665_980_1831 | 283 |
| 471 | 3300046452 | Ga0495617_031546 | Ga0495617_031546_821_1672 | 283 |
| 472 | 3300046453 | Ga0495627_001228 | Ga0495627_001228_13874_14725 | 283 |
| 473 | 3300046454 | Ga0495592_0013417 | Ga0495592_0013417_364_1215 | 283 |
| 474 | 3300046457 | Ga0495590_0002663 | Ga0495590_0002663_1178_2029 | 283 |
| 475 | 3300046457 | Ga0495590_0003209 | Ga0495590_0003209_651_1502 | 283 |
| 476 | 3300046457 | Ga0495590_0003906 | Ga0495590_0003906_4807_5658 | 283 |
| 477 | 3300046458 | Ga0495591_019789 | Ga0495591_019789_745_1596 | 283 |
| 478 | 3300046458 | Ga0495591_021687 | Ga0495591_021687_825_1676 | 283 |
| 479 | 3300046460 | Ga0495638_0007805 | Ga0495638_0007805_660_1511 | 283 |
| 480 | 3300046460 | Ga0495638_0010285 | Ga0495638_0010285_719_1570 | 283 |
| 481 | 3300046460 | Ga0495638_0044002 | Ga0495638_0044002_859_1710 | 283 |
| 482 | 3300046463 | Ga0495653_0003581 | Ga0495653_0003581_10455_11306 | 283 |
| 483 | 3300046463 | Ga0495653_0202670 | Ga0495653_0202670_231_1082 | 283 |
| 484 | 3300046471 | Ga0495650_0007214 | Ga0495650_0007214_5126_5977 | 283 |
| 485 | 3300046474 | Ga0495605_0014566 | Ga0495605_0014566_2206_3057 | 283 |
| 486 | 3300046474 | Ga0495605_0024838 | Ga0495605_0024838_1674_2525 | 283 |
| 487 | 3300046491 | Ga0495584_0019174 | Ga0495584_0019174_1138_1989 | 283 |
| 488 | 3300046491 | Ga0495584_0027976 | Ga0495584_0027976_1309_2160 | 283 |
| 489 | 3300046492 | Ga0495585_0002592 | Ga0495585_0002592_10742_11593 | 283 |
| 490 | 3300046492 | Ga0495585_0041146 | Ga0495585_0041146_1067_1918 | 283 |
| 491 | 3300046492 | Ga0495585_0041191 | Ga0495585_0041191_642_1493 | 283 |
| 492 | 3300046501 | Ga0495607_0000563 | Ga0495607_0000563_66_917 | 283 |
| 493 | 3300046501 | Ga0495607_0001138 | Ga0495607_0001138_13891_14742 | 283 |
| 494 | 3300046501 | Ga0495607_0009248 | Ga0495607_0009248_5170_6021 | 283 |
| 495 | 3300046501 | Ga0495607_0045804 | Ga0495607_0045804_1093_1944 | 283 |
| 496 | 3300046507 | Ga0495606_0025197 | Ga0495606_0025197_3302_4153 | 283 |
| 497 | 3300046512 | Ga0495610_0019617 | Ga0495610_0019617_678_1529 | 283 |
| 498 | 3300046512 | Ga0495610_0019910 | Ga0495610_0019910_1647_2498 | 283 |
| 499 | 3300046512 | Ga0495610_0073402 | Ga0495610_0073402_573_1424 | 283 |
| 500 | 3300046513 | Ga0495616_0006718 | Ga0495616_0006718_954_1805 | 283 |
| 501 | 3300046515 | Ga0495620_0000338 | Ga0495620_0000338_18961_19812 | 283 |
| 502 | 3300046515 | Ga0495620_0020743 | Ga0495620_0020743_1190_2041 | 283 |
| 503 | 3300046519 | Ga0495632_0047592 | Ga0495632_0047592_417_1268 | 283 |
| 504 | 3300046520 | Ga0495637_0005398 | Ga0495637_0005398_555_1406 | 283 |
| 505 | 3300046522 | Ga0495643_0008430 | Ga0495643_0008430_715_1566 | 283 |
| 506 | 3300046523 | Ga0495644_0003490 | Ga0495644_0003490_5027_5878 | 283 |
| 507 | 3300046524 | Ga0495648_0004415 | Ga0495648_0004415_9932_10783 | 283 |
| 508 | 3300046524 | Ga0495648_0073176 | Ga0495648_0073176_628_1479 | 283 |
| 509 | 3300046528 | Ga0495642_0000506 | Ga0495642_0000506_1274_2125 | 283 |
| 510 | 3300046530 | Ga0495654_0031806 | Ga0495654_0031806_489_1340 | 283 |
| 511 | 3300046530 | Ga0495654_0033304 | Ga0495654_0033304_538_1389 | 283 |
| 512 | 3300046536 | Ga0495587_0051964 | Ga0495587_0051964_508_1359 | 283 |
| 513 | 3300046538 | Ga0495609_0004832 | Ga0495609_0004832_1115_1966 | 283 |
| 514 | 3300046538 | Ga0495609_0092297 | Ga0495609_0092297_165_1016 | 283 |
| 515 | 3300046542 | Ga0495597_0049710 | Ga0495597_0049710_676_1527 | 283 |
| 516 | 3300046557 | Ga0495622_0044666 | Ga0495622_0044666_610_1461 | 283 |
| 517 | 3300046616 | Ga0495668_0050697 | Ga0495668_0050697_1258_2109 | 283 |
| 518 | 3300046616 | Ga0495668_0096456 | Ga0495668_0096456_441_1292 | 283 |
| 519 | 3300046642 | Ga0495634_0010361 | Ga0495634_0010361_935_1786 | 283 |
| 520 | 3300046648 | Ga0495611_0019423 | Ga0495611_0019423_488_1339 | 283 |
| 521 | 3300046648 | Ga0495611_0084838 | Ga0495611_0084838_592_1443 | 283 |
| 522 | 3300046660 | Ga0495625_0175066 | Ga0495625_0175066_237_1088 | 283 |
| 523 | 3300046663 | Ga0495635_0086663 | Ga0495635_0086663_835_1692 | 283 |
| 524 | 3300046665 | Ga0495661_0003926 | Ga0495661_0003926_6691_7542 | 283 |
| 525 | 3300046665 | Ga0495661_0064341 | Ga0495661_0064341_786_1637 | 283 |
| 526 | 3300046674 | Ga0495588_0018140 | Ga0495588_0018140_1921_2772 | 283 |
| 527 | 3300046684 | Ga0495669_0003637 | Ga0495669_0003637_459_1310 | 283 |
| 528 | 3300046689 | Ga0495613_0012226 | Ga0495613_0012226_5019_5870 | 283 |
| 529 | 3300046689 | Ga0495613_0048129 | Ga0495613_0048129_1157_2008 | 283 |
| 530 | 3300046690 | Ga0495624_0001882 | Ga0495624_0001882_13897_14748 | 283 |
| 531 | 3300046691 | Ga0495670_0000709 | Ga0495670_0000709_1158_2009 | 283 |
| 532 | 3300046692 | Ga0495671_0005900 | Ga0495671_0005900_1195_2046 | 283 |
| 533 | 3300046692 | Ga0495671_0021664 | Ga0495671_0021664_490_1341 | 283 |
| 534 | 3300046692 | Ga0495671_0032052 | Ga0495671_0032052_1125_1976 | 283 |
| 535 | 3300046694 | Ga0495649_0008096 | Ga0495649_0008096_668_1519 | 283 |
| 536 | 3300046694 | Ga0495649_0009798 | Ga0495649_0009798_4345_5196 | 283 |
| 537 | 3300046694 | Ga0495649_0037996 | Ga0495649_0037996_1633_2484 | 283 |
| 538 | 3300046794 | Ga0495589_0008973 | Ga0495589_0008973_4193_5044 | 283 |
| 539 | 3300046810 | Ga0495660_0011063 | Ga0495660_0011063_3206_4057 | 283 |
| 540 | 3300046810 | Ga0495660_0084381 | Ga0495660_0084381_435_1286 | 283 |
| 541 | 3300047317 | Ga0495604_0015482 | Ga0495604_0015482_1157_2008 | 283 |
| 542 | 3300047320 | Ga0495672_0002676 | Ga0495672_0002676_1263_2114 | 283 |
| 543 | 3300047320 | Ga0495672_0003814 | Ga0495672_0003814_1266_2117 | 283 |
| 544 | 3300047321 | Ga0495676_0004271 | Ga0495676_0004271_685_1536 | 283 |
| 545 | 3300047323 | Ga0495683_0040156 | Ga0495683_0040156_621_1472 | 283 |
| 546 | 3300047323 | Ga0495683_0040907 | Ga0495683_0040907_510_1361 | 283 |
| 547 | 3300047323 | Ga0495683_0082517 | Ga0495683_0082517_115_966 | 283 |
| 548 | 3300047446 | Ga0495679_004059 | Ga0495679_004059_5331_6182 | 283 |
| 549 | 3300047446 | Ga0495679_018686 | Ga0495679_018686_1027_1878 | 283 |
| 550 | 3300047469 | Ga0495673_0001179 | Ga0495673_0001179_8695_9546 | 283 |
| 551 | 3300047469 | Ga0495673_0002223 | Ga0495673_0002223_8742_9593 | 283 |
| 552 | 3300047469 | Ga0495673_0031248 | Ga0495673_0031248_617_1468 | 283 |
| 553 | 3300047469 | Ga0495673_0047147 | Ga0495673_0047147_815_1666 | 283 |
| 554 | 3300047470 | Ga0495681_0000536 | Ga0495681_0000536_10971_11822 | 283 |
| 555 | 3300047470 | Ga0495681_0001815 | Ga0495681_0001815_13890_14741 | 283 |
| 556 | 3300048091 | Ga0495626_0005902 | Ga0495626_0005902_1092_1943 | 283 |
| 557 | 3300048903 | Ga0496100_0102358 | Ga0496100_0102358_736_1587 | 283 |
| 558 | 3300048906 | Ga0496103_0102586 | Ga0496103_0102586_236_1087 | 283 |
| 559 | 3300048913 | Ga0496110_0006365 | Ga0496110_0006365_464_1315 | 283 |
| 560 | 3300048919 | Ga0496116_0003029 | Ga0496116_0003029_4642_5493 | 283 |
| 561 | 3300048919 | Ga0496116_0004538 | Ga0496116_0004538_1236_2087 | 283 |
| 562 | 3300048919 | Ga0496116_0013152 | Ga0496116_0013152_5229_6080 | 283 |
| 563 | 3300048919 | Ga0496116_0149135 | Ga0496116_0149135_224_1075 | 283 |
| 564 | 3300048920 | Ga0496117_0015909 | Ga0496117_0015909_568_1419 | 283 |
| 565 | 3300048920 | Ga0496117_0016327 | Ga0496117_0016327_464_1315 | 283 |
| 566 | 3300048920 | Ga0496117_0042483 | Ga0496117_0042483_1065_1916 | 283 |
| 567 | 3300048920 | Ga0496117_0042485 | Ga0496117_0042485_1401_2252 | 283 |
| 568 | 3300048921 | Ga0496118_0018025 | Ga0496118_0018025_581_1432 | 283 |
| 569 | 3300048921 | Ga0496118_0072065 | Ga0496118_0072065_53_904 | 283 |
| 570 | 3300048921 | Ga0496118_0091257 | Ga0496118_0091257_197_1048 | 283 |
| 571 | 3300048921 | Ga0496118_0108002 | Ga0496118_0108002_953_1804 | 283 |
| 572 | 3300048921 | Ga0496118_0138970 | Ga0496118_0138970_223_1074 | 283 |
| 573 | 3300048922 | Ga0496119_0013863 | Ga0496119_0013863_4898_5749 | 283 |
| 574 | 3300048922 | Ga0496119_0014255 | Ga0496119_0014255_492_1343 | 283 |
| 575 | 3300048923 | Ga0496120_0063200 | Ga0496120_0063200_25_876 | 283 |
| 576 | 3300048923 | Ga0496120_0108804 | Ga0496120_0108804_385_1236 | 283 |
| 577 | 3300048924 | Ga0496121_0018103 | Ga0496121_0018103_5137_5988 | 283 |
| 578 | 3300048924 | Ga0496121_0104954 | Ga0496121_0104954_727_1578 | 283 |
| 579 | 3300048924 | Ga0496121_0158374 | Ga0496121_0158374_224_1075 | 283 |
| 580 | 3300048924 | Ga0496121_0174369 | Ga0496121_0174369_224_1075 | 283 |
| 581 | 3300048925 | Ga0496122_0018845 | Ga0496122_0018845_284_1135 | 283 |
| 582 | 3300048925 | Ga0496122_0019180 | Ga0496122_0019180_471_1322 | 283 |
| 583 | 3300048926 | Ga0496123_0005883 | Ga0496123_0005883_9548_10402 | 283 |
| 584 | 3300048926 | Ga0496123_0098019 | Ga0496123_0098019_585_1436 | 283 |
| 585 | 3300048927 | Ga0496124_0010228 | Ga0496124_0010228_8082_8933 | 283 |
| 586 | 3300048927 | Ga0496124_0102260 | Ga0496124_0102260_460_1311 | 283 |
| 587 | 3300048927 | Ga0496124_0162257 | Ga0496124_0162257_583_1434 | 283 |
| 588 | 3300048927 | Ga0496124_0185723 | Ga0496124_0185723_438_1289 | 283 |
| 589 | 3300048928 | Ga0496125_0012895 | Ga0496125_0012895_4210_5061 | 283 |
| 590 | 3300048928 | Ga0496125_0087911 | Ga0496125_0087911_364_1215 | 283 |
| 591 | 3300048929 | Ga0496126_0167695 | Ga0496126_0167695_375_1226 | 283 |
| 592 | 3300049459 | Ga0495678_041489 | Ga0495678_041489_343_1194 | 283 |
| 593 | 3300049460 | Ga0495682_0003811 | Ga0495682_0003811_722_1573 | 283 |
| 594 | 3300049460 | Ga0495682_0041754 | Ga0495682_0041754_492_1343 | 283 |
| 595 | 3300049766 | Ga0501269_002850 | Ga0501269_002850_119_970 | 283 |
| 596 | 3300050489 | nmdc:mga03683_111520_c1 | nmdc:mga03683_111520_c1_35_886 | 283 |
| 597 | 3300050491 | nmdc:mga00v17_147598_c1 | nmdc:mga00v17_147598_c1_343_1194 | 283 |
| 598 | 3300050491 | nmdc:mga00v17_153323_c1 | nmdc:mga00v17_153323_c1_256_1107 | 283 |
| 599 | 3300050514 | nmdc:mga08x19_70088_c1 | nmdc:mga08x19_70088_c1_1032_1883 | 283 |
| 600 | 3300050516 | nmdc:mga0sz30_6379_c1 | nmdc:mga0sz30_6379_c1_3140_3991 | 283 |
| 601 | iso_pu_bacteria | 8054929484 | 8054931023 | 283 |
| 602 | 2162886007 | SwRhRL2b_contig_2050723 | SwRhRL2b_0917.00001790 | 284 |
| 603 | 3300005289 | Ga0065704_10070547 | Ga0065704_1007054711 | 284 |
| 604 | 3300013100 | Ga0157373_10013196 | Ga0157373_100131962 | 284 |
| 605 | 3300013100 | Ga0157373_10014392 | Ga0157373_100143922 | 284 |
| 606 | 3300013102 | Ga0157371_10003491 | Ga0157371_1000349112 | 284 |
| 607 | 3300013105 | Ga0157369_10030650 | Ga0157369_100306504 | 284 |
| 608 | 3300013306 | Ga0163162_10001271 | Ga0163162_1000127116 | 284 |
| 609 | 3300015261 | Ga0182006_1002669 | Ga0182006_10026697 | 284 |
| 610 | 3300015265 | Ga0182005_1003396 | Ga0182005_10033962 | 284 |
| 611 | 3300017792 | Ga0163161_10015126 | Ga0163161_100151265 | 284 |
| 612 | 3300025303 | Ga0209051_1047940 | Ga0209051_10479402 | 284 |
| 613 | 3300031548 | Ga0307408_100021941 | Ga0307408_1000219414 | 284 |
| 614 | 3300031711 | Ga0265314_10010534 | Ga0265314_100105345 | 284 |
| 615 | 3300041405 | Ga0439438_000562 | Ga0439438_000562_6731_7588 | 284 |
| 616 | 3300042004 | Ga0439445_0013812 | Ga0439445_0013812_585_1442 | 284 |
| 617 | 3300042006 | Ga0439432_014115 | Ga0439432_014115_207_1064 | 284 |
| 618 | 3300042009 | Ga0439451_007124 | Ga0439451_007124_440_1297 | 284 |
| 619 | 3300042010 | Ga0439452_002656 | Ga0439452_002656_4470_5327 | 284 |
| 620 | 3300042016 | Ga0439463_006040 | Ga0439463_006040_271_1128 | 284 |
| 621 | 3300042138 | Ga0450903_004423 | Ga0450903_004423_289_1146 | 284 |
| 622 | 3300046453 | Ga0495627_004102 | Ga0495627_004102_4127_4984 | 284 |
| 623 | 3300046458 | Ga0495591_001411 | Ga0495591_001411_12860_13717 | 284 |
| 624 | 3300046463 | Ga0495653_0015400 | Ga0495653_0015400_1248_2105 | 284 |
| 625 | 3300046474 | Ga0495605_0007807 | Ga0495605_0007807_1068_1925 | 284 |
| 626 | 3300046491 | Ga0495584_0010843 | Ga0495584_0010843_507_1364 | 284 |
| 627 | 3300046492 | Ga0495585_0013045 | Ga0495585_0013045_627_1484 | 284 |
| 628 | 3300046501 | Ga0495607_0012597 | Ga0495607_0012597_3892_4749 | 284 |
| 629 | 3300046513 | Ga0495616_0001708 | Ga0495616_0001708_12857_13714 | 284 |
| 630 | 3300046515 | Ga0495620_0008361 | Ga0495620_0008361_623_1480 | 284 |
| 631 | 3300046515 | Ga0495620_0036333 | Ga0495620_0036333_828_1685 | 284 |
| 632 | 3300046519 | Ga0495632_0034404 | Ga0495632_0034404_827_1684 | 284 |
| 633 | 3300046520 | Ga0495637_0070533 | Ga0495637_0070533_232_1089 | 284 |
| 634 | 3300046524 | Ga0495648_0017162 | Ga0495648_0017162_189_1046 | 284 |
| 635 | 3300046530 | Ga0495654_0000663 | Ga0495654_0000663_12882_13739 | 284 |
| 636 | 3300046538 | Ga0495609_0029567 | Ga0495609_0029567_1052_1909 | 284 |
| 637 | 3300046660 | Ga0495625_0014674 | Ga0495625_0014674_1262_2119 | 284 |
| 638 | 3300046660 | Ga0495625_0090300 | Ga0495625_0090300_289_1146 | 284 |
| 639 | 3300046692 | Ga0495671_0020650 | Ga0495671_0020650_948_1805 | 284 |
| 640 | 3300046694 | Ga0495649_0002234 | Ga0495649_0002234_12847_13704 | 284 |
| 641 | 3300046810 | Ga0495660_0007978 | Ga0495660_0007978_1263_2120 | 284 |
| 642 | 3300046810 | Ga0495660_0051280 | Ga0495660_0051280_1254_2111 | 284 |
| 643 | 3300047323 | Ga0495683_0028039 | Ga0495683_0028039_1389_2246 | 284 |
| 644 | 3300047446 | Ga0495679_004736 | Ga0495679_004736_1216_2073 | 284 |
| 645 | 3300047469 | Ga0495673_0002001 | Ga0495673_0002001_12857_13714 | 284 |
| 646 | 3300047472 | Ga0495686_0004152 | Ga0495686_0004152_9974_10831 | 284 |
| 647 | 3300048091 | Ga0495626_0002531 | Ga0495626_0002531_1254_2111 | 284 |
| 648 | 3300048091 | Ga0495626_0008233 | Ga0495626_0008233_807_1664 | 284 |
| 649 | 3300048920 | Ga0496117_0001815 | Ga0496117_0001815_11620_12495 | 284 |
| 650 | 3300048921 | Ga0496118_0002174 | Ga0496118_0002174_9899_10774 | 284 |
| 651 | 3300048924 | Ga0496121_0002497 | Ga0496121_0002497_16519_17394 | 284 |
| 652 | 3300048927 | Ga0496124_0004905 | Ga0496124_0004905_6019_6894 | 284 |
| 653 | 3300048928 | Ga0496125_0007915 | Ga0496125_0007915_7793_8668 | 284 |
| 654 | 3300048929 | Ga0496126_0002379 | Ga0496126_0002379_8355_9230 | 284 |
| 655 | 3300049459 | Ga0495678_002317 | Ga0495678_002317_2296_3153 | 284 |
| 656 | 3300049459 | Ga0495678_004804 | Ga0495678_004804_4114_4971 | 284 |
| 657 | 3300049459 | Ga0495678_008179 | Ga0495678_008179_4092_4949 | 284 |
| 658 | 3300049459 | Ga0495678_057442 | Ga0495678_057442_96_953 | 284 |
| 659 | 3300049758 | Ga0501241_000864 | Ga0501241_000864_4751_5608 | 284 |
| 660 | iso_pu_bacteria | 2511231006 | 2511263984 | 284 |
| 661 | iso_pu_bacteria | 2512047018 | 2512324956 | 284 |
| 662 | iso_pu_bacteria | 2582580891 | 2583791081 | 284 |
| 663 | iso_pu_bacteria | 2597489887 | 2597856774 | 284 |
| 664 | iso_pu_bacteria | 2599185185 | 2599483797 | 284 |
| 665 | iso_pu_bacteria | 2599185257 | 2599801443 | 284 |
| 666 | iso_pu_bacteria | 2600254931 | 2600365744 | 284 |
| 667 | iso_pu_bacteria | 2671180172 | 2671768392 | 284 |
| 668 | iso_pu_bacteria | 2740892503 | 2743736202 | 284 |
| 669 | iso_pu_bacteria | 2844665904 | 2844669106 | 284 |
| 670 | iso_pu_bacteria | 2923153595 | 2923155216 | 284 |
| 671 | iso_pu_bacteria | 8015687852 | 8015689437 | 284 |
| 672 | iso_pu_bacteria | 8019769354 | 8019774155 | 284 |
| 673 | iso_pu_bacteria | 8055770955 | 8055772571 | 284 |
| 674 | iso_pu_bacteria | 8057798959 | 8057798999 | 284 |
| 675 | 2124908027 | MRS2a_Contig_523 | MRS2a_00404000 | 285 |
| 676 | 2124908027 | MRS2a_Contig_9 | MRS2a_00742050 | 285 |
| 677 | 2162886011 | MRS1b_contig_3223266 | MRS1b_0426.00000200 | 285 |
| 678 | 3300002737 | JGI25162J39368_1000037 | JGI25162J39368_100003793 | 285 |
| 679 | 3300002771 | JGI25163J39215_1000160 | JGI25163J39215_100016012 | 285 |
| 680 | 3300002772 | JGI25164J39214_1000020 | JGI25164J39214_100002093 | 285 |
| 681 | 3300003214 | JGI25165J46597_1000077 | JGI25165J46597_100007793 | 285 |
| 682 | 3300003781 | Ga0055536_1000041 | Ga0055536_10000415 | 285 |
| 683 | 3300003781 | Ga0055536_1000042 | Ga0055536_100004245 | 285 |
| 684 | 3300003791 | Ga0055530_10000063 | Ga0055530_1000006374 | 285 |
| 685 | 3300003792 | Ga0055540_1000604 | Ga0055540_100060415 | 285 |
| 686 | 3300005288 | Ga0065714_10000129 | Ga0065714_100001296 | 285 |
| 687 | 3300005288 | Ga0065714_10004405 | Ga0065714_100044052 | 285 |
| 688 | 3300005288 | Ga0065714_10004572 | Ga0065714_100045725 | 285 |
| 689 | 3300005290 | Ga0065712_10000532 | Ga0065712_100005329 | 285 |
| 690 | 3300005293 | Ga0065715_10005656 | Ga0065715_100056564 | 285 |
| 691 | 3300009011 | Ga0105251_10000060 | Ga0105251_1000006017 | 285 |
| 692 | 3300009011 | Ga0105251_10000630 | Ga0105251_1000063019 | 285 |
| 693 | 3300009011 | Ga0105251_10002026 | Ga0105251_100020266 | 285 |
| 694 | 3300009011 | Ga0105251_10004603 | Ga0105251_100046034 | 285 |
| 695 | 3300009011 | Ga0105251_10014831 | Ga0105251_100148313 | 285 |
| 696 | 3300009011 | Ga0105251_10039338 | Ga0105251_100393382 | 285 |
| 697 | 3300009036 | Ga0105244_10002159 | Ga0105244_100021594 | 285 |
| 698 | 3300009036 | Ga0105244_10002763 | Ga0105244_100027638 | 285 |
| 699 | 3300009036 | Ga0105244_10004488 | Ga0105244_100044886 | 285 |
| 700 | 3300009092 | Ga0105250_10000979 | Ga0105250_100009795 | 285 |
| 701 | 3300009092 | Ga0105250_10002986 | Ga0105250_100029862 | 285 |
| 702 | 3300013100 | Ga0157373_10001457 | Ga0157373_1000145710 | 285 |
| 703 | 3300013102 | Ga0157371_10002880 | Ga0157371_100028806 | 285 |
| 704 | 3300013102 | Ga0157371_10020080 | Ga0157371_100200802 | 285 |
| 705 | 3300013104 | Ga0157370_10004442 | Ga0157370_100044428 | 285 |
| 706 | 3300013104 | Ga0157370_10086299 | Ga0157370_100862992 | 285 |
| 707 | 3300013306 | Ga0163162_10018673 | Ga0163162_100186735 | 285 |
| 708 | 3300013306 | Ga0163162_10074928 | Ga0163162_100749284 | 285 |
| 709 | 3300013308 | Ga0157375_10010475 | Ga0157375_100104754 | 285 |
| 710 | 3300013308 | Ga0157375_10738008 | Ga0157375_107380082 | 285 |
| 711 | 3300014497 | Ga0182008_10002027 | Ga0182008_100020277 | 285 |
| 712 | 3300014497 | Ga0182008_10004747 | Ga0182008_100047472 | 285 |
| 713 | 3300015261 | Ga0182006_1001020 | Ga0182006_10010205 | 285 |
| 714 | 3300015262 | Ga0182007_10000729 | Ga0182007_100007295 | 285 |
| 715 | 3300015265 | Ga0182005_1003133 | Ga0182005_10031333 | 285 |
| 716 | 3300015265 | Ga0182005_1018428 | Ga0182005_10184282 | 285 |
| 717 | 3300015265 | Ga0182005_1022877 | Ga0182005_10228772 | 285 |
| 718 | 3300015265 | Ga0182005_1023064 | Ga0182005_10230642 | 285 |
| 719 | 3300017792 | Ga0163161_10002333 | Ga0163161_100023337 | 285 |
| 720 | 3300025207 | Ga0209760_100053 | Ga0209760_10005375 | 285 |
| 721 | 3300025231 | Ga0207427_100001 | Ga0207427_100001863 | 285 |
| 722 | 3300025233 | Ga0209437_100003 | Ga0209437_100003509 | 285 |
| 723 | 3300025261 | Ga0209233_1000007 | Ga0209233_1000007863 | 285 |
| 724 | 3300025292 | Ga0209676_1000021 | Ga0209676_1000021163 | 285 |
| 725 | 3300025298 | Ga0209050_1000107 | Ga0209050_1000107162 | 285 |
| 726 | 3300025303 | Ga0209051_1000474 | Ga0209051_10004748 | 285 |
| 727 | 3300025711 | Ga0207696_1000818 | Ga0207696_10008188 | 285 |
| 728 | 3300025711 | Ga0207696_1002197 | Ga0207696_10021976 | 285 |
| 729 | 3300025728 | Ga0207655_1001937 | Ga0207655_10019376 | 285 |
| 730 | 3300025728 | Ga0207655_1002976 | Ga0207655_10029764 | 285 |
| 731 | 3300025728 | Ga0207655_1008548 | Ga0207655_10085486 | 285 |
| 732 | 3300025735 | Ga0207713_1000150 | Ga0207713_100015083 | 285 |
| 733 | 3300025735 | Ga0207713_1005386 | Ga0207713_10053866 | 285 |
| 734 | 3300025735 | Ga0207713_1006998 | Ga0207713_10069986 | 285 |
| 735 | 3300027111 | Ga0209281_1004437 | Ga0209281_10044374 | 285 |
| 736 | 3300030744 | Ga0316181_1060393 | Ga0316181_10603932 | 285 |
| 737 | 3300031548 | Ga0307408_100002045 | Ga0307408_1000020457 | 285 |
| 738 | 3300031548 | Ga0307408_100295151 | Ga0307408_1002951512 | 285 |
| 739 | 3300031731 | Ga0307405_10001772 | Ga0307405_100017725 | 285 |
| 740 | 3300031824 | Ga0307413_10022187 | Ga0307413_100221872 | 285 |
| 741 | 3300031901 | Ga0307406_10002886 | Ga0307406_100028864 | 285 |
| 742 | 3300031911 | Ga0307412_10001193 | Ga0307412_100011935 | 285 |
| 743 | 3300031911 | Ga0307412_10003158 | Ga0307412_100031585 | 285 |
| 744 | 3300032002 | Ga0307416_100070403 | Ga0307416_1000704033 | 285 |
| 745 | 3300032005 | Ga0307411_10005587 | Ga0307411_100055875 | 285 |
| 746 | 3300041405 | Ga0439438_000735 | Ga0439438_000735_10963_11835 | 285 |
| 747 | 3300041405 | Ga0439438_000802 | Ga0439438_000802_5856_6734 | 285 |
| 748 | 3300041405 | Ga0439438_010537 | Ga0439438_010537_1863_2720 | 285 |
| 749 | 3300041407 | Ga0439447_000425 | Ga0439447_000425_6867_7724 | 285 |
| 750 | 3300041407 | Ga0439447_002399 | Ga0439447_002399_5248_6105 | 285 |
| 751 | 3300041407 | Ga0439447_009600 | Ga0439447_009600_715_1572 | 285 |
| 752 | 3300041411 | Ga0439466_0000563 | Ga0439466_0000563_2541_3398 | 285 |
| 753 | 3300041411 | Ga0439466_0000841 | Ga0439466_0000841_8421_9278 | 285 |
| 754 | 3300041411 | Ga0439466_0012552 | Ga0439466_0012552_1426_2283 | 285 |
| 755 | 3300041411 | Ga0439466_0013241 | Ga0439466_0013241_1788_2645 | 285 |
| 756 | 3300041413 | Ga0439465_0011279 | Ga0439465_0011279_1401_2258 | 285 |
| 757 | 3300042006 | Ga0439432_001707 | Ga0439432_001707_5952_6809 | 285 |
| 758 | 3300042006 | Ga0439432_011449 | Ga0439432_011449_339_1196 | 285 |
| 759 | 3300042006 | Ga0439432_031711 | Ga0439432_031711_24_896 | 285 |
| 760 | 3300042009 | Ga0439451_000102 | Ga0439451_000102_9276_10133 | 285 |
| 761 | 3300042009 | Ga0439451_000661 | Ga0439451_000661_4993_5850 | 285 |
| 762 | 3300042009 | Ga0439451_002603 | Ga0439451_002603_2024_2881 | 285 |
| 763 | 3300042009 | Ga0439451_038558 | Ga0439451_038558_39_896 | 285 |
| 764 | 3300042010 | Ga0439452_001509 | Ga0439452_001509_7436_8293 | 285 |
| 765 | 3300042010 | Ga0439452_006238 | Ga0439452_006238_55_912 | 285 |
| 766 | 3300042010 | Ga0439452_007239 | Ga0439452_007239_1234_2091 | 285 |
| 767 | 3300042013 | Ga0439456_000497 | Ga0439456_000497_5303_6160 | 285 |
| 768 | 3300042013 | Ga0439456_000503 | Ga0439456_000503_663_1535 | 285 |
| 769 | 3300042013 | Ga0439456_001748 | Ga0439456_001748_2496_3353 | 285 |
| 770 | 3300042013 | Ga0439456_005305 | Ga0439456_005305_1469_2326 | 285 |
| 771 | 3300042013 | Ga0439456_037794 | Ga0439456_037794_80_937 | 285 |
| 772 | 3300042016 | Ga0439463_000413 | Ga0439463_000413_663_1529 | 285 |
| 773 | 3300042016 | Ga0439463_002586 | Ga0439463_002586_3502_4374 | 285 |
| 774 | 3300042016 | Ga0439463_036985 | Ga0439463_036985_183_1040 | 285 |
| 775 | 3300042115 | Ga0450911_000142 | Ga0450911_000142_14409_15281 | 285 |
| 776 | 3300042115 | Ga0450911_001259 | Ga0450911_001259_541_1398 | 285 |
| 777 | 3300042115 | Ga0450911_004427 | Ga0450911_004427_425_1285 | 285 |
| 778 | 3300042127 | Ga0450890_000374 | Ga0450890_000374_5081_5938 | 285 |
| 779 | 3300042129 | Ga0450891_000894 | Ga0450891_000894_883_1740 | 285 |
| 780 | 3300042136 | Ga0450900_000041 | Ga0450900_000041_1148_2020 | 285 |
| 781 | 3300042137 | Ga0450902_002552 | Ga0450902_002552_1434_2306 | 285 |
| 782 | 3300042137 | Ga0450902_006507 | Ga0450902_006507_387_1244 | 285 |
| 783 | 3300042138 | Ga0450903_007371 | Ga0450903_007371_669_1541 | 285 |
| 784 | 3300042138 | Ga0450903_012148 | Ga0450903_012148_182_1039 | 285 |
| 785 | 3300042146 | Ga0450907_006358 | Ga0450907_006358_473_1330 | 285 |
| 786 | 3300042146 | Ga0450907_010806 | Ga0450907_010806_209_1066 | 285 |
| 787 | 3300042147 | Ga0450910_003111 | Ga0450910_003111_677_1534 | 285 |
| 788 | 3300042156 | Ga0439446_0002357 | Ga0439446_0002357_602_1459 | 285 |
| 789 | 3300042184 | Ga0450908_002485 | Ga0450908_002485_771_1628 | 285 |
| 790 | 3300042185 | Ga0450909_000239 | Ga0450909_000239_5632_6489 | 285 |
| 791 | 3300042435 | Ga0439434_0015160 | Ga0439434_0015160_397_1254 | 285 |
| 792 | 3300042439 | Ga0439464_0016065 | Ga0439464_0016065_436_1293 | 285 |
| 793 | 3300042461 | Ga0439460_0001455 | Ga0439460_0001455_3221_4078 | 285 |
| 794 | 3300042461 | Ga0439460_0001896 | Ga0439460_0001896_1602_2459 | 285 |
| 795 | 3300042531 | Ga0450918_004793 | Ga0450918_004793_896_1768 | 285 |
| 796 | 3300042532 | Ga0450893_0003582 | Ga0450893_0003582_765_1637 | 285 |
| 797 | 3300042993 | Ga0439440_0017354 | Ga0439440_0017354_348_1205 | 285 |
| 798 | 3300046452 | Ga0495617_000328 | Ga0495617_000328_13984_14856 | 285 |
| 799 | 3300046452 | Ga0495617_010227 | Ga0495617_010227_577_1434 | 285 |
| 800 | 3300046453 | Ga0495627_003513 | Ga0495627_003513_5642_6520 | 285 |
| 801 | 3300046453 | Ga0495627_004134 | Ga0495627_004134_911_1768 | 285 |
| 802 | 3300046453 | Ga0495627_010317 | Ga0495627_010317_2044_2901 | 285 |
| 803 | 3300046453 | Ga0495627_030443 | Ga0495627_030443_333_1190 | 285 |
| 804 | 3300046455 | Ga0495603_0000519 | Ga0495603_0000519_10284_11141 | 285 |
| 805 | 3300046455 | Ga0495603_0007925 | Ga0495603_0007925_1930_2787 | 285 |
| 806 | 3300046457 | Ga0495590_0002661 | Ga0495590_0002661_1547_2404 | 285 |
| 807 | 3300046457 | Ga0495590_0029613 | Ga0495590_0029613_308_1165 | 285 |
| 808 | 3300046458 | Ga0495591_000256 | Ga0495591_000256_13135_14001 | 285 |
| 809 | 3300046458 | Ga0495591_003670 | Ga0495591_003670_1759_2616 | 285 |
| 810 | 3300046458 | Ga0495591_044566 | Ga0495591_044566_62_919 | 285 |
| 811 | 3300046459 | Ga0495629_0005998 | Ga0495629_0005998_6655_7512 | 285 |
| 812 | 3300046459 | Ga0495629_0130859 | Ga0495629_0130859_617_1474 | 285 |
| 813 | 3300046460 | Ga0495638_0008730 | Ga0495638_0008730_814_1671 | 285 |
| 814 | 3300046460 | Ga0495638_0044050 | Ga0495638_0044050_479_1336 | 285 |
| 815 | 3300046460 | Ga0495638_0181745 | Ga0495638_0181745_303_1160 | 285 |
| 816 | 3300046463 | Ga0495653_0005114 | Ga0495653_0005114_4295_5152 | 285 |
| 817 | 3300046463 | Ga0495653_0030146 | Ga0495653_0030146_840_1697 | 285 |
| 818 | 3300046471 | Ga0495650_0001778 | Ga0495650_0001778_7932_8789 | 285 |
| 819 | 3300046471 | Ga0495650_0005113 | Ga0495650_0005113_4375_5232 | 285 |
| 820 | 3300046471 | Ga0495650_0021962 | Ga0495650_0021962_1145_2017 | 285 |
| 821 | 3300046474 | Ga0495605_0000032 | Ga0495605_0000032_85852_86709 | 285 |
| 822 | 3300046474 | Ga0495605_0000857 | Ga0495605_0000857_1235_2092 | 285 |
| 823 | 3300046474 | Ga0495605_0001277 | Ga0495605_0001277_13267_14133 | 285 |
| 824 | 3300046474 | Ga0495605_0001888 | Ga0495605_0001888_7827_8684 | 285 |
| 825 | 3300046474 | Ga0495605_0002198 | Ga0495605_0002198_9047_9919 | 285 |
| 826 | 3300046474 | Ga0495605_0002521 | Ga0495605_0002521_4795_5652 | 285 |
| 827 | 3300046474 | Ga0495605_0006105 | Ga0495605_0006105_964_1821 | 285 |
| 828 | 3300046474 | Ga0495605_0018889 | Ga0495605_0018889_1823_2680 | 285 |
| 829 | 3300046474 | Ga0495605_0036323 | Ga0495605_0036323_379_1236 | 285 |
| 830 | 3300046474 | Ga0495605_0052299 | Ga0495605_0052299_23_880 | 285 |
| 831 | 3300046475 | Ga0495639_0000241 | Ga0495639_0000241_3656_4513 | 285 |
| 832 | 3300046475 | Ga0495639_0003322 | Ga0495639_0003322_546_1403 | 285 |
| 833 | 3300046477 | Ga0495664_0159173 | Ga0495664_0159173_419_1276 | 285 |
| 834 | 3300046491 | Ga0495584_0001923 | Ga0495584_0001923_4795_5652 | 285 |
| 835 | 3300046491 | Ga0495584_0002126 | Ga0495584_0002126_5191_6048 | 285 |
| 836 | 3300046491 | Ga0495584_0002304 | Ga0495584_0002304_4792_5649 | 285 |
| 837 | 3300046491 | Ga0495584_0003690 | Ga0495584_0003690_5401_6258 | 285 |
| 838 | 3300046492 | Ga0495585_0001287 | Ga0495585_0001287_13113_13970 | 285 |
| 839 | 3300046492 | Ga0495585_0009763 | Ga0495585_0009763_4128_4985 | 285 |
| 840 | 3300046499 | Ga0495594_0001279 | Ga0495594_0001279_449_1306 | 285 |
| 841 | 3300046499 | Ga0495594_0007038 | Ga0495594_0007038_92_949 | 285 |
| 842 | 3300046499 | Ga0495594_0037845 | Ga0495594_0037845_1131_1988 | 285 |
| 843 | 3300046499 | Ga0495594_0039263 | Ga0495594_0039263_1331_2188 | 285 |
| 844 | 3300046501 | Ga0495607_0001754 | Ga0495607_0001754_15375_16247 | 285 |
| 845 | 3300046501 | Ga0495607_0002115 | Ga0495607_0002115_11317_12183 | 285 |
| 846 | 3300046501 | Ga0495607_0003276 | Ga0495607_0003276_5068_5931 | 285 |
| 847 | 3300046501 | Ga0495607_0006139 | Ga0495607_0006139_602_1459 | 285 |
| 848 | 3300046501 | Ga0495607_0007248 | Ga0495607_0007248_4906_5763 | 285 |
| 849 | 3300046501 | Ga0495607_0008832 | Ga0495607_0008832_807_1664 | 285 |
| 850 | 3300046501 | Ga0495607_0009002 | Ga0495607_0009002_5171_6028 | 285 |
| 851 | 3300046501 | Ga0495607_0009800 | Ga0495607_0009800_570_1436 | 285 |
| 852 | 3300046501 | Ga0495607_0011881 | Ga0495607_0011881_1916_2782 | 285 |
| 853 | 3300046501 | Ga0495607_0025600 | Ga0495607_0025600_1286_2143 | 285 |
| 854 | 3300046506 | Ga0495583_0000052 | Ga0495583_0000052_86580_87437 | 285 |
| 855 | 3300046506 | Ga0495583_0001042 | Ga0495583_0001042_13712_14575 | 285 |
| 856 | 3300046506 | Ga0495583_0043477 | Ga0495583_0043477_326_1183 | 285 |
| 857 | 3300046506 | Ga0495583_0115354 | Ga0495583_0115354_221_1093 | 285 |
| 858 | 3300046507 | Ga0495606_0001451 | Ga0495606_0001451_13900_14757 | 285 |
| 859 | 3300046507 | Ga0495606_0013096 | Ga0495606_0013096_1415_2281 | 285 |
| 860 | 3300046507 | Ga0495606_0027499 | Ga0495606_0027499_2449_3306 | 285 |
| 861 | 3300046512 | Ga0495610_0031497 | Ga0495610_0031497_1869_2726 | 285 |
| 862 | 3300046512 | Ga0495610_0039683 | Ga0495610_0039683_1488_2345 | 285 |
| 863 | 3300046513 | Ga0495616_0002074 | Ga0495616_0002074_7817_8674 | 285 |
| 864 | 3300046513 | Ga0495616_0002254 | Ga0495616_0002254_830_1687 | 285 |
| 865 | 3300046513 | Ga0495616_0006526 | Ga0495616_0006526_3190_4047 | 285 |
| 866 | 3300046513 | Ga0495616_0018577 | Ga0495616_0018577_863_1720 | 285 |
| 867 | 3300046513 | Ga0495616_0019845 | Ga0495616_0019845_650_1507 | 285 |
| 868 | 3300046515 | Ga0495620_0000019 | Ga0495620_0000019_85895_86752 | 285 |
| 869 | 3300046515 | Ga0495620_0005406 | Ga0495620_0005406_1005_1862 | 285 |
| 870 | 3300046515 | Ga0495620_0040610 | Ga0495620_0040610_1052_1918 | 285 |
| 871 | 3300046517 | Ga0495630_0045820 | Ga0495630_0045820_1550_2407 | 285 |
| 872 | 3300046518 | Ga0495631_0002043 | Ga0495631_0002043_1020_1877 | 285 |
| 873 | 3300046518 | Ga0495631_0005944 | Ga0495631_0005944_4837_5694 | 285 |
| 874 | 3300046518 | Ga0495631_0031299 | Ga0495631_0031299_193_1050 | 285 |
| 875 | 3300046519 | Ga0495632_0001741 | Ga0495632_0001741_12465_13322 | 285 |
| 876 | 3300046519 | Ga0495632_0002607 | Ga0495632_0002607_1200_2057 | 285 |
| 877 | 3300046520 | Ga0495637_0000898 | Ga0495637_0000898_10555_11412 | 285 |
| 878 | 3300046520 | Ga0495637_0001294 | Ga0495637_0001294_1095_1952 | 285 |
| 879 | 3300046520 | Ga0495637_0005171 | Ga0495637_0005171_5146_6003 | 285 |
| 880 | 3300046520 | Ga0495637_0017508 | Ga0495637_0017508_1971_2828 | 285 |
| 881 | 3300046520 | Ga0495637_0019929 | Ga0495637_0019929_640_1497 | 285 |
| 882 | 3300046522 | Ga0495643_0002218 | Ga0495643_0002218_9831_10688 | 285 |
| 883 | 3300046522 | Ga0495643_0002334 | Ga0495643_0002334_9312_10169 | 285 |
| 884 | 3300046522 | Ga0495643_0002599 | Ga0495643_0002599_9604_10461 | 285 |
| 885 | 3300046522 | Ga0495643_0002768 | Ga0495643_0002768_10237_11109 | 285 |
| 886 | 3300046522 | Ga0495643_0058493 | Ga0495643_0058493_173_1030 | 285 |
| 887 | 3300046523 | Ga0495644_0002414 | Ga0495644_0002414_5161_6018 | 285 |
| 888 | 3300046523 | Ga0495644_0038159 | Ga0495644_0038159_944_1801 | 285 |
| 889 | 3300046523 | Ga0495644_0059060 | Ga0495644_0059060_117_974 | 285 |
| 890 | 3300046524 | Ga0495648_0002902 | Ga0495648_0002902_6822_7679 | 285 |
| 891 | 3300046524 | Ga0495648_0044124 | Ga0495648_0044124_540_1397 | 285 |
| 892 | 3300046524 | Ga0495648_0066505 | Ga0495648_0066505_744_1601 | 285 |
| 893 | 3300046524 | Ga0495648_0095192 | Ga0495648_0095192_170_1027 | 285 |
| 894 | 3300046524 | Ga0495648_0115944 | Ga0495648_0115944_226_1083 | 285 |
| 895 | 3300046526 | Ga0495666_0033192 | Ga0495666_0033192_1006_1863 | 285 |
| 896 | 3300046526 | Ga0495666_0046452 | Ga0495666_0046452_834_1691 | 285 |
| 897 | 3300046526 | Ga0495666_0069736 | Ga0495666_0069736_217_1074 | 285 |
| 898 | 3300046528 | Ga0495642_0000151 | Ga0495642_0000151_13210_14067 | 285 |
| 899 | 3300046528 | Ga0495642_0001115 | Ga0495642_0001115_1000_1857 | 285 |
| 900 | 3300046530 | Ga0495654_0000819 | Ga0495654_0000819_9213_10070 | 285 |
| 901 | 3300046530 | Ga0495654_0001683 | Ga0495654_0001683_5570_6442 | 285 |
| 902 | 3300046530 | Ga0495654_0087861 | Ga0495654_0087861_163_1020 | 285 |
| 903 | 3300046530 | Ga0495654_0110325 | Ga0495654_0110325_68_925 | 285 |
| 904 | 3300046536 | Ga0495587_0001556 | Ga0495587_0001556_14186_15043 | 285 |
| 905 | 3300046538 | Ga0495609_0000032 | Ga0495609_0000032_124458_125315 | 285 |
| 906 | 3300046538 | Ga0495609_0001044 | Ga0495609_0001044_8025_8888 | 285 |
| 907 | 3300046538 | Ga0495609_0001602 | Ga0495609_0001602_8014_8871 | 285 |
| 908 | 3300046538 | Ga0495609_0003586 | Ga0495609_0003586_2304_3176 | 285 |
| 909 | 3300046538 | Ga0495609_0011106 | Ga0495609_0011106_164_1021 | 285 |
| 910 | 3300046538 | Ga0495609_0019776 | Ga0495609_0019776_1196_2053 | 285 |
| 911 | 3300046538 | Ga0495609_0026373 | Ga0495609_0026373_598_1455 | 285 |
| 912 | 3300046542 | Ga0495597_0000852 | Ga0495597_0000852_14282_15139 | 285 |
| 913 | 3300046542 | Ga0495597_0003440 | Ga0495597_0003440_2770_3627 | 285 |
| 914 | 3300046542 | Ga0495597_0005741 | Ga0495597_0005741_760_1617 | 285 |
| 915 | 3300046542 | Ga0495597_0037447 | Ga0495597_0037447_610_1467 | 285 |
| 916 | 3300046557 | Ga0495622_0000294 | Ga0495622_0000294_21660_22517 | 285 |
| 917 | 3300046557 | Ga0495622_0000418 | Ga0495622_0000418_12270_13127 | 285 |
| 918 | 3300046557 | Ga0495622_0010785 | Ga0495622_0010785_290_1147 | 285 |
| 919 | 3300046558 | Ga0495633_0000040 | Ga0495633_0000040_90783_91640 | 285 |
| 920 | 3300046558 | Ga0495633_0003735 | Ga0495633_0003735_5183_6040 | 285 |
| 921 | 3300046558 | Ga0495633_0007547 | Ga0495633_0007547_559_1416 | 285 |
| 922 | 3300046558 | Ga0495633_0066898 | Ga0495633_0066898_262_1119 | 285 |
| 923 | 3300046615 | Ga0495656_0059671 | Ga0495656_0059671_226_1083 | 285 |
| 924 | 3300046642 | Ga0495634_0008936 | Ga0495634_0008936_5074_5931 | 285 |
| 925 | 3300046648 | Ga0495611_0003256 | Ga0495611_0003256_1088_1960 | 285 |
| 926 | 3300046648 | Ga0495611_0003539 | Ga0495611_0003539_1044_1901 | 285 |
| 927 | 3300046660 | Ga0495625_0017547 | Ga0495625_0017547_4082_4939 | 285 |
| 928 | 3300046660 | Ga0495625_0058085 | Ga0495625_0058085_520_1377 | 285 |
| 929 | 3300046660 | Ga0495625_0058410 | Ga0495625_0058410_657_1514 | 285 |
| 930 | 3300046660 | Ga0495625_0101294 | Ga0495625_0101294_545_1402 | 285 |
| 931 | 3300046664 | Ga0495659_0000883 | Ga0495659_0000883_4606_5463 | 285 |
| 932 | 3300046664 | Ga0495659_0032182 | Ga0495659_0032182_628_1485 | 285 |
| 933 | 3300046664 | Ga0495659_0035335 | Ga0495659_0035335_77_949 | 285 |
| 934 | 3300046665 | Ga0495661_0000037 | Ga0495661_0000037_84633_85490 | 285 |
| 935 | 3300046665 | Ga0495661_0007526 | Ga0495661_0007526_1683_2540 | 285 |
| 936 | 3300046665 | Ga0495661_0011493 | Ga0495661_0011493_4764_5621 | 285 |
| 937 | 3300046665 | Ga0495661_0048213 | Ga0495661_0048213_476_1333 | 285 |
| 938 | 3300046665 | Ga0495661_0059485 | Ga0495661_0059485_637_1494 | 285 |
| 939 | 3300046674 | Ga0495588_0012636 | Ga0495588_0012636_2198_3055 | 285 |
| 940 | 3300046674 | Ga0495588_0102262 | Ga0495588_0102262_520_1377 | 285 |
| 941 | 3300046674 | Ga0495588_0133269 | Ga0495588_0133269_358_1215 | 285 |
| 942 | 3300046679 | Ga0495623_0009046 | Ga0495623_0009046_523_1380 | 285 |
| 943 | 3300046680 | Ga0495646_0000953 | Ga0495646_0000953_12580_13437 | 285 |
| 944 | 3300046680 | Ga0495646_0059661 | Ga0495646_0059661_103_960 | 285 |
| 945 | 3300046684 | Ga0495669_0001725 | Ga0495669_0001725_4955_5812 | 285 |
| 946 | 3300046689 | Ga0495613_0032289 | Ga0495613_0032289_2773_3630 | 285 |
| 947 | 3300046689 | Ga0495613_0066682 | Ga0495613_0066682_557_1414 | 285 |
| 948 | 3300046691 | Ga0495670_0004374 | Ga0495670_0004374_5449_6306 | 285 |
| 949 | 3300046691 | Ga0495670_0023737 | Ga0495670_0023737_1260_2117 | 285 |
| 950 | 3300046691 | Ga0495670_0032594 | Ga0495670_0032594_1142_1999 | 285 |
| 951 | 3300046691 | Ga0495670_0043751 | Ga0495670_0043751_610_1488 | 285 |
| 952 | 3300046691 | Ga0495670_0050965 | Ga0495670_0050965_1003_1860 | 285 |
| 953 | 3300046691 | Ga0495670_0065327 | Ga0495670_0065327_583_1455 | 285 |
| 954 | 3300046692 | Ga0495671_0001424 | Ga0495671_0001424_9966_10823 | 285 |
| 955 | 3300046692 | Ga0495671_0001841 | Ga0495671_0001841_7806_8663 | 285 |
| 956 | 3300046692 | Ga0495671_0002352 | Ga0495671_0002352_2274_3146 | 285 |
| 957 | 3300046692 | Ga0495671_0040679 | Ga0495671_0040679_1136_1993 | 285 |
| 958 | 3300046692 | Ga0495671_0115570 | Ga0495671_0115570_223_1080 | 285 |
| 959 | 3300046694 | Ga0495649_0002275 | Ga0495649_0002275_1260_2117 | 285 |
| 960 | 3300046694 | Ga0495649_0005634 | Ga0495649_0005634_963_1820 | 285 |
| 961 | 3300046694 | Ga0495649_0067181 | Ga0495649_0067181_1007_1879 | 285 |
| 962 | 3300046794 | Ga0495589_0000263 | Ga0495589_0000263_20246_21103 | 285 |
| 963 | 3300046794 | Ga0495589_0000858 | Ga0495589_0000858_9879_10736 | 285 |
| 964 | 3300046794 | Ga0495589_0002405 | Ga0495589_0002405_8684_9556 | 285 |
| 965 | 3300046794 | Ga0495589_0003745 | Ga0495589_0003745_274_1131 | 285 |
| 966 | 3300046794 | Ga0495589_0004393 | Ga0495589_0004393_1201_2058 | 285 |
| 967 | 3300046809 | Ga0495600_0018471 | Ga0495600_0018471_638_1495 | 285 |
| 968 | 3300046810 | Ga0495660_0002590 | Ga0495660_0002590_5486_6343 | 285 |
| 969 | 3300046810 | Ga0495660_0006354 | Ga0495660_0006354_5446_6303 | 285 |
| 970 | 3300046810 | Ga0495660_0016204 | Ga0495660_0016204_638_1495 | 285 |
| 971 | 3300046810 | Ga0495660_0038082 | Ga0495660_0038082_1162_2019 | 285 |
| 972 | 3300046810 | Ga0495660_0052074 | Ga0495660_0052074_870_1727 | 285 |
| 973 | 3300046810 | Ga0495660_0139464 | Ga0495660_0139464_164_1021 | 285 |
| 974 | 3300046810 | Ga0495660_0156035 | Ga0495660_0156035_228_1085 | 285 |
| 975 | 3300047315 | Ga0495581_0007326 | Ga0495581_0007326_5043_5900 | 285 |
| 976 | 3300047315 | Ga0495581_0022149 | Ga0495581_0022149_1249_2106 | 285 |
| 977 | 3300047317 | Ga0495604_0012312 | Ga0495604_0012312_684_1541 | 285 |
| 978 | 3300047317 | Ga0495604_0159090 | Ga0495604_0159090_32_889 | 285 |
| 979 | 3300047318 | Ga0495636_0000753 | Ga0495636_0000753_8662_9534 | 285 |
| 980 | 3300047318 | Ga0495636_0002077 | Ga0495636_0002077_5619_6476 | 285 |
| 981 | 3300047320 | Ga0495672_0001393 | Ga0495672_0001393_8662_9534 | 285 |
| 982 | 3300047320 | Ga0495672_0001568 | Ga0495672_0001568_14429_15286 | 285 |
| 983 | 3300047320 | Ga0495672_0003479 | Ga0495672_0003479_4792_5649 | 285 |
| 984 | 3300047320 | Ga0495672_0013933 | Ga0495672_0013933_847_1704 | 285 |
| 985 | 3300047322 | Ga0495680_0015919 | Ga0495680_0015919_4849_5706 | 285 |
| 986 | 3300047322 | Ga0495680_0022647 | Ga0495680_0022647_901_1758 | 285 |
| 987 | 3300047323 | Ga0495683_0000011 | Ga0495683_0000011_86743_87600 | 285 |
| 988 | 3300047323 | Ga0495683_0004075 | Ga0495683_0004075_2595_3452 | 285 |
| 989 | 3300047323 | Ga0495683_0005637 | Ga0495683_0005637_5013_5870 | 285 |
| 990 | 3300047323 | Ga0495683_0006421 | Ga0495683_0006421_5012_5869 | 285 |
| 991 | 3300047323 | Ga0495683_0031292 | Ga0495683_0031292_1149_2006 | 285 |
| 992 | 3300047443 | Ga0495687_002112 | Ga0495687_002112_759_1616 | 285 |
| 993 | 3300047443 | Ga0495687_008543 | Ga0495687_008543_79_936 | 285 |
| 994 | 3300047444 | Ga0495675_0013975 | Ga0495675_0013975_763_1620 | 285 |
| 995 | 3300047444 | Ga0495675_0014655 | Ga0495675_0014655_221_1078 | 285 |
| 996 | 3300047445 | Ga0495677_0000393 | Ga0495677_0000393_12168_13025 | 285 |
| 997 | 3300047446 | Ga0495679_000176 | Ga0495679_000176_27343_28200 | 285 |
| 998 | 3300047446 | Ga0495679_003695 | Ga0495679_003695_4885_5742 | 285 |
| 999 | 3300047447 | Ga0495685_001024 | Ga0495685_001024_4920_5777 | 285 |
| 1000 | 3300047447 | Ga0495685_025697 | Ga0495685_025697_890_1747 | 285 |
| 1001 | 3300047469 | Ga0495673_0001247 | Ga0495673_0001247_13508_14380 | 285 |
| 1002 | 3300047469 | Ga0495673_0006626 | Ga0495673_0006626_723_1580 | 285 |
| 1003 | 3300047469 | Ga0495673_0006858 | Ga0495673_0006858_4855_5721 | 285 |
| 1004 | 3300047469 | Ga0495673_0007482 | Ga0495673_0007482_510_1367 | 285 |
| 1005 | 3300047469 | Ga0495673_0007539 | Ga0495673_0007539_3065_3922 | 285 |
| 1006 | 3300047469 | Ga0495673_0023870 | Ga0495673_0023870_2053_2910 | 285 |
| 1007 | 3300047469 | Ga0495673_0059595 | Ga0495673_0059595_224_1081 | 285 |
| 1008 | 3300047470 | Ga0495681_0041658 | Ga0495681_0041658_292_1149 | 285 |
| 1009 | 3300047470 | Ga0495681_0052239 | Ga0495681_0052239_922_1779 | 285 |
| 1010 | 3300047470 | Ga0495681_0059785 | Ga0495681_0059785_64_921 | 285 |
| 1011 | 3300047673 | Ga0495593_0003966 | Ga0495593_0003966_1034_1891 | 285 |
| 1012 | 3300047673 | Ga0495593_0009549 | Ga0495593_0009549_2050_2907 | 285 |
| 1013 | 3300048091 | Ga0495626_0001557 | Ga0495626_0001557_11247_12104 | 285 |
| 1014 | 3300048091 | Ga0495626_0005293 | Ga0495626_0005293_3800_4657 | 285 |
| 1015 | 3300048091 | Ga0495626_0006059 | Ga0495626_0006059_1168_2040 | 285 |
| 1016 | 3300048091 | Ga0495626_0006581 | Ga0495626_0006581_648_1505 | 285 |
| 1017 | 3300048091 | Ga0495626_0025111 | Ga0495626_0025111_999_1856 | 285 |
| 1018 | 3300048091 | Ga0495626_0103881 | Ga0495626_0103881_117_974 | 285 |
| 1019 | 3300048904 | Ga0496101_0062377 | Ga0496101_0062377_1265_2137 | 285 |
| 1020 | 3300048905 | Ga0496102_0000604 | Ga0496102_0000604_5259_6116 | 285 |
| 1021 | 3300048905 | Ga0496102_0104440 | Ga0496102_0104440_1171_2037 | 285 |
| 1022 | 3300048906 | Ga0496103_0006912 | Ga0496103_0006912_851_1708 | 285 |
| 1023 | 3300048913 | Ga0496110_0014430 | Ga0496110_0014430_764_1621 | 285 |
| 1024 | 3300048913 | Ga0496110_0045914 | Ga0496110_0045914_2642_3511 | 285 |
| 1025 | 3300048913 | Ga0496110_0243113 | Ga0496110_0243113_551_1408 | 285 |
| 1026 | 3300048919 | Ga0496116_0013391 | Ga0496116_0013391_5043_5900 | 285 |
| 1027 | 3300048919 | Ga0496116_0076126 | Ga0496116_0076126_358_1215 | 285 |
| 1028 | 3300048920 | Ga0496117_0015165 | Ga0496117_0015165_5057_5914 | 285 |
| 1029 | 3300048921 | Ga0496118_0016288 | Ga0496118_0016288_874_1731 | 285 |
| 1030 | 3300048922 | Ga0496119_0071686 | Ga0496119_0071686_614_1471 | 285 |
| 1031 | 3300048924 | Ga0496121_0001008 | Ga0496121_0001008_31795_32667 | 285 |
| 1032 | 3300048924 | Ga0496121_0029665 | Ga0496121_0029665_3638_4495 | 285 |
| 1033 | 3300048924 | Ga0496121_0092180 | Ga0496121_0092180_836_1693 | 285 |
| 1034 | 3300048925 | Ga0496122_0000945 | Ga0496122_0000945_47303_48175 | 285 |
| 1035 | 3300048925 | Ga0496122_0180157 | Ga0496122_0180157_364_1221 | 285 |
| 1036 | 3300048926 | Ga0496123_0000888 | Ga0496123_0000888_4278_5150 | 285 |
| 1037 | 3300048926 | Ga0496123_0050801 | Ga0496123_0050801_1407_2264 | 285 |
| 1038 | 3300048927 | Ga0496124_0002611 | Ga0496124_0002611_17051_17920 | 285 |
| 1039 | 3300048927 | Ga0496124_0114546 | Ga0496124_0114546_795_1652 | 285 |
| 1040 | 3300048928 | Ga0496125_0005661 | Ga0496125_0005661_2913_3782 | 285 |
| 1041 | 3300048928 | Ga0496125_0018010 | Ga0496125_0018010_5086_5943 | 285 |
| 1042 | 3300048928 | Ga0496125_0061124 | Ga0496125_0061124_1529_2386 | 285 |
| 1043 | 3300048929 | Ga0496126_0133150 | Ga0496126_0133150_486_1343 | 285 |
| 1044 | 3300049459 | Ga0495678_000033 | Ga0495678_000033_125044_125901 | 285 |
| 1045 | 3300049459 | Ga0495678_002782 | Ga0495678_002782_5021_5878 | 285 |
| 1046 | 3300049459 | Ga0495678_003313 | Ga0495678_003313_4079_4936 | 285 |
| 1047 | 3300049459 | Ga0495678_005647 | Ga0495678_005647_680_1537 | 285 |
| 1048 | 3300049459 | Ga0495678_046636 | Ga0495678_046636_319_1176 | 285 |
| 1049 | 3300049460 | Ga0495682_0000072 | Ga0495682_0000072_48853_49719 | 285 |
| 1050 | 3300049460 | Ga0495682_0001293 | Ga0495682_0001293_5414_6271 | 285 |
| 1051 | 3300049460 | Ga0495682_0002849 | Ga0495682_0002849_3866_4723 | 285 |
| 1052 | 3300049460 | Ga0495682_0017809 | Ga0495682_0017809_1711_2568 | 285 |
| 1053 | 3300049460 | Ga0495682_0018489 | Ga0495682_0018489_1162_2019 | 285 |
| 1054 | 3300049460 | Ga0495682_0019820 | Ga0495682_0019820_767_1639 | 285 |
| 1055 | 3300049460 | Ga0495682_0020861 | Ga0495682_0020861_677_1534 | 285 |
| 1056 | 3300049662 | Ga0501222_000921 | Ga0501222_000921_2193_3050 | 285 |
| 1057 | 3300049853 | Ga0501226_000988 | Ga0501226_000988_1278_2135 | 285 |
| 1058 | 3300053145 | Ga0500586_003095 | Ga0500586_003095_2126_2998 | 285 |
| 1059 | iso_pu_bacteria | 2511231023 | 2511366544 | 285 |
| 1060 | iso_pu_bacteria | 2511231156 | 2511823530 | 285 |
| 1061 | iso_pu_bacteria | 2713897148 | 2715751880 | 285 |
| 1062 | iso_pu_bacteria | 2791355520 | 2794596258 | 285 |
| 1063 | iso_pu_bacteria | 2808606445 | 2809216306 | 285 |
| 1064 | iso_pu_bacteria | 2842832357 | 2842832769 | 285 |
| 1065 | iso_pu_bacteria | 2842843487 | 2842848143 | 285 |
| 1066 | iso_pu_bacteria | 2919487758 | 2919491397 | 285 |
| 1067 | iso_pu_bacteria | 2998139840 | 2998141538 | 285 |
| 1068 | iso_pu_bacteria | 3007619802 | 3007622416 | 285 |
| 1069 | iso_pu_bacteria | 3007861166 | 3007863222 | 285 |
| 1070 | iso_pu_bacteria | 8029995093 | 8029999210 | 285 |
| 1071 | iso_pu_bacteria | 8056143049 | 8056147404 | 285 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kvq-assembly1.cif.gz_A-2 | udp-galactose 4-epimerase complexed with udp-phenol | 0.9009 | 1 | 280 |
| 7kn1-assembly2.cif.gz_B | crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound nad and formylated udp-arabinopyranose | 0.8999 | 2 | 280 |
| 3m2p-assembly2.cif.gz_C | the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus | 0.8983 | 2 | 280 |
| 3m2p-assembly2.cif.gz_F | the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus | 0.8925 | 1 | 280 |
| 1kvu-assembly1.cif.gz_A-2 | udp-galactose 4-epimerase complexed with udp-phenol | 0.8852 | 1 | 280 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5twcA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9058 | 2 | 34 | 3.50.50.60 |
| af_F4JRN8_123_262_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8888 | 1 | 74 | 3.40.50.720 |
| 3i3lA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8863 | 2 | 34 | 3.50.50.60 |
| af_F6P928_26_379_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8821 | 3 | 34 | 3.50.50.60 |
| af_A0A0R0KMW5_231_418_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8714 | 122 | 280 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0MWY4-F1-model_v4 | Epimerase | 0.9867 | 1 | 279 |
|
| AF-A0A1G0CXL0-F1-model_v4 | Epimerase | 0.9814 | 49 | 281 |
|
| AF-A0A1W6E4R5-F1-model_v4 | deleted | 0.9763 | 1 | 278 |
|
| AF-A0A1M3H5E6-F1-model_v4 | Epimerase | 0.9726 | 2 | 280 |
|
| AF-A0A1F9BJB4-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9712 | 1 | 284 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar