F489246

General Info

Members Datasets Scaffolds Average Seq Length
1059 283 1058 244

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10341106|Ga0207707_103411062
Length 266
Sequence MESAKFGYEDVTPDEKTRRVRGVFDSVARRYDVMNDLMSAGMHRGWKRFTVEVSGVRPGARVLDLAGGTGDLANLFAARVGPTGTVVHTDINGAMLAAGRDRLLDRGVVLPTVQCNAEALPFRDRAFDCVAIGFGLRNVTDKARALAEMARVLVPGGLALVLEFSRIARPLAPAYDWYSFTMLPLLGRLVVNDAASYRYLAESIRVHPDQEALKTMMERSGFDHVDYYNLAAGAVALHAGRVYQDGAGASGFPGLTPGTGARISGA

Samples

Sample ID Description Type Environment
1 2547132512 Azospira oryzae 6a3 Isolate Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
206 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
230 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
231 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
238 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
239 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.28
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 3.78
Rhizosphere 95.37
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1003866 3300001976 Bacteria 1973
2 JGI24750J21931_1014609 3300002070 Bacteria 1057
3 JGI24742J22300_10009794 3300002244 Bacteria 1583
4 JGI24751J29686_10055083 3300002459 Bacteria 820
5 Ga0065712_10185470 3300005290 Bacteria 1172
6 Ga0065715_10111911 3300005293 Bacteria 2554
7 Ga0065715_10337776 3300005293 Bacteria 972
8 Ga0070658_10011475 3300005327 Bacteria 7105
9 Ga0070658_10041175 3300005327 Bacteria 3727
10 Ga0070676_10000281 3300005328 Bacteria 22564
11 Ga0070676_10001759 3300005328 Bacteria 11014
12 Ga0070676_10259212 3300005328 Bacteria 1164
13 Ga0070683_100016475 3300005329 Bacteria 6519
14 Ga0070683_100024289 3300005329 Bacteria 5427
15 Ga0070683_100084578 3300005329 Bacteria 2972
16 Ga0070683_100239810 3300005329 Bacteria 1724
17 Ga0070690_100031724 3300005330 Bacteria 3294
18 Ga0070690_100038616 3300005330 Bacteria 3014
19 Ga0070690_100065714 3300005330 Bacteria 2345
20 Ga0070690_100234500 3300005330 Bacteria 1292
21 Ga0070670_100014893 3300005331 Bacteria 6671
22 Ga0070670_100023549 3300005331 Bacteria 5300
23 Ga0070670_100033793 3300005331 Bacteria 4404
24 Ga0070670_100042124 3300005331 Bacteria 3924
25 Ga0070670_100050046 3300005331 Bacteria 3591
26 Ga0070670_100090931 3300005331 Bacteria 2623
27 Ga0070670_100110824 3300005331 Bacteria 2365
28 Ga0070670_100150020 3300005331 Bacteria 2018
29 Ga0070670_100166284 3300005331 Bacteria 1912
30 Ga0070677_10061838 3300005333 Bacteria 1547
31 Ga0070677_10137776 3300005333 Bacteria 1122
32 Ga0068869_100000624 3300005334 Bacteria 20006
33 Ga0068869_100002125 3300005334 Bacteria 11913
34 Ga0068869_100028080 3300005334 Bacteria 3928
35 Ga0068869_100083885 3300005334 Bacteria 2384
36 Ga0068869_100098442 3300005334 Bacteria 2209
37 Ga0068869_100228265 3300005334 Bacteria 1478
38 Ga0068869_100454010 3300005334 Bacteria 1063
39 Ga0070666_10000739 3300005335 Bacteria 19804
40 Ga0070666_10004779 3300005335 Bacteria 8279
41 Ga0070666_10053784 3300005335 Bacteria 2716
42 Ga0070666_10260404 3300005335 Bacteria 1229
43 Ga0070666_10349203 3300005335 Bacteria 1058
44 Ga0070680_100009316 3300005336 Bacteria 7540
45 Ga0070680_100038303 3300005336 Bacteria 3878
46 Ga0070680_100301984 3300005336 Bacteria 1358
47 Ga0070682_100047121 3300005337 Bacteria 2678
48 Ga0068868_100001312 3300005338 Bacteria 17144
49 Ga0068868_100005791 3300005338 Bacteria 8707
50 Ga0068868_100014994 3300005338 Bacteria 5723
51 Ga0068868_100031446 3300005338 Bacteria 4077
52 Ga0068868_100038081 3300005338 Bacteria 3732
53 Ga0068868_100138325 3300005338 Bacteria 1998
54 Ga0068868_100283169 3300005338 Bacteria 1404
55 Ga0068868_100564506 3300005338 Bacteria 1004
56 Ga0068868_100781331 3300005338 Bacteria 860
57 Ga0070660_100001403 3300005339 Bacteria 16413
58 Ga0070660_100050230 3300005339 Bacteria 3209
59 Ga0070660_100054166 3300005339 Bacteria 3096
60 Ga0070660_100086513 3300005339 Bacteria 2466
61 Ga0070660_100095448 3300005339 Bacteria 2350
62 Ga0070660_100339225 3300005339 Bacteria 1236
63 Ga0070689_100003227 3300005340 Bacteria 10808
64 Ga0070689_100010115 3300005340 Bacteria 6715
65 Ga0070689_100010208 3300005340 Bacteria 6688
66 Ga0070689_100083192 3300005340 Bacteria 2515
67 Ga0070689_100263510 3300005340 Bacteria 1425
68 Ga0070691_10046915 3300005341 Bacteria 2053
69 Ga0070687_100016184 3300005343 Bacteria 3393
70 Ga0070687_100030760 3300005343 Bacteria 2627
71 Ga0070661_100011388 3300005344 Bacteria 6197
72 Ga0070661_100013381 3300005344 Bacteria 5758
73 Ga0070661_100040680 3300005344 Bacteria 3392
74 Ga0070661_100051874 3300005344 Bacteria 3002
75 Ga0070661_100073781 3300005344 Bacteria 2512
76 Ga0070661_100232380 3300005344 Bacteria 1418
77 Ga0070692_10018855 3300005345 Bacteria 3324
78 Ga0070692_10081162 3300005345 Bacteria 1747
79 Ga0070668_100000206 3300005347 Bacteria 38630
80 Ga0070668_100003475 3300005347 Bacteria 11626
81 Ga0070668_100008195 3300005347 Bacteria 7760
82 Ga0070668_100016442 3300005347 Bacteria 5531
83 Ga0070668_100039274 3300005347 Bacteria 3620
84 Ga0070668_100338579 3300005347 Bacteria 1270
85 Ga0070668_100467137 3300005347 Bacteria 1087
86 Ga0070668_100526183 3300005347 Bacteria 1026
87 Ga0070669_100000604 3300005353 Bacteria 26695
88 Ga0070669_100011414 3300005353 Bacteria 6308
89 Ga0070669_100038941 3300005353 Bacteria 3453
90 Ga0070669_100060921 3300005353 Bacteria 2773
91 Ga0070669_100071035 3300005353 Bacteria 2574
92 Ga0070669_100116098 3300005353 Bacteria 2037
93 Ga0070669_100225456 3300005353 Bacteria 1483
94 Ga0070669_100499727 3300005353 Bacteria 1009
95 Ga0070675_100006093 3300005354 Bacteria 9246
96 Ga0070675_100011069 3300005354 Bacteria 7061
97 Ga0070675_100015758 3300005354 Bacteria 5983
98 Ga0070675_100028476 3300005354 Bacteria 4496
99 Ga0070675_100035886 3300005354 Bacteria 4031
100 Ga0070675_100043188 3300005354 Bacteria 3683
101 Ga0070675_100059461 3300005354 Bacteria 3153
102 Ga0070675_100062846 3300005354 Bacteria 3069
103 Ga0070675_100165650 3300005354 Bacteria 1903
104 Ga0070675_100200331 3300005354 Bacteria 1732
105 Ga0070675_100292170 3300005354 Bacteria 1434
106 Ga0070671_100000272 3300005355 Bacteria 34885
107 Ga0070671_100005191 3300005355 Bacteria 10378
108 Ga0070671_100008903 3300005355 Bacteria 8052
109 Ga0070671_100009651 3300005355 Bacteria 7753
110 Ga0070671_100012546 3300005355 Bacteria 6823
111 Ga0070671_100016921 3300005355 Bacteria 5897
112 Ga0070671_100028836 3300005355 Bacteria 4574
113 Ga0070671_100029292 3300005355 Bacteria 4539
114 Ga0070671_100562546 3300005355 Bacteria 984
115 Ga0070674_100005378 3300005356 Bacteria 7388
116 Ga0070674_100009763 3300005356 Bacteria 5767
117 Ga0070674_100011367 3300005356 Bacteria 5419
118 Ga0070674_100022007 3300005356 Bacteria 4105
119 Ga0070674_100041689 3300005356 Bacteria 3113
120 Ga0070674_100073738 3300005356 Bacteria 2420
121 Ga0070674_100108926 3300005356 Bacteria 2031
122 Ga0070674_100197934 3300005356 Bacteria 1550
123 Ga0070673_100000624 3300005364 Bacteria 19369
124 Ga0070673_100024604 3300005364 Bacteria 4419
125 Ga0070673_100031680 3300005364 Bacteria 3972
126 Ga0070673_100076100 3300005364 Bacteria 2709
127 Ga0070673_100152987 3300005364 Bacteria 1955
128 Ga0070688_100000866 3300005365 Bacteria 15034
129 Ga0070659_100009914 3300005366 Bacteria 7006
130 Ga0070659_100039048 3300005366 Bacteria 3705
131 Ga0070659_100053499 3300005366 Bacteria 3177
132 Ga0070659_100065540 3300005366 Bacteria 2877
133 Ga0070659_100086076 3300005366 Bacteria 2514
134 Ga0070659_100568947 3300005366 Bacteria 971
135 Ga0070667_100001933 3300005367 Bacteria 18388
136 Ga0070667_100010773 3300005367 Bacteria 7555
137 Ga0070667_100013734 3300005367 Bacteria 6694
138 Ga0070667_100029876 3300005367 Bacteria 4544
139 Ga0070667_100038485 3300005367 Bacteria 4009
140 Ga0070667_100068830 3300005367 Bacteria 3012
141 Ga0070667_100090389 3300005367 Bacteria 2631
142 Ga0070667_100101038 3300005367 Bacteria 2491
143 Ga0070667_100105589 3300005367 Bacteria 2437
144 Ga0070667_100130145 3300005367 Bacteria 2196
145 Ga0070667_100220635 3300005367 Bacteria 1687
146 Ga0070709_10006716 3300005434 Bacteria 6281
147 Ga0070709_10034791 3300005434 Bacteria 3057
148 Ga0070714_100051247 3300005435 Bacteria 3518
149 Ga0070714_100102002 3300005435 Bacteria 2529
150 Ga0070713_100021313 3300005436 Bacteria 4981
151 Ga0070713_100057311 3300005436 Bacteria 3243
152 Ga0070713_100162694 3300005436 Bacteria 1993
153 Ga0070710_10026218 3300005437 Bacteria 3094
154 Ga0070710_10084431 3300005437 Bacteria 1860
155 Ga0070710_10385305 3300005437 Bacteria 936
156 Ga0070701_10017768 3300005438 Bacteria 3330
157 Ga0070701_10038512 3300005438 Bacteria 2420
158 Ga0070701_10050383 3300005438 Bacteria 2156
159 Ga0070701_10059373 3300005438 Bacteria 2011
160 Ga0070711_100015970 3300005439 Bacteria 4759
161 Ga0070711_100096448 3300005439 Bacteria 2142
162 Ga0070711_100269933 3300005439 Bacteria 1342
163 Ga0070700_100001933 3300005441 Bacteria 10491
164 Ga0070700_100016376 3300005441 Bacteria 4222
165 Ga0070700_100084305 3300005441 Bacteria 2059
166 Ga0070708_100000522 3300005445 Bacteria 28901
167 Ga0070708_100248018 3300005445 Bacteria 1672
168 Ga0070663_100029934 3300005455 Bacteria 3725
169 Ga0070663_100285960 3300005455 Bacteria 1315
170 Ga0070663_100548293 3300005455 Bacteria 966
171 Ga0070678_100001322 3300005456 Bacteria 13159
172 Ga0070678_100015222 3300005456 Bacteria 4882
173 Ga0070678_100015909 3300005456 Bacteria 4794
174 Ga0070678_100042337 3300005456 Bacteria 3236
175 Ga0070678_100123517 3300005456 Bacteria 2045
176 Ga0070678_100252404 3300005456 Bacteria 1480
177 Ga0070678_100302255 3300005456 Bacteria 1360
178 Ga0070662_100000594 3300005457 Bacteria 22024
179 Ga0070662_100022643 3300005457 Bacteria 4303
180 Ga0070662_100039703 3300005457 Bacteria 3348
181 Ga0070662_100065823 3300005457 Bacteria 2657
182 Ga0070662_100134285 3300005457 Bacteria 1912
183 Ga0070662_100335658 3300005457 Bacteria 1235
184 Ga0070662_100641886 3300005457 Bacteria 895
185 Ga0070681_10038204 3300005458 Bacteria 4814
186 Ga0070681_10137360 3300005458 Bacteria 2375
187 Ga0070681_10186610 3300005458 Bacteria 1994
188 Ga0070681_10385279 3300005458 Bacteria 1313
189 Ga0070681_10595592 3300005458 Bacteria 1020
190 Ga0068867_100006239 3300005459 Bacteria 8439
191 Ga0068867_100009445 3300005459 Bacteria 6876
192 Ga0068867_100011828 3300005459 Bacteria 6164
193 Ga0068867_100053493 3300005459 Bacteria 2982
194 Ga0068867_100144360 3300005459 Bacteria 1863
195 Ga0070685_10001494 3300005466 Bacteria 12315
196 Ga0070685_10013683 3300005466 Bacteria 4285
197 Ga0070685_10021405 3300005466 Bacteria 3514
198 Ga0070685_10061217 3300005466 Bacteria 2204
199 Ga0070685_10095033 3300005466 Bacteria 1811
200 Ga0070706_100076561 3300005467 Bacteria 3096
201 Ga0070679_100077478 3300005530 Bacteria 3313
202 Ga0070679_100125620 3300005530 Bacteria 2548
203 Ga0070679_100136429 3300005530 Bacteria 2434
204 Ga0070679_100218731 3300005530 Bacteria 1866
205 Ga0070684_100031580 3300005535 Bacteria 4510
206 Ga0070684_100062973 3300005535 Bacteria 3250
207 Ga0070684_100065959 3300005535 Bacteria 3178
208 Ga0070684_100216084 3300005535 Bacteria 1748
209 Ga0070684_100393688 3300005535 Bacteria 1277
210 Ga0068853_100003997 3300005539 Bacteria 11337
211 Ga0068853_100005776 3300005539 Bacteria 9745
212 Ga0068853_100009009 3300005539 Bacteria 8037
213 Ga0068853_100017010 3300005539 Bacteria 5996
214 Ga0068853_100068600 3300005539 Bacteria 3083
215 Ga0068853_100212067 3300005539 Bacteria 1765
216 Ga0068853_100231287 3300005539 Bacteria 1691
217 Ga0068853_100413131 3300005539 Bacteria 1264
218 Ga0068853_100491813 3300005539 Bacteria 1157
219 Ga0070672_100001908 3300005543 Bacteria 13069
220 Ga0070672_100006501 3300005543 Bacteria 7855
221 Ga0070672_100012404 3300005543 Bacteria 5981
222 Ga0070672_100039880 3300005543 Bacteria 3600
223 Ga0070672_100044411 3300005543 Bacteria 3432
224 Ga0070672_100052237 3300005543 Bacteria 3190
225 Ga0070672_100064203 3300005543 Bacteria 2901
226 Ga0070672_100082117 3300005543 Bacteria 2585
227 Ga0070672_100144566 3300005543 Bacteria 1964
228 Ga0070672_100175209 3300005543 Bacteria 1785
229 Ga0070686_100020885 3300005544 Bacteria 3882
230 Ga0070695_100062767 3300005545 Bacteria 2413
231 Ga0070696_100025279 3300005546 Bacteria 4036
232 Ga0070696_100253571 3300005546 Bacteria 1331
233 Ga0070696_100258487 3300005546 Bacteria 1320
234 Ga0070693_100022716 3300005547 Bacteria 3340
235 Ga0070693_100172645 3300005547 Bacteria 1386
236 Ga0070693_100184552 3300005547 Bacteria 1345
237 Ga0070693_100515906 3300005547 Bacteria 850
238 Ga0070665_100001632 3300005548 Bacteria 25847
239 Ga0070665_100002580 3300005548 Bacteria 19847
240 Ga0070665_100035138 3300005548 Bacteria 5039
241 Ga0070665_100046717 3300005548 Bacteria 4347
242 Ga0070665_100112726 3300005548 Bacteria 2722
243 Ga0068855_100001454 3300005563 Bacteria 29547
244 Ga0068855_100176966 3300005563 Bacteria 2413
245 Ga0068855_100298230 3300005563 Bacteria 1785
246 Ga0068855_100373267 3300005563 Bacteria 1567
247 Ga0068855_100457053 3300005563 Bacteria 1393
248 Ga0068855_100513137 3300005563 Bacteria 1301
249 Ga0070664_100010675 3300005564 Bacteria 7446
250 Ga0070664_100014182 3300005564 Bacteria 6498
251 Ga0070664_100037693 3300005564 Bacteria 4066
252 Ga0070664_100041004 3300005564 Bacteria 3905
253 Ga0070664_100042731 3300005564 Bacteria 3825
254 Ga0070664_100061518 3300005564 Bacteria 3200
255 Ga0070664_100210235 3300005564 Bacteria 1738
256 Ga0068857_100001513 3300005577 Bacteria 18546
257 Ga0068857_100034426 3300005577 Bacteria 4481
258 Ga0068857_100051501 3300005577 Bacteria 3653
259 Ga0068854_100010797 3300005578 Bacteria 5926
260 Ga0068854_100025805 3300005578 Bacteria 4033
261 Ga0068854_100036850 3300005578 Bacteria 3430
262 Ga0068854_100039141 3300005578 Bacteria 3338
263 Ga0068854_100063078 3300005578 Bacteria 2689
264 Ga0068854_100189677 3300005578 Bacteria 1610
265 Ga0068854_100295797 3300005578 Bacteria 1308
266 Ga0068854_100431482 3300005578 Bacteria 1096
267 Ga0068856_100000093 3300005614 Bacteria 84752
268 Ga0068856_100012134 3300005614 Bacteria 8345
269 Ga0068856_100028792 3300005614 Bacteria 5427
270 Ga0068856_100032574 3300005614 Bacteria 5103
271 Ga0068856_100085935 3300005614 Bacteria 3125
272 Ga0068856_100681437 3300005614 Bacteria 1048
273 Ga0070702_100018906 3300005615 Bacteria 3581
274 Ga0070702_100265429 3300005615 Bacteria 1171
275 Ga0068852_100007253 3300005616 Bacteria 8086
276 Ga0068852_100045670 3300005616 Bacteria 3727
277 Ga0068852_100077771 3300005616 Bacteria 2934
278 Ga0068852_100127268 3300005616 Bacteria 2341
279 Ga0068852_100481064 3300005616 Bacteria 1234
280 Ga0068852_100482208 3300005616 Bacteria 1232
281 Ga0068859_100001177 3300005617 Bacteria 26708
282 Ga0068859_100006143 3300005617 Bacteria 12206
283 Ga0068859_100006667 3300005617 Bacteria 11721
284 Ga0068859_100010198 3300005617 Bacteria 9457
285 Ga0068859_100091493 3300005617 Bacteria 3093
286 Ga0068859_100140612 3300005617 Bacteria 2487
287 Ga0068859_100545529 3300005617 Bacteria 1254
288 Ga0068864_100001668 3300005618 Bacteria 18287
289 Ga0068864_100001804 3300005618 Bacteria 17566
290 Ga0068864_100009196 3300005618 Bacteria 8148
291 Ga0068864_100017079 3300005618 Bacteria 6049
292 Ga0068864_100028460 3300005618 Bacteria 4724
293 Ga0068864_100032335 3300005618 Bacteria 4445
294 Ga0068864_100033066 3300005618 Bacteria 4396
295 Ga0068864_100063670 3300005618 Bacteria 3196
296 Ga0068864_100151417 3300005618 Bacteria 2101
297 Ga0068864_100168837 3300005618 Bacteria 1994
298 Ga0068866_10000752 3300005718 Bacteria 14618
299 Ga0068866_10124830 3300005718 Bacteria 1455
300 Ga0068866_10216633 3300005718 Bacteria 1153
301 Ga0068861_100000428 3300005719 Bacteria 24436
302 Ga0068861_100006340 3300005719 Bacteria 8054
303 Ga0068861_100061066 3300005719 Bacteria 2891
304 Ga0068861_100089868 3300005719 Bacteria 2421
305 Ga0068861_100238564 3300005719 Bacteria 1545
306 Ga0068861_100303331 3300005719 Bacteria 1384
307 Ga0068851_10001497 3300005834 Bacteria 10241
308 Ga0068851_10003446 3300005834 Bacteria 7036
309 Ga0068851_10003862 3300005834 Bacteria 6705
310 Ga0068851_10007291 3300005834 Bacteria 5072
311 Ga0068851_10009409 3300005834 Bacteria 4543
312 Ga0068870_10013653 3300005840 Bacteria 3823
313 Ga0068870_10218992 3300005840 Bacteria 1164
314 Ga0068863_100002038 3300005841 Bacteria 20027
315 Ga0068863_100002517 3300005841 Bacteria 18195
316 Ga0068863_100030434 3300005841 Bacteria 5154
317 Ga0068863_100052076 3300005841 Bacteria 3880
318 Ga0068863_100068510 3300005841 Bacteria 3356
319 Ga0068863_100070375 3300005841 Bacteria 3308
320 Ga0068863_100145309 3300005841 Bacteria 2268
321 Ga0068863_100243029 3300005841 Bacteria 1738
322 Ga0068863_100248799 3300005841 Bacteria 1717
323 Ga0068858_100003597 3300005842 Bacteria 15338
324 Ga0068858_100003715 3300005842 Bacteria 15117
325 Ga0068858_100011086 3300005842 Bacteria 8524
326 Ga0068858_100030738 3300005842 Bacteria 4988
327 Ga0068858_100031497 3300005842 Bacteria 4926
328 Ga0068858_100047276 3300005842 Bacteria 3989
329 Ga0068858_100081322 3300005842 Bacteria 3011
330 Ga0068858_100104325 3300005842 Bacteria 2645
331 Ga0068860_100001191 3300005843 Bacteria 28399
332 Ga0068860_100004248 3300005843 Bacteria 14675
333 Ga0068860_100005963 3300005843 Bacteria 12259
334 Ga0068860_100020059 3300005843 Bacteria 6476
335 Ga0068860_100023366 3300005843 Bacteria 5975
336 Ga0068860_100076628 3300005843 Bacteria 3180
337 Ga0068860_100085294 3300005843 Bacteria 3005
338 Ga0068860_100589733 3300005843 Bacteria 1116
339 Ga0068862_100000409 3300005844 Bacteria 46422
340 Ga0068862_100002844 3300005844 Bacteria 15181
341 Ga0068862_100044686 3300005844 Bacteria 3779
342 Ga0068862_100081892 3300005844 Bacteria 2800
343 Ga0068862_100169518 3300005844 Bacteria 1954
344 Ga0070716_100008216 3300006173 Bacteria 5171
345 Ga0070716_100024302 3300006173 Bacteria 3224
346 Ga0070712_100013494 3300006175 Bacteria 5223
347 Ga0070712_100212929 3300006175 Bacteria 1525
348 Ga0070712_100549397 3300006175 Bacteria 973
349 Ga0097621_100002130 3300006237 Bacteria 13542
350 Ga0097621_100003222 3300006237 Bacteria 11214
351 Ga0097621_100026847 3300006237 Bacteria 4522
352 Ga0097621_100107586 3300006237 Bacteria 2353
353 Ga0097621_100136561 3300006237 Bacteria 2092
354 Ga0097621_100152147 3300006237 Bacteria 1984
355 Ga0097621_100223769 3300006237 Bacteria 1640
356 Ga0068871_100000472 3300006358 Bacteria 27578
357 Ga0068871_100025411 3300006358 Bacteria 4608
358 Ga0068871_100078455 3300006358 Bacteria 2731
359 Ga0068871_100089196 3300006358 Bacteria 2566
360 Ga0075428_100080294 3300006844 Bacteria 3560
361 Ga0075434_100100301 3300006871 Bacteria 2901
362 Ga0075434_100355039 3300006871 Bacteria 1487
363 Ga0068865_100000366 3300006881 Bacteria 25072
364 Ga0068865_100003716 3300006881 Bacteria 9165
365 Ga0068865_100017913 3300006881 Bacteria 4563
366 Ga0068865_100046169 3300006881 Bacteria 2988
367 Ga0068865_100100703 3300006881 Bacteria 2114
368 Ga0068865_100221122 3300006881 Bacteria 1480
369 Ga0068865_100228452 3300006881 Bacteria 1459
370 Ga0097620_100001177 3300006931 Bacteria 26708
371 Ga0097620_100006144 3300006931 Bacteria 12206
372 Ga0097620_100006667 3300006931 Bacteria 11721
373 Ga0097620_100010198 3300006931 Bacteria 9457
374 Ga0097620_100091491 3300006931 Bacteria 3093
375 Ga0097620_100140615 3300006931 Bacteria 2487
376 Ga0097620_100545553 3300006931 Bacteria 1254
377 Ga0105240_10005083 3300009093 Bacteria 19712
378 Ga0105240_10078965 3300009093 Bacteria 4051
379 Ga0105240_10173874 3300009093 Bacteria 2548
380 Ga0105240_10411872 3300009093 Bacteria 1520
381 Ga0111539_10062708 3300009094 Bacteria 4399
382 Ga0111539_10080096 3300009094 Bacteria 3842
383 Ga0105245_10048386 3300009098 Bacteria 3804
384 Ga0105245_10050130 3300009098 Bacteria 3740
385 Ga0105245_10111078 3300009098 Bacteria 2549
386 Ga0105245_10210750 3300009098 Bacteria 1870
387 Ga0105247_10005062 3300009101 Bacteria 8360
388 Ga0105247_10090325 3300009101 Bacteria 1943
389 Ga0105247_10152910 3300009101 Bacteria 1522
390 Ga0114129_10933313 3300009147 Bacteria 1097
391 Ga0105243_10033167 3300009148 Bacteria 3992
392 Ga0105243_10177998 3300009148 Bacteria 1847
393 Ga0105243_10184637 3300009148 Bacteria 1816
394 Ga0105243_10253249 3300009148 Bacteria 1573
395 Ga0105241_10047890 3300009174 Bacteria 3251
396 Ga0105242_10019241 3300009176 Bacteria 5350
397 Ga0105242_10027342 3300009176 Bacteria 4528
398 Ga0105242_10139869 3300009176 Bacteria 2099
399 Ga0105242_10176922 3300009176 Bacteria 1879
400 Ga0105242_10267156 3300009176 Bacteria 1548
401 Ga0105248_10001670 3300009177 Bacteria 24699
402 Ga0105248_10064325 3300009177 Bacteria 4118
403 Ga0105248_10079981 3300009177 Bacteria 3673
404 Ga0105248_10166967 3300009177 Bacteria 2481
405 Ga0105248_10168288 3300009177 Bacteria 2470
406 Ga0105248_10320444 3300009177 Bacteria 1746
407 Ga0105248_10402241 3300009177 Bacteria 1542
408 Ga0105248_10486843 3300009177 Bacteria 1390
409 Ga0105237_10131355 3300009545 Bacteria 2499
410 Ga0105237_10781048 3300009545 Bacteria 962
411 Ga0105238_10017350 3300009551 Bacteria 7314
412 Ga0105238_10123699 3300009551 Bacteria 2566
413 Ga0105238_10518137 3300009551 Bacteria 1195
414 Ga0105249_10002440 3300009553 Bacteria 16141
415 Ga0105249_10018099 3300009553 Bacteria 6262
416 Ga0105249_10039473 3300009553 Bacteria 4287
417 Ga0105249_10078405 3300009553 Bacteria 3065
418 Ga0105249_10122113 3300009553 Bacteria 2477
419 Ga0105249_10822762 3300009553 Bacteria 993
420 Ga0105239_10119149 3300010375 Bacteria 2929
421 Ga0105239_10141949 3300010375 Bacteria 2677
422 Ga0105239_10186504 3300010375 Bacteria 2321
423 Ga0105239_10627233 3300010375 Bacteria 1227
424 Ga0105246_10056170 3300011119 Bacteria 2720
425 Ga0105246_10069155 3300011119 Bacteria 2479
426 Ga0105246_10154095 3300011119 Bacteria 1743
427 Ga0105246_10885321 3300011119 Bacteria 799
428 Ga0157373_10004614 3300013100 Bacteria 10364
429 Ga0157373_10026087 3300013100 Bacteria 4223
430 Ga0157373_10069848 3300013100 Bacteria 2482
431 Ga0157373_10087402 3300013100 Bacteria 2196
432 Ga0157371_10001206 3300013102 Bacteria 27613
433 Ga0157371_10064768 3300013102 Bacteria 2589
434 Ga0157371_10121345 3300013102 Bacteria 1859
435 Ga0157370_10015284 3300013104 Bacteria 7808
436 Ga0157370_10016110 3300013104 Bacteria 7577
437 Ga0157370_10027099 3300013104 Bacteria 5651
438 Ga0157370_10059323 3300013104 Bacteria 3636
439 Ga0157369_10105901 3300013105 Bacteria 2993
440 Ga0157369_10149884 3300013105 Bacteria 2465
441 Ga0157369_10221084 3300013105 Bacteria 1983
442 Ga0157369_10318754 3300013105 Bacteria 1616
443 Ga0157369_10417520 3300013105 Bacteria 1391
444 Ga0157369_10608580 3300013105 Bacteria 1128
445 Ga0157374_10000508 3300013296 Bacteria 35025
446 Ga0157374_10007944 3300013296 Bacteria 9061
447 Ga0157374_10014725 3300013296 Bacteria 6849
448 Ga0157374_10094555 3300013296 Bacteria 2857
449 Ga0157374_10134107 3300013296 Bacteria 2399
450 Ga0157374_10317112 3300013296 Bacteria 1544
451 Ga0157378_10057263 3300013297 Bacteria 3473
452 Ga0157378_10086953 3300013297 Bacteria 2834
453 Ga0157378_10091572 3300013297 Bacteria 2765
454 Ga0157378_10093755 3300013297 Bacteria 2734
455 Ga0157378_10116835 3300013297 Bacteria 2454
456 Ga0157378_10124246 3300013297 Bacteria 2382
457 Ga0157378_10173745 3300013297 Bacteria 2023
458 Ga0157378_10462613 3300013297 Bacteria 1261
459 Ga0157378_10554302 3300013297 Bacteria 1155
460 Ga0163162_10000619 3300013306 Bacteria 32928
461 Ga0163162_10017256 3300013306 Bacteria 7062
462 Ga0163162_10114868 3300013306 Bacteria 2792
463 Ga0163162_10180994 3300013306 Bacteria 2234
464 Ga0157372_10004601 3300013307 Bacteria 14667
465 Ga0157372_10059742 3300013307 Bacteria 4265
466 Ga0157372_10158952 3300013307 Bacteria 2611
467 Ga0157372_10162300 3300013307 Bacteria 2583
468 Ga0157372_10295772 3300013307 Bacteria 1883
469 Ga0157372_10403039 3300013307 Bacteria 1594
470 Ga0157372_10409952 3300013307 Bacteria 1579
471 Ga0157375_10007078 3300013308 Bacteria 9796
472 Ga0157375_10009046 3300013308 Bacteria 8720
473 Ga0157375_10022118 3300013308 Bacteria 5849
474 Ga0157375_10115611 3300013308 Bacteria 2786
475 Ga0157375_10149764 3300013308 Bacteria 2468
476 Ga0157375_10174736 3300013308 Bacteria 2297
477 Ga0157375_10188496 3300013308 Bacteria 2217
478 Ga0157375_10255169 3300013308 Bacteria 1915
479 Ga0157375_10354899 3300013308 Bacteria 1632
480 Ga0157375_11503945 3300013308 Bacteria 795
481 Ga0163163_10011502 3300014325 Bacteria 8033
482 Ga0163163_10066449 3300014325 Bacteria 3581
483 Ga0163163_10158110 3300014325 Bacteria 2311
484 Ga0163163_10323139 3300014325 Bacteria 1597
485 Ga0163163_10530139 3300014325 Bacteria 1240
486 Ga0157380_10032035 3300014326 Bacteria 4040
487 Ga0157380_10037350 3300014326 Bacteria 3763
488 Ga0157380_10041023 3300014326 Bacteria 3609
489 Ga0157380_10201322 3300014326 Bacteria 1767
490 Ga0157377_10012271 3300014745 Bacteria 4303
491 Ga0157377_10045326 3300014745 Bacteria 2456
492 Ga0157377_10123064 3300014745 Bacteria 1575
493 Ga0157377_10160777 3300014745 Bacteria 1396
494 Ga0157379_10001473 3300014968 Bacteria 19414
495 Ga0157379_10002331 3300014968 Bacteria 15818
496 Ga0157379_10013786 3300014968 Bacteria 7083
497 Ga0157379_10028567 3300014968 Bacteria 4960
498 Ga0157379_10033662 3300014968 Bacteria 4570
499 Ga0157379_10044178 3300014968 Bacteria 3977
500 Ga0157379_10051704 3300014968 Bacteria 3669
501 Ga0157379_10099119 3300014968 Bacteria 2616
502 Ga0157379_10182462 3300014968 Bacteria 1896
503 Ga0157379_10314716 3300014968 Bacteria 1428
504 Ga0157376_10003761 3300014969 Bacteria 10492
505 Ga0157376_10014955 3300014969 Bacteria 5848
506 Ga0157376_10015684 3300014969 Bacteria 5731
507 Ga0157376_10040994 3300014969 Bacteria 3788
508 Ga0157376_10094207 3300014969 Bacteria 2601
509 Ga0157376_10108931 3300014969 Bacteria 2434
510 Ga0157376_10267770 3300014969 Bacteria 1603
511 Ga0157376_10707538 3300014969 Bacteria 1013
512 Ga0163161_10061801 3300017792 Bacteria 2727
513 Ga0163161_10144611 3300017792 Bacteria 1803
514 Ga0163161_10303045 3300017792 Bacteria 1259
515 Ga0206356_11467867 3300020070 Bacteria 2011
516 Ga0206354_10294245 3300020081 Bacteria 1275
517 Ga0206353_12026708 3300020082 Bacteria 1433
518 Ga0207673_1002475 3300025290 Bacteria 2110
519 Ga0207697_10000152 3300025315 Bacteria 34092
520 Ga0207697_10004253 3300025315 Bacteria 6873
521 Ga0207656_10006344 3300025321 Bacteria 4242
522 Ga0207656_10008514 3300025321 Bacteria 3779
523 Ga0207656_10008690 3300025321 Bacteria 3748
524 Ga0207656_10025778 3300025321 Bacteria 2390
525 Ga0207656_10039431 3300025321 Bacteria 1998
526 Ga0207682_10000198 3300025893 Bacteria 27362
527 Ga0207682_10000277 3300025893 Bacteria 23286
528 Ga0207682_10006878 3300025893 Bacteria 4564
529 Ga0207692_10046556 3300025898 Bacteria 2175
530 Ga0207692_10118030 3300025898 Bacteria 1481
531 Ga0207692_10155700 3300025898 Bacteria 1312
532 Ga0207642_10011473 3300025899 Bacteria 3163
533 Ga0207642_10061926 3300025899 Bacteria 1742
534 Ga0207642_10121953 3300025899 Bacteria 1346
535 Ga0207642_10159191 3300025899 Bacteria 1211
536 Ga0207710_10012909 3300025900 Bacteria 3518
537 Ga0207710_10173428 3300025900 Bacteria 1055
538 Ga0207688_10003167 3300025901 Bacteria 8975
539 Ga0207688_10003793 3300025901 Bacteria 8244
540 Ga0207688_10025400 3300025901 Bacteria 3253
541 Ga0207688_10029662 3300025901 Bacteria 3013
542 Ga0207680_10015572 3300025903 Bacteria 3971
543 Ga0207680_10019451 3300025903 Bacteria 3632
544 Ga0207680_10038459 3300025903 Bacteria 2769
545 Ga0207680_10096533 3300025903 Bacteria 1891
546 Ga0207680_10117338 3300025903 Bacteria 1736
547 Ga0207680_10154042 3300025903 Bacteria 1535
548 Ga0207680_10186610 3300025903 Bacteria 1405
549 Ga0207680_10377906 3300025903 Bacteria 998
550 Ga0207685_10249831 3300025905 Bacteria 857
551 Ga0207699_10038224 3300025906 Bacteria 2749
552 Ga0207645_10000474 3300025907 Bacteria 33133
553 Ga0207645_10000676 3300025907 Bacteria 28210
554 Ga0207645_10004726 3300025907 Bacteria 10023
555 Ga0207645_10008223 3300025907 Bacteria 7297
556 Ga0207645_10016427 3300025907 Bacteria 4901
557 Ga0207643_10003006 3300025908 Bacteria 9094
558 Ga0207643_10003330 3300025908 Bacteria 8660
559 Ga0207643_10081378 3300025908 Bacteria 1877
560 Ga0207705_10015828 3300025909 Bacteria 5417
561 Ga0207705_10175394 3300025909 Bacteria 1615
562 Ga0207705_10284147 3300025909 Bacteria 1267
563 Ga0207705_10561905 3300025909 Bacteria 887
564 Ga0207684_10113524 3300025910 Bacteria 2319
565 Ga0207654_10013168 3300025911 Bacteria 4250
566 Ga0207654_10035150 3300025911 Bacteria 2790
567 Ga0207654_10088517 3300025911 Bacteria 1882
568 Ga0207707_10002449 3300025912 Bacteria 16703
569 Ga0207707_10028487 3300025912 Bacteria 4882
570 Ga0207707_10178339 3300025912 Bacteria 1855
571 Ga0207707_10321159 3300025912 Bacteria 1337
572 Ga0207707_10341106 3300025912 Bacteria 1292
573 Ga0207695_10011326 3300025913 Bacteria 10811
574 Ga0207693_10003348 3300025915 Bacteria 13714
575 Ga0207693_10051589 3300025915 Bacteria 3228
576 Ga0207693_10051620 3300025915 Bacteria 3227
577 Ga0207663_10012995 3300025916 Bacteria 4515
578 Ga0207663_10022644 3300025916 Bacteria 3595
579 Ga0207663_10041174 3300025916 Bacteria 2813
580 Ga0207663_10130019 3300025916 Bacteria 1738
581 Ga0207663_10194033 3300025916 Bacteria 1460
582 Ga0207660_10002462 3300025917 Bacteria 12164
583 Ga0207660_10295350 3300025917 Bacteria 1289
584 Ga0207660_10300631 3300025917 Bacteria 1278
585 Ga0207662_10010826 3300025918 Bacteria 5040
586 Ga0207662_10032649 3300025918 Bacteria 3031
587 Ga0207662_10036483 3300025918 Bacteria 2874
588 Ga0207657_10000045 3300025919 Bacteria 114661
589 Ga0207657_10000645 3300025919 Bacteria 37069
590 Ga0207657_10011950 3300025919 Bacteria 8592
591 Ga0207657_10019401 3300025919 Bacteria 6457
592 Ga0207657_10038623 3300025919 Bacteria 4248
593 Ga0207657_10087669 3300025919 Bacteria 2603
594 Ga0207649_10008368 3300025920 Bacteria 5638
595 Ga0207649_10009810 3300025920 Bacteria 5246
596 Ga0207649_10044013 3300025920 Bacteria 2732
597 Ga0207649_10088192 3300025920 Bacteria 2026
598 Ga0207649_10218574 3300025920 Bacteria 1356
599 Ga0207652_10001996 3300025921 Bacteria 17644
600 Ga0207652_10169040 3300025921 Bacteria 1961
601 Ga0207652_10355309 3300025921 Bacteria 1322
602 Ga0207681_10000431 3300025923 Bacteria 29283
603 Ga0207681_10007030 3300025923 Bacteria 6906
604 Ga0207681_10082287 3300025923 Bacteria 2275
605 Ga0207681_10194078 3300025923 Bacteria 1555
606 Ga0207681_10268582 3300025923 Bacteria 1338
607 Ga0207681_10335406 3300025923 Bacteria 1206
608 Ga0207694_10002970 3300025924 Bacteria 13612
609 Ga0207694_10213694 3300025924 Bacteria 1572
610 Ga0207650_10005059 3300025925 Bacteria 8997
611 Ga0207650_10009351 3300025925 Bacteria 6698
612 Ga0207650_10016584 3300025925 Bacteria 5149
613 Ga0207650_10027674 3300025925 Bacteria 4059
614 Ga0207650_10028240 3300025925 Bacteria 4021
615 Ga0207650_10037038 3300025925 Bacteria 3552
616 Ga0207650_10089216 3300025925 Bacteria 2353
617 Ga0207650_10114212 3300025925 Bacteria 2094
618 Ga0207650_10120622 3300025925 Bacteria 2041
619 Ga0207650_10150278 3300025925 Bacteria 1838
620 Ga0207650_10188387 3300025925 Bacteria 1647
621 Ga0207659_10003229 3300025926 Bacteria 9750
622 Ga0207659_10004533 3300025926 Bacteria 8405
623 Ga0207659_10007361 3300025926 Bacteria 6766
624 Ga0207659_10015982 3300025926 Bacteria 4876
625 Ga0207659_10044602 3300025926 Bacteria 3120
626 Ga0207659_10050310 3300025926 Bacteria 2960
627 Ga0207659_10064835 3300025926 Bacteria 2645
628 Ga0207659_10065472 3300025926 Bacteria 2633
629 Ga0207659_10066544 3300025926 Bacteria 2615
630 Ga0207659_10137371 3300025926 Bacteria 1894
631 Ga0207659_10205262 3300025926 Bacteria 1576
632 Ga0207659_10713243 3300025926 Bacteria 859
633 Ga0207687_10002138 3300025927 Bacteria 13458
634 Ga0207687_10057806 3300025927 Bacteria 2726
635 Ga0207687_10080930 3300025927 Bacteria 2346
636 Ga0207687_10476568 3300025927 Bacteria 1039
637 Ga0207700_10031456 3300025928 Bacteria 3771
638 Ga0207700_10088374 3300025928 Bacteria 2440
639 Ga0207664_10036940 3300025929 Bacteria 3777
640 Ga0207664_10084350 3300025929 Bacteria 2591
641 Ga0207664_10091708 3300025929 Bacteria 2492
642 Ga0207664_10281982 3300025929 Bacteria 1458
643 Ga0207644_10000972 3300025931 Bacteria 18307
644 Ga0207644_10008063 3300025931 Bacteria 6892
645 Ga0207644_10024002 3300025931 Bacteria 4182
646 Ga0207644_10029981 3300025931 Bacteria 3777
647 Ga0207644_10039583 3300025931 Bacteria 3328
648 Ga0207644_10044626 3300025931 Bacteria 3150
649 Ga0207644_10160418 3300025931 Bacteria 1747
650 Ga0207644_10178582 3300025931 Bacteria 1662
651 Ga0207644_10272989 3300025931 Bacteria 1355
652 Ga0207644_10417276 3300025931 Bacteria 1099
653 Ga0207690_10001179 3300025932 Bacteria 16547
654 Ga0207690_10029050 3300025932 Bacteria 3512
655 Ga0207690_10068804 3300025932 Bacteria 2434
656 Ga0207690_10320410 3300025932 Bacteria 1218
657 Ga0207690_10365324 3300025932 Bacteria 1144
658 Ga0207706_10000014 3300025933 Bacteria 177082
659 Ga0207706_10003500 3300025933 Bacteria 14990
660 Ga0207706_10006979 3300025933 Bacteria 10441
661 Ga0207706_10032209 3300025933 Bacteria 4668
662 Ga0207706_10060595 3300025933 Bacteria 3333
663 Ga0207706_10117935 3300025933 Bacteria 2334
664 Ga0207706_10125460 3300025933 Bacteria 2257
665 Ga0207706_10357425 3300025933 Bacteria 1269
666 Ga0207706_10592958 3300025933 Bacteria 952
667 Ga0207686_10003542 3300025934 Bacteria 8375
668 Ga0207686_10067157 3300025934 Bacteria 2293
669 Ga0207686_10085920 3300025934 Bacteria 2065
670 Ga0207709_10004901 3300025935 Bacteria 7660
671 Ga0207709_10041514 3300025935 Bacteria 2761
672 Ga0207709_10176823 3300025935 Bacteria 1503
673 Ga0207709_10765199 3300025935 Bacteria 777
674 Ga0207670_10001184 3300025936 Bacteria 13778
675 Ga0207670_10029194 3300025936 Bacteria 3511
676 Ga0207670_10215212 3300025936 Bacteria 1468
677 Ga0207669_10005326 3300025937 Bacteria 5761
678 Ga0207669_10008679 3300025937 Bacteria 4786
679 Ga0207669_10011008 3300025937 Bacteria 4379
680 Ga0207669_10015941 3300025937 Bacteria 3803
681 Ga0207669_10063095 3300025937 Bacteria 2285
682 Ga0207669_10139953 3300025937 Bacteria 1678
683 Ga0207704_10009522 3300025938 Bacteria 4691
684 Ga0207704_10020073 3300025938 Bacteria 3526
685 Ga0207704_10138304 3300025938 Bacteria 1699
686 Ga0207704_10144311 3300025938 Bacteria 1670
687 Ga0207704_10300126 3300025938 Bacteria 1230
688 Ga0207665_10018633 3300025939 Bacteria 4560
689 Ga0207665_10030153 3300025939 Bacteria 3585
690 Ga0207665_10135157 3300025939 Bacteria 1754
691 Ga0207691_10000243 3300025940 Bacteria 53649
692 Ga0207691_10000488 3300025940 Bacteria 39341
693 Ga0207691_10001900 3300025940 Bacteria 20407
694 Ga0207691_10005801 3300025940 Bacteria 11942
695 Ga0207691_10012831 3300025940 Bacteria 8022
696 Ga0207691_10019983 3300025940 Bacteria 6336
697 Ga0207691_10037878 3300025940 Bacteria 4464
698 Ga0207691_10046767 3300025940 Bacteria 3974
699 Ga0207691_10051702 3300025940 Bacteria 3755
700 Ga0207691_10056717 3300025940 Bacteria 3568
701 Ga0207691_10060755 3300025940 Bacteria 3434
702 Ga0207691_10095169 3300025940 Bacteria 2664
703 Ga0207691_10486846 3300025940 Bacteria 1048
704 Ga0207711_10007585 3300025941 Bacteria 9077
705 Ga0207711_10015749 3300025941 Bacteria 6271
706 Ga0207711_10064090 3300025941 Bacteria 3173
707 Ga0207711_10102386 3300025941 Bacteria 2535
708 Ga0207711_10160375 3300025941 Bacteria 2035
709 Ga0207711_10170586 3300025941 Bacteria 1974
710 Ga0207711_10181113 3300025941 Bacteria 1916
711 Ga0207711_10270533 3300025941 Bacteria 1563
712 Ga0207711_10527980 3300025941 Bacteria 1101
713 Ga0207711_10546592 3300025941 Bacteria 1080
714 Ga0207711_10616610 3300025941 Bacteria 1012
715 Ga0207689_10000066 3300025942 Bacteria 84063
716 Ga0207689_10003367 3300025942 Bacteria 14635
717 Ga0207689_10005902 3300025942 Bacteria 10846
718 Ga0207689_10034583 3300025942 Bacteria 4197
719 Ga0207689_10035534 3300025942 Bacteria 4139
720 Ga0207689_10045980 3300025942 Bacteria 3609
721 Ga0207689_10060061 3300025942 Bacteria 3126
722 Ga0207689_10135590 3300025942 Bacteria 2027
723 Ga0207689_10139746 3300025942 Bacteria 1995
724 Ga0207661_10004402 3300025944 Bacteria 9878
725 Ga0207661_10341929 3300025944 Bacteria 1348
726 Ga0207679_10001600 3300025945 Bacteria 14100
727 Ga0207679_10020641 3300025945 Bacteria 4448
728 Ga0207679_10055814 3300025945 Bacteria 2913
729 Ga0207679_10058139 3300025945 Bacteria 2863
730 Ga0207679_10331323 3300025945 Bacteria 1321
731 Ga0207679_10383761 3300025945 Bacteria 1232
732 Ga0207679_10494814 3300025945 Bacteria 1090
733 Ga0207667_10001516 3300025949 Bacteria 29182
734 Ga0207667_10021014 3300025949 Bacteria 7238
735 Ga0207667_10049554 3300025949 Bacteria 4435
736 Ga0207667_10295346 3300025949 Bacteria 1655
737 Ga0207667_10456132 3300025949 Bacteria 1299
738 Ga0207667_10683659 3300025949 Bacteria 1030
739 Ga0207667_10911040 3300025949 Bacteria 870
740 Ga0207651_10001665 3300025960 Bacteria 10209
741 Ga0207651_10002167 3300025960 Bacteria 9295
742 Ga0207651_10002291 3300025960 Bacteria 9103
743 Ga0207651_10020656 3300025960 Bacteria 3981
744 Ga0207651_10037711 3300025960 Bacteria 3168
745 Ga0207651_10146371 3300025960 Bacteria 1832
746 Ga0207651_10161803 3300025960 Bacteria 1755
747 Ga0207651_10292523 3300025960 Bacteria 1351
748 Ga0207712_10239736 3300025961 Bacteria 1460
749 Ga0207668_10008622 3300025972 Bacteria 6086
750 Ga0207668_10010320 3300025972 Bacteria 5642
751 Ga0207668_10017653 3300025972 Bacteria 4475
752 Ga0207668_10049379 3300025972 Bacteria 2892
753 Ga0207668_10203274 3300025972 Bacteria 1579
754 Ga0207668_10237925 3300025972 Bacteria 1471
755 Ga0207640_10003371 3300025981 Bacteria 8605
756 Ga0207640_10005106 3300025981 Bacteria 7136
757 Ga0207640_10012754 3300025981 Bacteria 4797
758 Ga0207640_10055730 3300025981 Bacteria 2591
759 Ga0207640_10168389 3300025981 Bacteria 1630
760 Ga0207640_10168773 3300025981 Bacteria 1628
761 Ga0207640_10269157 3300025981 Bacteria 1332
762 Ga0207640_10279131 3300025981 Bacteria 1311
763 Ga0207640_10488671 3300025981 Bacteria 1023
764 Ga0207658_10001108 3300025986 Bacteria 21730
765 Ga0207658_10004458 3300025986 Bacteria 9728
766 Ga0207658_10014988 3300025986 Bacteria 5315
767 Ga0207658_10017104 3300025986 Bacteria 4993
768 Ga0207658_10026799 3300025986 Bacteria 4045
769 Ga0207658_10061185 3300025986 Bacteria 2812
770 Ga0207658_10165542 3300025986 Bacteria 1816
771 Ga0207658_10183954 3300025986 Bacteria 1731
772 Ga0207658_10256144 3300025986 Bacteria 1489
773 Ga0207677_10000245 3300026023 Bacteria 41945
774 Ga0207677_10000509 3300026023 Bacteria 25064
775 Ga0207677_10009429 3300026023 Bacteria 5495
776 Ga0207677_10020454 3300026023 Bacteria 4019
777 Ga0207677_10031958 3300026023 Bacteria 3377
778 Ga0207677_10078563 3300026023 Bacteria 2357
779 Ga0207677_10126627 3300026023 Bacteria 1931
780 Ga0207677_10441439 3300026023 Bacteria 1113
781 Ga0207703_10000539 3300026035 Bacteria 38982
782 Ga0207703_10011462 3300026035 Bacteria 6895
783 Ga0207703_10012984 3300026035 Bacteria 6490
784 Ga0207703_10015182 3300026035 Bacteria 6009
785 Ga0207703_10016147 3300026035 Bacteria 5820
786 Ga0207703_10023957 3300026035 Bacteria 4801
787 Ga0207703_10072054 3300026035 Bacteria 2855
788 Ga0207703_10079707 3300026035 Bacteria 2725
789 Ga0207703_10120004 3300026035 Bacteria 2256
790 Ga0207703_10156884 3300026035 Bacteria 1990
791 Ga0207703_10233489 3300026035 Bacteria 1650
792 Ga0207639_10001295 3300026041 Bacteria 16893
793 Ga0207639_10003022 3300026041 Bacteria 11322
794 Ga0207639_10003407 3300026041 Bacteria 10693
795 Ga0207639_10053690 3300026041 Bacteria 3076
796 Ga0207639_10130078 3300026041 Bacteria 2083
797 Ga0207639_10185833 3300026041 Bacteria 1772
798 Ga0207639_10213784 3300026041 Bacteria 1661
799 Ga0207639_10847381 3300026041 Bacteria 853
800 Ga0207678_10001624 3300026067 Bacteria 20649
801 Ga0207678_10006813 3300026067 Bacteria 10134
802 Ga0207678_10040691 3300026067 Bacteria 4029
803 Ga0207678_10041206 3300026067 Bacteria 4004
804 Ga0207678_10056388 3300026067 Bacteria 3382
805 Ga0207708_10000789 3300026075 Bacteria 23888
806 Ga0207708_10001534 3300026075 Bacteria 17202
807 Ga0207702_10001843 3300026078 Bacteria 20863
808 Ga0207702_10011817 3300026078 Bacteria 7268
809 Ga0207702_10015429 3300026078 Bacteria 6327
810 Ga0207702_10328742 3300026078 Bacteria 1457
811 Ga0207641_10001273 3300026088 Bacteria 25089
812 Ga0207641_10003163 3300026088 Bacteria 14750
813 Ga0207641_10009112 3300026088 Bacteria 8197
814 Ga0207641_10031102 3300026088 Bacteria 4425
815 Ga0207641_10045583 3300026088 Bacteria 3692
816 Ga0207641_10178901 3300026088 Bacteria 1941
817 Ga0207641_10271292 3300026088 Bacteria 1592
818 Ga0207641_10275797 3300026088 Bacteria 1579
819 Ga0207641_10287249 3300026088 Bacteria 1549
820 Ga0207641_10511149 3300026088 Bacteria 1167
821 Ga0207648_10000324 3300026089 Bacteria 52466
822 Ga0207648_10002658 3300026089 Bacteria 19074
823 Ga0207648_10002908 3300026089 Bacteria 18136
824 Ga0207648_10006881 3300026089 Bacteria 11271
825 Ga0207648_10061623 3300026089 Bacteria 3271
826 Ga0207648_10068364 3300026089 Bacteria 3095
827 Ga0207648_10088232 3300026089 Bacteria 2708
828 Ga0207648_10110771 3300026089 Bacteria 2410
829 Ga0207648_10219609 3300026089 Bacteria 1689
830 Ga0207648_10292427 3300026089 Bacteria 1459
831 Ga0207676_10001046 3300026095 Bacteria 21066
832 Ga0207676_10001487 3300026095 Bacteria 17339
833 Ga0207676_10017376 3300026095 Bacteria 5212
834 Ga0207676_10038345 3300026095 Bacteria 3656
835 Ga0207676_10089722 3300026095 Bacteria 2520
836 Ga0207676_10091169 3300026095 Bacteria 2503
837 Ga0207676_10236075 3300026095 Bacteria 1637
838 Ga0207676_10273146 3300026095 Bacteria 1531
839 Ga0207676_10414734 3300026095 Bacteria 1261
840 Ga0207674_10000052 3300026116 Bacteria 115252
841 Ga0207674_10001714 3300026116 Bacteria 28052
842 Ga0207674_10003580 3300026116 Bacteria 18942
843 Ga0207674_10011948 3300026116 Bacteria 9735
844 Ga0207674_10071479 3300026116 Bacteria 3486
845 Ga0207674_10077341 3300026116 Bacteria 3333
846 Ga0207675_100000935 3300026118 Bacteria 29206
847 Ga0207675_100017179 3300026118 Bacteria 6758
848 Ga0207675_100024343 3300026118 Bacteria 5630
849 Ga0207675_100036219 3300026118 Bacteria 4603
850 Ga0207675_100118944 3300026118 Bacteria 2499
851 Ga0207675_100236324 3300026118 Bacteria 1764
852 Ga0207675_100538222 3300026118 Bacteria 1166
853 Ga0207683_10000109 3300026121 Bacteria 66727
854 Ga0207683_10000308 3300026121 Bacteria 44216
855 Ga0207683_10000448 3300026121 Bacteria 38154
856 Ga0207683_10001747 3300026121 Bacteria 19264
857 Ga0207683_10009182 3300026121 Bacteria 8425
858 Ga0207683_10033098 3300026121 Bacteria 4490
859 Ga0207683_10112725 3300026121 Bacteria 2436
860 Ga0207683_10160123 3300026121 Bacteria 2034
861 Ga0207698_10002172 3300026142 Bacteria 11590
862 Ga0207698_10002543 3300026142 Bacteria 10827
863 Ga0207698_10002567 3300026142 Bacteria 10783
864 Ga0207698_10013947 3300026142 Bacteria 5323
865 Ga0207698_10061510 3300026142 Bacteria 2927
866 Ga0207698_10089084 3300026142 Bacteria 2519
867 Ga0207698_10095794 3300026142 Bacteria 2444
868 Ga0207698_10208990 3300026142 Bacteria 1754
869 Ga0207698_10237335 3300026142 Bacteria 1659
870 Ga0209995_1026069 3300027471 Bacteria 975
871 Ga0209983_1002934 3300027665 Bacteria 3686
872 Ga0209983_1008217 3300027665 Bacteria 2134
873 Ga0209971_1000815 3300027682 Bacteria 8007
874 Ga0209998_10002354 3300027717 Bacteria 4363
875 Ga0209974_10107117 3300027876 Bacteria 981
876 Ga0207428_10048886 3300027907 Bacteria 3391
877 Ga0207428_10206687 3300027907 Bacteria 1476
878 Ga0268266_10010249 3300028379 Bacteria 8207
879 Ga0268266_10029384 3300028379 Bacteria 4673
880 Ga0268266_10112409 3300028379 Bacteria 2414
881 Ga0268265_10012708 3300028380 Bacteria 5713
882 Ga0268265_10025614 3300028380 Bacteria 4190
883 Ga0268265_10026921 3300028380 Bacteria 4096
884 Ga0268265_10122036 3300028380 Bacteria 2148
885 Ga0268265_10263569 3300028380 Bacteria 1533
886 Ga0268264_10002789 3300028381 Bacteria 15253
887 Ga0268264_10005553 3300028381 Bacteria 10688
888 Ga0268264_10005640 3300028381 Bacteria 10609
889 Ga0268264_10030120 3300028381 Bacteria 4449
890 Ga0268264_10039046 3300028381 Bacteria 3921
891 Ga0268264_10047823 3300028381 Bacteria 3557
892 Ga0268264_10320937 3300028381 Bacteria 1464
893 Ga0268264_10468044 3300028381 Bacteria 1224
894 Ga0268264_10636134 3300028381 Bacteria 1054
895 Ga0265316_10323379 3300031344 Bacteria 1120
896 Ga0307509_10000032 3300031507 Bacteria 202919
897 Ga0307408_100024739 3300031548 Bacteria 4104
898 Ga0307405_10005004 3300031731 Bacteria 6334
899 Ga0307405_10053724 3300031731 Bacteria 2511
900 Ga0307413_10009010 3300031824 Bacteria 4750
901 Ga0307413_10610743 3300031824 Bacteria 894
902 Ga0307410_10003008 3300031852 Bacteria 8320
903 Ga0307410_10504349 3300031852 Bacteria 996
904 Ga0307406_10005302 3300031901 Bacteria 7052
905 Ga0307406_10434972 3300031901 Bacteria 1049
906 Ga0307407_10002144 3300031903 Bacteria 7597
907 Ga0307412_10023419 3300031911 Bacteria 3799
908 Ga0307412_10028866 3300031911 Bacteria 3477
909 Ga0307412_10610668 3300031911 Bacteria 925
910 Ga0307409_100008089 3300031995 Bacteria 6350
911 Ga0307409_100022740 3300031995 Bacteria 4326
912 Ga0307409_100148154 3300031995 Bacteria 2033
913 Ga0307409_100259357 3300031995 Bacteria 1594
914 Ga0307416_100006675 3300032002 Bacteria 7240
915 Ga0307416_100020550 3300032002 Bacteria 4715
916 Ga0307416_100216478 3300032002 Bacteria 1832
917 Ga0307414_10309517 3300032004 Bacteria 1340
918 Ga0307411_10002809 3300032005 Bacteria 7844
919 Ga0307411_10278122 3300032005 Bacteria 1331
920 Ga0307415_100004096 3300032126 Bacteria 7522
921 Ga0373938_0002691 3300034957 Bacteria 2868
922 Ga0373926_0060484 3300035083 Bacteria 1380
923 Ga0373929_0042644 3300035085 Bacteria 1013
924 Ga0373934_0027703 3300035086 Bacteria 2203
925 Ga0373951_0060295 3300035091 Bacteria 949
926 Ga0373923_0264181 3300035111 Bacteria 808
927 Ga0373936_0111444 3300035113 Bacteria 1162
928 Ga0373953_0042136 3300035117 Bacteria 1818
929 Ga0373954_0041883 3300035118 Bacteria 2135
930 Ga0373956_0038992 3300035119 Bacteria 2104
931 Ga0373956_0268012 3300035119 Bacteria 812
932 Ga0373957_0012927 3300035120 Bacteria 2821
933 Ga0373943_0025786 3300035170 Bacteria 2749
934 Ga0373943_0177413 3300035170 Bacteria 1169
935 Ga0373955_0005929 3300035172 Bacteria 5530
936 Ga0373955_0159341 3300035172 Bacteria 1331
937 Ga0373961_0020263 3300035241 Bacteria 1757
938 Ga0373931_0225571 3300035691 Bacteria 1130
939 Ga0373935_0029677 3300035692 Bacteria 3385
940 Ga0373935_0152838 3300035692 Bacteria 1568
941 Ga0373927_0023145 3300035695 Bacteria 4069
942 Ga0373927_0149585 3300035695 Bacteria 1529
943 Ga0373927_0177796 3300035695 Bacteria 1395
944 Ga0373933_0219386 3300035724 Bacteria 1220
945 Ga0373933_0249504 3300035724 Bacteria 1143
946 Ga0373933_0503413 3300035724 Bacteria 794
947 Ga0373947_0045512 3300035725 Bacteria 2626
948 Ga0373947_0159058 3300035725 Bacteria 1460
949 Ga0373937_0047958 3300036401 Bacteria 3908
950 Ga0373937_0071510 3300036401 Bacteria 3199
951 Ga0373937_0151673 3300036401 Bacteria 2171
952 Ga0373937_0488064 3300036401 Bacteria 1170
953 Ga0373937_0634694 3300036401 Bacteria 1013
954 Ga0373937_0717506 3300036401 Bacteria 947
955 Ga0373925_0123963 3300037068 Bacteria 2008
956 Ga0395900_0315231 3300037418 Bacteria 1546
957 Ga0395898_0159801 3300037466 Bacteria 2155
958 Ga0395901_0258160 3300038443 Bacteria 1814
959 Ga0436363_1107351 3300039450 Bacteria 3024
960 Ga0451853_0141196 3300041512 Bacteria 1341
961 Ga0451853_1041411 3300041512 Bacteria 887
962 Ga0451853_3709595 3300041512 Bacteria 1793
963 Ga0450890_018026 3300042127 Bacteria 943
964 Ga0439464_0031216 3300042439 Bacteria 1494
965 Ga0439460_0040749 3300042461 Bacteria 1362
966 Ga0451576_0521569 3300045051 Bacteria 1248
967 Ga0451576_1070316 3300045051 Bacteria 844
968 Ga0466967_0723026 3300045976 Bacteria 987
969 Ga0495651_0038583 3300046462 Bacteria 3720
970 Ga0495580_0023293 3300046472 Bacteria 4550
971 Ga0495580_0105735 3300046472 Bacteria 1955
972 Ga0495582_0037593 3300046473 Bacteria 2662
973 Ga0495639_0050103 3300046475 Bacteria 1896
974 Ga0495662_0050061 3300046476 Bacteria 2016
975 Ga0495664_0132999 3300046477 Bacteria 1507
976 Ga0495587_0155480 3300046536 Bacteria 1303
977 Ga0495598_0043127 3300046537 Bacteria 1327
978 Ga0495621_0036320 3300046539 Bacteria 1710
979 Ga0495645_0386343 3300046543 Bacteria 894
980 Ga0495656_0204186 3300046615 Bacteria 982
981 Ga0495634_0154578 3300046642 Bacteria 1449
982 Ga0495635_0496092 3300046663 Bacteria 804
983 Ga0495659_0069824 3300046664 Bacteria 1314
984 Ga0495588_0056131 3300046674 Bacteria 2033
985 Ga0495623_0035223 3300046679 Bacteria 3209
986 Ga0495647_0021692 3300046681 Bacteria 2314
987 Ga0495647_0063769 3300046681 Bacteria 1460
988 Ga0495647_0201143 3300046681 Bacteria 874
989 Ga0495658_0012155 3300046683 Bacteria 4349
990 Ga0495658_0072465 3300046683 Bacteria 2004
991 Ga0495658_0073245 3300046683 Bacteria 1993
992 Ga0495658_0344854 3300046683 Bacteria 946
993 Ga0495669_0129282 3300046684 Bacteria 1188
994 Ga0495613_0089751 3300046689 Bacteria 2226
995 Ga0495600_0386550 3300046809 Bacteria 872
996 Ga0495581_0000428 3300047315 Bacteria 21379
997 Ga0495604_0142895 3300047317 Bacteria 1708
998 Ga0495674_0182036 3300047319 Bacteria 1750
999 Ga0495674_0245050 3300047319 Bacteria 1476
1000 Ga0495680_0036734 3300047322 Bacteria 3930
1001 Ga0495680_0071943 3300047322 Bacteria 2631
1002 Ga0495684_0316102 3300047471 Bacteria 1118
1003 Ga0495593_0103303 3300047673 Bacteria 1460
1004 Ga0495614_0054880 3300048089 Bacteria 1709
1005 Ga0496100_0017030 3300048903 Bacteria 4281
1006 Ga0496101_0136157 3300048904 Bacteria 1869
1007 Ga0496101_0189504 3300048904 Bacteria 1587
1008 Ga0496101_0236663 3300048904 Bacteria 1420
1009 Ga0496102_0018280 3300048905 Bacteria 6158
1010 Ga0496102_0023458 3300048905 Bacteria 5481
1011 Ga0496102_0399915 3300048905 Bacteria 1291
1012 Ga0496103_0056815 3300048906 Bacteria 2430
1013 Ga0496103_0069292 3300048906 Bacteria 2205
1014 Ga0496104_0004784 3300048907 Bacteria 11794
1015 Ga0496104_0006891 3300048907 Bacteria 10020
1016 Ga0496104_0194197 3300048907 Bacteria 1942
1017 Ga0496104_0489024 3300048907 Bacteria 1142
1018 Ga0496105_0017718 3300048908 Bacteria 5714
1019 Ga0496105_0018431 3300048908 Bacteria 5610
1020 Ga0496105_0019830 3300048908 Bacteria 5425
1021 Ga0496106_0001148 3300048909 Bacteria 19614
1022 Ga0496106_0203735 3300048909 Bacteria 1575
1023 Ga0496106_0233034 3300048909 Bacteria 1470
1024 Ga0496107_0003923 3300048910 Bacteria 9999
1025 Ga0496107_0038555 3300048910 Bacteria 3427
1026 Ga0496107_0159599 3300048910 Bacteria 1671
1027 Ga0496108_0005970 3300048911 Bacteria 9868
1028 Ga0496108_0185735 3300048911 Bacteria 1801
1029 Ga0496108_0334593 3300048911 Bacteria 1320
1030 Ga0496109_0008435 3300048912 Bacteria 8761
1031 Ga0496109_0088428 3300048912 Bacteria 2863
1032 Ga0496109_0164771 3300048912 Bacteria 2078
1033 Ga0496109_0232834 3300048912 Bacteria 1733
1034 Ga0496109_0403599 3300048912 Bacteria 1291
1035 Ga0496110_0051023 3300048913 Bacteria 3635
1036 Ga0496110_0212712 3300048913 Bacteria 1758
1037 Ga0496112_0116516 3300048915 Bacteria 2642
1038 Ga0496112_0286647 3300048915 Bacteria 1593
1039 Ga0496112_0839442 3300048915 Bacteria 842
1040 Ga0496114_0040616 3300048917 Bacteria 3852
1041 Ga0496114_0061047 3300048917 Bacteria 3152
1042 Ga0496114_0117969 3300048917 Bacteria 2280
1043 Ga0496114_0277628 3300048917 Bacteria 1477
1044 Ga0496115_0131495 3300048918 Bacteria 2063
1045 nmdc:mga05p37_823160_c1 3300050507 Bacteria 1012
1046 nmdc:mga08y16_34577_c1 3300050511 Bacteria 5309
1047 nmdc:mga08y16_433579_c1 3300050511 Bacteria 1342
1048 nmdc:mga08y16_43770_c1 3300050511 Bacteria 4692
1049 nmdc:mga08y16_603274_c1 3300050511 Bacteria 1106
1050 nmdc:mga0n895_220739_c1 3300050512 Bacteria 1924
1051 nmdc:mga0n895_76763_c1 3300050512 Bacteria 3322
1052 Ga0495601_0080294 3300053077 Bacteria 2093
1053 Ga0500635_0000238 3300053080 Bacteria 24308
1054 Ga0495619_0069732 3300053085 Bacteria 2350
1055 Ga0495619_0097255 3300053085 Bacteria 2000
1056 Ga0495619_0119194 3300053085 Bacteria 1809
1057 Ga0500559_0005454 3300053136 Bacteria 5849
1058 Ga0500619_000004 3300053154 Bacteria 98915

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035117 Ga0373953_0042136 Ga0373953_0042136_13_687 224
2 3300047319 Ga0495674_0182036 Ga0495674_0182036_1064_1738 224
3 3300009094 Ga0111539_10080096 Ga0111539_100800964 228
4 3300027907 Ga0207428_10206687 Ga0207428_102066871 228
5 3300050511 nmdc:mga08y16_43770_c1 nmdc:mga08y16_43770_c1_1139_1870 228
6 3300048911 Ga0496108_0185735 Ga0496108_0185735_642_1373 230
7 3300006881 Ga0068865_100221122 Ga0068865_1002211222 235
8 iso_pu_bacteria 2547132512 2548846311 239
9 3300005340 Ga0070689_100083192 Ga0070689_1000831922 240
10 3300005364 Ga0070673_100031680 Ga0070673_1000316803 240
11 3300025925 Ga0207650_10028240 Ga0207650_100282404 241
12 3300025941 Ga0207711_10160375 Ga0207711_101603752 241
13 3300032004 Ga0307414_10309517 Ga0307414_103095172 241
14 3300048911 Ga0496108_0334593 Ga0496108_0334593_407_1138 241
15 3300005327 Ga0070658_10041175 Ga0070658_100411754 242
16 3300005330 Ga0070690_100234500 Ga0070690_1002345002 242
17 3300005331 Ga0070670_100033793 Ga0070670_1000337933 242
18 3300005331 Ga0070670_100042124 Ga0070670_1000421243 242
19 3300005333 Ga0070677_10137776 Ga0070677_101377762 242
20 3300005334 Ga0068869_100028080 Ga0068869_1000280803 242
21 3300005334 Ga0068869_100083885 Ga0068869_1000838853 242
22 3300005335 Ga0070666_10053784 Ga0070666_100537843 242
23 3300005338 Ga0068868_100001312 Ga0068868_1000013125 242
24 3300005338 Ga0068868_100283169 Ga0068868_1002831692 242
25 3300005340 Ga0070689_100010208 Ga0070689_1000102085 242
26 3300005344 Ga0070661_100232380 Ga0070661_1002323801 242
27 3300005347 Ga0070668_100016442 Ga0070668_1000164423 242
28 3300005347 Ga0070668_100467137 Ga0070668_1004671372 242
29 3300005347 Ga0070668_100526183 Ga0070668_1005261832 242
30 3300005353 Ga0070669_100011414 Ga0070669_1000114143 242
31 3300005354 Ga0070675_100011069 Ga0070675_1000110697 242
32 3300005354 Ga0070675_100035886 Ga0070675_1000358863 242
33 3300005354 Ga0070675_100043188 Ga0070675_1000431882 242
34 3300005354 Ga0070675_100165650 Ga0070675_1001656502 242
35 3300005354 Ga0070675_100200331 Ga0070675_1002003312 242
36 3300005354 Ga0070675_100292170 Ga0070675_1002921701 242
37 3300005355 Ga0070671_100005191 Ga0070671_1000051913 242
38 3300005356 Ga0070674_100009763 Ga0070674_1000097633 242
39 3300005356 Ga0070674_100022007 Ga0070674_1000220073 242
40 3300005356 Ga0070674_100041689 Ga0070674_1000416893 242
41 3300005356 Ga0070674_100197934 Ga0070674_1001979342 242
42 3300005367 Ga0070667_100013734 Ga0070667_1000137342 242
43 3300005367 Ga0070667_100038485 Ga0070667_1000384852 242
44 3300005367 Ga0070667_100068830 Ga0070667_1000688302 242
45 3300005438 Ga0070701_10059373 Ga0070701_100593732 242
46 3300005456 Ga0070678_100015909 Ga0070678_1000159092 242
47 3300005456 Ga0070678_100123517 Ga0070678_1001235172 242
48 3300005457 Ga0070662_100022643 Ga0070662_1000226432 242
49 3300005457 Ga0070662_100335658 Ga0070662_1003356582 242
50 3300005459 Ga0068867_100006239 Ga0068867_1000062394 242
51 3300005466 Ga0070685_10061217 Ga0070685_100612173 242
52 3300005539 Ga0068853_100231287 Ga0068853_1002312872 242
53 3300005539 Ga0068853_100413131 Ga0068853_1004131311 242
54 3300005543 Ga0070672_100006501 Ga0070672_1000065018 242
55 3300005543 Ga0070672_100039880 Ga0070672_1000398804 242
56 3300005543 Ga0070672_100082117 Ga0070672_1000821173 242
57 3300005543 Ga0070672_100144566 Ga0070672_1001445663 242
58 3300005543 Ga0070672_100175209 Ga0070672_1001752092 242
59 3300005617 Ga0068859_100006667 Ga0068859_1000066676 242
60 3300005618 Ga0068864_100001804 Ga0068864_10000180411 242
61 3300005618 Ga0068864_100032335 Ga0068864_1000323353 242
62 3300005618 Ga0068864_100033066 Ga0068864_1000330663 242
63 3300005618 Ga0068864_100151417 Ga0068864_1001514172 242
64 3300005718 Ga0068866_10216633 Ga0068866_102166332 242
65 3300005719 Ga0068861_100089868 Ga0068861_1000898682 242
66 3300005719 Ga0068861_100238564 Ga0068861_1002385642 242
67 3300005834 Ga0068851_10003862 Ga0068851_100038628 242
68 3300005841 Ga0068863_100068510 Ga0068863_1000685103 242
69 3300005841 Ga0068863_100070375 Ga0068863_1000703752 242
70 3300005841 Ga0068863_100243029 Ga0068863_1002430292 242
71 3300005842 Ga0068858_100047276 Ga0068858_1000472762 242
72 3300005842 Ga0068858_100081322 Ga0068858_1000813222 242
73 3300005843 Ga0068860_100004248 Ga0068860_1000042482 242
74 3300005843 Ga0068860_100076628 Ga0068860_1000766282 242
75 3300005844 Ga0068862_100044686 Ga0068862_1000446863 242
76 3300006237 Ga0097621_100026847 Ga0097621_1000268474 242
77 3300006237 Ga0097621_100223769 Ga0097621_1002237692 242
78 3300006358 Ga0068871_100078455 Ga0068871_1000784553 242
79 3300006881 Ga0068865_100100703 Ga0068865_1001007032 242
80 3300006881 Ga0068865_100228452 Ga0068865_1002284522 242
81 3300006931 Ga0097620_100006667 Ga0097620_1000066676 242
82 3300009098 Ga0105245_10210750 Ga0105245_102107502 242
83 3300009148 Ga0105243_10033167 Ga0105243_100331674 242
84 3300009148 Ga0105243_10184637 Ga0105243_101846372 242
85 3300009176 Ga0105242_10019241 Ga0105242_100192414 242
86 3300009176 Ga0105242_10267156 Ga0105242_102671562 242
87 3300009177 Ga0105248_10320444 Ga0105248_103204443 242
88 3300009553 Ga0105249_10018099 Ga0105249_100180996 242
89 3300011119 Ga0105246_10885321 Ga0105246_108853211 242
90 3300013296 Ga0157374_10094555 Ga0157374_100945553 242
91 3300013297 Ga0157378_10124246 Ga0157378_101242463 242
92 3300013306 Ga0163162_10017256 Ga0163162_100172564 242
93 3300013308 Ga0157375_10022118 Ga0157375_100221185 242
94 3300013308 Ga0157375_10149764 Ga0157375_101497642 242
95 3300013308 Ga0157375_10188496 Ga0157375_101884963 242
96 3300013308 Ga0157375_10354899 Ga0157375_103548992 242
97 3300014325 Ga0163163_10066449 Ga0163163_100664493 242
98 3300014326 Ga0157380_10032035 Ga0157380_100320353 242
99 3300014326 Ga0157380_10037350 Ga0157380_100373502 242
100 3300014968 Ga0157379_10013786 Ga0157379_100137863 242
101 3300014968 Ga0157379_10028567 Ga0157379_100285673 242
102 3300014968 Ga0157379_10033662 Ga0157379_100336623 242
103 3300014969 Ga0157376_10015684 Ga0157376_100156843 242
104 3300017792 Ga0163161_10303045 Ga0163161_103030452 242
105 3300025899 Ga0207642_10121953 Ga0207642_101219532 242
106 3300025903 Ga0207680_10117338 Ga0207680_101173381 242
107 3300025905 Ga0207685_10249831 Ga0207685_102498311 242
108 3300025907 Ga0207645_10008223 Ga0207645_100082236 242
109 3300025907 Ga0207645_10016427 Ga0207645_100164273 242
110 3300025909 Ga0207705_10175394 Ga0207705_101753942 242
111 3300025909 Ga0207705_10284147 Ga0207705_102841472 242
112 3300025918 Ga0207662_10032649 Ga0207662_100326492 242
113 3300025918 Ga0207662_10036483 Ga0207662_100364833 242
114 3300025923 Ga0207681_10000431 Ga0207681_100004313 242
115 3300025925 Ga0207650_10016584 Ga0207650_100165845 242
116 3300025925 Ga0207650_10037038 Ga0207650_100370383 242
117 3300025925 Ga0207650_10120622 Ga0207650_101206222 242
118 3300025926 Ga0207659_10015982 Ga0207659_100159823 242
119 3300025926 Ga0207659_10050310 Ga0207659_100503104 242
120 3300025926 Ga0207659_10066544 Ga0207659_100665443 242
121 3300025926 Ga0207659_10137371 Ga0207659_101373712 242
122 3300025926 Ga0207659_10205262 Ga0207659_102052622 242
123 3300025926 Ga0207659_10713243 Ga0207659_107132431 242
124 3300025927 Ga0207687_10080930 Ga0207687_100809302 242
125 3300025931 Ga0207644_10039583 Ga0207644_100395832 242
126 3300025931 Ga0207644_10044626 Ga0207644_100446262 242
127 3300025931 Ga0207644_10417276 Ga0207644_104172762 242
128 3300025932 Ga0207690_10320410 Ga0207690_103204102 242
129 3300025933 Ga0207706_10032209 Ga0207706_100322092 242
130 3300025933 Ga0207706_10060595 Ga0207706_100605953 242
131 3300025933 Ga0207706_10592958 Ga0207706_105929582 242
132 3300025934 Ga0207686_10067157 Ga0207686_100671572 242
133 3300025935 Ga0207709_10041514 Ga0207709_100415143 242
134 3300025936 Ga0207670_10029194 Ga0207670_100291943 242
135 3300025937 Ga0207669_10015941 Ga0207669_100159413 242
136 3300025937 Ga0207669_10063095 Ga0207669_100630952 242
137 3300025938 Ga0207704_10020073 Ga0207704_100200733 242
138 3300025938 Ga0207704_10144311 Ga0207704_101443112 242
139 3300025940 Ga0207691_10012831 Ga0207691_100128313 242
140 3300025940 Ga0207691_10037878 Ga0207691_100378784 242
141 3300025940 Ga0207691_10046767 Ga0207691_100467672 242
142 3300025940 Ga0207691_10060755 Ga0207691_100607552 242
143 3300025940 Ga0207691_10095169 Ga0207691_100951693 242
144 3300025941 Ga0207711_10170586 Ga0207711_101705862 242
145 3300025942 Ga0207689_10045980 Ga0207689_100459803 242
146 3300025942 Ga0207689_10060061 Ga0207689_100600613 242
147 3300025945 Ga0207679_10494814 Ga0207679_104948142 242
148 3300025960 Ga0207651_10001665 Ga0207651_100016652 242
149 3300025960 Ga0207651_10020656 Ga0207651_100206563 242
150 3300025972 Ga0207668_10008622 Ga0207668_100086223 242
151 3300025972 Ga0207668_10203274 Ga0207668_102032741 242
152 3300025986 Ga0207658_10004458 Ga0207658_100044582 242
153 3300025986 Ga0207658_10026799 Ga0207658_100267995 242
154 3300026035 Ga0207703_10011462 Ga0207703_100114623 242
155 3300026035 Ga0207703_10016147 Ga0207703_100161473 242
156 3300026035 Ga0207703_10072054 Ga0207703_100720542 242
157 3300026041 Ga0207639_10185833 Ga0207639_101858332 242
158 3300026088 Ga0207641_10045583 Ga0207641_100455833 242
159 3300026088 Ga0207641_10178901 Ga0207641_101789012 242
160 3300026089 Ga0207648_10006881 Ga0207648_100068816 242
161 3300026089 Ga0207648_10068364 Ga0207648_100683642 242
162 3300026089 Ga0207648_10110771 Ga0207648_101107713 242
163 3300026089 Ga0207648_10219609 Ga0207648_102196093 242
164 3300026095 Ga0207676_10001487 Ga0207676_1000148711 242
165 3300026095 Ga0207676_10038345 Ga0207676_100383453 242
166 3300026095 Ga0207676_10091169 Ga0207676_100911692 242
167 3300026118 Ga0207675_100036219 Ga0207675_1000362192 242
168 3300026121 Ga0207683_10009182 Ga0207683_100091823 242
169 3300026121 Ga0207683_10033098 Ga0207683_100330982 242
170 3300026121 Ga0207683_10112725 Ga0207683_101127253 242
171 3300026142 Ga0207698_10061510 Ga0207698_100615103 242
172 3300026142 Ga0207698_10089084 Ga0207698_100890843 242
173 3300028380 Ga0268265_10026921 Ga0268265_100269212 242
174 3300028381 Ga0268264_10039046 Ga0268264_100390463 242
175 3300031731 Ga0307405_10053724 Ga0307405_100537242 242
176 3300031824 Ga0307413_10610743 Ga0307413_106107432 242
177 3300031911 Ga0307412_10028866 Ga0307412_100288663 242
178 3300031995 Ga0307409_100008089 Ga0307409_1000080892 242
179 3300032002 Ga0307416_100020550 Ga0307416_1000205503 242
180 3300032002 Ga0307416_100216478 Ga0307416_1002164783 242
181 3300032005 Ga0307411_10278122 Ga0307411_102781222 242
182 3300032126 Ga0307415_100004096 Ga0307415_1000040963 242
183 3300035724 Ga0373933_0249504 Ga0373933_0249504_330_1061 242
184 3300035725 Ga0373947_0045512 Ga0373947_0045512_647_1378 242
185 3300035725 Ga0373947_0159058 Ga0373947_0159058_165_896 242
186 3300036401 Ga0373937_0071510 Ga0373937_0071510_100_831 242
187 3300036401 Ga0373937_0151673 Ga0373937_0151673_24_755 242
188 3300039450 Ga0436363_1107351 Ga0436363_1107351_258_989 242
189 3300041512 Ga0451853_0141196 Ga0451853_0141196_23_754 242
190 3300041512 Ga0451853_1041411 Ga0451853_1041411_115_846 242
191 3300042439 Ga0439464_0031216 Ga0439464_0031216_149_880 242
192 3300042461 Ga0439460_0040749 Ga0439460_0040749_444_1175 242
193 3300046537 Ga0495598_0043127 Ga0495598_0043127_249_980 242
194 3300046615 Ga0495656_0204186 Ga0495656_0204186_132_863 242
195 3300046681 Ga0495647_0063769 Ga0495647_0063769_39_770 242
196 3300046683 Ga0495658_0012155 Ga0495658_0012155_562_1293 242
197 3300046809 Ga0495600_0386550 Ga0495600_0386550_41_772 242
198 3300047319 Ga0495674_0245050 Ga0495674_0245050_76_807 242
199 3300047322 Ga0495680_0071943 Ga0495680_0071943_937_1668 242
200 3300047471 Ga0495684_0316102 Ga0495684_0316102_210_941 242
201 3300048907 Ga0496104_0006891 Ga0496104_0006891_1673_2404 242
202 3300048907 Ga0496104_0194197 Ga0496104_0194197_533_1264 242
203 3300048908 Ga0496105_0019830 Ga0496105_0019830_2938_3669 242
204 3300048912 Ga0496109_0164771 Ga0496109_0164771_1148_1879 242
205 3300048915 Ga0496112_0839442 Ga0496112_0839442_13_750 242
206 3300048917 Ga0496114_0061047 Ga0496114_0061047_910_1641 242
207 3300048917 Ga0496114_0117969 Ga0496114_0117969_657_1388 242
208 3300050511 nmdc:mga08y16_603274_c1 nmdc:mga08y16_603274_c1_320_1051 242
209 3300053080 Ga0500635_0000238 Ga0500635_0000238_14217_14948 242
210 3300053085 Ga0495619_0097255 Ga0495619_0097255_917_1648 242
211 3300053085 Ga0495619_0119194 Ga0495619_0119194_912_1643 242
212 3300053136 Ga0500559_0005454 Ga0500559_0005454_1753_2484 242
213 3300053154 Ga0500619_000004 Ga0500619_000004_96047_96778 242
214 3300005327 Ga0070658_10011475 Ga0070658_100114755 243
215 3300005329 Ga0070683_100016475 Ga0070683_1000164754 243
216 3300005329 Ga0070683_100239810 Ga0070683_1002398102 243
217 3300005336 Ga0070680_100301984 Ga0070680_1003019841 243
218 3300005338 Ga0068868_100564506 Ga0068868_1005645061 243
219 3300005339 Ga0070660_100050230 Ga0070660_1000502302 243
220 3300005339 Ga0070660_100054166 Ga0070660_1000541663 243
221 3300005339 Ga0070660_100086513 Ga0070660_1000865132 243
222 3300005343 Ga0070687_100016184 Ga0070687_1000161844 243
223 3300005344 Ga0070661_100040680 Ga0070661_1000406802 243
224 3300005344 Ga0070661_100051874 Ga0070661_1000518744 243
225 3300005366 Ga0070659_100039048 Ga0070659_1000390484 243
226 3300005366 Ga0070659_100086076 Ga0070659_1000860763 243
227 3300005435 Ga0070714_100051247 Ga0070714_1000512474 243
228 3300005441 Ga0070700_100001933 Ga0070700_1000019335 243
229 3300005441 Ga0070700_100016376 Ga0070700_1000163765 243
230 3300005458 Ga0070681_10038204 Ga0070681_100382043 243
231 3300005458 Ga0070681_10137360 Ga0070681_101373603 243
232 3300005458 Ga0070681_10186610 Ga0070681_101866102 243
233 3300005466 Ga0070685_10013683 Ga0070685_100136832 243
234 3300005530 Ga0070679_100218731 Ga0070679_1002187312 243
235 3300005535 Ga0070684_100031580 Ga0070684_1000315804 243
236 3300005539 Ga0068853_100003997 Ga0068853_1000039973 243
237 3300005539 Ga0068853_100068600 Ga0068853_1000686002 243
238 3300005547 Ga0070693_100515906 Ga0070693_1005159061 243
239 3300005563 Ga0068855_100001454 Ga0068855_10000145412 243
240 3300005563 Ga0068855_100373267 Ga0068855_1003732673 243
241 3300005563 Ga0068855_100513137 Ga0068855_1005131371 243
242 3300005564 Ga0070664_100014182 Ga0070664_1000141824 243
243 3300005577 Ga0068857_100051501 Ga0068857_1000515013 243
244 3300005578 Ga0068854_100039141 Ga0068854_1000391414 243
245 3300005614 Ga0068856_100028792 Ga0068856_1000287925 243
246 3300005614 Ga0068856_100085935 Ga0068856_1000859351 243
247 3300005616 Ga0068852_100045670 Ga0068852_1000456702 243
248 3300005616 Ga0068852_100127268 Ga0068852_1001272683 243
249 3300005616 Ga0068852_100482208 Ga0068852_1004822082 243
250 3300005719 Ga0068861_100000428 Ga0068861_10000042817 243
251 3300005834 Ga0068851_10007291 Ga0068851_100072914 243
252 3300005841 Ga0068863_100145309 Ga0068863_1001453094 243
253 3300005844 Ga0068862_100000409 Ga0068862_10000040945 243
254 3300006175 Ga0070712_100549397 Ga0070712_1005493972 243
255 3300009093 Ga0105240_10078965 Ga0105240_100789654 243
256 3300009093 Ga0105240_10411872 Ga0105240_104118723 243
257 3300009174 Ga0105241_10047890 Ga0105241_100478904 243
258 3300009177 Ga0105248_10064325 Ga0105248_100643253 243
259 3300009545 Ga0105237_10131355 Ga0105237_101313553 243
260 3300009551 Ga0105238_10017350 Ga0105238_100173502 243
261 3300009553 Ga0105249_10002440 Ga0105249_1000244018 243
262 3300010375 Ga0105239_10119149 Ga0105239_101191493 243
263 3300013100 Ga0157373_10004614 Ga0157373_1000461412 243
264 3300013102 Ga0157371_10121345 Ga0157371_101213452 243
265 3300013104 Ga0157370_10016110 Ga0157370_100161103 243
266 3300013104 Ga0157370_10059323 Ga0157370_100593233 243
267 3300013105 Ga0157369_10105901 Ga0157369_101059011 243
268 3300013105 Ga0157369_10149884 Ga0157369_101498843 243
269 3300013105 Ga0157369_10318754 Ga0157369_103187542 243
270 3300013296 Ga0157374_10317112 Ga0157374_103171122 243
271 3300013307 Ga0157372_10158952 Ga0157372_101589523 243
272 3300013307 Ga0157372_10162300 Ga0157372_101623002 243
273 3300013307 Ga0157372_10295772 Ga0157372_102957723 243
274 3300014745 Ga0157377_10045326 Ga0157377_100453263 243
275 3300014745 Ga0157377_10123064 Ga0157377_101230642 243
276 3300014969 Ga0157376_10003761 Ga0157376_100037619 243
277 3300020070 Ga0206356_11467867 Ga0206356_114678673 243
278 3300020081 Ga0206354_10294245 Ga0206354_102942452 243
279 3300020082 Ga0206353_12026708 Ga0206353_120267082 243
280 3300025321 Ga0207656_10008514 Ga0207656_100085144 243
281 3300025901 Ga0207688_10003793 Ga0207688_100037935 243
282 3300025901 Ga0207688_10025400 Ga0207688_100254003 243
283 3300025909 Ga0207705_10015828 Ga0207705_100158282 243
284 3300025911 Ga0207654_10035150 Ga0207654_100351502 243
285 3300025912 Ga0207707_10002449 Ga0207707_1000244918 243
286 3300025912 Ga0207707_10178339 Ga0207707_101783392 243
287 3300025912 Ga0207707_10341106 Ga0207707_103411062 243
288 3300025913 Ga0207695_10011326 Ga0207695_100113267 243
289 3300025916 Ga0207663_10130019 Ga0207663_101300193 243
290 3300025917 Ga0207660_10002462 Ga0207660_100024626 243
291 3300025917 Ga0207660_10300631 Ga0207660_103006312 243
292 3300025919 Ga0207657_10000045 Ga0207657_1000004560 243
293 3300025919 Ga0207657_10011950 Ga0207657_100119504 243
294 3300025919 Ga0207657_10087669 Ga0207657_100876692 243
295 3300025920 Ga0207649_10008368 Ga0207649_100083682 243
296 3300025920 Ga0207649_10044013 Ga0207649_100440132 243
297 3300025921 Ga0207652_10001996 Ga0207652_1000199610 243
298 3300025924 Ga0207694_10002970 Ga0207694_100029708 243
299 3300025925 Ga0207650_10188387 Ga0207650_101883872 243
300 3300025926 Ga0207659_10044602 Ga0207659_100446022 243
301 3300025929 Ga0207664_10036940 Ga0207664_100369402 243
302 3300025932 Ga0207690_10029050 Ga0207690_100290503 243
303 3300025935 Ga0207709_10004901 Ga0207709_100049017 243
304 3300025939 Ga0207665_10135157 Ga0207665_101351572 243
305 3300025940 Ga0207691_10486846 Ga0207691_104868462 243
306 3300025942 Ga0207689_10034583 Ga0207689_100345833 243
307 3300025944 Ga0207661_10004402 Ga0207661_100044023 243
308 3300025945 Ga0207679_10055814 Ga0207679_100558143 243
309 3300025949 Ga0207667_10001516 Ga0207667_1000151614 243
310 3300025960 Ga0207651_10292523 Ga0207651_102925232 243
311 3300025981 Ga0207640_10055730 Ga0207640_100557302 243
312 3300026023 Ga0207677_10000245 Ga0207677_1000024510 243
313 3300026035 Ga0207703_10156884 Ga0207703_101568843 243
314 3300026041 Ga0207639_10003022 Ga0207639_100030227 243
315 3300026041 Ga0207639_10053690 Ga0207639_100536904 243
316 3300026067 Ga0207678_10006813 Ga0207678_100068133 243
317 3300026075 Ga0207708_10001534 Ga0207708_1000153415 243
318 3300026078 Ga0207702_10011817 Ga0207702_100118177 243
319 3300026078 Ga0207702_10015429 Ga0207702_100154294 243
320 3300026088 Ga0207641_10511149 Ga0207641_105111492 243
321 3300026095 Ga0207676_10414734 Ga0207676_104147342 243
322 3300026116 Ga0207674_10000052 Ga0207674_1000005280 243
323 3300026116 Ga0207674_10071479 Ga0207674_100714792 243
324 3300026142 Ga0207698_10002172 Ga0207698_100021723 243
325 3300026142 Ga0207698_10013947 Ga0207698_100139472 243
326 3300026142 Ga0207698_10095794 Ga0207698_100957943 243
327 3300028380 Ga0268265_10012708 Ga0268265_100127084 243
328 3300028380 Ga0268265_10263569 Ga0268265_102635693 243
329 3300031344 Ga0265316_10323379 Ga0265316_103233792 243
330 3300031507 Ga0307509_10000032 Ga0307509_100000323 243
331 3300031852 Ga0307410_10504349 Ga0307410_105043491 243
332 3300031901 Ga0307406_10434972 Ga0307406_104349722 243
333 3300031995 Ga0307409_100148154 Ga0307409_1001481543 243
334 3300031995 Ga0307409_100259357 Ga0307409_1002593572 243
335 3300034957 Ga0373938_0002691 Ga0373938_0002691_1985_2719 243
336 3300035085 Ga0373929_0042644 Ga0373929_0042644_222_980 243
337 3300037418 Ga0395900_0315231 Ga0395900_0315231_418_1149 243
338 3300037466 Ga0395898_0159801 Ga0395898_0159801_423_1154 243
339 3300038443 Ga0395901_0258160 Ga0395901_0258160_827_1558 243
340 3300042127 Ga0450890_018026 Ga0450890_018026_101_832 243
341 3300045051 Ga0451576_0521569 Ga0451576_0521569_181_912 243
342 3300045051 Ga0451576_1070316 Ga0451576_1070316_56_805 243
343 3300045976 Ga0466967_0723026 Ga0466967_0723026_70_801 243
344 3300046539 Ga0495621_0036320 Ga0495621_0036320_444_1178 243
345 3300046681 Ga0495647_0201143 Ga0495647_0201143_38_772 243
346 3300046683 Ga0495658_0072465 Ga0495658_0072465_1110_1844 243
347 3300050511 nmdc:mga08y16_433579_c1 nmdc:mga08y16_433579_c1_425_1159 243
348 3300001976 JGI24752J21851_1003866 JGI24752J21851_10038662 244
349 3300002070 JGI24750J21931_1014609 JGI24750J21931_10146091 244
350 3300002244 JGI24742J22300_10009794 JGI24742J22300_100097942 244
351 3300002459 JGI24751J29686_10055083 JGI24751J29686_100550831 244
352 3300005290 Ga0065712_10185470 Ga0065712_101854701 244
353 3300005293 Ga0065715_10111911 Ga0065715_101119113 244
354 3300005293 Ga0065715_10337776 Ga0065715_103377761 244
355 3300005328 Ga0070676_10000281 Ga0070676_100002817 244
356 3300005328 Ga0070676_10001759 Ga0070676_100017598 244
357 3300005328 Ga0070676_10259212 Ga0070676_102592122 244
358 3300005329 Ga0070683_100024289 Ga0070683_1000242894 244
359 3300005329 Ga0070683_100084578 Ga0070683_1000845781 244
360 3300005330 Ga0070690_100031724 Ga0070690_1000317242 244
361 3300005330 Ga0070690_100038616 Ga0070690_1000386163 244
362 3300005330 Ga0070690_100065714 Ga0070690_1000657143 244
363 3300005331 Ga0070670_100014893 Ga0070670_1000148934 244
364 3300005331 Ga0070670_100023549 Ga0070670_1000235495 244
365 3300005331 Ga0070670_100050046 Ga0070670_1000500464 244
366 3300005331 Ga0070670_100090931 Ga0070670_1000909312 244
367 3300005331 Ga0070670_100110824 Ga0070670_1001108242 244
368 3300005331 Ga0070670_100150020 Ga0070670_1001500201 244
369 3300005331 Ga0070670_100166284 Ga0070670_1001662843 244
370 3300005333 Ga0070677_10061838 Ga0070677_100618381 244
371 3300005334 Ga0068869_100000624 Ga0068869_10000062411 244
372 3300005334 Ga0068869_100002125 Ga0068869_1000021253 244
373 3300005334 Ga0068869_100098442 Ga0068869_1000984423 244
374 3300005334 Ga0068869_100228265 Ga0068869_1002282652 244
375 3300005334 Ga0068869_100454010 Ga0068869_1004540102 244
376 3300005335 Ga0070666_10000739 Ga0070666_1000073910 244
377 3300005335 Ga0070666_10004779 Ga0070666_100047793 244
378 3300005335 Ga0070666_10260404 Ga0070666_102604041 244
379 3300005335 Ga0070666_10349203 Ga0070666_103492032 244
380 3300005336 Ga0070680_100009316 Ga0070680_1000093162 244
381 3300005336 Ga0070680_100038303 Ga0070680_1000383032 244
382 3300005337 Ga0070682_100047121 Ga0070682_1000471212 244
383 3300005338 Ga0068868_100005791 Ga0068868_1000057916 244
384 3300005338 Ga0068868_100014994 Ga0068868_1000149941 244
385 3300005338 Ga0068868_100031446 Ga0068868_1000314463 244
386 3300005338 Ga0068868_100038081 Ga0068868_1000380813 244
387 3300005338 Ga0068868_100138325 Ga0068868_1001383253 244
388 3300005338 Ga0068868_100781331 Ga0068868_1007813311 244
389 3300005339 Ga0070660_100001403 Ga0070660_10000140312 244
390 3300005339 Ga0070660_100095448 Ga0070660_1000954482 244
391 3300005339 Ga0070660_100339225 Ga0070660_1003392251 244
392 3300005340 Ga0070689_100003227 Ga0070689_1000032278 244
393 3300005340 Ga0070689_100010115 Ga0070689_1000101153 244
394 3300005340 Ga0070689_100263510 Ga0070689_1002635102 244
395 3300005341 Ga0070691_10046915 Ga0070691_100469152 244
396 3300005343 Ga0070687_100030760 Ga0070687_1000307602 244
397 3300005344 Ga0070661_100011388 Ga0070661_1000113885 244
398 3300005344 Ga0070661_100013381 Ga0070661_1000133813 244
399 3300005344 Ga0070661_100073781 Ga0070661_1000737813 244
400 3300005345 Ga0070692_10018855 Ga0070692_100188554 244
401 3300005345 Ga0070692_10081162 Ga0070692_100811622 244
402 3300005347 Ga0070668_100000206 Ga0070668_10000020622 244
403 3300005347 Ga0070668_100003475 Ga0070668_1000034759 244
404 3300005347 Ga0070668_100008195 Ga0070668_1000081954 244
405 3300005347 Ga0070668_100039274 Ga0070668_1000392743 244
406 3300005347 Ga0070668_100338579 Ga0070668_1003385792 244
407 3300005353 Ga0070669_100000604 Ga0070669_10000060426 244
408 3300005353 Ga0070669_100038941 Ga0070669_1000389414 244
409 3300005353 Ga0070669_100060921 Ga0070669_1000609213 244
410 3300005353 Ga0070669_100071035 Ga0070669_1000710352 244
411 3300005353 Ga0070669_100116098 Ga0070669_1001160982 244
412 3300005353 Ga0070669_100225456 Ga0070669_1002254562 244
413 3300005353 Ga0070669_100499727 Ga0070669_1004997272 244
414 3300005354 Ga0070675_100006093 Ga0070675_1000060939 244
415 3300005354 Ga0070675_100015758 Ga0070675_1000157585 244
416 3300005354 Ga0070675_100028476 Ga0070675_1000284763 244
417 3300005354 Ga0070675_100059461 Ga0070675_1000594613 244
418 3300005354 Ga0070675_100062846 Ga0070675_1000628462 244
419 3300005355 Ga0070671_100000272 Ga0070671_10000027217 244
420 3300005355 Ga0070671_100008903 Ga0070671_1000089038 244
421 3300005355 Ga0070671_100009651 Ga0070671_1000096513 244
422 3300005355 Ga0070671_100012546 Ga0070671_1000125463 244
423 3300005355 Ga0070671_100016921 Ga0070671_1000169216 244
424 3300005355 Ga0070671_100028836 Ga0070671_1000288362 244
425 3300005355 Ga0070671_100029292 Ga0070671_1000292922 244
426 3300005355 Ga0070671_100562546 Ga0070671_1005625461 244
427 3300005356 Ga0070674_100005378 Ga0070674_1000053783 244
428 3300005356 Ga0070674_100011367 Ga0070674_1000113674 244
429 3300005356 Ga0070674_100073738 Ga0070674_1000737382 244
430 3300005356 Ga0070674_100108926 Ga0070674_1001089263 244
431 3300005364 Ga0070673_100000624 Ga0070673_1000006244 244
432 3300005364 Ga0070673_100024604 Ga0070673_1000246042 244
433 3300005364 Ga0070673_100076100 Ga0070673_1000761002 244
434 3300005364 Ga0070673_100152987 Ga0070673_1001529872 244
435 3300005365 Ga0070688_100000866 Ga0070688_10000086614 244
436 3300005366 Ga0070659_100009914 Ga0070659_1000099144 244
437 3300005366 Ga0070659_100053499 Ga0070659_1000534994 244
438 3300005366 Ga0070659_100065540 Ga0070659_1000655404 244
439 3300005366 Ga0070659_100568947 Ga0070659_1005689471 244
440 3300005367 Ga0070667_100001933 Ga0070667_1000019336 244
441 3300005367 Ga0070667_100010773 Ga0070667_1000107736 244
442 3300005367 Ga0070667_100029876 Ga0070667_1000298762 244
443 3300005367 Ga0070667_100090389 Ga0070667_1000903892 244
444 3300005367 Ga0070667_100101038 Ga0070667_1001010381 244
445 3300005367 Ga0070667_100105589 Ga0070667_1001055893 244
446 3300005367 Ga0070667_100130145 Ga0070667_1001301453 244
447 3300005367 Ga0070667_100220635 Ga0070667_1002206353 244
448 3300005434 Ga0070709_10006716 Ga0070709_100067162 244
449 3300005434 Ga0070709_10034791 Ga0070709_100347913 244
450 3300005435 Ga0070714_100102002 Ga0070714_1001020023 244
451 3300005436 Ga0070713_100021313 Ga0070713_1000213132 244
452 3300005436 Ga0070713_100057311 Ga0070713_1000573113 244
453 3300005436 Ga0070713_100162694 Ga0070713_1001626942 244
454 3300005437 Ga0070710_10026218 Ga0070710_100262182 244
455 3300005437 Ga0070710_10084431 Ga0070710_100844311 244
456 3300005437 Ga0070710_10385305 Ga0070710_103853051 244
457 3300005438 Ga0070701_10017768 Ga0070701_100177683 244
458 3300005438 Ga0070701_10038512 Ga0070701_100385123 244
459 3300005438 Ga0070701_10050383 Ga0070701_100503833 244
460 3300005439 Ga0070711_100015970 Ga0070711_1000159704 244
461 3300005439 Ga0070711_100096448 Ga0070711_1000964483 244
462 3300005439 Ga0070711_100269933 Ga0070711_1002699332 244
463 3300005441 Ga0070700_100084305 Ga0070700_1000843053 244
464 3300005445 Ga0070708_100000522 Ga0070708_10000052216 244
465 3300005445 Ga0070708_100248018 Ga0070708_1002480182 244
466 3300005455 Ga0070663_100029934 Ga0070663_1000299344 244
467 3300005455 Ga0070663_100285960 Ga0070663_1002859602 244
468 3300005455 Ga0070663_100548293 Ga0070663_1005482932 244
469 3300005456 Ga0070678_100001322 Ga0070678_1000013223 244
470 3300005456 Ga0070678_100015222 Ga0070678_1000152222 244
471 3300005456 Ga0070678_100042337 Ga0070678_1000423374 244
472 3300005456 Ga0070678_100252404 Ga0070678_1002524042 244
473 3300005456 Ga0070678_100302255 Ga0070678_1003022552 244
474 3300005457 Ga0070662_100000594 Ga0070662_10000059419 244
475 3300005457 Ga0070662_100039703 Ga0070662_1000397033 244
476 3300005457 Ga0070662_100065823 Ga0070662_1000658232 244
477 3300005457 Ga0070662_100134285 Ga0070662_1001342852 244
478 3300005457 Ga0070662_100641886 Ga0070662_1006418861 244
479 3300005458 Ga0070681_10385279 Ga0070681_103852792 244
480 3300005458 Ga0070681_10595592 Ga0070681_105955921 244
481 3300005459 Ga0068867_100009445 Ga0068867_1000094455 244
482 3300005459 Ga0068867_100011828 Ga0068867_1000118282 244
483 3300005459 Ga0068867_100053493 Ga0068867_1000534932 244
484 3300005459 Ga0068867_100144360 Ga0068867_1001443602 244
485 3300005466 Ga0070685_10001494 Ga0070685_100014944 244
486 3300005466 Ga0070685_10021405 Ga0070685_100214052 244
487 3300005466 Ga0070685_10095033 Ga0070685_100950332 244
488 3300005467 Ga0070706_100076561 Ga0070706_1000765612 244
489 3300005530 Ga0070679_100077478 Ga0070679_1000774784 244
490 3300005530 Ga0070679_100125620 Ga0070679_1001256201 244
491 3300005530 Ga0070679_100136429 Ga0070679_1001364293 244
492 3300005535 Ga0070684_100062973 Ga0070684_1000629734 244
493 3300005535 Ga0070684_100065959 Ga0070684_1000659594 244
494 3300005535 Ga0070684_100216084 Ga0070684_1002160843 244
495 3300005535 Ga0070684_100393688 Ga0070684_1003936882 244
496 3300005539 Ga0068853_100005776 Ga0068853_1000057762 244
497 3300005539 Ga0068853_100009009 Ga0068853_1000090094 244
498 3300005539 Ga0068853_100017010 Ga0068853_1000170105 244
499 3300005539 Ga0068853_100212067 Ga0068853_1002120671 244
500 3300005539 Ga0068853_100491813 Ga0068853_1004918132 244
501 3300005543 Ga0070672_100001908 Ga0070672_1000019084 244
502 3300005543 Ga0070672_100012404 Ga0070672_1000124045 244
503 3300005543 Ga0070672_100044411 Ga0070672_1000444113 244
504 3300005543 Ga0070672_100052237 Ga0070672_1000522374 244
505 3300005543 Ga0070672_100064203 Ga0070672_1000642032 244
506 3300005544 Ga0070686_100020885 Ga0070686_1000208854 244
507 3300005545 Ga0070695_100062767 Ga0070695_1000627672 244
508 3300005546 Ga0070696_100025279 Ga0070696_1000252794 244
509 3300005546 Ga0070696_100253571 Ga0070696_1002535712 244
510 3300005546 Ga0070696_100258487 Ga0070696_1002584872 244
511 3300005547 Ga0070693_100022716 Ga0070693_1000227163 244
512 3300005547 Ga0070693_100172645 Ga0070693_1001726452 244
513 3300005547 Ga0070693_100184552 Ga0070693_1001845522 244
514 3300005548 Ga0070665_100001632 Ga0070665_10000163213 244
515 3300005548 Ga0070665_100002580 Ga0070665_1000025805 244
516 3300005548 Ga0070665_100035138 Ga0070665_1000351384 244
517 3300005548 Ga0070665_100046717 Ga0070665_1000467174 244
518 3300005548 Ga0070665_100112726 Ga0070665_1001127263 244
519 3300005563 Ga0068855_100176966 Ga0068855_1001769663 244
520 3300005563 Ga0068855_100298230 Ga0068855_1002982303 244
521 3300005563 Ga0068855_100457053 Ga0068855_1004570532 244
522 3300005564 Ga0070664_100010675 Ga0070664_1000106754 244
523 3300005564 Ga0070664_100037693 Ga0070664_1000376934 244
524 3300005564 Ga0070664_100041004 Ga0070664_1000410042 244
525 3300005564 Ga0070664_100042731 Ga0070664_1000427313 244
526 3300005564 Ga0070664_100061518 Ga0070664_1000615184 244
527 3300005564 Ga0070664_100210235 Ga0070664_1002102352 244
528 3300005577 Ga0068857_100001513 Ga0068857_10000151319 244
529 3300005577 Ga0068857_100034426 Ga0068857_1000344264 244
530 3300005578 Ga0068854_100010797 Ga0068854_1000107975 244
531 3300005578 Ga0068854_100025805 Ga0068854_1000258052 244
532 3300005578 Ga0068854_100036850 Ga0068854_1000368502 244
533 3300005578 Ga0068854_100063078 Ga0068854_1000630784 244
534 3300005578 Ga0068854_100189677 Ga0068854_1001896772 244
535 3300005578 Ga0068854_100295797 Ga0068854_1002957972 244
536 3300005578 Ga0068854_100431482 Ga0068854_1004314821 244
537 3300005614 Ga0068856_100000093 Ga0068856_10000009326 244
538 3300005614 Ga0068856_100012134 Ga0068856_1000121348 244
539 3300005614 Ga0068856_100032574 Ga0068856_1000325744 244
540 3300005614 Ga0068856_100681437 Ga0068856_1006814372 244
541 3300005615 Ga0070702_100018906 Ga0070702_1000189064 244
542 3300005615 Ga0070702_100265429 Ga0070702_1002654291 244
543 3300005616 Ga0068852_100007253 Ga0068852_1000072533 244
544 3300005616 Ga0068852_100077771 Ga0068852_1000777713 244
545 3300005616 Ga0068852_100481064 Ga0068852_1004810642 244
546 3300005617 Ga0068859_100001177 Ga0068859_10000117724 244
547 3300005617 Ga0068859_100006143 Ga0068859_1000061436 244
548 3300005617 Ga0068859_100010198 Ga0068859_10001019810 244
549 3300005617 Ga0068859_100091493 Ga0068859_1000914934 244
550 3300005617 Ga0068859_100140612 Ga0068859_1001406122 244
551 3300005617 Ga0068859_100545529 Ga0068859_1005455292 244
552 3300005618 Ga0068864_100001668 Ga0068864_1000016683 244
553 3300005618 Ga0068864_100009196 Ga0068864_1000091962 244
554 3300005618 Ga0068864_100017079 Ga0068864_1000170796 244
555 3300005618 Ga0068864_100028460 Ga0068864_1000284602 244
556 3300005618 Ga0068864_100063670 Ga0068864_1000636704 244
557 3300005618 Ga0068864_100168837 Ga0068864_1001688372 244
558 3300005718 Ga0068866_10000752 Ga0068866_100007528 244
559 3300005718 Ga0068866_10124830 Ga0068866_101248302 244
560 3300005719 Ga0068861_100006340 Ga0068861_1000063406 244
561 3300005719 Ga0068861_100061066 Ga0068861_1000610664 244
562 3300005719 Ga0068861_100303331 Ga0068861_1003033312 244
563 3300005834 Ga0068851_10001497 Ga0068851_100014974 244
564 3300005834 Ga0068851_10003446 Ga0068851_100034465 244
565 3300005834 Ga0068851_10009409 Ga0068851_100094092 244
566 3300005840 Ga0068870_10013653 Ga0068870_100136534 244
567 3300005840 Ga0068870_10218992 Ga0068870_102189922 244
568 3300005841 Ga0068863_100002038 Ga0068863_1000020386 244
569 3300005841 Ga0068863_100002517 Ga0068863_10000251719 244
570 3300005841 Ga0068863_100030434 Ga0068863_1000304344 244
571 3300005841 Ga0068863_100052076 Ga0068863_1000520764 244
572 3300005841 Ga0068863_100248799 Ga0068863_1002487992 244
573 3300005842 Ga0068858_100003597 Ga0068858_10000359713 244
574 3300005842 Ga0068858_100003715 Ga0068858_10000371514 244
575 3300005842 Ga0068858_100011086 Ga0068858_1000110864 244
576 3300005842 Ga0068858_100030738 Ga0068858_1000307384 244
577 3300005842 Ga0068858_100031497 Ga0068858_1000314972 244
578 3300005842 Ga0068858_100104325 Ga0068858_1001043253 244
579 3300005843 Ga0068860_100001191 Ga0068860_10000119117 244
580 3300005843 Ga0068860_100005963 Ga0068860_1000059639 244
581 3300005843 Ga0068860_100020059 Ga0068860_1000200595 244
582 3300005843 Ga0068860_100023366 Ga0068860_1000233665 244
583 3300005843 Ga0068860_100085294 Ga0068860_1000852944 244
584 3300005843 Ga0068860_100589733 Ga0068860_1005897332 244
585 3300005844 Ga0068862_100002844 Ga0068862_10000284416 244
586 3300005844 Ga0068862_100081892 Ga0068862_1000818923 244
587 3300005844 Ga0068862_100169518 Ga0068862_1001695182 244
588 3300006173 Ga0070716_100008216 Ga0070716_1000082163 244
589 3300006173 Ga0070716_100024302 Ga0070716_1000243024 244
590 3300006175 Ga0070712_100013494 Ga0070712_1000134946 244
591 3300006175 Ga0070712_100212929 Ga0070712_1002129292 244
592 3300006237 Ga0097621_100002130 Ga0097621_1000021302 244
593 3300006237 Ga0097621_100003222 Ga0097621_1000032229 244
594 3300006237 Ga0097621_100107586 Ga0097621_1001075863 244
595 3300006237 Ga0097621_100136561 Ga0097621_1001365612 244
596 3300006237 Ga0097621_100152147 Ga0097621_1001521473 244
597 3300006358 Ga0068871_100000472 Ga0068871_10000047224 244
598 3300006358 Ga0068871_100025411 Ga0068871_1000254114 244
599 3300006358 Ga0068871_100089196 Ga0068871_1000891962 244
600 3300006844 Ga0075428_100080294 Ga0075428_1000802942 244
601 3300006871 Ga0075434_100100301 Ga0075434_1001003014 244
602 3300006871 Ga0075434_100355039 Ga0075434_1003550392 244
603 3300006881 Ga0068865_100000366 Ga0068865_1000003665 244
604 3300006881 Ga0068865_100003716 Ga0068865_1000037162 244
605 3300006881 Ga0068865_100017913 Ga0068865_1000179133 244
606 3300006881 Ga0068865_100046169 Ga0068865_1000461693 244
607 3300006931 Ga0097620_100001177 Ga0097620_1000011773 244
608 3300006931 Ga0097620_100006144 Ga0097620_1000061447 244
609 3300006931 Ga0097620_100010198 Ga0097620_10001019810 244
610 3300006931 Ga0097620_100091491 Ga0097620_1000914914 244
611 3300006931 Ga0097620_100140615 Ga0097620_1001406153 244
612 3300006931 Ga0097620_100545553 Ga0097620_1005455532 244
613 3300009093 Ga0105240_10005083 Ga0105240_1000508314 244
614 3300009093 Ga0105240_10173874 Ga0105240_101738744 244
615 3300009094 Ga0111539_10062708 Ga0111539_100627083 244
616 3300009098 Ga0105245_10048386 Ga0105245_100483863 244
617 3300009098 Ga0105245_10050130 Ga0105245_100501303 244
618 3300009098 Ga0105245_10111078 Ga0105245_101110783 244
619 3300009101 Ga0105247_10005062 Ga0105247_100050623 244
620 3300009101 Ga0105247_10090325 Ga0105247_100903252 244
621 3300009101 Ga0105247_10152910 Ga0105247_101529102 244
622 3300009147 Ga0114129_10933313 Ga0114129_109333132 244
623 3300009148 Ga0105243_10177998 Ga0105243_101779982 244
624 3300009148 Ga0105243_10253249 Ga0105243_102532492 244
625 3300009176 Ga0105242_10027342 Ga0105242_100273424 244
626 3300009176 Ga0105242_10139869 Ga0105242_101398693 244
627 3300009176 Ga0105242_10176922 Ga0105242_101769222 244
628 3300009177 Ga0105248_10001670 Ga0105248_1000167021 244
629 3300009177 Ga0105248_10079981 Ga0105248_100799813 244
630 3300009177 Ga0105248_10166967 Ga0105248_101669673 244
631 3300009177 Ga0105248_10168288 Ga0105248_101682883 244
632 3300009177 Ga0105248_10402241 Ga0105248_104022412 244
633 3300009177 Ga0105248_10486843 Ga0105248_104868432 244
634 3300009545 Ga0105237_10781048 Ga0105237_107810481 244
635 3300009551 Ga0105238_10123699 Ga0105238_101236992 244
636 3300009551 Ga0105238_10518137 Ga0105238_105181372 244
637 3300009553 Ga0105249_10039473 Ga0105249_100394733 244
638 3300009553 Ga0105249_10078405 Ga0105249_100784052 244
639 3300009553 Ga0105249_10122113 Ga0105249_101221133 244
640 3300009553 Ga0105249_10822762 Ga0105249_108227622 244
641 3300010375 Ga0105239_10141949 Ga0105239_101419493 244
642 3300010375 Ga0105239_10186504 Ga0105239_101865044 244
643 3300010375 Ga0105239_10627233 Ga0105239_106272332 244
644 3300011119 Ga0105246_10056170 Ga0105246_100561703 244
645 3300011119 Ga0105246_10069155 Ga0105246_100691552 244
646 3300011119 Ga0105246_10154095 Ga0105246_101540952 244
647 3300013100 Ga0157373_10026087 Ga0157373_100260874 244
648 3300013100 Ga0157373_10069848 Ga0157373_100698484 244
649 3300013100 Ga0157373_10087402 Ga0157373_100874022 244
650 3300013102 Ga0157371_10001206 Ga0157371_1000120627 244
651 3300013102 Ga0157371_10064768 Ga0157371_100647682 244
652 3300013104 Ga0157370_10015284 Ga0157370_100152848 244
653 3300013104 Ga0157370_10027099 Ga0157370_100270992 244
654 3300013105 Ga0157369_10221084 Ga0157369_102210842 244
655 3300013105 Ga0157369_10417520 Ga0157369_104175202 244
656 3300013105 Ga0157369_10608580 Ga0157369_106085802 244
657 3300013296 Ga0157374_10000508 Ga0157374_1000050813 244
658 3300013296 Ga0157374_10007944 Ga0157374_100079445 244
659 3300013296 Ga0157374_10014725 Ga0157374_100147253 244
660 3300013296 Ga0157374_10134107 Ga0157374_101341072 244
661 3300013297 Ga0157378_10057263 Ga0157378_100572634 244
662 3300013297 Ga0157378_10086953 Ga0157378_100869532 244
663 3300013297 Ga0157378_10091572 Ga0157378_100915722 244
664 3300013297 Ga0157378_10093755 Ga0157378_100937553 244
665 3300013297 Ga0157378_10116835 Ga0157378_101168353 244
666 3300013297 Ga0157378_10173745 Ga0157378_101737452 244
667 3300013297 Ga0157378_10462613 Ga0157378_104626131 244
668 3300013297 Ga0157378_10554302 Ga0157378_105543021 244
669 3300013306 Ga0163162_10000619 Ga0163162_1000061915 244
670 3300013306 Ga0163162_10114868 Ga0163162_101148683 244
671 3300013306 Ga0163162_10180994 Ga0163162_101809943 244
672 3300013307 Ga0157372_10004601 Ga0157372_100046013 244
673 3300013307 Ga0157372_10059742 Ga0157372_100597424 244
674 3300013307 Ga0157372_10403039 Ga0157372_104030392 244
675 3300013307 Ga0157372_10409952 Ga0157372_104099523 244
676 3300013308 Ga0157375_10007078 Ga0157375_100070787 244
677 3300013308 Ga0157375_10009046 Ga0157375_100090468 244
678 3300013308 Ga0157375_10115611 Ga0157375_101156112 244
679 3300013308 Ga0157375_10174736 Ga0157375_101747361 244
680 3300013308 Ga0157375_10255169 Ga0157375_102551692 244
681 3300013308 Ga0157375_11503945 Ga0157375_115039451 244
682 3300014325 Ga0163163_10011502 Ga0163163_1001150210 244
683 3300014325 Ga0163163_10158110 Ga0163163_101581103 244
684 3300014325 Ga0163163_10323139 Ga0163163_103231392 244
685 3300014325 Ga0163163_10530139 Ga0163163_105301392 244
686 3300014326 Ga0157380_10041023 Ga0157380_100410234 244
687 3300014326 Ga0157380_10201322 Ga0157380_102013222 244
688 3300014745 Ga0157377_10012271 Ga0157377_100122715 244
689 3300014745 Ga0157377_10160777 Ga0157377_101607772 244
690 3300014968 Ga0157379_10001473 Ga0157379_1000147319 244
691 3300014968 Ga0157379_10002331 Ga0157379_100023319 244
692 3300014968 Ga0157379_10044178 Ga0157379_100441783 244
693 3300014968 Ga0157379_10051704 Ga0157379_100517043 244
694 3300014968 Ga0157379_10099119 Ga0157379_100991193 244
695 3300014968 Ga0157379_10182462 Ga0157379_101824622 244
696 3300014968 Ga0157379_10314716 Ga0157379_103147161 244
697 3300014969 Ga0157376_10014955 Ga0157376_100149553 244
698 3300014969 Ga0157376_10040994 Ga0157376_100409944 244
699 3300014969 Ga0157376_10094207 Ga0157376_100942072 244
700 3300014969 Ga0157376_10108931 Ga0157376_101089313 244
701 3300014969 Ga0157376_10267770 Ga0157376_102677702 244
702 3300014969 Ga0157376_10707538 Ga0157376_107075381 244
703 3300017792 Ga0163161_10061801 Ga0163161_100618013 244
704 3300017792 Ga0163161_10144611 Ga0163161_101446113 244
705 3300025290 Ga0207673_1002475 Ga0207673_10024752 244
706 3300025315 Ga0207697_10000152 Ga0207697_1000015212 244
707 3300025315 Ga0207697_10004253 Ga0207697_100042533 244
708 3300025321 Ga0207656_10006344 Ga0207656_100063442 244
709 3300025321 Ga0207656_10008690 Ga0207656_100086903 244
710 3300025321 Ga0207656_10025778 Ga0207656_100257782 244
711 3300025321 Ga0207656_10039431 Ga0207656_100394312 244
712 3300025893 Ga0207682_10000198 Ga0207682_100001983 244
713 3300025893 Ga0207682_10000277 Ga0207682_1000027724 244
714 3300025893 Ga0207682_10006878 Ga0207682_100068783 244
715 3300025898 Ga0207692_10046556 Ga0207692_100465562 244
716 3300025898 Ga0207692_10118030 Ga0207692_101180302 244
717 3300025898 Ga0207692_10155700 Ga0207692_101557002 244
718 3300025899 Ga0207642_10011473 Ga0207642_100114734 244
719 3300025899 Ga0207642_10061926 Ga0207642_100619262 244
720 3300025899 Ga0207642_10159191 Ga0207642_101591912 244
721 3300025900 Ga0207710_10012909 Ga0207710_100129092 244
722 3300025900 Ga0207710_10173428 Ga0207710_101734282 244
723 3300025901 Ga0207688_10003167 Ga0207688_100031676 244
724 3300025901 Ga0207688_10029662 Ga0207688_100296623 244
725 3300025903 Ga0207680_10015572 Ga0207680_100155723 244
726 3300025903 Ga0207680_10019451 Ga0207680_100194513 244
727 3300025903 Ga0207680_10038459 Ga0207680_100384593 244
728 3300025903 Ga0207680_10096533 Ga0207680_100965332 244
729 3300025903 Ga0207680_10154042 Ga0207680_101540422 244
730 3300025903 Ga0207680_10186610 Ga0207680_101866103 244
731 3300025903 Ga0207680_10377906 Ga0207680_103779062 244
732 3300025906 Ga0207699_10038224 Ga0207699_100382243 244
733 3300025907 Ga0207645_10000474 Ga0207645_1000047429 244
734 3300025907 Ga0207645_10000676 Ga0207645_100006763 244
735 3300025907 Ga0207645_10004726 Ga0207645_100047268 244
736 3300025908 Ga0207643_10003006 Ga0207643_100030062 244
737 3300025908 Ga0207643_10003330 Ga0207643_100033303 244
738 3300025908 Ga0207643_10081378 Ga0207643_100813782 244
739 3300025909 Ga0207705_10561905 Ga0207705_105619051 244
740 3300025910 Ga0207684_10113524 Ga0207684_101135242 244
741 3300025911 Ga0207654_10013168 Ga0207654_100131682 244
742 3300025911 Ga0207654_10088517 Ga0207654_100885173 244
743 3300025912 Ga0207707_10028487 Ga0207707_100284874 244
744 3300025912 Ga0207707_10321159 Ga0207707_103211592 244
745 3300025915 Ga0207693_10003348 Ga0207693_1000334815 244
746 3300025915 Ga0207693_10051589 Ga0207693_100515892 244
747 3300025915 Ga0207693_10051620 Ga0207693_100516203 244
748 3300025916 Ga0207663_10012995 Ga0207663_100129954 244
749 3300025916 Ga0207663_10022644 Ga0207663_100226444 244
750 3300025916 Ga0207663_10041174 Ga0207663_100411743 244
751 3300025916 Ga0207663_10194033 Ga0207663_101940332 244
752 3300025917 Ga0207660_10295350 Ga0207660_102953501 244
753 3300025918 Ga0207662_10010826 Ga0207662_100108263 244
754 3300025919 Ga0207657_10000645 Ga0207657_1000064536 244
755 3300025919 Ga0207657_10019401 Ga0207657_100194018 244
756 3300025919 Ga0207657_10038623 Ga0207657_100386235 244
757 3300025920 Ga0207649_10009810 Ga0207649_100098104 244
758 3300025920 Ga0207649_10088192 Ga0207649_100881923 244
759 3300025920 Ga0207649_10218574 Ga0207649_102185742 244
760 3300025921 Ga0207652_10169040 Ga0207652_101690402 244
761 3300025921 Ga0207652_10355309 Ga0207652_103553092 244
762 3300025923 Ga0207681_10007030 Ga0207681_100070304 244
763 3300025923 Ga0207681_10082287 Ga0207681_100822872 244
764 3300025923 Ga0207681_10194078 Ga0207681_101940782 244
765 3300025923 Ga0207681_10268582 Ga0207681_102685821 244
766 3300025923 Ga0207681_10335406 Ga0207681_103354061 244
767 3300025924 Ga0207694_10213694 Ga0207694_102136943 244
768 3300025925 Ga0207650_10005059 Ga0207650_100050592 244
769 3300025925 Ga0207650_10009351 Ga0207650_100093514 244
770 3300025925 Ga0207650_10027674 Ga0207650_100276742 244
771 3300025925 Ga0207650_10089216 Ga0207650_100892162 244
772 3300025925 Ga0207650_10114212 Ga0207650_101142122 244
773 3300025925 Ga0207650_10150278 Ga0207650_101502782 244
774 3300025926 Ga0207659_10003229 Ga0207659_100032296 244
775 3300025926 Ga0207659_10004533 Ga0207659_100045339 244
776 3300025926 Ga0207659_10007361 Ga0207659_100073615 244
777 3300025926 Ga0207659_10064835 Ga0207659_100648353 244
778 3300025926 Ga0207659_10065472 Ga0207659_100654722 244
779 3300025927 Ga0207687_10002138 Ga0207687_100021383 244
780 3300025927 Ga0207687_10057806 Ga0207687_100578063 244
781 3300025927 Ga0207687_10476568 Ga0207687_104765682 244
782 3300025928 Ga0207700_10031456 Ga0207700_100314564 244
783 3300025928 Ga0207700_10088374 Ga0207700_100883742 244
784 3300025929 Ga0207664_10084350 Ga0207664_100843503 244
785 3300025929 Ga0207664_10091708 Ga0207664_100917082 244
786 3300025929 Ga0207664_10281982 Ga0207664_102819822 244
787 3300025931 Ga0207644_10000972 Ga0207644_1000097215 244
788 3300025931 Ga0207644_10008063 Ga0207644_100080633 244
789 3300025931 Ga0207644_10024002 Ga0207644_100240022 244
790 3300025931 Ga0207644_10029981 Ga0207644_100299812 244
791 3300025931 Ga0207644_10160418 Ga0207644_101604182 244
792 3300025931 Ga0207644_10178582 Ga0207644_101785821 244
793 3300025931 Ga0207644_10272989 Ga0207644_102729892 244
794 3300025932 Ga0207690_10001179 Ga0207690_1000117913 244
795 3300025932 Ga0207690_10068804 Ga0207690_100688042 244
796 3300025932 Ga0207690_10365324 Ga0207690_103653242 244
797 3300025933 Ga0207706_10000014 Ga0207706_1000001448 244
798 3300025933 Ga0207706_10003500 Ga0207706_100035003 244
799 3300025933 Ga0207706_10006979 Ga0207706_100069799 244
800 3300025933 Ga0207706_10117935 Ga0207706_101179352 244
801 3300025933 Ga0207706_10125460 Ga0207706_101254602 244
802 3300025933 Ga0207706_10357425 Ga0207706_103574252 244
803 3300025934 Ga0207686_10003542 Ga0207686_1000354210 244
804 3300025934 Ga0207686_10085920 Ga0207686_100859202 244
805 3300025935 Ga0207709_10176823 Ga0207709_101768232 244
806 3300025935 Ga0207709_10765199 Ga0207709_107651991 244
807 3300025936 Ga0207670_10001184 Ga0207670_100011843 244
808 3300025936 Ga0207670_10215212 Ga0207670_102152122 244
809 3300025937 Ga0207669_10005326 Ga0207669_100053266 244
810 3300025937 Ga0207669_10008679 Ga0207669_100086793 244
811 3300025937 Ga0207669_10011008 Ga0207669_100110084 244
812 3300025937 Ga0207669_10139953 Ga0207669_101399531 244
813 3300025938 Ga0207704_10009522 Ga0207704_100095223 244
814 3300025938 Ga0207704_10138304 Ga0207704_101383042 244
815 3300025938 Ga0207704_10300126 Ga0207704_103001262 244
816 3300025939 Ga0207665_10018633 Ga0207665_100186333 244
817 3300025939 Ga0207665_10030153 Ga0207665_100301533 244
818 3300025940 Ga0207691_10000243 Ga0207691_100002433 244
819 3300025940 Ga0207691_10000488 Ga0207691_1000048833 244
820 3300025940 Ga0207691_10001900 Ga0207691_100019007 244
821 3300025940 Ga0207691_10005801 Ga0207691_1000580111 244
822 3300025940 Ga0207691_10019983 Ga0207691_100199832 244
823 3300025940 Ga0207691_10051702 Ga0207691_100517022 244
824 3300025940 Ga0207691_10056717 Ga0207691_100567173 244
825 3300025941 Ga0207711_10007585 Ga0207711_100075854 244
826 3300025941 Ga0207711_10015749 Ga0207711_100157496 244
827 3300025941 Ga0207711_10064090 Ga0207711_100640902 244
828 3300025941 Ga0207711_10102386 Ga0207711_101023863 244
829 3300025941 Ga0207711_10181113 Ga0207711_101811132 244
830 3300025941 Ga0207711_10270533 Ga0207711_102705332 244
831 3300025941 Ga0207711_10527980 Ga0207711_105279802 244
832 3300025941 Ga0207711_10546592 Ga0207711_105465922 244
833 3300025941 Ga0207711_10616610 Ga0207711_106166102 244
834 3300025942 Ga0207689_10000066 Ga0207689_1000006634 244
835 3300025942 Ga0207689_10003367 Ga0207689_1000336712 244
836 3300025942 Ga0207689_10005902 Ga0207689_100059028 244
837 3300025942 Ga0207689_10035534 Ga0207689_100355344 244
838 3300025942 Ga0207689_10135590 Ga0207689_101355903 244
839 3300025942 Ga0207689_10139746 Ga0207689_101397463 244
840 3300025944 Ga0207661_10341929 Ga0207661_103419292 244
841 3300025945 Ga0207679_10001600 Ga0207679_100016003 244
842 3300025945 Ga0207679_10020641 Ga0207679_100206414 244
843 3300025945 Ga0207679_10058139 Ga0207679_100581394 244
844 3300025945 Ga0207679_10331323 Ga0207679_103313232 244
845 3300025945 Ga0207679_10383761 Ga0207679_103837612 244
846 3300025949 Ga0207667_10021014 Ga0207667_100210145 244
847 3300025949 Ga0207667_10049554 Ga0207667_100495544 244
848 3300025949 Ga0207667_10295346 Ga0207667_102953463 244
849 3300025949 Ga0207667_10456132 Ga0207667_104561322 244
850 3300025949 Ga0207667_10683659 Ga0207667_106836592 244
851 3300025949 Ga0207667_10911040 Ga0207667_109110401 244
852 3300025960 Ga0207651_10002167 Ga0207651_100021674 244
853 3300025960 Ga0207651_10002291 Ga0207651_100022913 244
854 3300025960 Ga0207651_10037711 Ga0207651_100377113 244
855 3300025960 Ga0207651_10146371 Ga0207651_101463712 244
856 3300025960 Ga0207651_10161803 Ga0207651_101618032 244
857 3300025961 Ga0207712_10239736 Ga0207712_102397362 244
858 3300025972 Ga0207668_10010320 Ga0207668_100103202 244
859 3300025972 Ga0207668_10017653 Ga0207668_100176535 244
860 3300025972 Ga0207668_10049379 Ga0207668_100493792 244
861 3300025972 Ga0207668_10237925 Ga0207668_102379251 244
862 3300025981 Ga0207640_10003371 Ga0207640_1000337110 244
863 3300025981 Ga0207640_10005106 Ga0207640_100051068 244
864 3300025981 Ga0207640_10012754 Ga0207640_100127545 244
865 3300025981 Ga0207640_10168389 Ga0207640_101683892 244
866 3300025981 Ga0207640_10168773 Ga0207640_101687732 244
867 3300025981 Ga0207640_10269157 Ga0207640_102691572 244
868 3300025981 Ga0207640_10279131 Ga0207640_102791311 244
869 3300025981 Ga0207640_10488671 Ga0207640_104886712 244
870 3300025986 Ga0207658_10001108 Ga0207658_100011089 244
871 3300025986 Ga0207658_10014988 Ga0207658_100149882 244
872 3300025986 Ga0207658_10017104 Ga0207658_100171042 244
873 3300025986 Ga0207658_10061185 Ga0207658_100611853 244
874 3300025986 Ga0207658_10165542 Ga0207658_101655422 244
875 3300025986 Ga0207658_10183954 Ga0207658_101839542 244
876 3300025986 Ga0207658_10256144 Ga0207658_102561442 244
877 3300026023 Ga0207677_10000509 Ga0207677_100005092 244
878 3300026023 Ga0207677_10009429 Ga0207677_100094294 244
879 3300026023 Ga0207677_10020454 Ga0207677_100204544 244
880 3300026023 Ga0207677_10031958 Ga0207677_100319583 244
881 3300026023 Ga0207677_10078563 Ga0207677_100785633 244
882 3300026023 Ga0207677_10126627 Ga0207677_101266273 244
883 3300026023 Ga0207677_10441439 Ga0207677_104414392 244
884 3300026035 Ga0207703_10000539 Ga0207703_1000053937 244
885 3300026035 Ga0207703_10012984 Ga0207703_100129848 244
886 3300026035 Ga0207703_10015182 Ga0207703_100151823 244
887 3300026035 Ga0207703_10023957 Ga0207703_100239573 244
888 3300026035 Ga0207703_10079707 Ga0207703_100797074 244
889 3300026035 Ga0207703_10120004 Ga0207703_101200042 244
890 3300026035 Ga0207703_10233489 Ga0207703_102334891 244
891 3300026041 Ga0207639_10001295 Ga0207639_100012956 244
892 3300026041 Ga0207639_10003407 Ga0207639_100034077 244
893 3300026041 Ga0207639_10130078 Ga0207639_101300782 244
894 3300026041 Ga0207639_10213784 Ga0207639_102137841 244
895 3300026041 Ga0207639_10847381 Ga0207639_108473811 244
896 3300026067 Ga0207678_10001624 Ga0207678_1000162414 244
897 3300026067 Ga0207678_10040691 Ga0207678_100406914 244
898 3300026067 Ga0207678_10041206 Ga0207678_100412064 244
899 3300026067 Ga0207678_10056388 Ga0207678_100563883 244
900 3300026075 Ga0207708_10000789 Ga0207708_1000078925 244
901 3300026078 Ga0207702_10001843 Ga0207702_1000184310 244
902 3300026078 Ga0207702_10328742 Ga0207702_103287422 244
903 3300026088 Ga0207641_10001273 Ga0207641_1000127321 244
904 3300026088 Ga0207641_10003163 Ga0207641_100031637 244
905 3300026088 Ga0207641_10009112 Ga0207641_100091122 244
906 3300026088 Ga0207641_10031102 Ga0207641_100311025 244
907 3300026088 Ga0207641_10271292 Ga0207641_102712921 244
908 3300026088 Ga0207641_10275797 Ga0207641_102757971 244
909 3300026088 Ga0207641_10287249 Ga0207641_102872492 244
910 3300026089 Ga0207648_10000324 Ga0207648_1000032431 244
911 3300026089 Ga0207648_10002658 Ga0207648_1000265819 244
912 3300026089 Ga0207648_10002908 Ga0207648_1000290815 244
913 3300026089 Ga0207648_10061623 Ga0207648_100616233 244
914 3300026089 Ga0207648_10088232 Ga0207648_100882323 244
915 3300026089 Ga0207648_10292427 Ga0207648_102924272 244
916 3300026095 Ga0207676_10001046 Ga0207676_100010464 244
917 3300026095 Ga0207676_10017376 Ga0207676_100173764 244
918 3300026095 Ga0207676_10089722 Ga0207676_100897222 244
919 3300026095 Ga0207676_10236075 Ga0207676_102360752 244
920 3300026095 Ga0207676_10273146 Ga0207676_102731461 244
921 3300026116 Ga0207674_10001714 Ga0207674_1000171413 244
922 3300026116 Ga0207674_10003580 Ga0207674_1000358019 244
923 3300026116 Ga0207674_10011948 Ga0207674_1001194811 244
924 3300026116 Ga0207674_10077341 Ga0207674_100773413 244
925 3300026118 Ga0207675_100000935 Ga0207675_10000093529 244
926 3300026118 Ga0207675_100017179 Ga0207675_1000171792 244
927 3300026118 Ga0207675_100024343 Ga0207675_1000243432 244
928 3300026118 Ga0207675_100118944 Ga0207675_1001189443 244
929 3300026118 Ga0207675_100236324 Ga0207675_1002363242 244
930 3300026118 Ga0207675_100538222 Ga0207675_1005382221 244
931 3300026121 Ga0207683_10000109 Ga0207683_1000010953 244
932 3300026121 Ga0207683_10000308 Ga0207683_100003083 244
933 3300026121 Ga0207683_10000448 Ga0207683_1000044810 244
934 3300026121 Ga0207683_10001747 Ga0207683_100017478 244
935 3300026121 Ga0207683_10160123 Ga0207683_101601232 244
936 3300026142 Ga0207698_10002543 Ga0207698_100025433 244
937 3300026142 Ga0207698_10002567 Ga0207698_100025677 244
938 3300026142 Ga0207698_10208990 Ga0207698_102089901 244
939 3300026142 Ga0207698_10237335 Ga0207698_102373353 244
940 3300027471 Ga0209995_1026069 Ga0209995_10260691 244
941 3300027665 Ga0209983_1002934 Ga0209983_10029344 244
942 3300027665 Ga0209983_1008217 Ga0209983_10082172 244
943 3300027682 Ga0209971_1000815 Ga0209971_10008154 244
944 3300027717 Ga0209998_10002354 Ga0209998_100023544 244
945 3300027876 Ga0209974_10107117 Ga0209974_101071172 244
946 3300027907 Ga0207428_10048886 Ga0207428_100488862 244
947 3300028379 Ga0268266_10010249 Ga0268266_100102496 244
948 3300028379 Ga0268266_10029384 Ga0268266_100293843 244
949 3300028379 Ga0268266_10112409 Ga0268266_101124091 244
950 3300028380 Ga0268265_10025614 Ga0268265_100256142 244
951 3300028380 Ga0268265_10122036 Ga0268265_101220361 244
952 3300028381 Ga0268264_10002789 Ga0268264_100027899 244
953 3300028381 Ga0268264_10005553 Ga0268264_100055534 244
954 3300028381 Ga0268264_10005640 Ga0268264_1000564011 244
955 3300028381 Ga0268264_10030120 Ga0268264_100301203 244
956 3300028381 Ga0268264_10047823 Ga0268264_100478232 244
957 3300028381 Ga0268264_10320937 Ga0268264_103209372 244
958 3300028381 Ga0268264_10468044 Ga0268264_104680441 244
959 3300028381 Ga0268264_10636134 Ga0268264_106361342 244
960 3300031548 Ga0307408_100024739 Ga0307408_1000247394 244
961 3300031731 Ga0307405_10005004 Ga0307405_100050045 244
962 3300031824 Ga0307413_10009010 Ga0307413_100090103 244
963 3300031852 Ga0307410_10003008 Ga0307410_100030082 244
964 3300031901 Ga0307406_10005302 Ga0307406_100053025 244
965 3300031903 Ga0307407_10002144 Ga0307407_100021444 244
966 3300031911 Ga0307412_10023419 Ga0307412_100234192 244
967 3300031911 Ga0307412_10610668 Ga0307412_106106682 244
968 3300031995 Ga0307409_100022740 Ga0307409_1000227404 244
969 3300032002 Ga0307416_100006675 Ga0307416_1000066754 244
970 3300032005 Ga0307411_10002809 Ga0307411_100028094 244
971 3300035083 Ga0373926_0060484 Ga0373926_0060484_235_969 244
972 3300035086 Ga0373934_0027703 Ga0373934_0027703_381_1115 244
973 3300035091 Ga0373951_0060295 Ga0373951_0060295_117_851 244
974 3300035111 Ga0373923_0264181 Ga0373923_0264181_56_790 244
975 3300035113 Ga0373936_0111444 Ga0373936_0111444_71_805 244
976 3300035118 Ga0373954_0041883 Ga0373954_0041883_500_1234 244
977 3300035119 Ga0373956_0038992 Ga0373956_0038992_245_979 244
978 3300035119 Ga0373956_0268012 Ga0373956_0268012_12_746 244
979 3300035120 Ga0373957_0012927 Ga0373957_0012927_129_863 244
980 3300035170 Ga0373943_0025786 Ga0373943_0025786_606_1340 244
981 3300035170 Ga0373943_0177413 Ga0373943_0177413_67_801 244
982 3300035172 Ga0373955_0005929 Ga0373955_0005929_3970_4704 244
983 3300035172 Ga0373955_0159341 Ga0373955_0159341_327_1061 244
984 3300035241 Ga0373961_0020263 Ga0373961_0020263_263_997 244
985 3300035691 Ga0373931_0225571 Ga0373931_0225571_12_746 244
986 3300035692 Ga0373935_0029677 Ga0373935_0029677_410_1144 244
987 3300035692 Ga0373935_0152838 Ga0373935_0152838_215_949 244
988 3300035695 Ga0373927_0023145 Ga0373927_0023145_1009_1743 244
989 3300035695 Ga0373927_0149585 Ga0373927_0149585_696_1430 244
990 3300035695 Ga0373927_0177796 Ga0373927_0177796_617_1351 244
991 3300035724 Ga0373933_0219386 Ga0373933_0219386_25_759 244
992 3300035724 Ga0373933_0503413 Ga0373933_0503413_39_776 244
993 3300036401 Ga0373937_0047958 Ga0373937_0047958_1598_2332 244
994 3300036401 Ga0373937_0488064 Ga0373937_0488064_375_1112 244
995 3300036401 Ga0373937_0634694 Ga0373937_0634694_175_909 244
996 3300036401 Ga0373937_0717506 Ga0373937_0717506_190_927 244
997 3300037068 Ga0373925_0123963 Ga0373925_0123963_1162_1896 244
998 3300041512 Ga0451853_3709595 Ga0451853_3709595_785_1519 244
999 3300046462 Ga0495651_0038583 Ga0495651_0038583_1134_1868 244
1000 3300046472 Ga0495580_0023293 Ga0495580_0023293_1530_2294 244
1001 3300046472 Ga0495580_0105735 Ga0495580_0105735_824_1558 244
1002 3300046473 Ga0495582_0037593 Ga0495582_0037593_1558_2292 244
1003 3300046475 Ga0495639_0050103 Ga0495639_0050103_61_795 244
1004 3300046476 Ga0495662_0050061 Ga0495662_0050061_636_1370 244
1005 3300046477 Ga0495664_0132999 Ga0495664_0132999_437_1171 244
1006 3300046536 Ga0495587_0155480 Ga0495587_0155480_172_906 244
1007 3300046543 Ga0495645_0386343 Ga0495645_0386343_101_835 244
1008 3300046642 Ga0495634_0154578 Ga0495634_0154578_687_1421 244
1009 3300046663 Ga0495635_0496092 Ga0495635_0496092_54_791 244
1010 3300046664 Ga0495659_0069824 Ga0495659_0069824_455_1189 244
1011 3300046674 Ga0495588_0056131 Ga0495588_0056131_647_1381 244
1012 3300046679 Ga0495623_0035223 Ga0495623_0035223_2142_2876 244
1013 3300046681 Ga0495647_0021692 Ga0495647_0021692_459_1193 244
1014 3300046683 Ga0495658_0073245 Ga0495658_0073245_889_1623 244
1015 3300046683 Ga0495658_0344854 Ga0495658_0344854_127_861 244
1016 3300046684 Ga0495669_0129282 Ga0495669_0129282_366_1100 244
1017 3300046689 Ga0495613_0089751 Ga0495613_0089751_857_1591 244
1018 3300047315 Ga0495581_0000428 Ga0495581_0000428_4909_5643 244
1019 3300047317 Ga0495604_0142895 Ga0495604_0142895_873_1607 244
1020 3300047322 Ga0495680_0036734 Ga0495680_0036734_1722_2456 244
1021 3300047673 Ga0495593_0103303 Ga0495593_0103303_315_1049 244
1022 3300048089 Ga0495614_0054880 Ga0495614_0054880_498_1232 244
1023 3300048903 Ga0496100_0017030 Ga0496100_0017030_37_771 244
1024 3300048904 Ga0496101_0136157 Ga0496101_0136157_375_1109 244
1025 3300048904 Ga0496101_0189504 Ga0496101_0189504_702_1436 244
1026 3300048904 Ga0496101_0236663 Ga0496101_0236663_495_1229 244
1027 3300048905 Ga0496102_0018280 Ga0496102_0018280_1367_2101 244
1028 3300048905 Ga0496102_0023458 Ga0496102_0023458_378_1112 244
1029 3300048905 Ga0496102_0399915 Ga0496102_0399915_64_798 244
1030 3300048906 Ga0496103_0056815 Ga0496103_0056815_1572_2306 244
1031 3300048906 Ga0496103_0069292 Ga0496103_0069292_55_789 244
1032 3300048907 Ga0496104_0004784 Ga0496104_0004784_3452_4186 244
1033 3300048907 Ga0496104_0489024 Ga0496104_0489024_129_863 244
1034 3300048908 Ga0496105_0017718 Ga0496105_0017718_4934_5668 244
1035 3300048908 Ga0496105_0018431 Ga0496105_0018431_1687_2421 244
1036 3300048909 Ga0496106_0001148 Ga0496106_0001148_14767_15501 244
1037 3300048909 Ga0496106_0203735 Ga0496106_0203735_765_1499 244
1038 3300048909 Ga0496106_0233034 Ga0496106_0233034_578_1312 244
1039 3300048910 Ga0496107_0003923 Ga0496107_0003923_1923_2657 244
1040 3300048910 Ga0496107_0038555 Ga0496107_0038555_1795_2529 244
1041 3300048910 Ga0496107_0159599 Ga0496107_0159599_549_1283 244
1042 3300048911 Ga0496108_0005970 Ga0496108_0005970_1522_2256 244
1043 3300048912 Ga0496109_0008435 Ga0496109_0008435_6996_7730 244
1044 3300048912 Ga0496109_0088428 Ga0496109_0088428_2066_2800 244
1045 3300048912 Ga0496109_0232834 Ga0496109_0232834_640_1377 244
1046 3300048912 Ga0496109_0403599 Ga0496109_0403599_391_1125 244
1047 3300048913 Ga0496110_0051023 Ga0496110_0051023_2275_3009 244
1048 3300048913 Ga0496110_0212712 Ga0496110_0212712_536_1270 244
1049 3300048915 Ga0496112_0116516 Ga0496112_0116516_1629_2363 244
1050 3300048915 Ga0496112_0286647 Ga0496112_0286647_818_1552 244
1051 3300048917 Ga0496114_0040616 Ga0496114_0040616_1659_2396 244
1052 3300048917 Ga0496114_0277628 Ga0496114_0277628_336_1070 244
1053 3300048918 Ga0496115_0131495 Ga0496115_0131495_804_1538 244
1054 3300050507 nmdc:mga05p37_823160_c1 nmdc:mga05p37_823160_c1_107_841 244
1055 3300050511 nmdc:mga08y16_34577_c1 nmdc:mga08y16_34577_c1_2503_3237 244
1056 3300050512 nmdc:mga0n895_220739_c1 nmdc:mga0n895_220739_c1_501_1235 244
1057 3300050512 nmdc:mga0n895_76763_c1 nmdc:mga0n895_76763_c1_2043_2777 244
1058 3300053077 Ga0495601_0080294 Ga0495601_0080294_624_1358 244
1059 3300053085 Ga0495619_0069732 Ga0495619_0069732_1218_1952 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

12

242

0.97

PF08241

Methyltransf_11

Methyltransferase domain

63

161

0.96

PF13649

Methyltransf_25

Methyltransferase domain

62

157

0.95

PF08242

Methyltransf_12

Methyltransferase domain

63

159

0.92

PF07021

MetW

Methionine biosynthesis protein MetW

47

160

0.87

PF13489

Methyltransf_23

Methyltransferase domain

38

227

0.8

PF13847

Methyltransf_31

Methyltransferase domain

56

221

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9224 28 244
5zvh-assembly2.cif.gz_A the crystal structure of nsun6 from pyrococcus horikoshii with sfg 0.852 48 164
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8507 28 244
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.8417 52 231
5wwt-assembly2.cif.gz_B crystal structure of human nsun6/trna 0.8245 46 164
ID Description Score Start End Superfamily
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9865 28 244 3.40.50.150
af_C7J169_1_82_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9685 36 107 3.40.50.150
af_A0A0R0FLG0_1_109_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.966 57 106 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9645 28 244 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9578 28 244 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6A5KTX5-F1-model_v4 deleted 0.985 3 242
AF-W7WCB7-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9835 4 243 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
GO:0046872
AF-A0A2U2N2G9-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9821 3 244 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A7Z1KVL5-F1-model_v4 deleted 0.9797 1 244
AF-A0A7V5PGH2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9776 1 204 GO:0008425
GO:0009234
GO:0032259

Feature Viewer

pLDDT pTM Quality
88.35 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map