F489160

General Info

Members Datasets Scaffolds Average Seq Length
1055 323 955 321

Family's Representative Sequence

Representative Sequence 3300042009|Ga0439451_004589|Ga0439451_004589_1291_2394
Length 367
Sequence MGCVLRQARIIPDSDGYASDIRRLSVLNKHGVEELEWDPILRADFNCHMPVLTEGVPDLQRGAALEQEELFPIREVARLTGINPVTLRAWERRYGLIQPTRTESGHRLYSMADIEKVRSILGWIDRGVAVSKVGKILAKTEPLKALAKIIPDELVQADYAQWQQEVQVAVTAFDEVKLEQVYGQIFSSYPLTVVFQDILMPIWKLMLQRHHAFGQTSEWLFLDGFLRSRVLQRMLLVRVMQPRRVIVCALADQAHELEVLVTALYLSSVDSAIQLLSIGQPFDELTLVCERIKPTALVLVSNHAPAPELPRRLNRLALSLDCQLLLAGDASDLAQDSLAGSSIGCLGNEGMVMRQRLKQFLAGNLDT

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231031 Pseudomonas sp. GM16 Isolate Nodule
20 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
21 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
22 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
23 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
24 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
25 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
26 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
27 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
28 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
29 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
30 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
31 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
32 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
33 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
34 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
35 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
36 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
37 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
38 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
39 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
40 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
41 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
42 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
43 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
44 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
45 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
46 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
47 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
48 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
49 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
50 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
51 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
52 2773857670 Pseudomonas sp. 478 Isolate Unclassified
53 2773857673 Pseudomonas sp. 443 Isolate Unclassified
54 2784132063 Pseudomonas sp. 424 Isolate Unclassified
55 2784132072 Pseudomonas sp. 460 Isolate Unclassified
56 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
57 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
58 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
59 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
60 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
61 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
62 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
63 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
64 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
65 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
66 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
67 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
68 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
69 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
70 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
71 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
72 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
73 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
74 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
75 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
76 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
77 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
78 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
79 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
80 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
81 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
82 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
83 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
84 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
85 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
86 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
87 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
88 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
89 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
90 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
91 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
92 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
93 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
94 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
95 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
96 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
97 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
98 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
99 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
100 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
101 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
102 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
103 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
104 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
105 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
106 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
107 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
108 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
109 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
110 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
113 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
118 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
158 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
167 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
168 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
180 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
186 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
187 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
188 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
189 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
190 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
191 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
192 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
193 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
194 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
195 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
196 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
197 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
198 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
199 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
200 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
201 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
202 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
206 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
207 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
208 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
211 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
212 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
216 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
238 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
244 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
260 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
268 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
269 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
280 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
284 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
285 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
286 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
297 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
298 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
299 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
306 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
307 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
308 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
311 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
312 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
313 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
314 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
315 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
316 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
317 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
318 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
319 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
320 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
321 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
322 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
323 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.52
Metatranscriptomes 0
Isolates 9.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.36
Nodule 2.37
Rhizoplane 2.18
Rhizosphere 82.27
Stem 0
Stem Tuber 0
Unclassified 8.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6922 2124908027 Bacteria 2908
2 SwRhRL2b_contig_2015853 2162886007 Bacteria 9227
3 MRS1b_contig_7133303 2162886011 Bacteria 1396
4 JGI25162J39368_1000101 3300002737 Bacteria 94481
5 JGI25162J39368_1000340 3300002737 Bacteria 40502
6 JGI25163J39215_1000349 3300002771 Bacteria 15330
7 JGI25163J39215_1000385 3300002771 Bacteria 14123
8 JGI25164J39214_1000097 3300002772 Bacteria 87008
9 JGI25164J39214_1000249 3300002772 Bacteria 40502
10 JGI25165J46597_1000184 3300003214 Bacteria 94481
11 JGI25165J46597_1000459 3300003214 Bacteria 40502
12 rootH1_10304266 3300003323 Bacteria 4160
13 Ga0055536_1000172 3300003781 Bacteria 54152
14 Ga0055536_1000304 3300003781 Bacteria 36931
15 Ga0055530_10000300 3300003791 Bacteria 44962
16 Ga0055530_10001892 3300003791 Bacteria 14351
17 Ga0055540_1000376 3300003792 Bacteria 37376
18 Ga0055540_1000804 3300003792 Bacteria 21223
19 Ga0055531_10000346 3300003794 Bacteria 45327
20 Ga0065714_10002230 3300005288 Bacteria 41722
21 Ga0065714_10003116 3300005288 Bacteria 8511
22 Ga0065714_10004641 3300005288 Bacteria 4822
23 Ga0065714_10007175 3300005288 Bacteria 4444
24 Ga0065714_10067312 3300005288 Bacteria 5662
25 Ga0065714_10075726 3300005288 Bacteria 2873
26 Ga0065714_10094794 3300005288 Bacteria 1805
27 Ga0065704_10073240 3300005289 Bacteria 7403
28 Ga0065704_10087605 3300005289 Bacteria 3011
29 Ga0065712_10001162 3300005290 Bacteria 8038
30 Ga0065715_10096237 3300005293 Bacteria 3917
31 Ga0070669_100004796 3300005353 Bacteria 9760
32 Ga0070659_100091591 3300005366 Bacteria 2437
33 Ga0070662_100046750 3300005457 Bacteria 3110
34 Ga0070665_100143793 3300005548 Bacteria 2388
35 Ga0070665_100468082 3300005548 Bacteria 1271
36 Ga0075364_10047290 3300006051 Bacteria 2802
37 Ga0075432_10006195 3300006058 Bacteria 4066
38 Ga0075432_10006358 3300006058 Bacteria 4016
39 Ga0075432_10009003 3300006058 Bacteria 3404
40 Ga0075432_10009541 3300006058 Bacteria 3306
41 Ga0075432_10011684 3300006058 Bacteria 2983
42 Ga0075432_10031330 3300006058 Bacteria 1840
43 Ga0075362_10017996 3300006177 Bacteria 2919
44 Ga0075362_10067871 3300006177 Bacteria 1623
45 Ga0075369_10068007 3300006186 Bacteria 1565
46 Ga0075436_100062266 3300006914 Bacteria 2578
47 Ga0075436_100087592 3300006914 Bacteria 2163
48 Ga0079104_1000259 3300006946 Bacteria 70490
49 Ga0079104_1000332 3300006946 Bacteria 57787
50 Ga0079104_1005361 3300006946 Bacteria 5145
51 Ga0099826_10022026 3300006948 Bacteria 4767
52 Ga0105251_10000421 3300009011 Bacteria 41190
53 Ga0105251_10011066 3300009011 Bacteria 5176
54 Ga0105251_10031349 3300009011 Bacteria 2661
55 Ga0105244_10001030 3300009036 Bacteria 23386
56 Ga0105244_10001964 3300009036 Bacteria 15924
57 Ga0105244_10012099 3300009036 Bacteria 5126
58 Ga0105244_10013631 3300009036 Bacteria 4738
59 Ga0105244_10018451 3300009036 Bacteria 3914
60 Ga0105244_10069895 3300009036 Bacteria 1753
61 Ga0105244_10081292 3300009036 Bacteria 1604
62 Ga0105244_10087118 3300009036 Bacteria 1539
63 Ga0105250_10000494 3300009092 Bacteria 27715
64 Ga0105250_10005062 3300009092 Bacteria 5960
65 Ga0105250_10008083 3300009092 Bacteria 4485
66 Ga0105250_10019446 3300009092 Bacteria 2746
67 Ga0105250_10028857 3300009092 Bacteria 2233
68 Ga0105243_10000821 3300009148 Bacteria 29660
69 Ga0105243_10009345 3300009148 Bacteria 7475
70 Ga0105243_10066269 3300009148 Bacteria 2904
71 Ga0105242_10094405 3300009176 Bacteria 2523
72 Ga0105249_10032624 3300009553 Bacteria 4711
73 Ga0105246_10001254 3300011119 Bacteria 14912
74 Ga0105246_10003184 3300011119 Bacteria 9973
75 Ga0157345_1000012 3300012498 Bacteria 52464
76 Ga0157345_1001056 3300012498 Bacteria 2000
77 Ga0157373_10000994 3300013100 Bacteria 21932
78 Ga0157373_10007648 3300013100 Bacteria 8029
79 Ga0157373_10033206 3300013100 Bacteria 3713
80 Ga0157373_10100847 3300013100 Bacteria 2031
81 Ga0157373_10109985 3300013100 Bacteria 1937
82 Ga0157371_10000278 3300013102 Bacteria 69168
83 Ga0157371_10000321 3300013102 Bacteria 62219
84 Ga0157371_10002027 3300013102 Bacteria 20002
85 Ga0157371_10011847 3300013102 Bacteria 6693
86 Ga0157371_10337877 3300013102 Bacteria 1095
87 Ga0157370_10017498 3300013104 Bacteria 7231
88 Ga0157370_10018992 3300013104 Bacteria 6911
89 Ga0157370_10030010 3300013104 Bacteria 5329
90 Ga0157370_10108940 3300013104 Bacteria 2590
91 Ga0157370_10115838 3300013104 Bacteria 2503
92 Ga0157370_10378735 3300013104 Bacteria 1303
93 Ga0157370_10386585 3300013104 Bacteria 1288
94 Ga0157369_10001543 3300013105 Bacteria 28224
95 Ga0157369_10005555 3300013105 Bacteria 14644
96 Ga0157369_10173635 3300013105 Bacteria 2270
97 Ga0157369_10229591 3300013105 Bacteria 1941
98 Ga0157369_10321295 3300013105 Bacteria 1609
99 Ga0163162_10004547 3300013306 Bacteria 13369
100 Ga0163162_10006260 3300013306 Bacteria 11534
101 Ga0163162_10132659 3300013306 Bacteria 2600
102 Ga0163162_10196214 3300013306 Bacteria 2147
103 Ga0163162_10266214 3300013306 Bacteria 1845
104 Ga0163162_10329308 3300013306 Bacteria 1660
105 Ga0157372_10009285 3300013307 Bacteria 10461
106 Ga0157375_10158440 3300013308 Bacteria 2404
107 Ga0157375_10670119 3300013308 Bacteria 1192
108 Ga0182008_10000305 3300014497 Bacteria 38494
109 Ga0182008_10002253 3300014497 Bacteria 12179
110 Ga0182008_10003094 3300014497 Bacteria 10206
111 Ga0182008_10003708 3300014497 Bacteria 9110
112 Ga0182008_10010282 3300014497 Bacteria 5012
113 Ga0182008_10017538 3300014497 Bacteria 3713
114 Ga0182006_1000667 3300015261 Bacteria 24099
115 Ga0182006_1007434 3300015261 Bacteria 5012
116 Ga0182006_1008788 3300015261 Bacteria 4568
117 Ga0182006_1008976 3300015261 Bacteria 4506
118 Ga0182006_1011044 3300015261 Bacteria 3987
119 Ga0182006_1034464 3300015261 Bacteria 2025
120 Ga0182007_10000462 3300015262 Bacteria 24569
121 Ga0182007_10020121 3300015262 Bacteria 2391
122 Ga0182007_10054343 3300015262 Bacteria 1317
123 Ga0182005_1000497 3300015265 Bacteria 20074
124 Ga0182005_1024894 3300015265 Bacteria 1634
125 Ga0163161_10000806 3300017792 Bacteria 24571
126 Ga0163161_10008948 3300017792 Bacteria 6924
127 Ga0163161_10009423 3300017792 Bacteria 6756
128 Ga0163161_10021282 3300017792 Bacteria 4559
129 Ga0163161_10043450 3300017792 Bacteria 3235
130 Ga0163161_10054803 3300017792 Bacteria 2894
131 Ga0163161_10139690 3300017792 Bacteria 1834
132 Ga0163161_10206565 3300017792 Bacteria 1515
133 Ga0209760_100198 3300025207 Bacteria 28964
134 Ga0209563_101666 3300025230 Bacteria 5667
135 Ga0207427_100001 3300025231 Bacteria 1410763
136 Ga0207427_100004 3300025231 Bacteria 939600
137 Ga0209437_100003 3300025233 Bacteria 1517827
138 Ga0209437_100028 3300025233 Bacteria 540136
139 Ga0209759_1001762 3300025256 Bacteria 11059
140 Ga0209233_1000007 3300025261 Bacteria 1411234
141 Ga0209233_1000008 3300025261 Bacteria 1356712
142 Ga0209675_1008586 3300025291 Bacteria 3730
143 Ga0209676_1000056 3300025292 Bacteria 361329
144 Ga0209676_1000078 3300025292 Bacteria 296293
145 Ga0209676_1000101 3300025292 Bacteria 227976
146 Ga0209050_1000041 3300025298 Bacteria 408004
147 Ga0209050_1000181 3300025298 Bacteria 142533
148 Ga0209050_1000560 3300025298 Bacteria 60894
149 Ga0209051_1000061 3300025303 Bacteria 253485
150 Ga0209051_1000085 3300025303 Bacteria 189973
151 Ga0209257_1000105 3300025304 Bacteria 243729
152 Ga0207696_1000032 3300025711 Bacteria 380071
153 Ga0207696_1001372 3300025711 Bacteria 13335
154 Ga0207696_1001399 3300025711 Bacteria 13182
155 Ga0207696_1013911 3300025711 Bacteria 2779
156 Ga0207696_1039532 3300025711 Bacteria 1387
157 Ga0207696_1045382 3300025711 Bacteria 1271
158 Ga0207655_1000021 3300025728 Bacteria 518596
159 Ga0207655_1000204 3300025728 Bacteria 103596
160 Ga0207655_1001258 3300025728 Bacteria 24186
161 Ga0207655_1003454 3300025728 Bacteria 11747
162 Ga0207655_1003932 3300025728 Bacteria 10773
163 Ga0207655_1004849 3300025728 Bacteria 9348
164 Ga0207655_1007453 3300025728 Bacteria 7095
165 Ga0207655_1008606 3300025728 Bacteria 6452
166 Ga0207655_1018311 3300025728 Bacteria 3722
167 Ga0207655_1020221 3300025728 Bacteria 3432
168 Ga0207655_1037048 3300025728 Bacteria 2153
169 Ga0207655_1075267 3300025728 Bacteria 1239
170 Ga0207713_1001157 3300025735 Bacteria 22282
171 Ga0207713_1001332 3300025735 Bacteria 20241
172 Ga0207713_1001765 3300025735 Bacteria 16576
173 Ga0207713_1003529 3300025735 Bacteria 10604
174 Ga0207713_1006819 3300025735 Bacteria 6889
175 Ga0207713_1006903 3300025735 Bacteria 6821
176 Ga0207713_1010489 3300025735 Bacteria 5122
177 Ga0207713_1011022 3300025735 Bacteria 4952
178 Ga0207681_10000343 3300025923 Bacteria 33453
179 Ga0207690_10215993 3300025932 Bacteria 1465
180 Ga0207706_10006334 3300025933 Bacteria 10992
181 Ga0207709_10000067 3300025935 Bacteria 189188
182 Ga0207709_10015663 3300025935 Bacteria 4206
183 Ga0209281_1000013 3300027111 Bacteria 653449
184 Ga0209281_1000015 3300027111 Bacteria 590084
185 Ga0209281_1002154 3300027111 Bacteria 8638
186 Ga0209281_1005482 3300027111 Bacteria 3511
187 Ga0209281_1014644 3300027111 Bacteria 1655
188 Ga0209371_1000142 3300027312 Bacteria 118726
189 Ga0209995_1004957 3300027471 Bacteria 2136
190 Ga0209968_1006590 3300027526 Bacteria 1749
191 Ga0209999_1004280 3300027543 Bacteria 2569
192 Ga0209974_10006018 3300027876 Bacteria 4244
193 Ga0207428_10031329 3300027907 Bacteria 4389
194 Ga0207428_10065555 3300027907 Bacteria 2865
195 Ga0207428_10098318 3300027907 Bacteria 2265
196 Ga0207428_10163400 3300027907 Bacteria 1690
197 Ga0207428_10190512 3300027907 Bacteria 1546
198 Ga0207428_10234027 3300027907 Bacteria 1374
199 Ga0268266_10017099 3300028379 Bacteria 6193
200 Ga0307517_10067952 3300028786 Bacteria 3254
201 Ga0268256_1000111 3300030500 Bacteria 118726
202 Ga0316178_1023745 3300030735 Bacteria 38907
203 Ga0316183_1209807 3300030742 Bacteria 4985
204 Ga0307408_100000920 3300031548 Bacteria 22938
205 Ga0307408_100326933 3300031548 Bacteria 1293
206 Ga0307516_10028663 3300031730 Bacteria 5633
207 Ga0307516_10087707 3300031730 Bacteria 2945
208 Ga0307405_10002094 3300031731 Bacteria 8702
209 Ga0307407_10015936 3300031903 Bacteria 3730
210 Ga0307412_10025631 3300031911 Bacteria 3653
211 Ga0307412_10149695 3300031911 Bacteria 1720
212 Ga0307409_100044577 3300031995 Bacteria 3342
213 Ga0307416_100480327 3300032002 Bacteria 1302
214 Ga0307414_10062759 3300032004 Bacteria 2638
215 Ga0307411_10162768 3300032005 Bacteria 1673
216 Ga0307411_10185958 3300032005 Bacteria 1581
217 Ga0307510_10000622 3300033180 Bacteria 35905
218 Ga0439438_000750 3300041405 Bacteria 14516
219 Ga0439438_000852 3300041405 Bacteria 13639
220 Ga0439438_001149 3300041405 Bacteria 11772
221 Ga0439438_001833 3300041405 Bacteria 9302
222 Ga0439438_002168 3300041405 Bacteria 8465
223 Ga0439438_003359 3300041405 Bacteria 6483
224 Ga0439438_003879 3300041405 Bacteria 5895
225 Ga0439438_013701 3300041405 Bacteria 2437
226 Ga0439438_028887 3300041405 Bacteria 1487
227 Ga0439447_000159 3300041407 Bacteria 23077
228 Ga0439447_005657 3300041407 Bacteria 4136
229 Ga0439447_007665 3300041407 Bacteria 3400
230 Ga0439447_009121 3300041407 Bacteria 3025
231 Ga0439447_011244 3300041407 Bacteria 2622
232 Ga0439447_015773 3300041407 Bacteria 2090
233 Ga0439447_022325 3300041407 Bacteria 1658
234 Ga0439447_051795 3300041407 Bacteria 978
235 Ga0439466_0000898 3300041411 Bacteria 11342
236 Ga0439466_0003475 3300041411 Bacteria 6106
237 Ga0439466_0003488 3300041411 Bacteria 6096
238 Ga0439466_0004614 3300041411 Bacteria 5292
239 Ga0439466_0004624 3300041411 Bacteria 5288
240 Ga0439466_0007686 3300041411 Bacteria 4071
241 Ga0439466_0010832 3300041411 Bacteria 3384
242 Ga0439466_0024262 3300041411 Bacteria 2127
243 Ga0439466_0033966 3300041411 Bacteria 1730
244 Ga0439466_0047191 3300041411 Bacteria 1420
245 Ga0439466_0048620 3300041411 Bacteria 1394
246 Ga0439465_0005755 3300041413 Bacteria 3942
247 Ga0439431_0000294 3300041997 Bacteria 10273
248 Ga0439445_0001807 3300042004 Bacteria 4718
249 Ga0439445_0012031 3300042004 Bacteria 2072
250 Ga0439445_0014985 3300042004 Bacteria 1895
251 Ga0439445_0059144 3300042004 Bacteria 1045
252 Ga0439432_000535 3300042006 Bacteria 14134
253 Ga0439432_000720 3300042006 Bacteria 12373
254 Ga0439432_001157 3300042006 Bacteria 9996
255 Ga0439432_005740 3300042006 Bacteria 4459
256 Ga0439432_018184 3300042006 Bacteria 2352
257 Ga0439432_023588 3300042006 Bacteria 2025
258 Ga0439432_037910 3300042006 Bacteria 1536
259 Ga0439451_000925 3300042009 Bacteria 5649
260 Ga0439451_001687 3300042009 Bacteria 4390
261 Ga0439451_001913 3300042009 Bacteria 4161
262 Ga0439451_004589 3300042009 Bacteria 2811
263 Ga0439451_008042 3300042009 Bacteria 2140
264 Ga0439451_017992 3300042009 Bacteria 1425
265 Ga0439452_000100 3300042010 Bacteria 72176
266 Ga0439452_000252 3300042010 Bacteria 36729
267 Ga0439452_001211 3300042010 Bacteria 11038
268 Ga0439452_002358 3300042010 Bacteria 7017
269 Ga0439452_003769 3300042010 Bacteria 5216
270 Ga0439452_006990 3300042010 Bacteria 3489
271 Ga0439452_016363 3300042010 Bacteria 2015
272 Ga0439452_019078 3300042010 Bacteria 1818
273 Ga0439456_001097 3300042013 Bacteria 5366
274 Ga0439456_026001 3300042013 Bacteria 1244
275 Ga0439463_000091 3300042016 Bacteria 21082
276 Ga0439463_006563 3300042016 Bacteria 2881
277 Ga0439463_008397 3300042016 Bacteria 2547
278 Ga0439463_011152 3300042016 Bacteria 2207
279 Ga0450911_000062 3300042115 Bacteria 43944
280 Ga0450911_000913 3300042115 Bacteria 7848
281 Ga0450911_001675 3300042115 Bacteria 4894
282 Ga0450911_002422 3300042115 Bacteria 3662
283 Ga0450911_005733 3300042115 Bacteria 1901
284 Ga0450919_003002 3300042121 Bacteria 2153
285 Ga0450922_000048 3300042124 Bacteria 10642
286 Ga0450922_002553 3300042124 Bacteria 1707
287 Ga0450890_000167 3300042127 Bacteria 10100
288 Ga0450892_002397 3300042130 Bacteria 1604
289 Ga0450902_002890 3300042137 Bacteria 2470
290 Ga0450902_004535 3300042137 Bacteria 2070
291 Ga0450902_007056 3300042137 Bacteria 1732
292 Ga0450902_017572 3300042137 Bacteria 1169
293 Ga0450903_000881 3300042138 Bacteria 5782
294 Ga0450903_000919 3300042138 Bacteria 5649
295 Ga0450903_003257 3300042138 Bacteria 2820
296 Ga0450903_003836 3300042138 Bacteria 2590
297 Ga0450904_001137 3300042139 Bacteria 4052
298 Ga0450904_004391 3300042139 Bacteria 1464
299 Ga0450906_000148 3300042145 Bacteria 12883
300 Ga0450906_001325 3300042145 Bacteria 5425
301 Ga0450906_004974 3300042145 Bacteria 2758
302 Ga0450907_000126 3300042146 Bacteria 28680
303 Ga0450907_001767 3300042146 Bacteria 4468
304 Ga0450907_002874 3300042146 Bacteria 3177
305 Ga0450907_011838 3300042146 Bacteria 1449
306 Ga0450910_000109 3300042147 Bacteria 8633
307 Ga0450910_003330 3300042147 Bacteria 2133
308 Ga0439446_0007873 3300042156 Bacteria 2812
309 Ga0439446_0013774 3300042156 Bacteria 2224
310 Ga0450908_000888 3300042184 Bacteria 5765
311 Ga0439434_0000110 3300042435 Bacteria 21329
312 Ga0439434_0006488 3300042435 Bacteria 3418
313 Ga0439464_0003166 3300042439 Bacteria 4126
314 Ga0439464_0016391 3300042439 Bacteria 2002
315 Ga0439460_0000354 3300042461 Bacteria 9662
316 Ga0450918_001987 3300042531 Bacteria 3927
317 Ga0450918_004140 3300042531 Bacteria 2658
318 Ga0450918_011803 3300042531 Bacteria 1521
319 Ga0450893_0002844 3300042532 Bacteria 2714
320 Ga0450901_001231 3300042533 Bacteria 2958
321 Ga0451577_0017128 3300042876 Bacteria 6699
322 Ga0439440_0002271 3300042993 Bacteria 3609
323 Ga0495617_000922 3300046452 Bacteria 13672
324 Ga0495617_001045 3300046452 Bacteria 12663
325 Ga0495617_002512 3300046452 Bacteria 7258
326 Ga0495617_002930 3300046452 Bacteria 6547
327 Ga0495617_006274 3300046452 Bacteria 4180
328 Ga0495617_007216 3300046452 Bacteria 3865
329 Ga0495617_008560 3300046452 Bacteria 3521
330 Ga0495617_019147 3300046452 Bacteria 2314
331 Ga0495617_019538 3300046452 Bacteria 2291
332 Ga0495617_020822 3300046452 Bacteria 2216
333 Ga0495617_023924 3300046452 Bacteria 2062
334 Ga0495617_029366 3300046452 Bacteria 1848
335 Ga0495627_000689 3300046453 Bacteria 25791
336 Ga0495627_003044 3300046453 Bacteria 7655
337 Ga0495627_003217 3300046453 Bacteria 7346
338 Ga0495627_003392 3300046453 Bacteria 7059
339 Ga0495627_017486 3300046453 Bacteria 2435
340 Ga0495592_0014934 3300046454 Bacteria 5895
341 Ga0495603_0001509 3300046455 Bacteria 13567
342 Ga0495603_0008229 3300046455 Bacteria 6303
343 Ga0495603_0034781 3300046455 Bacteria 3028
344 Ga0495603_0095559 3300046455 Bacteria 1736
345 Ga0495590_0000464 3300046457 Bacteria 20031
346 Ga0495590_0000998 3300046457 Bacteria 12475
347 Ga0495590_0002606 3300046457 Bacteria 7454
348 Ga0495590_0002883 3300046457 Bacteria 7079
349 Ga0495590_0003084 3300046457 Bacteria 6818
350 Ga0495590_0003154 3300046457 Bacteria 6741
351 Ga0495590_0020378 3300046457 Bacteria 2357
352 Ga0495591_000737 3300046458 Bacteria 23628
353 Ga0495591_001318 3300046458 Bacteria 15623
354 Ga0495591_001332 3300046458 Bacteria 15534
355 Ga0495591_004194 3300046458 Bacteria 7144
356 Ga0495591_004469 3300046458 Bacteria 6844
357 Ga0495591_006121 3300046458 Bacteria 5396
358 Ga0495591_007253 3300046458 Bacteria 4742
359 Ga0495591_007565 3300046458 Bacteria 4596
360 Ga0495591_008422 3300046458 Bacteria 4224
361 Ga0495591_009027 3300046458 Bacteria 4009
362 Ga0495591_010841 3300046458 Bacteria 3495
363 Ga0495591_011813 3300046458 Bacteria 3284
364 Ga0495591_013568 3300046458 Bacteria 2970
365 Ga0495591_048514 3300046458 Bacteria 1170
366 Ga0495629_0160889 3300046459 Bacteria 1560
367 Ga0495638_0006890 3300046460 Bacteria 8204
368 Ga0495638_0008070 3300046460 Bacteria 7494
369 Ga0495638_0008904 3300046460 Bacteria 7075
370 Ga0495638_0013646 3300046460 Bacteria 5520
371 Ga0495638_0020377 3300046460 Bacteria 4382
372 Ga0495638_0030963 3300046460 Bacteria 3440
373 Ga0495638_0037912 3300046460 Bacteria 3065
374 Ga0495638_0040327 3300046460 Bacteria 2959
375 Ga0495638_0052455 3300046460 Bacteria 2540
376 Ga0495638_0078651 3300046460 Bacteria 2006
377 Ga0495638_0086324 3300046460 Bacteria 1896
378 Ga0495638_0102830 3300046460 Bacteria 1706
379 Ga0495638_0107818 3300046460 Bacteria 1658
380 Ga0495638_0198924 3300046460 Bacteria 1132
381 Ga0495653_0011857 3300046463 Bacteria 7120
382 Ga0495653_0055577 3300046463 Bacteria 3020
383 Ga0495650_0002672 3300046471 Bacteria 13883
384 Ga0495650_0005956 3300046471 Bacteria 7730
385 Ga0495650_0006502 3300046471 Bacteria 7266
386 Ga0495650_0006645 3300046471 Bacteria 7172
387 Ga0495650_0006677 3300046471 Bacteria 7145
388 Ga0495650_0044693 3300046471 Bacteria 1870
389 Ga0495650_0047336 3300046471 Bacteria 1799
390 Ga0495650_0066654 3300046471 Bacteria 1424
391 Ga0495582_0007143 3300046473 Bacteria 6203
392 Ga0495605_0000353 3300046474 Bacteria 44329
393 Ga0495605_0002239 3300046474 Bacteria 12079
394 Ga0495605_0003600 3300046474 Bacteria 9186
395 Ga0495605_0006000 3300046474 Bacteria 7021
396 Ga0495605_0006128 3300046474 Bacteria 6935
397 Ga0495605_0007647 3300046474 Bacteria 6127
398 Ga0495605_0011226 3300046474 Bacteria 5001
399 Ga0495605_0014999 3300046474 Bacteria 4225
400 Ga0495605_0016589 3300046474 Bacteria 3984
401 Ga0495605_0023718 3300046474 Bacteria 3222
402 Ga0495605_0032359 3300046474 Bacteria 2662
403 Ga0495639_0000008 3300046475 Bacteria 97096
404 Ga0495639_0003867 3300046475 Bacteria 6428
405 Ga0495639_0007336 3300046475 Bacteria 4732
406 Ga0495584_0001473 3300046491 Bacteria 14112
407 Ga0495584_0001655 3300046491 Bacteria 13112
408 Ga0495584_0002254 3300046491 Bacteria 10996
409 Ga0495584_0002578 3300046491 Bacteria 10220
410 Ga0495584_0003922 3300046491 Bacteria 8043
411 Ga0495584_0004196 3300046491 Bacteria 7774
412 Ga0495584_0005155 3300046491 Bacteria 6935
413 Ga0495584_0005560 3300046491 Bacteria 6671
414 Ga0495584_0016648 3300046491 Bacteria 3748
415 Ga0495584_0018812 3300046491 Bacteria 3510
416 Ga0495584_0026885 3300046491 Bacteria 2916
417 Ga0495584_0051629 3300046491 Bacteria 2070
418 Ga0495584_0127645 3300046491 Bacteria 1289
419 Ga0495585_0000440 3300046492 Bacteria 39788
420 Ga0495585_0003760 3300046492 Bacteria 10131
421 Ga0495585_0004328 3300046492 Bacteria 9231
422 Ga0495585_0005949 3300046492 Bacteria 7632
423 Ga0495585_0006898 3300046492 Bacteria 6997
424 Ga0495585_0012868 3300046492 Bacteria 4918
425 Ga0495585_0014424 3300046492 Bacteria 4604
426 Ga0495585_0017318 3300046492 Bacteria 4164
427 Ga0495585_0035745 3300046492 Bacteria 2805
428 Ga0495585_0045743 3300046492 Bacteria 2442
429 Ga0495585_0058962 3300046492 Bacteria 2116
430 Ga0495585_0068216 3300046492 Bacteria 1943
431 Ga0495585_0115063 3300046492 Bacteria 1427
432 Ga0495585_0134309 3300046492 Bacteria 1300
433 Ga0495594_0007439 3300046499 Bacteria 5634
434 Ga0495594_0019325 3300046499 Bacteria 3619
435 Ga0495594_0058164 3300046499 Bacteria 2135
436 Ga0495596_0000306 3300046500 Bacteria 32460
437 Ga0495596_0012837 3300046500 Bacteria 3573
438 Ga0495596_0016012 3300046500 Bacteria 3121
439 Ga0495596_0016260 3300046500 Bacteria 3093
440 Ga0495596_0108908 3300046500 Bacteria 1075
441 Ga0495607_0000446 3300046501 Bacteria 41547
442 Ga0495607_0000605 3300046501 Bacteria 34893
443 Ga0495607_0007417 3300046501 Bacteria 7592
444 Ga0495607_0008268 3300046501 Bacteria 7120
445 Ga0495607_0011344 3300046501 Bacteria 5938
446 Ga0495607_0012398 3300046501 Bacteria 5631
447 Ga0495607_0012477 3300046501 Bacteria 5606
448 Ga0495607_0014740 3300046501 Bacteria 5082
449 Ga0495607_0020700 3300046501 Bacteria 4152
450 Ga0495607_0021961 3300046501 Bacteria 4013
451 Ga0495607_0028844 3300046501 Bacteria 3418
452 Ga0495607_0032311 3300046501 Bacteria 3195
453 Ga0495607_0035635 3300046501 Bacteria 3008
454 Ga0495607_0037214 3300046501 Bacteria 2924
455 Ga0495607_0045491 3300046501 Bacteria 2581
456 Ga0495607_0057113 3300046501 Bacteria 2238
457 Ga0495607_0104364 3300046501 Bacteria 1512
458 Ga0495583_0001843 3300046506 Bacteria 19779
459 Ga0495583_0005701 3300046506 Bacteria 8369
460 Ga0495583_0006881 3300046506 Bacteria 7315
461 Ga0495583_0017065 3300046506 Bacteria 3869
462 Ga0495606_0004984 3300046507 Bacteria 12946
463 Ga0495606_0005675 3300046507 Bacteria 11814
464 Ga0495606_0007938 3300046507 Bacteria 9349
465 Ga0495606_0009869 3300046507 Bacteria 8005
466 Ga0495606_0009921 3300046507 Bacteria 7974
467 Ga0495606_0014171 3300046507 Bacteria 6240
468 Ga0495606_0104215 3300046507 Bacteria 1722
469 Ga0495610_0003490 3300046512 Bacteria 12224
470 Ga0495610_0004811 3300046512 Bacteria 9852
471 Ga0495610_0005117 3300046512 Bacteria 9431
472 Ga0495610_0005423 3300046512 Bacteria 9074
473 Ga0495610_0008118 3300046512 Bacteria 6860
474 Ga0495610_0008264 3300046512 Bacteria 6765
475 Ga0495610_0009548 3300046512 Bacteria 6119
476 Ga0495610_0019342 3300046512 Bacteria 3815
477 Ga0495610_0020137 3300046512 Bacteria 3711
478 Ga0495610_0021128 3300046512 Bacteria 3586
479 Ga0495610_0031086 3300046512 Bacteria 2789
480 Ga0495616_0001151 3300046513 Bacteria 18698
481 Ga0495616_0005542 3300046513 Bacteria 7753
482 Ga0495616_0005784 3300046513 Bacteria 7556
483 Ga0495616_0006154 3300046513 Bacteria 7307
484 Ga0495616_0007450 3300046513 Bacteria 6551
485 Ga0495616_0015288 3300046513 Bacteria 4268
486 Ga0495616_0022269 3300046513 Bacteria 3422
487 Ga0495616_0027432 3300046513 Bacteria 3021
488 Ga0495620_0000492 3300046515 Bacteria 25629
489 Ga0495620_0000923 3300046515 Bacteria 18062
490 Ga0495620_0003531 3300046515 Bacteria 8942
491 Ga0495620_0010229 3300046515 Bacteria 4950
492 Ga0495620_0011761 3300046515 Bacteria 4551
493 Ga0495620_0012086 3300046515 Bacteria 4478
494 Ga0495620_0015385 3300046515 Bacteria 3865
495 Ga0495620_0017113 3300046515 Bacteria 3622
496 Ga0495620_0043590 3300046515 Bacteria 1953
497 Ga0495620_0054475 3300046515 Bacteria 1689
498 Ga0495620_0072172 3300046515 Bacteria 1410
499 Ga0495628_0078608 3300046516 Bacteria 2566
500 Ga0495630_0002264 3300046517 Bacteria 13403
501 Ga0495630_0009636 3300046517 Bacteria 6948
502 Ga0495631_0000112 3300046518 Bacteria 54578
503 Ga0495631_0000593 3300046518 Bacteria 23995
504 Ga0495631_0024342 3300046518 Bacteria 2795
505 Ga0495631_0048124 3300046518 Bacteria 1870
506 Ga0495631_0063459 3300046518 Bacteria 1599
507 Ga0495631_0067559 3300046518 Bacteria 1546
508 Ga0495631_0070421 3300046518 Bacteria 1512
509 Ga0495632_0001917 3300046519 Bacteria 16627
510 Ga0495632_0002120 3300046519 Bacteria 15473
511 Ga0495632_0004556 3300046519 Bacteria 9393
512 Ga0495632_0006969 3300046519 Bacteria 7175
513 Ga0495632_0008828 3300046519 Bacteria 6136
514 Ga0495632_0009903 3300046519 Bacteria 5698
515 Ga0495632_0011764 3300046519 Bacteria 5093
516 Ga0495632_0017711 3300046519 Bacteria 3926
517 Ga0495632_0020735 3300046519 Bacteria 3552
518 Ga0495632_0023516 3300046519 Bacteria 3290
519 Ga0495632_0030603 3300046519 Bacteria 2792
520 Ga0495632_0031257 3300046519 Bacteria 2754
521 Ga0495632_0031344 3300046519 Bacteria 2749
522 Ga0495632_0040847 3300046519 Bacteria 2333
523 Ga0495637_0001124 3300046520 Bacteria 16372
524 Ga0495637_0001181 3300046520 Bacteria 15948
525 Ga0495637_0002443 3300046520 Bacteria 10265
526 Ga0495637_0002892 3300046520 Bacteria 9296
527 Ga0495637_0003846 3300046520 Bacteria 7879
528 Ga0495637_0004880 3300046520 Bacteria 6901
529 Ga0495637_0005454 3300046520 Bacteria 6478
530 Ga0495637_0010757 3300046520 Bacteria 4413
531 Ga0495637_0012488 3300046520 Bacteria 4060
532 Ga0495637_0017455 3300046520 Bacteria 3344
533 Ga0495637_0020755 3300046520 Bacteria 3016
534 Ga0495637_0027580 3300046520 Bacteria 2539
535 Ga0495637_0033619 3300046520 Bacteria 2250
536 Ga0495637_0036528 3300046520 Bacteria 2139
537 Ga0495643_0007235 3300046522 Bacteria 7191
538 Ga0495643_0032621 3300046522 Bacteria 2889
539 Ga0495643_0039643 3300046522 Bacteria 2575
540 Ga0495643_0047153 3300046522 Bacteria 2334
541 Ga0495643_0055388 3300046522 Bacteria 2120
542 Ga0495644_0001167 3300046523 Bacteria 10775
543 Ga0495644_0001536 3300046523 Bacteria 9421
544 Ga0495644_0001577 3300046523 Bacteria 9294
545 Ga0495644_0003392 3300046523 Bacteria 6298
546 Ga0495644_0012328 3300046523 Bacteria 3288
547 Ga0495644_0033914 3300046523 Bacteria 1927
548 Ga0495644_0046547 3300046523 Bacteria 1630
549 Ga0495648_0000882 3300046524 Bacteria 31571
550 Ga0495648_0001861 3300046524 Bacteria 20207
551 Ga0495648_0009602 3300046524 Bacteria 7468
552 Ga0495648_0010923 3300046524 Bacteria 6886
553 Ga0495648_0011179 3300046524 Bacteria 6780
554 Ga0495648_0013747 3300046524 Bacteria 5967
555 Ga0495648_0018725 3300046524 Bacteria 4888
556 Ga0495648_0023507 3300046524 Bacteria 4219
557 Ga0495648_0025994 3300046524 Bacteria 3952
558 Ga0495648_0027949 3300046524 Bacteria 3766
559 Ga0495648_0029481 3300046524 Bacteria 3642
560 Ga0495648_0034151 3300046524 Bacteria 3313
561 Ga0495648_0037880 3300046524 Bacteria 3093
562 Ga0495648_0058509 3300046524 Bacteria 2304
563 Ga0495648_0063248 3300046524 Bacteria 2186
564 Ga0495666_0000271 3300046526 Bacteria 22372
565 Ga0495666_0005894 3300046526 Bacteria 6174
566 Ga0495666_0021727 3300046526 Bacteria 3175
567 Ga0495642_0000131 3300046528 Bacteria 43078
568 Ga0495642_0000394 3300046528 Bacteria 23462
569 Ga0495642_0000567 3300046528 Bacteria 18607
570 Ga0495654_0000783 3300046530 Bacteria 24509
571 Ga0495654_0002991 3300046530 Bacteria 10569
572 Ga0495654_0003231 3300046530 Bacteria 10073
573 Ga0495654_0005111 3300046530 Bacteria 7665
574 Ga0495654_0006662 3300046530 Bacteria 6537
575 Ga0495654_0009205 3300046530 Bacteria 5415
576 Ga0495654_0010846 3300046530 Bacteria 4949
577 Ga0495654_0011142 3300046530 Bacteria 4881
578 Ga0495654_0015411 3300046530 Bacteria 4058
579 Ga0495654_0019721 3300046530 Bacteria 3524
580 Ga0495654_0021608 3300046530 Bacteria 3346
581 Ga0495654_0021743 3300046530 Bacteria 3335
582 Ga0495654_0022058 3300046530 Bacteria 3311
583 Ga0495654_0024909 3300046530 Bacteria 3087
584 Ga0495654_0027676 3300046530 Bacteria 2903
585 Ga0495654_0029014 3300046530 Bacteria 2824
586 Ga0495654_0030582 3300046530 Bacteria 2738
587 Ga0495654_0044946 3300046530 Bacteria 2180
588 Ga0495654_0060998 3300046530 Bacteria 1812
589 Ga0495654_0097467 3300046530 Bacteria 1357
590 Ga0495586_0139187 3300046535 Bacteria 1361
591 Ga0495587_0001455 3300046536 Bacteria 15798
592 Ga0495587_0016153 3300046536 Bacteria 4646
593 Ga0495609_0002706 3300046538 Bacteria 10687
594 Ga0495609_0004649 3300046538 Bacteria 7451
595 Ga0495609_0005102 3300046538 Bacteria 6998
596 Ga0495609_0006652 3300046538 Bacteria 5866
597 Ga0495609_0017548 3300046538 Bacteria 3324
598 Ga0495609_0054010 3300046538 Bacteria 1784
599 Ga0495609_0073111 3300046538 Bacteria 1504
600 Ga0495597_0004366 3300046542 Bacteria 7799
601 Ga0495597_0006682 3300046542 Bacteria 5939
602 Ga0495597_0008366 3300046542 Bacteria 5186
603 Ga0495597_0008893 3300046542 Bacteria 5008
604 Ga0495597_0009747 3300046542 Bacteria 4730
605 Ga0495597_0017802 3300046542 Bacteria 3339
606 Ga0495597_0021209 3300046542 Bacteria 3021
607 Ga0495597_0027067 3300046542 Bacteria 2630
608 Ga0495597_0029954 3300046542 Bacteria 2482
609 Ga0495597_0037546 3300046542 Bacteria 2174
610 Ga0495597_0096239 3300046542 Bacteria 1252
611 Ga0495645_0027738 3300046543 Bacteria 4114
612 Ga0495622_0000456 3300046557 Bacteria 26169
613 Ga0495622_0000507 3300046557 Bacteria 24182
614 Ga0495622_0000635 3300046557 Bacteria 20385
615 Ga0495622_0008419 3300046557 Bacteria 4775
616 Ga0495622_0019214 3300046557 Bacteria 3182
617 Ga0495622_0032394 3300046557 Bacteria 2441
618 Ga0495622_0119951 3300046557 Bacteria 1201
619 Ga0495633_0006067 3300046558 Bacteria 7243
620 Ga0495633_0006963 3300046558 Bacteria 6609
621 Ga0495633_0028095 3300046558 Bacteria 2744
622 Ga0495633_0105148 3300046558 Bacteria 1309
623 Ga0495656_0000873 3300046615 Bacteria 9756
624 Ga0495656_0031946 3300046615 Bacteria 2139
625 Ga0495668_0001931 3300046616 Bacteria 18433
626 Ga0495668_0006811 3300046616 Bacteria 7418
627 Ga0495668_0020815 3300046616 Bacteria 3767
628 Ga0495668_0146113 3300046616 Bacteria 1294
629 Ga0495634_0003247 3300046642 Bacteria 13134
630 Ga0495634_0049416 3300046642 Bacteria 2828
631 Ga0495611_0000262 3300046648 Bacteria 36226
632 Ga0495611_0003346 3300046648 Bacteria 7077
633 Ga0495611_0012193 3300046648 Bacteria 3654
634 Ga0495611_0012552 3300046648 Bacteria 3602
635 Ga0495611_0058141 3300046648 Bacteria 1753
636 Ga0495611_0117263 3300046648 Bacteria 1241
637 Ga0495625_0005545 3300046660 Bacteria 11458
638 Ga0495625_0010216 3300046660 Bacteria 7788
639 Ga0495625_0010527 3300046660 Bacteria 7640
640 Ga0495625_0011385 3300046660 Bacteria 7258
641 Ga0495625_0013014 3300046660 Bacteria 6711
642 Ga0495625_0018523 3300046660 Bacteria 5432
643 Ga0495625_0024938 3300046660 Bacteria 4542
644 Ga0495625_0033777 3300046660 Bacteria 3778
645 Ga0495625_0035381 3300046660 Bacteria 3682
646 Ga0495625_0037684 3300046660 Bacteria 3544
647 Ga0495625_0073203 3300046660 Bacteria 2402
648 Ga0495635_0004290 3300046663 Bacteria 9870
649 Ga0495659_0000164 3300046664 Bacteria 29695
650 Ga0495659_0010911 3300046664 Bacteria 2925
651 Ga0495661_0006297 3300046665 Bacteria 8345
652 Ga0495661_0007624 3300046665 Bacteria 7541
653 Ga0495661_0013128 3300046665 Bacteria 5575
654 Ga0495661_0020168 3300046665 Bacteria 4357
655 Ga0495661_0022380 3300046665 Bacteria 4112
656 Ga0495661_0031216 3300046665 Bacteria 3384
657 Ga0495661_0048775 3300046665 Bacteria 2571
658 Ga0495588_0001490 3300046674 Bacteria 10037
659 Ga0495588_0001824 3300046674 Bacteria 9079
660 Ga0495588_0044359 3300046674 Bacteria 2277
661 Ga0495588_0070552 3300046674 Bacteria 1816
662 Ga0495623_0004616 3300046679 Bacteria 9050
663 Ga0495623_0017482 3300046679 Bacteria 4633
664 Ga0495646_0002467 3300046680 Bacteria 11369
665 Ga0495646_0010541 3300046680 Bacteria 5871
666 Ga0495646_0024167 3300046680 Bacteria 3826
667 Ga0495669_0046628 3300046684 Bacteria 1934
668 Ga0495613_0009980 3300046689 Bacteria 7055
669 Ga0495613_0039101 3300046689 Bacteria 3517
670 Ga0495613_0064421 3300046689 Bacteria 2680
671 Ga0495624_0000441 3300046690 Bacteria 32708
672 Ga0495670_0000274 3300046691 Bacteria 24255
673 Ga0495670_0003929 3300046691 Bacteria 7301
674 Ga0495670_0004679 3300046691 Bacteria 6714
675 Ga0495670_0006895 3300046691 Bacteria 5592
676 Ga0495670_0011554 3300046691 Bacteria 4344
677 Ga0495670_0018948 3300046691 Bacteria 3391
678 Ga0495670_0034867 3300046691 Bacteria 2507
679 Ga0495670_0038131 3300046691 Bacteria 2396
680 Ga0495670_0038401 3300046691 Bacteria 2387
681 Ga0495670_0060143 3300046691 Bacteria 1908
682 Ga0495670_0065504 3300046691 Bacteria 1831
683 Ga0495670_0091183 3300046691 Bacteria 1560
684 Ga0495670_0111784 3300046691 Bacteria 1414
685 Ga0495670_0154655 3300046691 Bacteria 1203
686 Ga0495671_0000511 3300046692 Bacteria 29778
687 Ga0495671_0006066 3300046692 Bacteria 7022
688 Ga0495671_0006205 3300046692 Bacteria 6933
689 Ga0495671_0006290 3300046692 Bacteria 6872
690 Ga0495671_0006890 3300046692 Bacteria 6519
691 Ga0495671_0009118 3300046692 Bacteria 5558
692 Ga0495671_0012684 3300046692 Bacteria 4594
693 Ga0495671_0014573 3300046692 Bacteria 4226
694 Ga0495671_0018970 3300046692 Bacteria 3642
695 Ga0495671_0019206 3300046692 Bacteria 3616
696 Ga0495671_0042290 3300046692 Bacteria 2290
697 Ga0495671_0065757 3300046692 Bacteria 1784
698 Ga0495671_0065836 3300046692 Bacteria 1783
699 Ga0495649_0002393 3300046694 Bacteria 13249
700 Ga0495649_0002826 3300046694 Bacteria 12050
701 Ga0495649_0006785 3300046694 Bacteria 7090
702 Ga0495649_0006969 3300046694 Bacteria 6974
703 Ga0495649_0007276 3300046694 Bacteria 6773
704 Ga0495649_0007428 3300046694 Bacteria 6678
705 Ga0495649_0007633 3300046694 Bacteria 6569
706 Ga0495649_0010041 3300046694 Bacteria 5596
707 Ga0495649_0020078 3300046694 Bacteria 3749
708 Ga0495649_0029535 3300046694 Bacteria 3031
709 Ga0495649_0030550 3300046694 Bacteria 2975
710 Ga0495649_0040168 3300046694 Bacteria 2563
711 Ga0495649_0046896 3300046694 Bacteria 2351
712 Ga0495649_0099118 3300046694 Bacteria 1550
713 Ga0495589_0000493 3300046794 Bacteria 28238
714 Ga0495589_0002700 3300046794 Bacteria 9803
715 Ga0495589_0002949 3300046794 Bacteria 9378
716 Ga0495589_0004706 3300046794 Bacteria 7246
717 Ga0495589_0005561 3300046794 Bacteria 6648
718 Ga0495589_0016567 3300046794 Bacteria 3787
719 Ga0495589_0021118 3300046794 Bacteria 3327
720 Ga0495589_0051680 3300046794 Bacteria 2031
721 Ga0495589_0083850 3300046794 Bacteria 1549
722 Ga0495600_0006750 3300046809 Bacteria 6995
723 Ga0495600_0051638 3300046809 Bacteria 2683
724 Ga0495660_0003281 3300046810 Bacteria 10036
725 Ga0495660_0005356 3300046810 Bacteria 7681
726 Ga0495660_0008563 3300046810 Bacteria 5987
727 Ga0495660_0010650 3300046810 Bacteria 5345
728 Ga0495660_0010849 3300046810 Bacteria 5292
729 Ga0495660_0010981 3300046810 Bacteria 5261
730 Ga0495660_0012488 3300046810 Bacteria 4930
731 Ga0495660_0013036 3300046810 Bacteria 4819
732 Ga0495660_0015995 3300046810 Bacteria 4328
733 Ga0495660_0023383 3300046810 Bacteria 3525
734 Ga0495660_0024731 3300046810 Bacteria 3419
735 Ga0495660_0029537 3300046810 Bacteria 3092
736 Ga0495660_0030449 3300046810 Bacteria 3039
737 Ga0495581_0002503 3300047315 Bacteria 10425
738 Ga0495581_0003982 3300047315 Bacteria 8509
739 Ga0495604_0006682 3300047317 Bacteria 9143
740 Ga0495604_0029192 3300047317 Bacteria 4387
741 Ga0495604_0064322 3300047317 Bacteria 2795
742 Ga0495604_0256780 3300047317 Bacteria 1189
743 Ga0495636_0000694 3300047318 Bacteria 12336
744 Ga0495636_0020588 3300047318 Bacteria 2658
745 Ga0495636_0059104 3300047318 Bacteria 1617
746 Ga0495674_0009915 3300047319 Bacteria 9034
747 Ga0495672_0000703 3300047320 Bacteria 36780
748 Ga0495672_0001170 3300047320 Bacteria 26579
749 Ga0495672_0001944 3300047320 Bacteria 19535
750 Ga0495672_0002480 3300047320 Bacteria 16914
751 Ga0495672_0002806 3300047320 Bacteria 15542
752 Ga0495672_0004691 3300047320 Bacteria 11062
753 Ga0495672_0007460 3300047320 Bacteria 8226
754 Ga0495672_0009005 3300047320 Bacteria 7282
755 Ga0495672_0014451 3300047320 Bacteria 5406
756 Ga0495672_0016446 3300047320 Bacteria 4984
757 Ga0495672_0031546 3300047320 Bacteria 3307
758 Ga0495672_0033772 3300047320 Bacteria 3167
759 Ga0495672_0037743 3300047320 Bacteria 2953
760 Ga0495672_0062773 3300047320 Bacteria 2135
761 Ga0495676_0003018 3300047321 Bacteria 15214
762 Ga0495676_0015053 3300047321 Bacteria 6905
763 Ga0495680_0000801 3300047322 Bacteria 35054
764 Ga0495680_0009169 3300047322 Bacteria 8928
765 Ga0495680_0011578 3300047322 Bacteria 7797
766 Ga0495680_0016249 3300047322 Bacteria 6400
767 Ga0495680_0022794 3300047322 Bacteria 5214
768 Ga0495683_0000143 3300047323 Bacteria 70181
769 Ga0495683_0001519 3300047323 Bacteria 15033
770 Ga0495683_0006567 3300047323 Bacteria 6346
771 Ga0495683_0007746 3300047323 Bacteria 5767
772 Ga0495683_0009289 3300047323 Bacteria 5238
773 Ga0495683_0012934 3300047323 Bacteria 4375
774 Ga0495683_0015878 3300047323 Bacteria 3911
775 Ga0495683_0023917 3300047323 Bacteria 3137
776 Ga0495683_0024897 3300047323 Bacteria 3069
777 Ga0495683_0031261 3300047323 Bacteria 2713
778 Ga0495683_0032975 3300047323 Bacteria 2637
779 Ga0495683_0040714 3300047323 Bacteria 2347
780 Ga0495687_001510 3300047443 Bacteria 21206
781 Ga0495687_007026 3300047443 Bacteria 6748
782 Ga0495687_007064 3300047443 Bacteria 6711
783 Ga0495687_070883 3300047443 Bacteria 1398
784 Ga0495675_0009120 3300047444 Bacteria 6166
785 Ga0495675_0034438 3300047444 Bacteria 3233
786 Ga0495675_0210018 3300047444 Bacteria 1182
787 Ga0495677_0001464 3300047445 Bacteria 9461
788 Ga0495677_0010867 3300047445 Bacteria 3337
789 Ga0495677_0023087 3300047445 Bacteria 2258
790 Ga0495679_003716 3300047446 Bacteria 7260
791 Ga0495679_004247 3300047446 Bacteria 6657
792 Ga0495679_005890 3300047446 Bacteria 5374
793 Ga0495679_008400 3300047446 Bacteria 4200
794 Ga0495679_010429 3300047446 Bacteria 3648
795 Ga0495679_029581 3300047446 Bacteria 1786
796 Ga0495679_049883 3300047446 Bacteria 1261
797 Ga0495685_002486 3300047447 Bacteria 5780
798 Ga0495673_0000744 3300047469 Bacteria 31024
799 Ga0495673_0001425 3300047469 Bacteria 19150
800 Ga0495673_0005815 3300047469 Bacteria 7377
801 Ga0495673_0006124 3300047469 Bacteria 7138
802 Ga0495673_0006611 3300047469 Bacteria 6795
803 Ga0495673_0006652 3300047469 Bacteria 6769
804 Ga0495673_0007074 3300047469 Bacteria 6503
805 Ga0495673_0008625 3300047469 Bacteria 5708
806 Ga0495673_0015304 3300047469 Bacteria 3955
807 Ga0495673_0015892 3300047469 Bacteria 3863
808 Ga0495673_0022292 3300047469 Bacteria 3107
809 Ga0495673_0024896 3300047469 Bacteria 2882
810 Ga0495673_0038249 3300047469 Bacteria 2184
811 Ga0495673_0040060 3300047469 Bacteria 2120
812 Ga0495673_0051923 3300047469 Bacteria 1793
813 Ga0495673_0064917 3300047469 Bacteria 1551
814 Ga0495681_0001117 3300047470 Bacteria 20353
815 Ga0495681_0001578 3300047470 Bacteria 16960
816 Ga0495681_0001597 3300047470 Bacteria 16856
817 Ga0495681_0003045 3300047470 Bacteria 11782
818 Ga0495681_0003468 3300047470 Bacteria 10965
819 Ga0495681_0003834 3300047470 Bacteria 10405
820 Ga0495681_0003897 3300047470 Bacteria 10287
821 Ga0495681_0003995 3300047470 Bacteria 10153
822 Ga0495681_0008047 3300047470 Bacteria 6646
823 Ga0495681_0008261 3300047470 Bacteria 6540
824 Ga0495681_0018932 3300047470 Bacteria 3777
825 Ga0495681_0020947 3300047470 Bacteria 3534
826 Ga0495681_0037644 3300047470 Bacteria 2380
827 Ga0495681_0042142 3300047470 Bacteria 2211
828 Ga0495684_0003851 3300047471 Bacteria 11691
829 Ga0495684_0012664 3300047471 Bacteria 6509
830 Ga0495686_0005162 3300047472 Bacteria 10402
831 Ga0495686_0005684 3300047472 Bacteria 9754
832 Ga0495686_0014908 3300047472 Bacteria 5332
833 Ga0495686_0050851 3300047472 Bacteria 2602
834 Ga0495686_0112449 3300047472 Bacteria 1631
835 Ga0495686_0170258 3300047472 Bacteria 1267
836 Ga0495593_0004062 3300047673 Bacteria 8714
837 Ga0495593_0007690 3300047673 Bacteria 6290
838 Ga0495593_0031434 3300047673 Bacteria 2900
839 Ga0495602_0029139 3300048088 Bacteria 5267
840 Ga0495626_0000389 3300048091 Bacteria 45440
841 Ga0495626_0000680 3300048091 Bacteria 32558
842 Ga0495626_0001038 3300048091 Bacteria 23766
843 Ga0495626_0001100 3300048091 Bacteria 22830
844 Ga0495626_0001264 3300048091 Bacteria 20709
845 Ga0495626_0003300 3300048091 Bacteria 10421
846 Ga0495626_0003471 3300048091 Bacteria 10103
847 Ga0495626_0003606 3300048091 Bacteria 9846
848 Ga0495626_0007046 3300048091 Bacteria 6311
849 Ga0495626_0010520 3300048091 Bacteria 4928
850 Ga0495626_0019197 3300048091 Bacteria 3420
851 Ga0495626_0025452 3300048091 Bacteria 2894
852 Ga0495626_0052420 3300048091 Bacteria 1880
853 Ga0495626_0079097 3300048091 Bacteria 1463
854 Ga0496102_0003469 3300048905 Bacteria 13373
855 Ga0496102_0120973 3300048905 Bacteria 2445
856 Ga0496102_0202329 3300048905 Bacteria 1872
857 Ga0496103_0003844 3300048906 Bacteria 9137
858 Ga0496110_0036139 3300048913 Bacteria 4289
859 Ga0496112_0099989 3300048915 Bacteria 2870
860 Ga0496116_0000289 3300048919 Bacteria 85507
861 Ga0496116_0000916 3300048919 Bacteria 36473
862 Ga0496116_0001059 3300048919 Bacteria 33350
863 Ga0496116_0003514 3300048919 Bacteria 15422
864 Ga0496116_0005435 3300048919 Bacteria 11809
865 Ga0496116_0038223 3300048919 Bacteria 3336
866 Ga0496116_0043715 3300048919 Bacteria 3049
867 Ga0496117_0006902 3300048920 Bacteria 11267
868 Ga0496117_0011565 3300048920 Bacteria 7896
869 Ga0496117_0024967 3300048920 Bacteria 4708
870 Ga0496117_0033075 3300048920 Bacteria 3916
871 Ga0496117_0036783 3300048920 Bacteria 3657
872 Ga0496117_0038754 3300048920 Bacteria 3527
873 Ga0496117_0123048 3300048920 Bacteria 1589
874 Ga0496117_0161922 3300048920 Bacteria 1309
875 Ga0496118_0013981 3300048921 Bacteria 7539
876 Ga0496118_0015113 3300048921 Bacteria 7169
877 Ga0496118_0015408 3300048921 Bacteria 7077
878 Ga0496118_0017881 3300048921 Bacteria 6432
879 Ga0496118_0044866 3300048921 Bacteria 3457
880 Ga0496118_0142712 3300048921 Bacteria 1514
881 Ga0496118_0172598 3300048921 Bacteria 1318
882 Ga0496119_0036766 3300048922 Bacteria 3190
883 Ga0496119_0041700 3300048922 Bacteria 2919
884 Ga0496119_0070666 3300048922 Bacteria 2047
885 Ga0496121_0000422 3300048924 Bacteria 83552
886 Ga0496121_0001439 3300048924 Bacteria 40227
887 Ga0496121_0015727 3300048924 Bacteria 7889
888 Ga0496121_0016794 3300048924 Bacteria 7528
889 Ga0496121_0176687 3300048924 Bacteria 1545
890 Ga0496121_0179823 3300048924 Bacteria 1527
891 Ga0496121_0197947 3300048924 Bacteria 1434
892 Ga0496121_0216925 3300048924 Bacteria 1350
893 Ga0496122_0004526 3300048925 Bacteria 17162
894 Ga0496122_0008603 3300048925 Bacteria 10958
895 Ga0496122_0012116 3300048925 Bacteria 8633
896 Ga0496122_0038845 3300048925 Bacteria 3805
897 Ga0496122_0076864 3300048925 Bacteria 2347
898 Ga0496123_0006576 3300048926 Bacteria 11229
899 Ga0496123_0008027 3300048926 Bacteria 9775
900 Ga0496123_0009135 3300048926 Bacteria 8967
901 Ga0496123_0019719 3300048926 Bacteria 5306
902 Ga0496123_0028707 3300048926 Bacteria 4112
903 Ga0496123_0035222 3300048926 Bacteria 3570
904 Ga0496123_0147001 3300048926 Bacteria 1278
905 Ga0496124_0001293 3300048927 Bacteria 37983
906 Ga0496124_0007831 3300048927 Bacteria 11272
907 Ga0496124_0028007 3300048927 Bacteria 5044
908 Ga0496124_0043516 3300048927 Bacteria 3860
909 Ga0496124_0066402 3300048927 Bacteria 3004
910 Ga0496124_0073133 3300048927 Bacteria 2837
911 Ga0496124_0125029 3300048927 Bacteria 2050
912 Ga0496124_0217088 3300048927 Bacteria 1441
913 Ga0496125_0004825 3300048928 Bacteria 15324
914 Ga0496125_0006656 3300048928 Bacteria 12438
915 Ga0496125_0015949 3300048928 Bacteria 7236
916 Ga0496125_0028796 3300048928 Bacteria 5006
917 Ga0496125_0086407 3300048928 Bacteria 2372
918 Ga0495678_001007 3300049459 Bacteria 24122
919 Ga0495678_002701 3300049459 Bacteria 11697
920 Ga0495678_003244 3300049459 Bacteria 10187
921 Ga0495678_003336 3300049459 Bacteria 10002
922 Ga0495678_005566 3300049459 Bacteria 6901
923 Ga0495678_005688 3300049459 Bacteria 6786
924 Ga0495678_006936 3300049459 Bacteria 5945
925 Ga0495678_009050 3300049459 Bacteria 4969
926 Ga0495678_014004 3300049459 Bacteria 3742
927 Ga0495678_019396 3300049459 Bacteria 3033
928 Ga0495678_020475 3300049459 Bacteria 2927
929 Ga0495678_036958 3300049459 Bacteria 1988
930 Ga0495678_052727 3300049459 Bacteria 1565
931 Ga0495678_055154 3300049459 Bacteria 1518
932 Ga0495682_0002393 3300049460 Bacteria 8890
933 Ga0495682_0002558 3300049460 Bacteria 8549
934 Ga0495682_0003128 3300049460 Bacteria 7485
935 Ga0495682_0005158 3300049460 Bacteria 5463
936 Ga0495682_0017431 3300049460 Bacteria 2710
937 Ga0495682_0020731 3300049460 Bacteria 2466
938 Ga0495682_0022845 3300049460 Bacteria 2337
939 Ga0495682_0031952 3300049460 Bacteria 1945
940 Ga0495682_0049213 3300049460 Bacteria 1535
941 Ga0495682_0061017 3300049460 Bacteria 1361
942 Ga0501241_000718 3300049758 Bacteria 7153
943 nmdc:mga03683_108198_c1 3300050489 Bacteria 1227
944 nmdc:mga03683_93090_c1 3300050489 Bacteria 1316
945 nmdc:mga00v17_44407_c2 3300050491 Bacteria 1800
946 nmdc:mga00v17_79571_c1 3300050491 Bacteria 2044
947 nmdc:mga00v17_97044_c1 3300050491 Bacteria 1857
948 nmdc:mga08x19_138956_c1 3300050514 Bacteria 1640
949 nmdc:mga08x19_171285_c1 3300050514 Bacteria 1479
950 nmdc:mga08x19_171325_c1 3300050514 Bacteria 1478
951 nmdc:mga08x19_67338_c1 3300050514 Bacteria 2329
952 Ga0500572_001147 3300053111 Bacteria 7673
953 Ga0500621_011829 3300053126 Bacteria 3082
954 Ga0500568_0077734 3300053139 Bacteria 1262
955 Ga0500586_005514 3300053145 Bacteria 3209

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0035635 Ga0495607_0035635_238_1143 297
2 3300041407 Ga0439447_051795 Ga0439447_051795_38_934 298
3 3300042009 Ga0439451_008042 Ga0439451_008042_536_1495 299
4 3300046500 Ga0495596_0108908 Ga0495596_0108908_26_937 303
5 iso_pu_bacteria 2713897148 2715750921 303
6 3300048926 Ga0496123_0028707 Ga0496123_0028707_1863_2777 304
7 iso_pu_bacteria 2946006987 2946007696 305
8 3300046460 Ga0495638_0052455 Ga0495638_0052455_247_1206 306
9 iso_pu_bacteria 2511231007 2511274867 306
10 iso_pu_bacteria 2599185161 2599361262 306
11 iso_pu_bacteria 2599185162 2599367584 306
12 iso_pu_bacteria 2599185163 2599374374 306
13 iso_pu_bacteria 2599185166 2599393232 306
14 iso_pu_bacteria 2599185168 2599404999 306
15 3300047322 Ga0495680_0011578 Ga0495680_0011578_4950_5873 307
16 3300046474 Ga0495605_0006000 Ga0495605_0006000_3947_4885 308
17 3300049460 Ga0495682_0031952 Ga0495682_0031952_161_1087 308
18 3300041411 Ga0439466_0000898 Ga0439466_0000898_4392_5321 309
19 3300042115 Ga0450911_005733 Ga0450911_005733_21_950 309
20 3300046810 Ga0495660_0013036 Ga0495660_0013036_3876_4805 309
21 3300002737 JGI25162J39368_1000340 JGI25162J39368_100034026 311
22 3300002771 JGI25163J39215_1000385 JGI25163J39215_10003854 311
23 3300002772 JGI25164J39214_1000249 JGI25164J39214_100024926 311
24 3300003214 JGI25165J46597_1000459 JGI25165J46597_100045926 311
25 3300009553 Ga0105249_10032624 Ga0105249_100326245 311
26 3300013102 Ga0157371_10000278 Ga0157371_1000027853 311
27 3300014497 Ga0182008_10000305 Ga0182008_1000030525 311
28 3300025231 Ga0207427_100001 Ga0207427_100001113 311
29 3300025233 Ga0209437_100003 Ga0209437_1000031259 311
30 3300025261 Ga0209233_1000007 Ga0209233_1000007113 311
31 3300042876 Ga0451577_0017128 Ga0451577_0017128_4300_5253 311
32 3300048919 Ga0496116_0000289 Ga0496116_0000289_14158_15099 311
33 3300048920 Ga0496117_0038754 Ga0496117_0038754_586_1527 311
34 3300048921 Ga0496118_0172598 Ga0496118_0172598_355_1296 311
35 3300048924 Ga0496121_0000422 Ga0496121_0000422_68522_69463 311
36 3300048925 Ga0496122_0004526 Ga0496122_0004526_6440_7381 311
37 3300048926 Ga0496123_0009135 Ga0496123_0009135_1563_2504 311
38 iso_pu_bacteria 2599185307 2599971759 311
39 3300042016 Ga0439463_000091 Ga0439463_000091_4107_5054 312
40 3300046506 Ga0495583_0005701 Ga0495583_0005701_4252_5199 312
41 3300048919 Ga0496116_0038223 Ga0496116_0038223_727_1674 312
42 3300048921 Ga0496118_0044866 Ga0496118_0044866_2469_3416 312
43 3300048924 Ga0496121_0001439 Ga0496121_0001439_16730_17677 312
44 3300048925 Ga0496122_0038845 Ga0496122_0038845_2232_3179 312
45 3300048926 Ga0496123_0019719 Ga0496123_0019719_548_1495 312
46 3300048927 Ga0496124_0001293 Ga0496124_0001293_5581_6528 312
47 iso_pu_bacteria 2600255283 2601626056 312
48 iso_pu_bacteria 2844665904 2844668423 312
49 iso_pu_bacteria 2912963787 2912964610 312
50 iso_pu_bacteria 3007315729 3007319588 312
51 iso_pu_bacteria 2623620446 2624494228 313
52 iso_pu_bacteria 2919697872 2919699856 313
53 iso_pu_bacteria 8019775933 8019776522 313
54 3300006058 Ga0075432_10006358 Ga0075432_100063584 314
55 3300027907 Ga0207428_10190512 Ga0207428_101905122 314
56 iso_pu_bacteria 3007619802 3007623548 314
57 3300041407 Ga0439447_009121 Ga0439447_009121_1254_2207 315
58 3300041411 Ga0439466_0003475 Ga0439466_0003475_2509_3462 315
59 3300042006 Ga0439432_018184 Ga0439432_018184_163_1116 315
60 3300042010 Ga0439452_002358 Ga0439452_002358_4928_5881 315
61 3300042124 Ga0450922_002553 Ga0450922_002553_692_1645 315
62 3300046460 Ga0495638_0006890 Ga0495638_0006890_2838_3785 315
63 3300046507 Ga0495606_0104215 Ga0495606_0104215_223_1176 315
64 3300046520 Ga0495637_0012488 Ga0495637_0012488_298_1251 315
65 3300046694 Ga0495649_0029535 Ga0495649_0029535_847_1800 315
66 3300048915 Ga0496112_0099989 Ga0496112_0099989_1051_2061 315
67 iso_pu_bacteria 2511231008 2511276854 315
68 iso_pu_bacteria 2511231010 2511291418 315
69 iso_pu_bacteria 2511231011 2511297791 315
70 iso_pu_bacteria 2511231012 2511299230 315
71 iso_pu_bacteria 2511231014 2511313919 315
72 iso_pu_bacteria 2511231015 2511321422 315
73 iso_pu_bacteria 2511231020 2511348258 315
74 iso_pu_bacteria 2511231021 2511353492 315
75 iso_pu_bacteria 2511231022 2511362358 315
76 iso_pu_bacteria 2511231031 2511413650 315
77 iso_pu_bacteria 2582580891 2583790366 315
78 iso_pu_bacteria 2599185185 2599483599 315
79 iso_pu_bacteria 2599185257 2599805507 315
80 iso_pu_bacteria 2599185306 2599966624 315
81 iso_pu_bacteria 2599185308 2599977811 315
82 iso_pu_bacteria 2599185314 2600011930 315
83 iso_pu_bacteria 2600255318 2601800708 315
84 iso_pu_bacteria 2603880185 2606074772 315
85 iso_pu_bacteria 2603880199 2606127635 315
86 iso_pu_bacteria 2643221565 2643844101 315
87 iso_pu_bacteria 2643221589 2643957347 315
88 iso_pu_bacteria 2643221602 2644020940 315
89 iso_pu_bacteria 2643221633 2644187885 315
90 iso_pu_bacteria 2651869719 2652545001 315
91 iso_pu_bacteria 2671180172 2671767757 315
92 iso_pu_bacteria 2713897149 2715757426 315
93 iso_pu_bacteria 2718217725 2718632605 315
94 iso_pu_bacteria 2738543015 2739258256 315
95 iso_pu_bacteria 2740892503 2743735551 315
96 iso_pu_bacteria 2773857670 2774120781 315
97 iso_pu_bacteria 2773857673 2774136817 315
98 iso_pu_bacteria 2784132063 2784260568 315
99 iso_pu_bacteria 2784132072 2784313381 315
100 iso_pu_bacteria 2808606382 2808956867 315
101 iso_pu_bacteria 2808606445 2809215653 315
102 iso_pu_bacteria 2818991456 2819658265 315
103 iso_pu_bacteria 2825651385 2825655866 315
104 iso_pu_bacteria 2842843487 2842848056 315
105 iso_pu_bacteria 2852657418 2852661601 315
106 iso_pu_bacteria 2860339153 2860343101 315
107 iso_pu_bacteria 2878029506 2878030671 315
108 iso_pu_bacteria 2880230671 2880231583 315
109 iso_pu_bacteria 2904518522 2904523336 315
110 iso_pu_bacteria 2904550169 2904550954 315
111 iso_pu_bacteria 2919063839 2919067377 315
112 iso_pu_bacteria 2919385768 2919390840 315
113 iso_pu_bacteria 2919456309 2919458454 315
114 iso_pu_bacteria 2919481497 2919482652 315
115 iso_pu_bacteria 2919487758 2919492544 315
116 iso_pu_bacteria 2923153595 2923154556 315
117 iso_pu_bacteria 2931396565 2931399357 315
118 iso_pu_bacteria 2939636861 2939638266 315
119 iso_pu_bacteria 2984286254 2984291480 315
120 iso_pu_bacteria 3007419365 3007425029 315
121 iso_pu_bacteria 3007511990 3007512260 315
122 iso_pu_bacteria 3007614139 3007618617 315
123 iso_pu_bacteria 3007855910 3007860833 315
124 iso_pu_bacteria 3007866637 3007867491 315
125 iso_pu_bacteria 8015687852 8015688802 315
126 iso_pu_bacteria 8055770955 8055771907 315
127 iso_pu_bacteria 8056125926 8056126932 315
128 iso_pu_bacteria 8056177738 8056180729 315
129 3300013102 Ga0157371_10011847 Ga0157371_100118475 316
130 3300015261 Ga0182006_1011044 Ga0182006_10110446 316
131 3300025256 Ga0209759_1001762 Ga0209759_10017625 316
132 3300027312 Ga0209371_1000142 Ga0209371_100014236 316
133 3300027471 Ga0209995_1004957 Ga0209995_10049572 316
134 3300027526 Ga0209968_1006590 Ga0209968_10065902 316
135 3300027543 Ga0209999_1004280 Ga0209999_10042802 316
136 3300027876 Ga0209974_10006018 Ga0209974_100060186 316
137 3300030500 Ga0268256_1000111 Ga0268256_100011190 316
138 3300042439 Ga0439464_0003166 Ga0439464_0003166_2200_3153 316
139 3300042533 Ga0450901_001231 Ga0450901_001231_207_1163 316
140 3300046538 Ga0495609_0054010 Ga0495609_0054010_375_1331 316
141 3300048926 Ga0496123_0147001 Ga0496123_0147001_86_1039 316
142 2124908027 MRS2a_Contig_6922 MRS2a_00766960 317
143 2162886007 SwRhRL2b_contig_2015853 SwRhRL2b_0013.00007960 317
144 2162886011 MRS1b_contig_7133303 MRS1b_0861.00000680 317
145 3300002737 JGI25162J39368_1000101 JGI25162J39368_100010118 317
146 3300002771 JGI25163J39215_1000349 JGI25163J39215_10003496 317
147 3300002772 JGI25164J39214_1000097 JGI25164J39214_100009774 317
148 3300003214 JGI25165J46597_1000184 JGI25165J46597_100018418 317
149 3300003323 rootH1_10304266 rootH1_103042665 317
150 3300003781 Ga0055536_1000172 Ga0055536_100017241 317
151 3300003781 Ga0055536_1000304 Ga0055536_100030412 317
152 3300003791 Ga0055530_10000300 Ga0055530_1000030019 317
153 3300003791 Ga0055530_10001892 Ga0055530_100018928 317
154 3300003792 Ga0055540_1000376 Ga0055540_100037613 317
155 3300003792 Ga0055540_1000804 Ga0055540_100080414 317
156 3300003794 Ga0055531_10000346 Ga0055531_1000034613 317
157 3300005288 Ga0065714_10002230 Ga0065714_1000223033 317
158 3300005288 Ga0065714_10003116 Ga0065714_100031163 317
159 3300005288 Ga0065714_10004641 Ga0065714_100046414 317
160 3300005288 Ga0065714_10007175 Ga0065714_100071753 317
161 3300005288 Ga0065714_10067312 Ga0065714_100673122 317
162 3300005288 Ga0065714_10075726 Ga0065714_100757264 317
163 3300005288 Ga0065714_10094794 Ga0065714_100947942 317
164 3300005289 Ga0065704_10073240 Ga0065704_100732406 317
165 3300005289 Ga0065704_10087605 Ga0065704_100876051 317
166 3300005290 Ga0065712_10001162 Ga0065712_100011627 317
167 3300005293 Ga0065715_10096237 Ga0065715_100962372 317
168 3300005353 Ga0070669_100004796 Ga0070669_10000479610 317
169 3300005366 Ga0070659_100091591 Ga0070659_1000915914 317
170 3300005457 Ga0070662_100046750 Ga0070662_1000467502 317
171 3300005548 Ga0070665_100143793 Ga0070665_1001437932 317
172 3300005548 Ga0070665_100468082 Ga0070665_1004680821 317
173 3300006051 Ga0075364_10047290 Ga0075364_100472902 317
174 3300006058 Ga0075432_10006195 Ga0075432_100061954 317
175 3300006058 Ga0075432_10009003 Ga0075432_100090033 317
176 3300006058 Ga0075432_10009541 Ga0075432_100095413 317
177 3300006058 Ga0075432_10011684 Ga0075432_100116843 317
178 3300006058 Ga0075432_10031330 Ga0075432_100313302 317
179 3300006177 Ga0075362_10017996 Ga0075362_100179962 317
180 3300006177 Ga0075362_10067871 Ga0075362_100678712 317
181 3300006186 Ga0075369_10068007 Ga0075369_100680072 317
182 3300006914 Ga0075436_100062266 Ga0075436_1000622664 317
183 3300006914 Ga0075436_100087592 Ga0075436_1000875922 317
184 3300006946 Ga0079104_1000259 Ga0079104_100025917 317
185 3300006946 Ga0079104_1000332 Ga0079104_100033242 317
186 3300006946 Ga0079104_1005361 Ga0079104_10053612 317
187 3300006948 Ga0099826_10022026 Ga0099826_100220262 317
188 3300009011 Ga0105251_10000421 Ga0105251_1000042115 317
189 3300009011 Ga0105251_10011066 Ga0105251_100110665 317
190 3300009011 Ga0105251_10031349 Ga0105251_100313494 317
191 3300009036 Ga0105244_10001030 Ga0105244_1000103018 317
192 3300009036 Ga0105244_10001964 Ga0105244_1000196411 317
193 3300009036 Ga0105244_10012099 Ga0105244_100120993 317
194 3300009036 Ga0105244_10013631 Ga0105244_100136315 317
195 3300009036 Ga0105244_10018451 Ga0105244_100184513 317
196 3300009036 Ga0105244_10069895 Ga0105244_100698952 317
197 3300009036 Ga0105244_10081292 Ga0105244_100812922 317
198 3300009036 Ga0105244_10087118 Ga0105244_100871182 317
199 3300009092 Ga0105250_10000494 Ga0105250_1000049414 317
200 3300009092 Ga0105250_10005062 Ga0105250_100050623 317
201 3300009092 Ga0105250_10008083 Ga0105250_100080834 317
202 3300009092 Ga0105250_10019446 Ga0105250_100194464 317
203 3300009092 Ga0105250_10028857 Ga0105250_100288573 317
204 3300009148 Ga0105243_10000821 Ga0105243_100008218 317
205 3300009148 Ga0105243_10009345 Ga0105243_100093457 317
206 3300009148 Ga0105243_10066269 Ga0105243_100662694 317
207 3300009176 Ga0105242_10094405 Ga0105242_100944052 317
208 3300011119 Ga0105246_10001254 Ga0105246_1000125414 317
209 3300011119 Ga0105246_10003184 Ga0105246_100031846 317
210 3300012498 Ga0157345_1000012 Ga0157345_10000124 317
211 3300012498 Ga0157345_1001056 Ga0157345_10010562 317
212 3300013100 Ga0157373_10000994 Ga0157373_100009944 317
213 3300013100 Ga0157373_10007648 Ga0157373_100076486 317
214 3300013100 Ga0157373_10033206 Ga0157373_100332063 317
215 3300013100 Ga0157373_10100847 Ga0157373_101008473 317
216 3300013100 Ga0157373_10109985 Ga0157373_101099852 317
217 3300013102 Ga0157371_10000321 Ga0157371_1000032148 317
218 3300013102 Ga0157371_10002027 Ga0157371_100020277 317
219 3300013102 Ga0157371_10337877 Ga0157371_103378772 317
220 3300013104 Ga0157370_10017498 Ga0157370_100174987 317
221 3300013104 Ga0157370_10018992 Ga0157370_100189928 317
222 3300013104 Ga0157370_10030010 Ga0157370_100300105 317
223 3300013104 Ga0157370_10108940 Ga0157370_101089402 317
224 3300013104 Ga0157370_10115838 Ga0157370_101158382 317
225 3300013104 Ga0157370_10378735 Ga0157370_103787352 317
226 3300013104 Ga0157370_10386585 Ga0157370_103865852 317
227 3300013105 Ga0157369_10001543 Ga0157369_100015435 317
228 3300013105 Ga0157369_10005555 Ga0157369_100055558 317
229 3300013105 Ga0157369_10173635 Ga0157369_101736352 317
230 3300013105 Ga0157369_10229591 Ga0157369_102295911 317
231 3300013105 Ga0157369_10321295 Ga0157369_103212952 317
232 3300013306 Ga0163162_10004547 Ga0163162_1000454712 317
233 3300013306 Ga0163162_10006260 Ga0163162_1000626010 317
234 3300013306 Ga0163162_10132659 Ga0163162_101326594 317
235 3300013306 Ga0163162_10196214 Ga0163162_101962142 317
236 3300013306 Ga0163162_10266214 Ga0163162_102662142 317
237 3300013306 Ga0163162_10329308 Ga0163162_103293082 317
238 3300013307 Ga0157372_10009285 Ga0157372_100092858 317
239 3300013308 Ga0157375_10158440 Ga0157375_101584404 317
240 3300013308 Ga0157375_10670119 Ga0157375_106701191 317
241 3300014497 Ga0182008_10002253 Ga0182008_1000225313 317
242 3300014497 Ga0182008_10003094 Ga0182008_100030948 317
243 3300014497 Ga0182008_10003708 Ga0182008_100037087 317
244 3300014497 Ga0182008_10010282 Ga0182008_100102826 317
245 3300014497 Ga0182008_10017538 Ga0182008_100175384 317
246 3300015261 Ga0182006_1000667 Ga0182006_100066711 317
247 3300015261 Ga0182006_1007434 Ga0182006_10074347 317
248 3300015261 Ga0182006_1008788 Ga0182006_10087882 317
249 3300015261 Ga0182006_1008976 Ga0182006_10089762 317
250 3300015261 Ga0182006_1034464 Ga0182006_10344642 317
251 3300015262 Ga0182007_10000462 Ga0182007_1000046211 317
252 3300015262 Ga0182007_10020121 Ga0182007_100201212 317
253 3300015262 Ga0182007_10054343 Ga0182007_100543432 317
254 3300015265 Ga0182005_1000497 Ga0182005_100049714 317
255 3300015265 Ga0182005_1024894 Ga0182005_10248942 317
256 3300017792 Ga0163161_10000806 Ga0163161_1000080619 317
257 3300017792 Ga0163161_10008948 Ga0163161_100089487 317
258 3300017792 Ga0163161_10009423 Ga0163161_100094234 317
259 3300017792 Ga0163161_10021282 Ga0163161_100212822 317
260 3300017792 Ga0163161_10043450 Ga0163161_100434503 317
261 3300017792 Ga0163161_10054803 Ga0163161_100548032 317
262 3300017792 Ga0163161_10139690 Ga0163161_101396902 317
263 3300017792 Ga0163161_10206565 Ga0163161_102065652 317
264 3300025207 Ga0209760_100198 Ga0209760_1001988 317
265 3300025230 Ga0209563_101666 Ga0209563_1016664 317
266 3300025231 Ga0207427_100004 Ga0207427_100004482 317
267 3300025233 Ga0209437_100028 Ga0209437_100028318 317
268 3300025261 Ga0209233_1000008 Ga0209233_10000081029 317
269 3300025291 Ga0209675_1008586 Ga0209675_10085863 317
270 3300025292 Ga0209676_1000056 Ga0209676_1000056220 317
271 3300025292 Ga0209676_1000078 Ga0209676_1000078138 317
272 3300025292 Ga0209676_1000101 Ga0209676_100010159 317
273 3300025298 Ga0209050_1000041 Ga0209050_1000041158 317
274 3300025298 Ga0209050_1000181 Ga0209050_1000181121 317
275 3300025298 Ga0209050_1000560 Ga0209050_100056021 317
276 3300025303 Ga0209051_1000061 Ga0209051_1000061220 317
277 3300025303 Ga0209051_1000085 Ga0209051_1000085158 317
278 3300025304 Ga0209257_1000105 Ga0209257_1000105109 317
279 3300025711 Ga0207696_1000032 Ga0207696_100003240 317
280 3300025711 Ga0207696_1001372 Ga0207696_100137213 317
281 3300025711 Ga0207696_1001399 Ga0207696_10013994 317
282 3300025711 Ga0207696_1013911 Ga0207696_10139112 317
283 3300025711 Ga0207696_1039532 Ga0207696_10395321 317
284 3300025711 Ga0207696_1045382 Ga0207696_10453822 317
285 3300025728 Ga0207655_1000021 Ga0207655_1000021162 317
286 3300025728 Ga0207655_1000204 Ga0207655_100020489 317
287 3300025728 Ga0207655_1001258 Ga0207655_100125811 317
288 3300025728 Ga0207655_1003454 Ga0207655_10034543 317
289 3300025728 Ga0207655_1003932 Ga0207655_100393211 317
290 3300025728 Ga0207655_1004849 Ga0207655_10048494 317
291 3300025728 Ga0207655_1007453 Ga0207655_10074538 317
292 3300025728 Ga0207655_1008606 Ga0207655_10086064 317
293 3300025728 Ga0207655_1018311 Ga0207655_10183114 317
294 3300025728 Ga0207655_1020221 Ga0207655_10202213 317
295 3300025728 Ga0207655_1037048 Ga0207655_10370483 317
296 3300025728 Ga0207655_1075267 Ga0207655_10752672 317
297 3300025735 Ga0207713_1001157 Ga0207713_100115723 317
298 3300025735 Ga0207713_1001332 Ga0207713_100133217 317
299 3300025735 Ga0207713_1001765 Ga0207713_10017654 317
300 3300025735 Ga0207713_1003529 Ga0207713_10035297 317
301 3300025735 Ga0207713_1006819 Ga0207713_10068197 317
302 3300025735 Ga0207713_1006903 Ga0207713_10069038 317
303 3300025735 Ga0207713_1010489 Ga0207713_10104893 317
304 3300025735 Ga0207713_1011022 Ga0207713_10110225 317
305 3300025923 Ga0207681_10000343 Ga0207681_1000034316 317
306 3300025932 Ga0207690_10215993 Ga0207690_102159931 317
307 3300025933 Ga0207706_10006334 Ga0207706_1000633411 317
308 3300025935 Ga0207709_10000067 Ga0207709_10000067121 317
309 3300025935 Ga0207709_10015663 Ga0207709_100156637 317
310 3300027111 Ga0209281_1000013 Ga0209281_100001381 317
311 3300027111 Ga0209281_1000015 Ga0209281_1000015225 317
312 3300027111 Ga0209281_1002154 Ga0209281_10021545 317
313 3300027111 Ga0209281_1005482 Ga0209281_10054826 317
314 3300027111 Ga0209281_1014644 Ga0209281_10146441 317
315 3300027907 Ga0207428_10031329 Ga0207428_100313294 317
316 3300027907 Ga0207428_10065555 Ga0207428_100655553 317
317 3300027907 Ga0207428_10098318 Ga0207428_100983182 317
318 3300027907 Ga0207428_10163400 Ga0207428_101634002 317
319 3300027907 Ga0207428_10234027 Ga0207428_102340271 317
320 3300028379 Ga0268266_10017099 Ga0268266_100170992 317
321 3300028786 Ga0307517_10067952 Ga0307517_100679523 317
322 3300030735 Ga0316178_1023745 Ga0316178_102374527 317
323 3300030742 Ga0316183_1209807 Ga0316183_12098072 317
324 3300031548 Ga0307408_100000920 Ga0307408_1000009204 317
325 3300031548 Ga0307408_100326933 Ga0307408_1003269331 317
326 3300031730 Ga0307516_10028663 Ga0307516_100286635 317
327 3300031730 Ga0307516_10087707 Ga0307516_100877074 317
328 3300031731 Ga0307405_10002094 Ga0307405_100020948 317
329 3300031903 Ga0307407_10015936 Ga0307407_100159363 317
330 3300031911 Ga0307412_10025631 Ga0307412_100256312 317
331 3300031911 Ga0307412_10149695 Ga0307412_101496952 317
332 3300031995 Ga0307409_100044577 Ga0307409_1000445772 317
333 3300032002 Ga0307416_100480327 Ga0307416_1004803271 317
334 3300032004 Ga0307414_10062759 Ga0307414_100627592 317
335 3300032005 Ga0307411_10162768 Ga0307411_101627682 317
336 3300032005 Ga0307411_10185958 Ga0307411_101859581 317
337 3300033180 Ga0307510_10000622 Ga0307510_1000062219 317
338 3300041405 Ga0439438_000750 Ga0439438_000750_7376_8353 317
339 3300041405 Ga0439438_000852 Ga0439438_000852_10473_11432 317
340 3300041405 Ga0439438_001149 Ga0439438_001149_2019_2978 317
341 3300041405 Ga0439438_001833 Ga0439438_001833_6337_7296 317
342 3300041405 Ga0439438_002168 Ga0439438_002168_3222_4199 317
343 3300041405 Ga0439438_003359 Ga0439438_003359_471_1448 317
344 3300041405 Ga0439438_003879 Ga0439438_003879_2692_3651 317
345 3300041405 Ga0439438_013701 Ga0439438_013701_398_1357 317
346 3300041405 Ga0439438_028887 Ga0439438_028887_320_1279 317
347 3300041407 Ga0439447_000159 Ga0439447_000159_16187_17146 317
348 3300041407 Ga0439447_005657 Ga0439447_005657_792_1751 317
349 3300041407 Ga0439447_007665 Ga0439447_007665_1973_2932 317
350 3300041407 Ga0439447_011244 Ga0439447_011244_1222_2199 317
351 3300041407 Ga0439447_015773 Ga0439447_015773_499_1458 317
352 3300041407 Ga0439447_022325 Ga0439447_022325_513_1490 317
353 3300041411 Ga0439466_0003488 Ga0439466_0003488_1964_2923 317
354 3300041411 Ga0439466_0004614 Ga0439466_0004614_3944_4903 317
355 3300041411 Ga0439466_0004624 Ga0439466_0004624_4096_5055 317
356 3300041411 Ga0439466_0007686 Ga0439466_0007686_2472_3431 317
357 3300041411 Ga0439466_0010832 Ga0439466_0010832_270_1223 317
358 3300041411 Ga0439466_0024262 Ga0439466_0024262_981_1958 317
359 3300041411 Ga0439466_0033966 Ga0439466_0033966_314_1273 317
360 3300041411 Ga0439466_0047191 Ga0439466_0047191_342_1301 317
361 3300041411 Ga0439466_0048620 Ga0439466_0048620_341_1300 317
362 3300041413 Ga0439465_0005755 Ga0439465_0005755_2172_3131 317
363 3300041997 Ga0439431_0000294 Ga0439431_0000294_1846_2805 317
364 3300042004 Ga0439445_0001807 Ga0439445_0001807_3087_4046 317
365 3300042004 Ga0439445_0012031 Ga0439445_0012031_184_1161 317
366 3300042004 Ga0439445_0014985 Ga0439445_0014985_312_1289 317
367 3300042004 Ga0439445_0059144 Ga0439445_0059144_69_1028 317
368 3300042006 Ga0439432_000535 Ga0439432_000535_11235_12194 317
369 3300042006 Ga0439432_000720 Ga0439432_000720_10699_11658 317
370 3300042006 Ga0439432_001157 Ga0439432_001157_7202_8161 317
371 3300042006 Ga0439432_005740 Ga0439432_005740_3051_4028 317
372 3300042006 Ga0439432_023588 Ga0439432_023588_789_1742 317
373 3300042006 Ga0439432_037910 Ga0439432_037910_241_1200 317
374 3300042009 Ga0439451_000925 Ga0439451_000925_1448_2407 317
375 3300042009 Ga0439451_001687 Ga0439451_001687_1114_2091 317
376 3300042009 Ga0439451_001913 Ga0439451_001913_2204_3181 317
377 3300042009 Ga0439451_004589 Ga0439451_004589_1291_2394 317
378 3300042009 Ga0439451_017992 Ga0439451_017992_273_1232 317
379 3300042010 Ga0439452_000100 Ga0439452_000100_13296_14273 317
380 3300042010 Ga0439452_000252 Ga0439452_000252_21216_22175 317
381 3300042010 Ga0439452_001211 Ga0439452_001211_2386_3345 317
382 3300042010 Ga0439452_003769 Ga0439452_003769_4046_5023 317
383 3300042010 Ga0439452_006990 Ga0439452_006990_1488_2447 317
384 3300042010 Ga0439452_016363 Ga0439452_016363_818_1771 317
385 3300042010 Ga0439452_019078 Ga0439452_019078_249_1226 317
386 3300042013 Ga0439456_001097 Ga0439456_001097_282_1241 317
387 3300042013 Ga0439456_026001 Ga0439456_026001_236_1213 317
388 3300042016 Ga0439463_006563 Ga0439463_006563_1808_2767 317
389 3300042016 Ga0439463_008397 Ga0439463_008397_1283_2260 317
390 3300042016 Ga0439463_011152 Ga0439463_011152_557_1534 317
391 3300042115 Ga0450911_000062 Ga0450911_000062_13477_14454 317
392 3300042115 Ga0450911_000913 Ga0450911_000913_6426_7403 317
393 3300042115 Ga0450911_001675 Ga0450911_001675_1578_2549 317
394 3300042115 Ga0450911_002422 Ga0450911_002422_1997_2968 317
395 3300042121 Ga0450919_003002 Ga0450919_003002_206_1183 317
396 3300042124 Ga0450922_000048 Ga0450922_000048_5437_6390 317
397 3300042127 Ga0450890_000167 Ga0450890_000167_2880_3839 317
398 3300042130 Ga0450892_002397 Ga0450892_002397_604_1581 317
399 3300042137 Ga0450902_002890 Ga0450902_002890_925_1884 317
400 3300042137 Ga0450902_004535 Ga0450902_004535_594_1571 317
401 3300042137 Ga0450902_007056 Ga0450902_007056_143_1246 317
402 3300042137 Ga0450902_017572 Ga0450902_017572_56_1033 317
403 3300042138 Ga0450903_000881 Ga0450903_000881_4084_5061 317
404 3300042138 Ga0450903_000919 Ga0450903_000919_1849_2808 317
405 3300042138 Ga0450903_003257 Ga0450903_003257_966_1925 317
406 3300042138 Ga0450903_003836 Ga0450903_003836_207_1166 317
407 3300042139 Ga0450904_001137 Ga0450904_001137_1165_2124 317
408 3300042139 Ga0450904_004391 Ga0450904_004391_299_1276 317
409 3300042145 Ga0450906_000148 Ga0450906_000148_3724_4701 317
410 3300042145 Ga0450906_001325 Ga0450906_001325_464_1417 317
411 3300042145 Ga0450906_004974 Ga0450906_004974_1307_2266 317
412 3300042146 Ga0450907_000126 Ga0450907_000126_16841_17800 317
413 3300042146 Ga0450907_001767 Ga0450907_001767_1965_2942 317
414 3300042146 Ga0450907_002874 Ga0450907_002874_1832_2935 317
415 3300042146 Ga0450907_011838 Ga0450907_011838_98_1057 317
416 3300042147 Ga0450910_000109 Ga0450910_000109_3594_4547 317
417 3300042147 Ga0450910_003330 Ga0450910_003330_825_1802 317
418 3300042156 Ga0439446_0007873 Ga0439446_0007873_1434_2411 317
419 3300042156 Ga0439446_0013774 Ga0439446_0013774_585_1544 317
420 3300042184 Ga0450908_000888 Ga0450908_000888_745_1722 317
421 3300042435 Ga0439434_0000110 Ga0439434_0000110_10554_11513 317
422 3300042435 Ga0439434_0006488 Ga0439434_0006488_1927_2886 317
423 3300042439 Ga0439464_0016391 Ga0439464_0016391_217_1194 317
424 3300042461 Ga0439460_0000354 Ga0439460_0000354_3298_4257 317
425 3300042531 Ga0450918_001987 Ga0450918_001987_2536_3513 317
426 3300042531 Ga0450918_004140 Ga0450918_004140_258_1211 317
427 3300042531 Ga0450918_011803 Ga0450918_011803_528_1505 317
428 3300042532 Ga0450893_0002844 Ga0450893_0002844_1301_2260 317
429 3300042993 Ga0439440_0002271 Ga0439440_0002271_2019_2996 317
430 3300046452 Ga0495617_000922 Ga0495617_000922_10047_11006 317
431 3300046452 Ga0495617_001045 Ga0495617_001045_5714_6673 317
432 3300046452 Ga0495617_002512 Ga0495617_002512_4101_5078 317
433 3300046452 Ga0495617_002930 Ga0495617_002930_4313_5272 317
434 3300046452 Ga0495617_006274 Ga0495617_006274_1583_2542 317
435 3300046452 Ga0495617_007216 Ga0495617_007216_2327_3304 317
436 3300046452 Ga0495617_008560 Ga0495617_008560_1970_2947 317
437 3300046452 Ga0495617_019147 Ga0495617_019147_1059_2018 317
438 3300046452 Ga0495617_019538 Ga0495617_019538_1053_2012 317
439 3300046452 Ga0495617_020822 Ga0495617_020822_268_1227 317
440 3300046452 Ga0495617_023924 Ga0495617_023924_910_1887 317
441 3300046452 Ga0495617_029366 Ga0495617_029366_332_1291 317
442 3300046453 Ga0495627_000689 Ga0495627_000689_20249_21226 317
443 3300046453 Ga0495627_003044 Ga0495627_003044_1087_2046 317
444 3300046453 Ga0495627_003217 Ga0495627_003217_1883_2860 317
445 3300046453 Ga0495627_003392 Ga0495627_003392_4007_4984 317
446 3300046453 Ga0495627_017486 Ga0495627_017486_245_1216 317
447 3300046454 Ga0495592_0014934 Ga0495592_0014934_1921_2880 317
448 3300046455 Ga0495603_0001509 Ga0495603_0001509_7407_8366 317
449 3300046455 Ga0495603_0008229 Ga0495603_0008229_4754_5731 317
450 3300046455 Ga0495603_0034781 Ga0495603_0034781_1387_2346 317
451 3300046455 Ga0495603_0095559 Ga0495603_0095559_154_1113 317
452 3300046457 Ga0495590_0000464 Ga0495590_0000464_10685_11644 317
453 3300046457 Ga0495590_0000998 Ga0495590_0000998_4658_5617 317
454 3300046457 Ga0495590_0002606 Ga0495590_0002606_4218_5177 317
455 3300046457 Ga0495590_0002883 Ga0495590_0002883_2058_3035 317
456 3300046457 Ga0495590_0003084 Ga0495590_0003084_1439_2398 317
457 3300046457 Ga0495590_0003154 Ga0495590_0003154_4037_5014 317
458 3300046457 Ga0495590_0020378 Ga0495590_0020378_619_1578 317
459 3300046458 Ga0495591_000737 Ga0495591_000737_20607_21584 317
460 3300046458 Ga0495591_001318 Ga0495591_001318_10665_11624 317
461 3300046458 Ga0495591_001332 Ga0495591_001332_12335_13312 317
462 3300046458 Ga0495591_004194 Ga0495591_004194_3890_4849 317
463 3300046458 Ga0495591_004469 Ga0495591_004469_4057_5034 317
464 3300046458 Ga0495591_006121 Ga0495591_006121_3816_4775 317
465 3300046458 Ga0495591_007253 Ga0495591_007253_1854_2831 317
466 3300046458 Ga0495591_007565 Ga0495591_007565_2325_3296 317
467 3300046458 Ga0495591_008422 Ga0495591_008422_2073_3032 317
468 3300046458 Ga0495591_009027 Ga0495591_009027_1078_2055 317
469 3300046458 Ga0495591_010841 Ga0495591_010841_252_1226 317
470 3300046458 Ga0495591_011813 Ga0495591_011813_1330_2289 317
471 3300046458 Ga0495591_013568 Ga0495591_013568_1157_2116 317
472 3300046458 Ga0495591_048514 Ga0495591_048514_163_1122 317
473 3300046459 Ga0495629_0160889 Ga0495629_0160889_354_1331 317
474 3300046460 Ga0495638_0008070 Ga0495638_0008070_3131_4090 317
475 3300046460 Ga0495638_0008904 Ga0495638_0008904_3873_4850 317
476 3300046460 Ga0495638_0013646 Ga0495638_0013646_2385_3344 317
477 3300046460 Ga0495638_0020377 Ga0495638_0020377_1203_2162 317
478 3300046460 Ga0495638_0030963 Ga0495638_0030963_407_1378 317
479 3300046460 Ga0495638_0037912 Ga0495638_0037912_893_1864 317
480 3300046460 Ga0495638_0040327 Ga0495638_0040327_1450_2409 317
481 3300046460 Ga0495638_0078651 Ga0495638_0078651_61_1038 317
482 3300046460 Ga0495638_0086324 Ga0495638_0086324_589_1548 317
483 3300046460 Ga0495638_0102830 Ga0495638_0102830_247_1224 317
484 3300046460 Ga0495638_0107818 Ga0495638_0107818_436_1443 317
485 3300046460 Ga0495638_0198924 Ga0495638_0198924_162_1121 317
486 3300046463 Ga0495653_0011857 Ga0495653_0011857_4490_5449 317
487 3300046463 Ga0495653_0055577 Ga0495653_0055577_1863_2840 317
488 3300046471 Ga0495650_0002672 Ga0495650_0002672_8599_9558 317
489 3300046471 Ga0495650_0005956 Ga0495650_0005956_1267_2226 317
490 3300046471 Ga0495650_0006502 Ga0495650_0006502_2124_3083 317
491 3300046471 Ga0495650_0006645 Ga0495650_0006645_1991_2968 317
492 3300046471 Ga0495650_0006677 Ga0495650_0006677_4043_5020 317
493 3300046471 Ga0495650_0044693 Ga0495650_0044693_72_1049 317
494 3300046471 Ga0495650_0047336 Ga0495650_0047336_611_1570 317
495 3300046471 Ga0495650_0066654 Ga0495650_0066654_23_994 317
496 3300046473 Ga0495582_0007143 Ga0495582_0007143_1009_1968 317
497 3300046474 Ga0495605_0000353 Ga0495605_0000353_42860_43819 317
498 3300046474 Ga0495605_0002239 Ga0495605_0002239_11044_12003 317
499 3300046474 Ga0495605_0003600 Ga0495605_0003600_6071_7030 317
500 3300046474 Ga0495605_0006128 Ga0495605_0006128_4224_5201 317
501 3300046474 Ga0495605_0007647 Ga0495605_0007647_3317_4276 317
502 3300046474 Ga0495605_0011226 Ga0495605_0011226_2596_3567 317
503 3300046474 Ga0495605_0014999 Ga0495605_0014999_1157_2134 317
504 3300046474 Ga0495605_0016589 Ga0495605_0016589_2100_3077 317
505 3300046474 Ga0495605_0023718 Ga0495605_0023718_1278_2237 317
506 3300046474 Ga0495605_0032359 Ga0495605_0032359_170_1129 317
507 3300046475 Ga0495639_0000008 Ga0495639_0000008_80713_81666 317
508 3300046475 Ga0495639_0003867 Ga0495639_0003867_3125_4102 317
509 3300046475 Ga0495639_0007336 Ga0495639_0007336_614_1573 317
510 3300046491 Ga0495584_0001473 Ga0495584_0001473_6201_7160 317
511 3300046491 Ga0495584_0001655 Ga0495584_0001655_6042_7019 317
512 3300046491 Ga0495584_0002254 Ga0495584_0002254_5789_6760 317
513 3300046491 Ga0495584_0002578 Ga0495584_0002578_5301_6260 317
514 3300046491 Ga0495584_0003922 Ga0495584_0003922_2204_3163 317
515 3300046491 Ga0495584_0004196 Ga0495584_0004196_2726_3703 317
516 3300046491 Ga0495584_0005155 Ga0495584_0005155_3897_4874 317
517 3300046491 Ga0495584_0005560 Ga0495584_0005560_2947_3906 317
518 3300046491 Ga0495584_0016648 Ga0495584_0016648_1728_2702 317
519 3300046491 Ga0495584_0018812 Ga0495584_0018812_581_1540 317
520 3300046491 Ga0495584_0026885 Ga0495584_0026885_1121_2080 317
521 3300046491 Ga0495584_0051629 Ga0495584_0051629_844_1803 317
522 3300046491 Ga0495584_0127645 Ga0495584_0127645_247_1218 317
523 3300046492 Ga0495585_0000440 Ga0495585_0000440_23841_24818 317
524 3300046492 Ga0495585_0003760 Ga0495585_0003760_4177_5148 317
525 3300046492 Ga0495585_0004328 Ga0495585_0004328_2065_3042 317
526 3300046492 Ga0495585_0005949 Ga0495585_0005949_2132_3109 317
527 3300046492 Ga0495585_0006898 Ga0495585_0006898_2048_3025 317
528 3300046492 Ga0495585_0012868 Ga0495585_0012868_2009_2986 317
529 3300046492 Ga0495585_0014424 Ga0495585_0014424_1750_2709 317
530 3300046492 Ga0495585_0017318 Ga0495585_0017318_1475_2452 317
531 3300046492 Ga0495585_0035745 Ga0495585_0035745_1247_2206 317
532 3300046492 Ga0495585_0045743 Ga0495585_0045743_947_1906 317
533 3300046492 Ga0495585_0058962 Ga0495585_0058962_608_1567 317
534 3300046492 Ga0495585_0068216 Ga0495585_0068216_586_1545 317
535 3300046492 Ga0495585_0115063 Ga0495585_0115063_220_1215 317
536 3300046492 Ga0495585_0134309 Ga0495585_0134309_136_1107 317
537 3300046499 Ga0495594_0007439 Ga0495594_0007439_2408_3361 317
538 3300046499 Ga0495594_0019325 Ga0495594_0019325_1610_2569 317
539 3300046499 Ga0495594_0058164 Ga0495594_0058164_80_1057 317
540 3300046500 Ga0495596_0000306 Ga0495596_0000306_15458_16417 317
541 3300046500 Ga0495596_0012837 Ga0495596_0012837_1188_2165 317
542 3300046500 Ga0495596_0016012 Ga0495596_0016012_163_1140 317
543 3300046500 Ga0495596_0016260 Ga0495596_0016260_1615_2592 317
544 3300046501 Ga0495607_0000446 Ga0495607_0000446_2228_3205 317
545 3300046501 Ga0495607_0000605 Ga0495607_0000605_6385_7344 317
546 3300046501 Ga0495607_0007417 Ga0495607_0007417_4591_5568 317
547 3300046501 Ga0495607_0008268 Ga0495607_0008268_5878_6855 317
548 3300046501 Ga0495607_0011344 Ga0495607_0011344_3279_4256 317
549 3300046501 Ga0495607_0012398 Ga0495607_0012398_2611_3570 317
550 3300046501 Ga0495607_0012477 Ga0495607_0012477_4348_5307 317
551 3300046501 Ga0495607_0014740 Ga0495607_0014740_299_1258 317
552 3300046501 Ga0495607_0020700 Ga0495607_0020700_2905_3864 317
553 3300046501 Ga0495607_0021961 Ga0495607_0021961_1320_2291 317
554 3300046501 Ga0495607_0028844 Ga0495607_0028844_1850_2809 317
555 3300046501 Ga0495607_0032311 Ga0495607_0032311_614_1591 317
556 3300046501 Ga0495607_0037214 Ga0495607_0037214_1041_2000 317
557 3300046501 Ga0495607_0045491 Ga0495607_0045491_412_1371 317
558 3300046501 Ga0495607_0057113 Ga0495607_0057113_861_1838 317
559 3300046501 Ga0495607_0104364 Ga0495607_0104364_270_1247 317
560 3300046506 Ga0495583_0001843 Ga0495583_0001843_13724_14683 317
561 3300046506 Ga0495583_0006881 Ga0495583_0006881_4125_5084 317
562 3300046506 Ga0495583_0017065 Ga0495583_0017065_702_1679 317
563 3300046507 Ga0495606_0004984 Ga0495606_0004984_9765_10742 317
564 3300046507 Ga0495606_0005675 Ga0495606_0005675_6486_7457 317
565 3300046507 Ga0495606_0007938 Ga0495606_0007938_4126_5085 317
566 3300046507 Ga0495606_0009869 Ga0495606_0009869_675_1634 317
567 3300046507 Ga0495606_0009921 Ga0495606_0009921_2222_3199 317
568 3300046507 Ga0495606_0014171 Ga0495606_0014171_571_1548 317
569 3300046512 Ga0495610_0003490 Ga0495610_0003490_7749_8708 317
570 3300046512 Ga0495610_0004811 Ga0495610_0004811_3789_4760 317
571 3300046512 Ga0495610_0005117 Ga0495610_0005117_6539_7516 317
572 3300046512 Ga0495610_0005423 Ga0495610_0005423_2925_3896 317
573 3300046512 Ga0495610_0008118 Ga0495610_0008118_3935_4894 317
574 3300046512 Ga0495610_0008264 Ga0495610_0008264_5345_6304 317
575 3300046512 Ga0495610_0009548 Ga0495610_0009548_4355_5314 317
576 3300046512 Ga0495610_0019342 Ga0495610_0019342_973_1932 317
577 3300046512 Ga0495610_0020137 Ga0495610_0020137_2221_3195 317
578 3300046512 Ga0495610_0021128 Ga0495610_0021128_702_1679 317
579 3300046512 Ga0495610_0031086 Ga0495610_0031086_407_1366 317
580 3300046513 Ga0495616_0001151 Ga0495616_0001151_5494_6453 317
581 3300046513 Ga0495616_0005542 Ga0495616_0005542_630_1607 317
582 3300046513 Ga0495616_0005784 Ga0495616_0005784_4440_5417 317
583 3300046513 Ga0495616_0006154 Ga0495616_0006154_4272_5249 317
584 3300046513 Ga0495616_0007450 Ga0495616_0007450_3919_4878 317
585 3300046513 Ga0495616_0015288 Ga0495616_0015288_1200_2177 317
586 3300046513 Ga0495616_0022269 Ga0495616_0022269_1034_2005 317
587 3300046513 Ga0495616_0027432 Ga0495616_0027432_782_1741 317
588 3300046515 Ga0495620_0000492 Ga0495620_0000492_4751_5728 317
589 3300046515 Ga0495620_0000923 Ga0495620_0000923_3020_3991 317
590 3300046515 Ga0495620_0003531 Ga0495620_0003531_3824_4783 317
591 3300046515 Ga0495620_0010229 Ga0495620_0010229_1202_2161 317
592 3300046515 Ga0495620_0011761 Ga0495620_0011761_2197_3174 317
593 3300046515 Ga0495620_0012086 Ga0495620_0012086_2910_3869 317
594 3300046515 Ga0495620_0015385 Ga0495620_0015385_1377_2354 317
595 3300046515 Ga0495620_0017113 Ga0495620_0017113_2451_3410 317
596 3300046515 Ga0495620_0043590 Ga0495620_0043590_406_1383 317
597 3300046515 Ga0495620_0054475 Ga0495620_0054475_409_1368 317
598 3300046515 Ga0495620_0072172 Ga0495620_0072172_318_1277 317
599 3300046516 Ga0495628_0078608 Ga0495628_0078608_1414_2373 317
600 3300046517 Ga0495630_0002264 Ga0495630_0002264_6424_7383 317
601 3300046517 Ga0495630_0009636 Ga0495630_0009636_4360_5337 317
602 3300046518 Ga0495631_0000112 Ga0495631_0000112_19777_20736 317
603 3300046518 Ga0495631_0000593 Ga0495631_0000593_2213_3190 317
604 3300046518 Ga0495631_0024342 Ga0495631_0024342_1294_2271 317
605 3300046518 Ga0495631_0048124 Ga0495631_0048124_249_1226 317
606 3300046518 Ga0495631_0063459 Ga0495631_0063459_288_1247 317
607 3300046518 Ga0495631_0067559 Ga0495631_0067559_235_1212 317
608 3300046518 Ga0495631_0070421 Ga0495631_0070421_47_1006 317
609 3300046519 Ga0495632_0001917 Ga0495632_0001917_13398_14357 317
610 3300046519 Ga0495632_0002120 Ga0495632_0002120_6423_7382 317
611 3300046519 Ga0495632_0004556 Ga0495632_0004556_3970_4941 317
612 3300046519 Ga0495632_0006969 Ga0495632_0006969_2191_3168 317
613 3300046519 Ga0495632_0008828 Ga0495632_0008828_3836_4795 317
614 3300046519 Ga0495632_0009903 Ga0495632_0009903_3971_4930 317
615 3300046519 Ga0495632_0011764 Ga0495632_0011764_413_1372 317
616 3300046519 Ga0495632_0017711 Ga0495632_0017711_747_1706 317
617 3300046519 Ga0495632_0020735 Ga0495632_0020735_635_1612 317
618 3300046519 Ga0495632_0023516 Ga0495632_0023516_1541_2512 317
619 3300046519 Ga0495632_0030603 Ga0495632_0030603_533_1498 317
620 3300046519 Ga0495632_0031257 Ga0495632_0031257_422_1399 317
621 3300046519 Ga0495632_0031344 Ga0495632_0031344_1422_2399 317
622 3300046519 Ga0495632_0040847 Ga0495632_0040847_247_1224 317
623 3300046520 Ga0495637_0001124 Ga0495637_0001124_4904_5863 317
624 3300046520 Ga0495637_0001181 Ga0495637_0001181_12799_13776 317
625 3300046520 Ga0495637_0002443 Ga0495637_0002443_4597_5556 317
626 3300046520 Ga0495637_0002892 Ga0495637_0002892_6041_7000 317
627 3300046520 Ga0495637_0003846 Ga0495637_0003846_4083_5057 317
628 3300046520 Ga0495637_0004880 Ga0495637_0004880_3838_4797 317
629 3300046520 Ga0495637_0005454 Ga0495637_0005454_4242_5219 317
630 3300046520 Ga0495637_0010757 Ga0495637_0010757_1930_2901 317
631 3300046520 Ga0495637_0017455 Ga0495637_0017455_433_1410 317
632 3300046520 Ga0495637_0020755 Ga0495637_0020755_1316_2275 317
633 3300046520 Ga0495637_0027580 Ga0495637_0027580_1171_2148 317
634 3300046520 Ga0495637_0033619 Ga0495637_0033619_613_1572 317
635 3300046520 Ga0495637_0036528 Ga0495637_0036528_266_1225 317
636 3300046522 Ga0495643_0007235 Ga0495643_0007235_4154_5131 317
637 3300046522 Ga0495643_0032621 Ga0495643_0032621_1367_2326 317
638 3300046522 Ga0495643_0039643 Ga0495643_0039643_236_1195 317
639 3300046522 Ga0495643_0047153 Ga0495643_0047153_553_1530 317
640 3300046522 Ga0495643_0055388 Ga0495643_0055388_874_1845 317
641 3300046523 Ga0495644_0001167 Ga0495644_0001167_4388_5347 317
642 3300046523 Ga0495644_0001536 Ga0495644_0001536_1530_2489 317
643 3300046523 Ga0495644_0001577 Ga0495644_0001577_4392_5351 317
644 3300046523 Ga0495644_0003392 Ga0495644_0003392_1229_2206 317
645 3300046523 Ga0495644_0012328 Ga0495644_0012328_1514_2485 317
646 3300046523 Ga0495644_0033914 Ga0495644_0033914_124_1083 317
647 3300046523 Ga0495644_0046547 Ga0495644_0046547_660_1619 317
648 3300046524 Ga0495648_0000882 Ga0495648_0000882_13323_14282 317
649 3300046524 Ga0495648_0001861 Ga0495648_0001861_13929_14888 317
650 3300046524 Ga0495648_0009602 Ga0495648_0009602_2213_3190 317
651 3300046524 Ga0495648_0010923 Ga0495648_0010923_2053_3012 317
652 3300046524 Ga0495648_0011179 Ga0495648_0011179_368_1327 317
653 3300046524 Ga0495648_0013747 Ga0495648_0013747_2075_3052 317
654 3300046524 Ga0495648_0018725 Ga0495648_0018725_875_1852 317
655 3300046524 Ga0495648_0023507 Ga0495648_0023507_2504_3463 317
656 3300046524 Ga0495648_0025994 Ga0495648_0025994_1971_2930 317
657 3300046524 Ga0495648_0027949 Ga0495648_0027949_1488_2447 317
658 3300046524 Ga0495648_0029481 Ga0495648_0029481_1298_2257 317
659 3300046524 Ga0495648_0034151 Ga0495648_0034151_2092_3051 317
660 3300046524 Ga0495648_0037880 Ga0495648_0037880_1365_2324 317
661 3300046524 Ga0495648_0058509 Ga0495648_0058509_113_1090 317
662 3300046524 Ga0495648_0063248 Ga0495648_0063248_817_1794 317
663 3300046526 Ga0495666_0000271 Ga0495666_0000271_15892_16869 317
664 3300046526 Ga0495666_0005894 Ga0495666_0005894_1486_2445 317
665 3300046526 Ga0495666_0021727 Ga0495666_0021727_594_1553 317
666 3300046528 Ga0495642_0000131 Ga0495642_0000131_4643_5602 317
667 3300046528 Ga0495642_0000394 Ga0495642_0000394_10066_11025 317
668 3300046528 Ga0495642_0000567 Ga0495642_0000567_1998_2957 317
669 3300046530 Ga0495654_0000783 Ga0495654_0000783_21358_22335 317
670 3300046530 Ga0495654_0002991 Ga0495654_0002991_2064_3041 317
671 3300046530 Ga0495654_0003231 Ga0495654_0003231_3959_4930 317
672 3300046530 Ga0495654_0005111 Ga0495654_0005111_2173_3132 317
673 3300046530 Ga0495654_0006662 Ga0495654_0006662_161_1120 317
674 3300046530 Ga0495654_0009205 Ga0495654_0009205_2391_3386 317
675 3300046530 Ga0495654_0010846 Ga0495654_0010846_1698_2675 317
676 3300046530 Ga0495654_0011142 Ga0495654_0011142_2941_3918 317
677 3300046530 Ga0495654_0015411 Ga0495654_0015411_2057_3028 317
678 3300046530 Ga0495654_0019721 Ga0495654_0019721_636_1595 317
679 3300046530 Ga0495654_0021608 Ga0495654_0021608_178_1137 317
680 3300046530 Ga0495654_0021743 Ga0495654_0021743_579_1556 317
681 3300046530 Ga0495654_0022058 Ga0495654_0022058_70_1029 317
682 3300046530 Ga0495654_0024909 Ga0495654_0024909_160_1137 317
683 3300046530 Ga0495654_0027676 Ga0495654_0027676_1767_2726 317
684 3300046530 Ga0495654_0029014 Ga0495654_0029014_1404_2363 317
685 3300046530 Ga0495654_0030582 Ga0495654_0030582_1318_2277 317
686 3300046530 Ga0495654_0044946 Ga0495654_0044946_789_1766 317
687 3300046530 Ga0495654_0060998 Ga0495654_0060998_421_1380 317
688 3300046530 Ga0495654_0097467 Ga0495654_0097467_264_1241 317
689 3300046535 Ga0495586_0139187 Ga0495586_0139187_287_1246 317
690 3300046536 Ga0495587_0001455 Ga0495587_0001455_8054_9013 317
691 3300046536 Ga0495587_0016153 Ga0495587_0016153_936_1895 317
692 3300046538 Ga0495609_0002706 Ga0495609_0002706_1624_2601 317
693 3300046538 Ga0495609_0004649 Ga0495609_0004649_1935_2912 317
694 3300046538 Ga0495609_0005102 Ga0495609_0005102_4338_5315 317
695 3300046538 Ga0495609_0006652 Ga0495609_0006652_2876_3835 317
696 3300046538 Ga0495609_0017548 Ga0495609_0017548_1596_2555 317
697 3300046538 Ga0495609_0073111 Ga0495609_0073111_267_1226 317
698 3300046542 Ga0495597_0004366 Ga0495597_0004366_2313_3290 317
699 3300046542 Ga0495597_0006682 Ga0495597_0006682_4521_5492 317
700 3300046542 Ga0495597_0008366 Ga0495597_0008366_1976_2935 317
701 3300046542 Ga0495597_0008893 Ga0495597_0008893_1875_2846 317
702 3300046542 Ga0495597_0009747 Ga0495597_0009747_1511_2470 317
703 3300046542 Ga0495597_0017802 Ga0495597_0017802_2128_3099 317
704 3300046542 Ga0495597_0021209 Ga0495597_0021209_310_1269 317
705 3300046542 Ga0495597_0027067 Ga0495597_0027067_934_1893 317
706 3300046542 Ga0495597_0029954 Ga0495597_0029954_863_1822 317
707 3300046542 Ga0495597_0037546 Ga0495597_0037546_618_1577 317
708 3300046542 Ga0495597_0096239 Ga0495597_0096239_258_1229 317
709 3300046543 Ga0495645_0027738 Ga0495645_0027738_2498_3457 317
710 3300046557 Ga0495622_0000456 Ga0495622_0000456_784_1737 317
711 3300046557 Ga0495622_0000507 Ga0495622_0000507_21024_22001 317
712 3300046557 Ga0495622_0000635 Ga0495622_0000635_8030_8989 317
713 3300046557 Ga0495622_0008419 Ga0495622_0008419_2334_3293 317
714 3300046557 Ga0495622_0019214 Ga0495622_0019214_1698_2657 317
715 3300046557 Ga0495622_0032394 Ga0495622_0032394_128_1105 317
716 3300046557 Ga0495622_0119951 Ga0495622_0119951_79_1056 317
717 3300046558 Ga0495633_0006067 Ga0495633_0006067_4153_5130 317
718 3300046558 Ga0495633_0006963 Ga0495633_0006963_4490_5449 317
719 3300046558 Ga0495633_0028095 Ga0495633_0028095_1642_2601 317
720 3300046558 Ga0495633_0105148 Ga0495633_0105148_17_988 317
721 3300046615 Ga0495656_0000873 Ga0495656_0000873_6006_6965 317
722 3300046615 Ga0495656_0031946 Ga0495656_0031946_1061_2020 317
723 3300046616 Ga0495668_0001931 Ga0495668_0001931_11158_12117 317
724 3300046616 Ga0495668_0006811 Ga0495668_0006811_2171_3148 317
725 3300046616 Ga0495668_0020815 Ga0495668_0020815_1921_2898 317
726 3300046616 Ga0495668_0146113 Ga0495668_0146113_223_1200 317
727 3300046642 Ga0495634_0003247 Ga0495634_0003247_9606_10565 317
728 3300046642 Ga0495634_0049416 Ga0495634_0049416_869_1828 317
729 3300046648 Ga0495611_0000262 Ga0495611_0000262_14021_14998 317
730 3300046648 Ga0495611_0003346 Ga0495611_0003346_2128_3087 317
731 3300046648 Ga0495611_0012193 Ga0495611_0012193_1540_2499 317
732 3300046648 Ga0495611_0012552 Ga0495611_0012552_1258_2217 317
733 3300046648 Ga0495611_0058141 Ga0495611_0058141_270_1247 317
734 3300046648 Ga0495611_0117263 Ga0495611_0117263_133_1092 317
735 3300046660 Ga0495625_0005545 Ga0495625_0005545_4333_5292 317
736 3300046660 Ga0495625_0010216 Ga0495625_0010216_1766_2725 317
737 3300046660 Ga0495625_0010527 Ga0495625_0010527_1962_2939 317
738 3300046660 Ga0495625_0011385 Ga0495625_0011385_4398_5375 317
739 3300046660 Ga0495625_0013014 Ga0495625_0013014_4079_5038 317
740 3300046660 Ga0495625_0018523 Ga0495625_0018523_2275_3234 317
741 3300046660 Ga0495625_0024938 Ga0495625_0024938_3495_4454 317
742 3300046660 Ga0495625_0033777 Ga0495625_0033777_1266_2243 317
743 3300046660 Ga0495625_0035381 Ga0495625_0035381_2507_3484 317
744 3300046660 Ga0495625_0037684 Ga0495625_0037684_71_1030 317
745 3300046660 Ga0495625_0073203 Ga0495625_0073203_1136_2095 317
746 3300046663 Ga0495635_0004290 Ga0495635_0004290_2808_3767 317
747 3300046664 Ga0495659_0000164 Ga0495659_0000164_12428_13381 317
748 3300046664 Ga0495659_0010911 Ga0495659_0010911_769_1728 317
749 3300046665 Ga0495661_0006297 Ga0495661_0006297_5879_6838 317
750 3300046665 Ga0495661_0007624 Ga0495661_0007624_4732_5709 317
751 3300046665 Ga0495661_0013128 Ga0495661_0013128_1085_2044 317
752 3300046665 Ga0495661_0020168 Ga0495661_0020168_1752_2729 317
753 3300046665 Ga0495661_0022380 Ga0495661_0022380_1256_2233 317
754 3300046665 Ga0495661_0031216 Ga0495661_0031216_266_1225 317
755 3300046665 Ga0495661_0048775 Ga0495661_0048775_600_1559 317
756 3300046674 Ga0495588_0001490 Ga0495588_0001490_3178_4137 317
757 3300046674 Ga0495588_0001824 Ga0495588_0001824_5425_6384 317
758 3300046674 Ga0495588_0044359 Ga0495588_0044359_900_1859 317
759 3300046674 Ga0495588_0070552 Ga0495588_0070552_155_1114 317
760 3300046679 Ga0495623_0004616 Ga0495623_0004616_2010_2969 317
761 3300046679 Ga0495623_0017482 Ga0495623_0017482_1719_2696 317
762 3300046680 Ga0495646_0002467 Ga0495646_0002467_1312_2271 317
763 3300046680 Ga0495646_0010541 Ga0495646_0010541_707_1666 317
764 3300046680 Ga0495646_0024167 Ga0495646_0024167_730_1689 317
765 3300046684 Ga0495669_0046628 Ga0495669_0046628_641_1600 317
766 3300046689 Ga0495613_0009980 Ga0495613_0009980_1972_2931 317
767 3300046689 Ga0495613_0039101 Ga0495613_0039101_679_1638 317
768 3300046689 Ga0495613_0064421 Ga0495613_0064421_484_1491 317
769 3300046690 Ga0495624_0000441 Ga0495624_0000441_29601_30560 317
770 3300046691 Ga0495670_0000274 Ga0495670_0000274_21127_22104 317
771 3300046691 Ga0495670_0003929 Ga0495670_0003929_2236_3195 317
772 3300046691 Ga0495670_0004679 Ga0495670_0004679_3734_4711 317
773 3300046691 Ga0495670_0006895 Ga0495670_0006895_2409_3368 317
774 3300046691 Ga0495670_0011554 Ga0495670_0011554_1860_2831 317
775 3300046691 Ga0495670_0018948 Ga0495670_0018948_1790_2767 317
776 3300046691 Ga0495670_0034867 Ga0495670_0034867_1290_2249 317
777 3300046691 Ga0495670_0038131 Ga0495670_0038131_222_1181 317
778 3300046691 Ga0495670_0038401 Ga0495670_0038401_576_1553 317
779 3300046691 Ga0495670_0060143 Ga0495670_0060143_684_1643 317
780 3300046691 Ga0495670_0065504 Ga0495670_0065504_277_1254 317
781 3300046691 Ga0495670_0091183 Ga0495670_0091183_566_1525 317
782 3300046691 Ga0495670_0111784 Ga0495670_0111784_202_1161 317
783 3300046691 Ga0495670_0154655 Ga0495670_0154655_174_1133 317
784 3300046692 Ga0495671_0000511 Ga0495671_0000511_16141_17118 317
785 3300046692 Ga0495671_0006066 Ga0495671_0006066_2064_3041 317
786 3300046692 Ga0495671_0006205 Ga0495671_0006205_1705_2682 317
787 3300046692 Ga0495671_0006290 Ga0495671_0006290_1203_2162 317
788 3300046692 Ga0495671_0006890 Ga0495671_0006890_1357_2316 317
789 3300046692 Ga0495671_0009118 Ga0495671_0009118_2108_3067 317
790 3300046692 Ga0495671_0012684 Ga0495671_0012684_934_1893 317
791 3300046692 Ga0495671_0014573 Ga0495671_0014573_1296_2255 317
792 3300046692 Ga0495671_0018970 Ga0495671_0018970_575_1546 317
793 3300046692 Ga0495671_0019206 Ga0495671_0019206_2474_3448 317
794 3300046692 Ga0495671_0042290 Ga0495671_0042290_1041_2018 317
795 3300046692 Ga0495671_0065757 Ga0495671_0065757_637_1596 317
796 3300046692 Ga0495671_0065836 Ga0495671_0065836_189_1148 317
797 3300046694 Ga0495649_0002393 Ga0495649_0002393_6920_7879 317
798 3300046694 Ga0495649_0002826 Ga0495649_0002826_308_1267 317
799 3300046694 Ga0495649_0006785 Ga0495649_0006785_1866_2843 317
800 3300046694 Ga0495649_0006969 Ga0495649_0006969_1883_2860 317
801 3300046694 Ga0495649_0007276 Ga0495649_0007276_2916_3875 317
802 3300046694 Ga0495649_0007428 Ga0495649_0007428_5258_6217 317
803 3300046694 Ga0495649_0007633 Ga0495649_0007633_1318_2277 317
804 3300046694 Ga0495649_0010041 Ga0495649_0010041_2420_3373 317
805 3300046694 Ga0495649_0020078 Ga0495649_0020078_1192_2163 317
806 3300046694 Ga0495649_0030550 Ga0495649_0030550_624_1601 317
807 3300046694 Ga0495649_0040168 Ga0495649_0040168_1101_2060 317
808 3300046694 Ga0495649_0046896 Ga0495649_0046896_527_1486 317
809 3300046694 Ga0495649_0099118 Ga0495649_0099118_74_1033 317
810 3300046794 Ga0495589_0000493 Ga0495589_0000493_13765_14724 317
811 3300046794 Ga0495589_0002700 Ga0495589_0002700_2121_3074 317
812 3300046794 Ga0495589_0002949 Ga0495589_0002949_3999_4958 317
813 3300046794 Ga0495589_0004706 Ga0495589_0004706_2069_3028 317
814 3300046794 Ga0495589_0005561 Ga0495589_0005561_5201_6160 317
815 3300046794 Ga0495589_0016567 Ga0495589_0016567_1300_2259 317
816 3300046794 Ga0495589_0021118 Ga0495589_0021118_452_1411 317
817 3300046794 Ga0495589_0051680 Ga0495589_0051680_332_1291 317
818 3300046794 Ga0495589_0083850 Ga0495589_0083850_32_1027 317
819 3300046809 Ga0495600_0006750 Ga0495600_0006750_1937_2896 317
820 3300046809 Ga0495600_0051638 Ga0495600_0051638_243_1202 317
821 3300046810 Ga0495660_0003281 Ga0495660_0003281_4647_5606 317
822 3300046810 Ga0495660_0005356 Ga0495660_0005356_1994_2971 317
823 3300046810 Ga0495660_0008563 Ga0495660_0008563_2125_3102 317
824 3300046810 Ga0495660_0010650 Ga0495660_0010650_2359_3318 317
825 3300046810 Ga0495660_0010849 Ga0495660_0010849_2255_3232 317
826 3300046810 Ga0495660_0010981 Ga0495660_0010981_241_1218 317
827 3300046810 Ga0495660_0012488 Ga0495660_0012488_2015_2974 317
828 3300046810 Ga0495660_0015995 Ga0495660_0015995_2384_3343 317
829 3300046810 Ga0495660_0023383 Ga0495660_0023383_1912_2871 317
830 3300046810 Ga0495660_0024731 Ga0495660_0024731_1741_2700 317
831 3300046810 Ga0495660_0029537 Ga0495660_0029537_855_1814 317
832 3300046810 Ga0495660_0030449 Ga0495660_0030449_1281_2258 317
833 3300047315 Ga0495581_0002503 Ga0495581_0002503_5892_6869 317
834 3300047315 Ga0495581_0003982 Ga0495581_0003982_5545_6498 317
835 3300047317 Ga0495604_0006682 Ga0495604_0006682_6163_7122 317
836 3300047317 Ga0495604_0029192 Ga0495604_0029192_707_1666 317
837 3300047317 Ga0495604_0064322 Ga0495604_0064322_1153_2112 317
838 3300047317 Ga0495604_0256780 Ga0495604_0256780_158_1135 317
839 3300047318 Ga0495636_0000694 Ga0495636_0000694_5044_6003 317
840 3300047318 Ga0495636_0020588 Ga0495636_0020588_630_1589 317
841 3300047318 Ga0495636_0059104 Ga0495636_0059104_391_1350 317
842 3300047319 Ga0495674_0009915 Ga0495674_0009915_6014_6973 317
843 3300047320 Ga0495672_0000703 Ga0495672_0000703_9368_10327 317
844 3300047320 Ga0495672_0001170 Ga0495672_0001170_5794_6753 317
845 3300047320 Ga0495672_0001944 Ga0495672_0001944_2157_3116 317
846 3300047320 Ga0495672_0002480 Ga0495672_0002480_13768_14727 317
847 3300047320 Ga0495672_0002806 Ga0495672_0002806_2220_3197 317
848 3300047320 Ga0495672_0004691 Ga0495672_0004691_5735_6694 317
849 3300047320 Ga0495672_0007460 Ga0495672_0007460_5044_6003 317
850 3300047320 Ga0495672_0009005 Ga0495672_0009005_4353_5312 317
851 3300047320 Ga0495672_0014451 Ga0495672_0014451_1803_2780 317
852 3300047320 Ga0495672_0016446 Ga0495672_0016446_3564_4523 317
853 3300047320 Ga0495672_0031546 Ga0495672_0031546_454_1413 317
854 3300047320 Ga0495672_0033772 Ga0495672_0033772_1537_2514 317
855 3300047320 Ga0495672_0037743 Ga0495672_0037743_919_1878 317
856 3300047320 Ga0495672_0062773 Ga0495672_0062773_268_1227 317
857 3300047321 Ga0495676_0003018 Ga0495676_0003018_12101_13078 317
858 3300047321 Ga0495676_0015053 Ga0495676_0015053_1911_2870 317
859 3300047322 Ga0495680_0000801 Ga0495680_0000801_14278_15237 317
860 3300047322 Ga0495680_0009169 Ga0495680_0009169_5847_6806 317
861 3300047322 Ga0495680_0016249 Ga0495680_0016249_1140_2099 317
862 3300047322 Ga0495680_0022794 Ga0495680_0022794_2136_3131 317
863 3300047323 Ga0495683_0000143 Ga0495683_0000143_19629_20588 317
864 3300047323 Ga0495683_0001519 Ga0495683_0001519_9765_10724 317
865 3300047323 Ga0495683_0006567 Ga0495683_0006567_1217_2194 317
866 3300047323 Ga0495683_0007746 Ga0495683_0007746_2159_3136 317
867 3300047323 Ga0495683_0009289 Ga0495683_0009289_255_1232 317
868 3300047323 Ga0495683_0012934 Ga0495683_0012934_848_1807 317
869 3300047323 Ga0495683_0015878 Ga0495683_0015878_1250_2227 317
870 3300047323 Ga0495683_0023917 Ga0495683_0023917_1746_2723 317
871 3300047323 Ga0495683_0024897 Ga0495683_0024897_295_1254 317
872 3300047323 Ga0495683_0031261 Ga0495683_0031261_1287_2246 317
873 3300047323 Ga0495683_0032975 Ga0495683_0032975_810_1769 317
874 3300047323 Ga0495683_0040714 Ga0495683_0040714_1325_2284 317
875 3300047443 Ga0495687_001510 Ga0495687_001510_5916_6875 317
876 3300047443 Ga0495687_007026 Ga0495687_007026_4272_5231 317
877 3300047443 Ga0495687_007064 Ga0495687_007064_1607_2560 317
878 3300047443 Ga0495687_070883 Ga0495687_070883_351_1310 317
879 3300047444 Ga0495675_0009120 Ga0495675_0009120_343_1302 317
880 3300047444 Ga0495675_0034438 Ga0495675_0034438_494_1453 317
881 3300047444 Ga0495675_0210018 Ga0495675_0210018_164_1159 317
882 3300047445 Ga0495677_0001464 Ga0495677_0001464_6096_7055 317
883 3300047445 Ga0495677_0010867 Ga0495677_0010867_1876_2853 317
884 3300047445 Ga0495677_0023087 Ga0495677_0023087_1105_2064 317
885 3300047446 Ga0495679_003716 Ga0495679_003716_4274_5251 317
886 3300047446 Ga0495679_004247 Ga0495679_004247_2794_3765 317
887 3300047446 Ga0495679_005890 Ga0495679_005890_749_1708 317
888 3300047446 Ga0495679_008400 Ga0495679_008400_1851_2828 317
889 3300047446 Ga0495679_010429 Ga0495679_010429_2076_3053 317
890 3300047446 Ga0495679_029581 Ga0495679_029581_413_1372 317
891 3300047446 Ga0495679_049883 Ga0495679_049883_258_1217 317
892 3300047447 Ga0495685_002486 Ga0495685_002486_1593_2552 317
893 3300047469 Ga0495673_0000744 Ga0495673_0000744_3539_4498 317
894 3300047469 Ga0495673_0001425 Ga0495673_0001425_8885_9844 317
895 3300047469 Ga0495673_0005815 Ga0495673_0005815_2131_3108 317
896 3300047469 Ga0495673_0006124 Ga0495673_0006124_3683_4642 317
897 3300047469 Ga0495673_0006611 Ga0495673_0006611_1540_2499 317
898 3300047469 Ga0495673_0006652 Ga0495673_0006652_2529_3500 317
899 3300047469 Ga0495673_0007074 Ga0495673_0007074_3002_3973 317
900 3300047469 Ga0495673_0008625 Ga0495673_0008625_4401_5360 317
901 3300047469 Ga0495673_0015304 Ga0495673_0015304_1919_2878 317
902 3300047469 Ga0495673_0015892 Ga0495673_0015892_2019_2996 317
903 3300047469 Ga0495673_0022292 Ga0495673_0022292_733_1692 317
904 3300047469 Ga0495673_0024896 Ga0495673_0024896_112_1071 317
905 3300047469 Ga0495673_0038249 Ga0495673_0038249_378_1355 317
906 3300047469 Ga0495673_0040060 Ga0495673_0040060_1059_2036 317
907 3300047469 Ga0495673_0051923 Ga0495673_0051923_113_1072 317
908 3300047469 Ga0495673_0064917 Ga0495673_0064917_244_1221 317
909 3300047470 Ga0495681_0001117 Ga0495681_0001117_17798_18757 317
910 3300047470 Ga0495681_0001578 Ga0495681_0001578_13787_14746 317
911 3300047470 Ga0495681_0001597 Ga0495681_0001597_2482_3441 317
912 3300047470 Ga0495681_0003045 Ga0495681_0003045_6609_7568 317
913 3300047470 Ga0495681_0003468 Ga0495681_0003468_2170_3147 317
914 3300047470 Ga0495681_0003834 Ga0495681_0003834_1632_2609 317
915 3300047470 Ga0495681_0003897 Ga0495681_0003897_4753_5730 317
916 3300047470 Ga0495681_0003995 Ga0495681_0003995_5224_6195 317
917 3300047470 Ga0495681_0008047 Ga0495681_0008047_1963_2922 317
918 3300047470 Ga0495681_0008261 Ga0495681_0008261_2027_3004 317
919 3300047470 Ga0495681_0018932 Ga0495681_0018932_2606_3565 317
920 3300047470 Ga0495681_0020947 Ga0495681_0020947_2100_3077 317
921 3300047470 Ga0495681_0037644 Ga0495681_0037644_40_1011 317
922 3300047470 Ga0495681_0042142 Ga0495681_0042142_970_1947 317
923 3300047471 Ga0495684_0003851 Ga0495684_0003851_9380_10357 317
924 3300047471 Ga0495684_0012664 Ga0495684_0012664_1768_2727 317
925 3300047472 Ga0495686_0005162 Ga0495686_0005162_5277_6248 317
926 3300047472 Ga0495686_0005684 Ga0495686_0005684_6731_7708 317
927 3300047472 Ga0495686_0014908 Ga0495686_0014908_4096_5073 317
928 3300047472 Ga0495686_0050851 Ga0495686_0050851_65_1024 317
929 3300047472 Ga0495686_0112449 Ga0495686_0112449_160_1119 317
930 3300047472 Ga0495686_0170258 Ga0495686_0170258_71_1030 317
931 3300047673 Ga0495593_0004062 Ga0495593_0004062_6239_7198 317
932 3300047673 Ga0495593_0007690 Ga0495593_0007690_2400_3377 317
933 3300047673 Ga0495593_0031434 Ga0495593_0031434_958_1917 317
934 3300048088 Ga0495602_0029139 Ga0495602_0029139_4293_5252 317
935 3300048091 Ga0495626_0000389 Ga0495626_0000389_16009_16968 317
936 3300048091 Ga0495626_0000680 Ga0495626_0000680_19891_20850 317
937 3300048091 Ga0495626_0001038 Ga0495626_0001038_2749_3702 317
938 3300048091 Ga0495626_0001100 Ga0495626_0001100_19969_20946 317
939 3300048091 Ga0495626_0001264 Ga0495626_0001264_4422_5393 317
940 3300048091 Ga0495626_0003300 Ga0495626_0003300_2595_3554 317
941 3300048091 Ga0495626_0003471 Ga0495626_0003471_3674_4633 317
942 3300048091 Ga0495626_0003606 Ga0495626_0003606_7320_8279 317
943 3300048091 Ga0495626_0007046 Ga0495626_0007046_4001_4960 317
944 3300048091 Ga0495626_0010520 Ga0495626_0010520_1242_2219 317
945 3300048091 Ga0495626_0019197 Ga0495626_0019197_1917_2876 317
946 3300048091 Ga0495626_0025452 Ga0495626_0025452_1356_2333 317
947 3300048091 Ga0495626_0052420 Ga0495626_0052420_303_1280 317
948 3300048091 Ga0495626_0079097 Ga0495626_0079097_275_1234 317
949 3300048905 Ga0496102_0003469 Ga0496102_0003469_2656_3615 317
950 3300048905 Ga0496102_0120973 Ga0496102_0120973_1001_1960 317
951 3300048905 Ga0496102_0202329 Ga0496102_0202329_301_1254 317
952 3300048906 Ga0496103_0003844 Ga0496103_0003844_6168_7127 317
953 3300048913 Ga0496110_0036139 Ga0496110_0036139_57_1016 317
954 3300048919 Ga0496116_0000916 Ga0496116_0000916_12427_13380 317
955 3300048919 Ga0496116_0001059 Ga0496116_0001059_30207_31184 317
956 3300048919 Ga0496116_0003514 Ga0496116_0003514_1786_2745 317
957 3300048919 Ga0496116_0005435 Ga0496116_0005435_1738_2697 317
958 3300048919 Ga0496116_0043715 Ga0496116_0043715_1351_2310 317
959 3300048920 Ga0496117_0006902 Ga0496117_0006902_1832_2791 317
960 3300048920 Ga0496117_0011565 Ga0496117_0011565_4634_5593 317
961 3300048920 Ga0496117_0024967 Ga0496117_0024967_1640_2599 317
962 3300048920 Ga0496117_0033075 Ga0496117_0033075_1910_2863 317
963 3300048920 Ga0496117_0036783 Ga0496117_0036783_1369_2328 317
964 3300048920 Ga0496117_0123048 Ga0496117_0123048_389_1387 317
965 3300048920 Ga0496117_0161922 Ga0496117_0161922_202_1200 317
966 3300048921 Ga0496118_0013981 Ga0496118_0013981_4617_5576 317
967 3300048921 Ga0496118_0015113 Ga0496118_0015113_1369_2328 317
968 3300048921 Ga0496118_0015408 Ga0496118_0015408_4270_5229 317
969 3300048921 Ga0496118_0017881 Ga0496118_0017881_2385_3344 317
970 3300048921 Ga0496118_0142712 Ga0496118_0142712_311_1309 317
971 3300048922 Ga0496119_0036766 Ga0496119_0036766_472_1431 317
972 3300048922 Ga0496119_0041700 Ga0496119_0041700_676_1635 317
973 3300048922 Ga0496119_0070666 Ga0496119_0070666_180_1139 317
974 3300048924 Ga0496121_0015727 Ga0496121_0015727_5500_6459 317
975 3300048924 Ga0496121_0016794 Ga0496121_0016794_4609_5568 317
976 3300048924 Ga0496121_0176687 Ga0496121_0176687_277_1236 317
977 3300048924 Ga0496121_0179823 Ga0496121_0179823_490_1449 317
978 3300048924 Ga0496121_0197947 Ga0496121_0197947_231_1229 317
979 3300048924 Ga0496121_0216925 Ga0496121_0216925_175_1134 317
980 3300048925 Ga0496122_0008603 Ga0496122_0008603_1620_2579 317
981 3300048925 Ga0496122_0012116 Ga0496122_0012116_5402_6355 317
982 3300048925 Ga0496122_0076864 Ga0496122_0076864_142_1101 317
983 3300048926 Ga0496123_0006576 Ga0496123_0006576_8468_9427 317
984 3300048926 Ga0496123_0008027 Ga0496123_0008027_7317_8348 317
985 3300048926 Ga0496123_0035222 Ga0496123_0035222_1365_2324 317
986 3300048927 Ga0496124_0007831 Ga0496124_0007831_5875_6834 317
987 3300048927 Ga0496124_0028007 Ga0496124_0028007_1972_2931 317
988 3300048927 Ga0496124_0043516 Ga0496124_0043516_863_1822 317
989 3300048927 Ga0496124_0066402 Ga0496124_0066402_544_1497 317
990 3300048927 Ga0496124_0073133 Ga0496124_0073133_397_1356 317
991 3300048927 Ga0496124_0125029 Ga0496124_0125029_398_1375 317
992 3300048927 Ga0496124_0217088 Ga0496124_0217088_152_1111 317
993 3300048928 Ga0496125_0004825 Ga0496125_0004825_4698_5657 317
994 3300048928 Ga0496125_0006656 Ga0496125_0006656_2026_3057 317
995 3300048928 Ga0496125_0015949 Ga0496125_0015949_1916_2875 317
996 3300048928 Ga0496125_0028796 Ga0496125_0028796_1591_2550 317
997 3300048928 Ga0496125_0086407 Ga0496125_0086407_856_1815 317
998 3300049459 Ga0495678_001007 Ga0495678_001007_8068_9027 317
999 3300049459 Ga0495678_002701 Ga0495678_002701_8696_9673 317
1000 3300049459 Ga0495678_003244 Ga0495678_003244_2216_3193 317
1001 3300049459 Ga0495678_003336 Ga0495678_003336_4333_5292 317
1002 3300049459 Ga0495678_005566 Ga0495678_005566_3945_4904 317
1003 3300049459 Ga0495678_005688 Ga0495678_005688_3945_4922 317
1004 3300049459 Ga0495678_006936 Ga0495678_006936_3823_4782 317
1005 3300049459 Ga0495678_009050 Ga0495678_009050_1467_2426 317
1006 3300049459 Ga0495678_014004 Ga0495678_014004_615_1592 317
1007 3300049459 Ga0495678_019396 Ga0495678_019396_1442_2419 317
1008 3300049459 Ga0495678_020475 Ga0495678_020475_1688_2659 317
1009 3300049459 Ga0495678_036958 Ga0495678_036958_814_1773 317
1010 3300049459 Ga0495678_052727 Ga0495678_052727_317_1294 317
1011 3300049459 Ga0495678_055154 Ga0495678_055154_302_1279 317
1012 3300049460 Ga0495682_0002393 Ga0495682_0002393_2177_3154 317
1013 3300049460 Ga0495682_0002558 Ga0495682_0002558_3078_4037 317
1014 3300049460 Ga0495682_0003128 Ga0495682_0003128_2201_3196 317
1015 3300049460 Ga0495682_0005158 Ga0495682_0005158_1986_2963 317
1016 3300049460 Ga0495682_0017431 Ga0495682_0017431_581_1540 317
1017 3300049460 Ga0495682_0020731 Ga0495682_0020731_77_1054 317
1018 3300049460 Ga0495682_0022845 Ga0495682_0022845_771_1730 317
1019 3300049460 Ga0495682_0049213 Ga0495682_0049213_280_1239 317
1020 3300049460 Ga0495682_0061017 Ga0495682_0061017_124_1101 317
1021 3300049758 Ga0501241_000718 Ga0501241_000718_2159_3136 317
1022 3300050489 nmdc:mga03683_108198_c1 nmdc:mga03683_108198_c1_244_1203 317
1023 3300050489 nmdc:mga03683_93090_c1 nmdc:mga03683_93090_c1_265_1242 317
1024 3300050491 nmdc:mga00v17_44407_c2 nmdc:mga00v17_44407_c2_428_1387 317
1025 3300050491 nmdc:mga00v17_79571_c1 nmdc:mga00v17_79571_c1_173_1195 317
1026 3300050491 nmdc:mga00v17_97044_c1 nmdc:mga00v17_97044_c1_110_1069 317
1027 3300050514 nmdc:mga08x19_138956_c1 nmdc:mga08x19_138956_c1_195_1154 317
1028 3300050514 nmdc:mga08x19_171285_c1 nmdc:mga08x19_171285_c1_408_1367 317
1029 3300050514 nmdc:mga08x19_171325_c1 nmdc:mga08x19_171325_c1_400_1359 317
1030 3300050514 nmdc:mga08x19_67338_c1 nmdc:mga08x19_67338_c1_791_1750 317
1031 3300053111 Ga0500572_001147 Ga0500572_001147_4583_5560 317
1032 3300053126 Ga0500621_011829 Ga0500621_011829_1597_2574 317
1033 3300053139 Ga0500568_0077734 Ga0500568_0077734_249_1220 317
1034 3300053145 Ga0500586_005514 Ga0500586_005514_1305_2264 317
1035 iso_pu_bacteria 2511231004 2511255728 317
1036 iso_pu_bacteria 2511231016 2511325690 317
1037 iso_pu_bacteria 2511231017 2511335398 317
1038 iso_pu_bacteria 2511231019 2511342643 317
1039 iso_pu_bacteria 2511231023 2511370813 317
1040 iso_pu_bacteria 2599185300 2599930191 317
1041 iso_pu_bacteria 2623620443 2624478708 317
1042 iso_pu_bacteria 2738543004 2739200319 317
1043 iso_pu_bacteria 2738543025 2739314775 317
1044 iso_pu_bacteria 2808606377 2808928871 317
1045 iso_pu_bacteria 2808606381 2808950992 317
1046 iso_pu_bacteria 2842832357 2842835816 317
1047 iso_pu_bacteria 2969304461 2969305498 317
1048 iso_pu_bacteria 2974289157 2974292866 317
1049 iso_pu_bacteria 2998139840 2998140940 317
1050 iso_pu_bacteria 3007718800 3007723935 317
1051 iso_pu_bacteria 3007861166 3007863839 317
1052 iso_pu_bacteria 8029995093 8029999817 317
1053 iso_pu_bacteria 8056155041 8056161076 317
1054 iso_pu_bacteria 8056166840 8056170110 317
1055 iso_pu_bacteria 8056569372 8056569594 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

72

109

0.98

PF13411

MerR_1

MerR HTH family regulatory protein

71

140

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i44-assembly1.cif.gz_D structure of raca-dna complex; p21 form 0.9236 20 80
5i44-assembly4.cif.gz_G-2 structure of raca-dna complex; p21 form 0.9137 19 80
4r4e-assembly1.cif.gz_B structure of glnr-dna complex 0.9116 17 91
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.9048 14 88
4r4e-assembly1.cif.gz_A structure of glnr-dna complex 0.904 20 92
ID Description Score Start End Superfamily
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9906 19 89 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9507 19 89 1.10.1660.10
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9454 19 86 1.10.1660.10
5i44J00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9153 20 80 1.10.1660.10
5i44K00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9121 19 80 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A101DAI5-F1-model_v4 MerR family transcriptional regulator 0.9805 192 316
AF-A0A3B9XLD1-F1-model_v4 MerR family transcriptional regulator 0.9453 18 85 GO:0003677
GO:0006355
AF-A0A101DAI5-F1-model_v4 MerR family transcriptional regulator 0.9433 192 316
AF-A0A1H5DFQ1-F1-model_v4 deleted 0.909 17 316
AF-A0A1H5DFQ1-F1-model_v4 deleted 0.8977 17 316

Feature Viewer

pLDDT pTM Quality
85.18 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map