F489148

General Info

Members Datasets Scaffolds Average Seq Length
1055 314 2110 215

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10099351|Ga0075433_100993513
Length 239
Sequence MLTIETGSASPSPLGVTADRPANKAAGQPVMPTTRASVLLVDDHALLRTGVANIINQEADLQVVAEAGNGVEALEAYERHHPDVTLLDLRMPLMEGVEVVRRLRERDPRARVIVLTTYDTDEEISRALKAGAKAYVLKDISADDLVTCIRDVLAGKTYLAPAAAAKLAEEVTRVHLTPRELASLRLMADGKSNKEIANELGISDRTVKTHLGHLFEKLGVTSRTEAVKVATRRGLVRLE

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
184 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
185 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
216 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
217 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
218 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
219 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
220 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
221 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
222 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
223 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
314 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0
Rhizoplane 1.99
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 4.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10099351 3300006852 Bacteria 2576
2 JGI24746J21847_1001582 3300001977 Bacteria 3632
3 JGI25406J46586_10080056 3300003203 Bacteria 1004
4 Ga0065704_10156926 3300005289 Bacteria 1384
5 Ga0065712_10025247 3300005290 Bacteria 1296
6 Ga0065712_10068050 3300005290 Bacteria 15945
7 Ga0065712_10183322 3300005290 Bacteria 1174
8 Ga0065715_10041372 3300005293 Bacteria 1877
9 Ga0065715_10102033 3300005293 Bacteria 3150
10 Ga0065715_10113886 3300005293 Bacteria 2471
11 Ga0065715_10114181 3300005293 Bacteria 2460
12 Ga0065715_10165599 3300005293 Bacteria 1573
13 Ga0065715_10372887 3300005293 Bacteria 918
14 Ga0065707_10103607 3300005295 Bacteria 2739
15 Ga0065707_10104626 3300005295 Bacteria 2686
16 Ga0065707_10118121 3300005295 Bacteria 2194
17 Ga0065707_10142886 3300005295 Bacteria 1750
18 Ga0065707_10151627 3300005295 Bacteria 1652
19 Ga0065707_10251173 3300005295 Bacteria 1112
20 Ga0070676_10004253 3300005328 Bacteria 7526
21 Ga0070676_10071409 3300005328 Bacteria 2085
22 Ga0070676_10156645 3300005328 Bacteria 1462
23 Ga0070683_100064319 3300005329 Bacteria 3414
24 Ga0070683_100269704 3300005329 Bacteria 1619
25 Ga0070683_100453853 3300005329 Bacteria 1223
26 Ga0070690_100000890 3300005330 Bacteria 15249
27 Ga0070690_100007258 3300005330 Bacteria 6342
28 Ga0070690_100017463 3300005330 Bacteria 4315
29 Ga0070690_100110946 3300005330 Bacteria 1830
30 Ga0070690_100652948 3300005330 Bacteria 804
31 Ga0070670_100011687 3300005331 Bacteria 7509
32 Ga0070670_100026604 3300005331 Bacteria 4977
33 Ga0070670_100046557 3300005331 Bacteria 3730
34 Ga0070670_100084202 3300005331 Bacteria 2732
35 Ga0070670_100097921 3300005331 Bacteria 2523
36 Ga0070670_100206789 3300005331 Bacteria 1706
37 Ga0070670_100299467 3300005331 Bacteria 1406
38 Ga0070677_10000840 3300005333 Bacteria 10081
39 Ga0070677_10020087 3300005333 Bacteria 2428
40 Ga0070677_10310531 3300005333 Unclassified 804
41 Ga0068869_100001684 3300005334 Bacteria 13196
42 Ga0068869_100002101 3300005334 Bacteria 11970
43 Ga0068869_100009776 3300005334 Bacteria 6227
44 Ga0068869_100106732 3300005334 Bacteria 2125
45 Ga0068869_100195397 3300005334 Bacteria 1593
46 Ga0068869_100199771 3300005334 Bacteria 1576
47 Ga0068869_100267824 3300005334 Bacteria 1370
48 Ga0068869_100453581 3300005334 Bacteria 1063
49 Ga0070666_10014439 3300005335 Bacteria 5029
50 Ga0070666_10047325 3300005335 Bacteria 2887
51 Ga0070666_10108885 3300005335 Bacteria 1915
52 Ga0070666_10135406 3300005335 Bacteria 1714
53 Ga0070680_100064688 3300005336 Bacteria 2997
54 Ga0070680_100633226 3300005336 Bacteria 919
55 Ga0068868_100016449 3300005338 Bacteria 5493
56 Ga0068868_100099870 3300005338 Bacteria 2348
57 Ga0068868_100165240 3300005338 Bacteria 1830
58 Ga0068868_101061311 3300005338 Bacteria 744
59 Ga0070689_100026199 3300005340 Bacteria 4389
60 Ga0070689_100084019 3300005340 Bacteria 2502
61 Ga0070689_100204256 3300005340 Bacteria 1614
62 Ga0070689_100542831 3300005340 Bacteria 1001
63 Ga0070691_10125105 3300005341 Bacteria 1298
64 Ga0070687_100007174 3300005343 Bacteria 4625
65 Ga0070687_100110392 3300005343 Bacteria 1555
66 Ga0070687_100173051 3300005343 Bacteria 1287
67 Ga0070661_100045423 3300005344 Bacteria 3211
68 Ga0070661_100235992 3300005344 Bacteria 1407
69 Ga0070661_100293203 3300005344 Bacteria 1265
70 Ga0070692_10227296 3300005345 Bacteria 1106
71 Ga0070692_10286763 3300005345 Bacteria 1000
72 Ga0070668_100081894 3300005347 Bacteria 2531
73 Ga0070668_100087211 3300005347 Bacteria 2455
74 Ga0070668_100156572 3300005347 Bacteria 1846
75 Ga0070668_100176481 3300005347 Bacteria 1742
76 Ga0070668_100346128 3300005347 Bacteria 1257
77 Ga0070668_100349437 3300005347 Bacteria 1251
78 Ga0070668_100653317 3300005347 Unclassified 924
79 Ga0070669_100004520 3300005353 Bacteria 10035
80 Ga0070669_100034611 3300005353 Bacteria 3657
81 Ga0070669_100057757 3300005353 Bacteria 2847
82 Ga0070669_100064201 3300005353 Bacteria 2703
83 Ga0070669_100124154 3300005353 Bacteria 1973
84 Ga0070669_100169561 3300005353 Bacteria 1701
85 Ga0070669_100194241 3300005353 Bacteria 1594
86 Ga0070669_100234187 3300005353 Bacteria 1456
87 Ga0070675_100002520 3300005354 Bacteria 13711
88 Ga0070675_100027586 3300005354 Bacteria 4563
89 Ga0070675_100039130 3300005354 Bacteria 3868
90 Ga0070675_100072937 3300005354 Bacteria 2850
91 Ga0070675_100080054 3300005354 Bacteria 2723
92 Ga0070675_100169817 3300005354 Unclassified 1880
93 Ga0070675_100193427 3300005354 Bacteria 1763
94 Ga0070675_100445478 3300005354 Bacteria 1161
95 Ga0070675_100479921 3300005354 Bacteria 1118
96 Ga0070671_100110784 3300005355 Bacteria 2306
97 Ga0070671_100143078 3300005355 Bacteria 2018
98 Ga0070674_100000364 3300005356 Bacteria 22649
99 Ga0070674_100006705 3300005356 Bacteria 6737
100 Ga0070674_100025080 3300005356 Bacteria 3877
101 Ga0070674_100031042 3300005356 Bacteria 3537
102 Ga0070674_100285217 3300005356 Bacteria 1310
103 Ga0070674_100985424 3300005356 Bacteria 739
104 Ga0070673_100035572 3300005364 Bacteria 3778
105 Ga0070673_100043344 3300005364 Bacteria 3476
106 Ga0070673_100099912 3300005364 Bacteria 2387
107 Ga0070673_100131019 3300005364 Bacteria 2104
108 Ga0070673_100289630 3300005364 Bacteria 1439
109 Ga0070673_100756472 3300005364 Bacteria 895
110 Ga0070688_100010095 3300005365 Bacteria 5192
111 Ga0070688_100031210 3300005365 Bacteria 3204
112 Ga0070688_100049617 3300005365 Bacteria 2612
113 Ga0070688_100095322 3300005365 Bacteria 1953
114 Ga0070688_100199880 3300005365 Bacteria 1398
115 Ga0070659_100515046 3300005366 Bacteria 1021
116 Ga0070667_100099399 3300005367 Bacteria 2511
117 Ga0070667_100212428 3300005367 Bacteria 1720
118 Ga0070667_100502266 3300005367 Bacteria 1112
119 Ga0070667_100856312 3300005367 Bacteria 845
120 Ga0070709_10353097 3300005434 Bacteria 1087
121 Ga0070713_100020746 3300005436 Bacteria 5043
122 Ga0070701_10033947 3300005438 Bacteria 2553
123 Ga0070701_10065153 3300005438 Bacteria 1933
124 Ga0070701_10065962 3300005438 Bacteria 1923
125 Ga0070701_10085189 3300005438 Bacteria 1720
126 Ga0070705_100000970 3300005440 Bacteria 16077
127 Ga0070705_100224632 3300005440 Bacteria 1302
128 Ga0070705_100275021 3300005440 Bacteria 1194
129 Ga0070700_100036087 3300005441 Bacteria 2996
130 Ga0070700_100152314 3300005441 Bacteria 1583
131 Ga0070700_100242060 3300005441 Bacteria 1290
132 Ga0070694_100004019 3300005444 Bacteria 8808
133 Ga0070694_100007253 3300005444 Bacteria 6752
134 Ga0070694_100525962 3300005444 Bacteria 944
135 Ga0070708_100022789 3300005445 Bacteria 5317
136 Ga0070663_100001957 3300005455 Bacteria 11503
137 Ga0070663_100185606 3300005455 Bacteria 1616
138 Ga0070678_100005756 3300005456 Bacteria 7209
139 Ga0070678_100034622 3300005456 Bacteria 3519
140 Ga0070678_100137338 3300005456 Bacteria 1951
141 Ga0070678_100213249 3300005456 Bacteria 1601
142 Ga0070678_100307199 3300005456 Bacteria 1350
143 Ga0070678_100522283 3300005456 Bacteria 1050
144 Ga0070678_100578062 3300005456 Bacteria 1001
145 Ga0070662_100085346 3300005457 Bacteria 2359
146 Ga0070662_100136625 3300005457 Bacteria 1896
147 Ga0070662_100204552 3300005457 Bacteria 1568
148 Ga0070662_100550224 3300005457 Bacteria 967
149 Ga0070662_100588957 3300005457 Bacteria 935
150 Ga0070681_10015196 3300005458 Bacteria 7657
151 Ga0068867_100047480 3300005459 Bacteria 3156
152 Ga0070685_10006210 3300005466 Bacteria 6083
153 Ga0070685_10054655 3300005466 Bacteria 2317
154 Ga0070685_10064921 3300005466 Bacteria 2147
155 Ga0070706_100208940 3300005467 Bacteria 1823
156 Ga0070707_100077124 3300005468 Bacteria 3215
157 Ga0070707_100093690 3300005468 Bacteria 2908
158 Ga0070707_100131768 3300005468 Bacteria 2431
159 Ga0070707_100194981 3300005468 Bacteria 1975
160 Ga0070707_100712083 3300005468 Unclassified 967
161 Ga0070698_100004770 3300005471 Bacteria 14880
162 Ga0070698_100010684 3300005471 Bacteria 9782
163 Ga0070698_100023550 3300005471 Bacteria 6437
164 Ga0070698_100171047 3300005471 Bacteria 2114
165 Ga0070698_100278040 3300005471 Bacteria 1606
166 Ga0070698_100305180 3300005471 Bacteria 1522
167 Ga0070698_100592336 3300005471 Bacteria 1049
168 Ga0070699_100008093 3300005518 Bacteria 9126
169 Ga0070699_100017059 3300005518 Bacteria 6236
170 Ga0070699_100050501 3300005518 Bacteria 3601
171 Ga0070699_100064418 3300005518 Bacteria 3179
172 Ga0070699_100175296 3300005518 Bacteria 1901
173 Ga0070699_100355586 3300005518 Bacteria 1320
174 Ga0070684_100018696 3300005535 Bacteria 5716
175 Ga0070684_100078603 3300005535 Bacteria 2915
176 Ga0070684_100165486 3300005535 Bacteria 2007
177 Ga0070684_100180349 3300005535 Bacteria 1920
178 Ga0070697_100068891 3300005536 Bacteria 2897
179 Ga0070697_100180984 3300005536 Bacteria 1787
180 Ga0070697_100273226 3300005536 Bacteria 1449
181 Ga0070697_100315323 3300005536 Bacteria 1346
182 Ga0070697_100377858 3300005536 Bacteria 1227
183 Ga0070672_100011178 3300005543 Bacteria 6254
184 Ga0070672_100094786 3300005543 Bacteria 2413
185 Ga0070672_100166887 3300005543 Bacteria 1829
186 Ga0070672_100219383 3300005543 Bacteria 1595
187 Ga0070672_100518060 3300005543 Bacteria 1033
188 Ga0070672_100671451 3300005543 Bacteria 906
189 Ga0070686_100000401 3300005544 Bacteria 27147
190 Ga0070686_100011335 3300005544 Bacteria 5054
191 Ga0070686_100032999 3300005544 Bacteria 3178
192 Ga0070686_100055527 3300005544 Bacteria 2537
193 Ga0070686_100063764 3300005544 Bacteria 2388
194 Ga0070695_100003001 3300005545 Bacteria 9830
195 Ga0070695_100003046 3300005545 Bacteria 9750
196 Ga0070696_100001252 3300005546 Bacteria 16506
197 Ga0070696_100010085 3300005546 Bacteria 6322
198 Ga0070696_100125631 3300005546 Bacteria 1861
199 Ga0070696_100133670 3300005546 Bacteria 1807
200 Ga0070696_100138511 3300005546 Bacteria 1776
201 Ga0070696_100235919 3300005546 Unclassified 1378
202 Ga0070696_100391910 3300005546 Bacteria 1085
203 Ga0070696_100632229 3300005546 Bacteria 866
204 Ga0070693_100012527 3300005547 Bacteria 4293
205 Ga0070693_100059855 3300005547 Bacteria 2209
206 Ga0070693_100240981 3300005547 Bacteria 1194
207 Ga0070693_100659273 3300005547 Unclassified 762
208 Ga0070665_100001655 3300005548 Bacteria 25682
209 Ga0070665_100017910 3300005548 Bacteria 7114
210 Ga0070665_100019558 3300005548 Bacteria 6798
211 Ga0070704_100028496 3300005549 Bacteria 3716
212 Ga0070704_100044482 3300005549 Bacteria 3085
213 Ga0070704_100064965 3300005549 Bacteria 2625
214 Ga0070704_100073251 3300005549 Bacteria 2495
215 Ga0070704_100110491 3300005549 Bacteria 2091
216 Ga0070704_100413148 3300005549 Bacteria 1154
217 Ga0070704_100944452 3300005549 Bacteria 778
218 Ga0070664_100015363 3300005564 Bacteria 6260
219 Ga0070664_100052023 3300005564 Bacteria 3468
220 Ga0070664_100089919 3300005564 Bacteria 2657
221 Ga0070664_100117099 3300005564 Bacteria 2330
222 Ga0070664_100123849 3300005564 Bacteria 2266
223 Ga0070664_100207509 3300005564 Bacteria 1750
224 Ga0070664_100488179 3300005564 Bacteria 1134
225 Ga0070664_100549628 3300005564 Bacteria 1068
226 Ga0068857_100068663 3300005577 Bacteria 3155
227 Ga0068857_100105707 3300005577 Bacteria 2528
228 Ga0068857_100145437 3300005577 Bacteria 2145
229 Ga0068857_100399889 3300005577 Bacteria 1278
230 Ga0068854_100003857 3300005578 Bacteria 9396
231 Ga0068854_100077981 3300005578 Bacteria 2439
232 Ga0070702_100283747 3300005615 Bacteria 1138
233 Ga0070702_100441489 3300005615 Bacteria 942
234 Ga0068852_100550909 3300005616 Bacteria 1154
235 Ga0068859_100017066 3300005617 Bacteria 7288
236 Ga0068859_100030592 3300005617 Bacteria 5403
237 Ga0068859_100281721 3300005617 Bacteria 1755
238 Ga0068859_100310223 3300005617 Bacteria 1671
239 Ga0068859_100313091 3300005617 Bacteria 1663
240 Ga0068859_100332814 3300005617 Bacteria 1613
241 Ga0068859_100419902 3300005617 Bacteria 1434
242 Ga0068859_100430432 3300005617 Bacteria 1416
243 Ga0068864_100004010 3300005618 Bacteria 12117
244 Ga0068864_100015528 3300005618 Bacteria 6332
245 Ga0068864_100018262 3300005618 Bacteria 5857
246 Ga0068864_100028669 3300005618 Bacteria 4709
247 Ga0068864_100029274 3300005618 Bacteria 4661
248 Ga0068864_100246467 3300005618 Bacteria 1657
249 Ga0068864_100275277 3300005618 Bacteria 1570
250 Ga0068864_100328513 3300005618 Bacteria 1438
251 Ga0068864_100548557 3300005618 Bacteria 1117
252 Ga0068866_10134832 3300005718 Bacteria 1409
253 Ga0068861_100016271 3300005719 Bacteria 5259
254 Ga0068861_100069818 3300005719 Bacteria 2719
255 Ga0068861_100129894 3300005719 Bacteria 2044
256 Ga0068861_100159932 3300005719 Bacteria 1857
257 Ga0068861_100309948 3300005719 Bacteria 1371
258 Ga0068861_100323476 3300005719 Bacteria 1344
259 Ga0068851_10032879 3300005834 Bacteria 2582
260 Ga0068870_10009401 3300005840 Bacteria 4444
261 Ga0068870_10027648 3300005840 Unclassified 2839
262 Ga0068870_10175123 3300005840 Bacteria 1283
263 Ga0068870_10249480 3300005840 Bacteria 1100
264 Ga0068870_10440140 3300005840 Bacteria 857
265 Ga0068863_100089458 3300005841 Bacteria 2919
266 Ga0068863_100435876 3300005841 Bacteria 1285
267 Ga0068863_100772628 3300005841 Bacteria 957
268 Ga0068858_100011666 3300005842 Bacteria 8288
269 Ga0068858_100198659 3300005842 Bacteria 1896
270 Ga0068858_100390793 3300005842 Bacteria 1336
271 Ga0068860_100005333 3300005843 Bacteria 13046
272 Ga0068860_100316762 3300005843 Bacteria 1530
273 Ga0068860_100427426 3300005843 Bacteria 1314
274 Ga0068860_100483965 3300005843 Bacteria 1234
275 Ga0068860_100824485 3300005843 Bacteria 942
276 Ga0068860_101041446 3300005843 Bacteria 837
277 Ga0068862_100002180 3300005844 Bacteria 17576
278 Ga0068862_100031111 3300005844 Bacteria 4502
279 Ga0068862_100090727 3300005844 Bacteria 2661
280 Ga0068862_100114770 3300005844 Bacteria 2368
281 Ga0068862_100152778 3300005844 Bacteria 2056
282 Ga0068862_100175917 3300005844 Bacteria 1919
283 Ga0068862_100497524 3300005844 Bacteria 1156
284 Ga0068862_100994978 3300005844 Bacteria 829
285 Ga0081455_10041723 3300005937 Bacteria 4032
286 Ga0081539_10020045 3300005985 Bacteria 4545
287 Ga0075368_10059677 3300006042 Bacteria 1526
288 Ga0075368_10094016 3300006042 Bacteria 1228
289 Ga0075364_10032948 3300006051 Bacteria 3333
290 Ga0075432_10015652 3300006058 Bacteria 2587
291 Ga0070716_100513635 3300006173 Bacteria 886
292 Ga0075366_10012387 3300006195 Bacteria 4837
293 Ga0075366_10066500 3300006195 Bacteria 2144
294 Ga0097621_100000100 3300006237 Bacteria 48202
295 Ga0097621_100235386 3300006237 Bacteria 1600
296 Ga0097621_100464004 3300006237 Bacteria 1143
297 Ga0075370_10006109 3300006353 Bacteria 6039
298 Ga0068871_100000375 3300006358 Bacteria 31241
299 Ga0068871_100052045 3300006358 Bacteria 3315
300 Ga0068871_100190877 3300006358 Bacteria 1765
301 Ga0068871_100214317 3300006358 Bacteria 1666
302 Ga0075428_100012127 3300006844 Bacteria 9588
303 Ga0075428_100013895 3300006844 Bacteria 8966
304 Ga0075428_100028084 3300006844 Bacteria 6223
305 Ga0075428_100052623 3300006844 Bacteria 4462
306 Ga0075428_100075118 3300006844 Bacteria 3691
307 Ga0075428_100171178 3300006844 Bacteria 2354
308 Ga0075428_100212070 3300006844 Bacteria 2093
309 Ga0075430_100001690 3300006846 Bacteria 18037
310 Ga0075430_100017504 3300006846 Bacteria 6105
311 Ga0075430_100178984 3300006846 Bacteria 1764
312 Ga0075430_100223131 3300006846 Bacteria 1563
313 Ga0075430_100278532 3300006846 Bacteria 1384
314 Ga0075431_100004245 3300006847 Bacteria 14041
315 Ga0075431_100082450 3300006847 Bacteria 3319
316 Ga0075431_100520151 3300006847 Bacteria 1179
317 Ga0075431_100540466 3300006847 Bacteria 1153
318 Ga0075431_100715978 3300006847 Bacteria 978
319 Ga0075433_10002197 3300006852 Bacteria 14790
320 Ga0075433_10033356 3300006852 Bacteria 4413
321 Ga0075433_10077189 3300006852 Bacteria 2934
322 Ga0075433_10125634 3300006852 Bacteria 2278
323 Ga0075433_10161767 3300006852 Bacteria 1993
324 Ga0075434_100000328 3300006871 Bacteria 34123
325 Ga0075434_100001939 3300006871 Bacteria 17945
326 Ga0075434_100002034 3300006871 Bacteria 17562
327 Ga0075434_100020264 3300006871 Bacteria 6447
328 Ga0075434_100020600 3300006871 Bacteria 6400
329 Ga0075434_100035972 3300006871 Bacteria 4897
330 Ga0075434_100058487 3300006871 Bacteria 3831
331 Ga0075434_100062726 3300006871 Bacteria 3701
332 Ga0075434_100327889 3300006871 Bacteria 1551
333 Ga0075429_100004546 3300006880 Bacteria 11931
334 Ga0075429_100023814 3300006880 Bacteria 5313
335 Ga0075429_100043176 3300006880 Bacteria 3922
336 Ga0075429_100076208 3300006880 Bacteria 2921
337 Ga0075429_100139410 3300006880 Bacteria 2123
338 Ga0075429_100181098 3300006880 Unclassified 1846
339 Ga0075429_100346465 3300006880 Bacteria 1300
340 Ga0068865_100072714 3300006881 Bacteria 2443
341 Ga0068865_100093531 3300006881 Bacteria 2186
342 Ga0068865_100176527 3300006881 Bacteria 1642
343 Ga0068865_100720880 3300006881 Bacteria 854
344 Ga0068865_100742986 3300006881 Bacteria 842
345 Ga0075436_100001898 3300006914 Bacteria 14359
346 Ga0075436_100021191 3300006914 Bacteria 4460
347 Ga0075436_100515132 3300006914 Bacteria 876
348 Ga0097620_100017067 3300006931 Bacteria 7288
349 Ga0097620_100030592 3300006931 Bacteria 5403
350 Ga0097620_100281703 3300006931 Bacteria 1755
351 Ga0097620_100310234 3300006931 Bacteria 1671
352 Ga0097620_100313086 3300006931 Bacteria 1663
353 Ga0097620_100332824 3300006931 Bacteria 1613
354 Ga0097620_100419918 3300006931 Bacteria 1434
355 Ga0097620_100430384 3300006931 Bacteria 1416
356 Ga0075435_100000032 3300007076 Bacteria 71881
357 Ga0075435_100000184 3300007076 Bacteria 37257
358 Ga0075435_100005713 3300007076 Bacteria 8721
359 Ga0075435_100034619 3300007076 Bacteria 4003
360 Ga0075435_100034880 3300007076 Bacteria 3990
361 Ga0075435_100076492 3300007076 Bacteria 2743
362 Ga0075435_100119441 3300007076 Bacteria 2199
363 Ga0075435_100168249 3300007076 Bacteria 1849
364 Ga0105240_10789519 3300009093 Bacteria 1029
365 Ga0111539_10000007 3300009094 Bacteria 418059
366 Ga0111539_10000202 3300009094 Bacteria 70287
367 Ga0111539_10002776 3300009094 Bacteria 23243
368 Ga0111539_10008951 3300009094 Bacteria 12677
369 Ga0111539_10035500 3300009094 Bacteria 6035
370 Ga0111539_10040646 3300009094 Bacteria 5596
371 Ga0111539_10080505 3300009094 Bacteria 3831
372 Ga0111539_10087094 3300009094 Bacteria 3670
373 Ga0111539_10101759 3300009094 Bacteria 3373
374 Ga0111539_10177459 3300009094 Bacteria 2488
375 Ga0111539_10378387 3300009094 Bacteria 1648
376 Ga0111539_10625597 3300009094 Bacteria 1254
377 Ga0111539_10745080 3300009094 Bacteria 1140
378 Ga0111539_11266352 3300009094 Bacteria 856
379 Ga0105245_10011163 3300009098 Bacteria 7818
380 Ga0105245_11112852 3300009098 Bacteria 836
381 Ga0105245_11477017 3300009098 Bacteria 730
382 Ga0105247_10052630 3300009101 Bacteria 2511
383 Ga0105247_10237913 3300009101 Bacteria 1239
384 Ga0105247_10310576 3300009101 Bacteria 1097
385 Ga0114129_10000235 3300009147 Bacteria 61785
386 Ga0114129_10000598 3300009147 Bacteria 44512
387 Ga0114129_10001781 3300009147 Bacteria 29343
388 Ga0114129_10005968 3300009147 Bacteria 17245
389 Ga0114129_10034145 3300009147 Bacteria 7184
390 Ga0114129_10044838 3300009147 Bacteria 6220
391 Ga0114129_10070069 3300009147 Bacteria 4888
392 Ga0114129_10110868 3300009147 Bacteria 3787
393 Ga0114129_10117224 3300009147 Bacteria 3669
394 Ga0114129_10146961 3300009147 Bacteria 3228
395 Ga0114129_10200015 3300009147 Bacteria 2707
396 Ga0114129_10257584 3300009147 Bacteria 2340
397 Ga0114129_10320906 3300009147 Bacteria 2059
398 Ga0114129_10880853 3300009147 Bacteria 1136
399 Ga0114129_10992075 3300009147 Bacteria 1058
400 Ga0114129_11105911 3300009147 Bacteria 992
401 Ga0105243_10267570 3300009148 Bacteria 1533
402 Ga0105243_10739509 3300009148 Bacteria 963
403 Ga0105241_10030344 3300009174 Bacteria 4039
404 Ga0105241_10610404 3300009174 Bacteria 986
405 Ga0105242_10050388 3300009176 Bacteria 3390
406 Ga0105242_10094821 3300009176 Bacteria 2518
407 Ga0105242_10154432 3300009176 Bacteria 2004
408 Ga0105242_10179465 3300009176 Bacteria 1867
409 Ga0105248_10012947 3300009177 Bacteria 9195
410 Ga0105248_10015654 3300009177 Bacteria 8357
411 Ga0105248_10043535 3300009177 Bacteria 5033
412 Ga0105248_10046089 3300009177 Bacteria 4887
413 Ga0105248_10063264 3300009177 Bacteria 4153
414 Ga0105248_10068205 3300009177 Bacteria 3994
415 Ga0105248_10068379 3300009177 Bacteria 3988
416 Ga0105248_10152260 3300009177 Bacteria 2610
417 Ga0105248_10177413 3300009177 Bacteria 2401
418 Ga0105248_10185941 3300009177 Bacteria 2341
419 Ga0105248_10574954 3300009177 Bacteria 1271
420 Ga0105248_10658223 3300009177 Bacteria 1182
421 Ga0105237_10845912 3300009545 Bacteria 922
422 Ga0105238_10007149 3300009551 Bacteria 11164
423 Ga0105238_10253610 3300009551 Bacteria 1738
424 Ga0105249_10008963 3300009553 Bacteria 8740
425 Ga0105249_10153949 3300009553 Bacteria 2216
426 Ga0105249_10212407 3300009553 Bacteria 1899
427 Ga0105249_10221892 3300009553 Bacteria 1860
428 Ga0105249_10422625 3300009553 Bacteria 1367
429 Ga0105249_10790993 3300009553 Unclassified 1012
430 Ga0105239_10832143 3300010375 Bacteria 1058
431 Ga0105246_10013077 3300011119 Bacteria 5194
432 Ga0105246_10421631 3300011119 Bacteria 1114
433 Ga0105246_10770371 3300011119 Bacteria 851
434 Ga0157374_10114897 3300013296 Bacteria 2592
435 Ga0157378_10280375 3300013297 Bacteria 1606
436 Ga0157378_10688270 3300013297 Bacteria 1041
437 Ga0163162_10005823 3300013306 Bacteria 11920
438 Ga0163162_10016621 3300013306 Bacteria 7190
439 Ga0163162_10504892 3300013306 Bacteria 1340
440 Ga0163162_10711758 3300013306 Unclassified 1125
441 Ga0157375_10011341 3300013308 Bacteria 7870
442 Ga0157375_10259123 3300013308 Bacteria 1901
443 Ga0157375_10507927 3300013308 Unclassified 1369
444 Ga0163163_10012051 3300014325 Bacteria 7865
445 Ga0163163_10066812 3300014325 Bacteria 3572
446 Ga0163163_10068085 3300014325 Bacteria 3542
447 Ga0163163_10093109 3300014325 Bacteria 3030
448 Ga0163163_10098027 3300014325 Bacteria 2952
449 Ga0157380_10006911 3300014326 Bacteria 8026
450 Ga0157380_10016060 3300014326 Bacteria 5514
451 Ga0157380_10016330 3300014326 Bacteria 5473
452 Ga0157380_10149981 3300014326 Bacteria 2014
453 Ga0157380_10284901 3300014326 Bacteria 1514
454 Ga0157380_10294346 3300014326 Bacteria 1492
455 Ga0157380_10317044 3300014326 Bacteria 1444
456 Ga0157380_10831991 3300014326 Bacteria 943
457 Ga0157380_11060384 3300014326 Bacteria 847
458 Ga0157380_11311597 3300014326 Unclassified 771
459 Ga0157377_10026758 3300014745 Bacteria 3090
460 Ga0157377_10040826 3300014745 Bacteria 2571
461 Ga0157377_10041199 3300014745 Bacteria 2561
462 Ga0157379_10044888 3300014968 Bacteria 3945
463 Ga0157379_10082094 3300014968 Bacteria 2888
464 Ga0157379_10389949 3300014968 Bacteria 1279
465 Ga0157376_10019563 3300014969 Bacteria 5222
466 Ga0157376_10192730 3300014969 Bacteria 1870
467 Ga0157376_11307139 3300014969 Bacteria 755
468 Ga0157376_11526491 3300014969 Bacteria 701
469 Ga0163161_10012564 3300017792 Bacteria 5882
470 Ga0163161_10380996 3300017792 Bacteria 1127
471 Ga0207697_10000929 3300025315 Bacteria 16526
472 Ga0207656_10005635 3300025321 Bacteria 4443
473 Ga0207682_10000410 3300025893 Bacteria 19658
474 Ga0207682_10006016 3300025893 Bacteria 4907
475 Ga0207682_10019124 3300025893 Bacteria 2681
476 Ga0207682_10134350 3300025893 Bacteria 1106
477 Ga0207642_10060221 3300025899 Bacteria 1760
478 Ga0207710_10110702 3300025900 Bacteria 1304
479 Ga0207710_10125252 3300025900 Bacteria 1230
480 Ga0207688_10001629 3300025901 Bacteria 11850
481 Ga0207688_10039430 3300025901 Bacteria 2623
482 Ga0207680_10005934 3300025903 Bacteria 5870
483 Ga0207680_10034058 3300025903 Bacteria 2911
484 Ga0207680_10174319 3300025903 Bacteria 1450
485 Ga0207645_10006358 3300025907 Bacteria 8489
486 Ga0207645_10012525 3300025907 Bacteria 5752
487 Ga0207645_10031255 3300025907 Bacteria 3427
488 Ga0207645_10145400 3300025907 Bacteria 1545
489 Ga0207645_10233279 3300025907 Bacteria 1215
490 Ga0207643_10000191 3300025908 Bacteria 42334
491 Ga0207643_10011118 3300025908 Bacteria 4858
492 Ga0207643_10016688 3300025908 Unclassified 4005
493 Ga0207643_10081969 3300025908 Bacteria 1870
494 Ga0207643_10109072 3300025908 Bacteria 1629
495 Ga0207643_10264752 3300025908 Bacteria 1062
496 Ga0207643_10339362 3300025908 Bacteria 941
497 Ga0207707_10017932 3300025912 Bacteria 6172
498 Ga0207695_10594961 3300025913 Bacteria 987
499 Ga0207662_10001858 3300025918 Bacteria 10379
500 Ga0207662_10008722 3300025918 Bacteria 5560
501 Ga0207662_10061700 3300025918 Bacteria 2251
502 Ga0207662_10210162 3300025918 Bacteria 1263
503 Ga0207662_10333821 3300025918 Bacteria 1015
504 Ga0207657_10056918 3300025919 Bacteria 3372
505 Ga0207649_10063531 3300025920 Bacteria 2331
506 Ga0207649_10198571 3300025920 Bacteria 1415
507 Ga0207649_10200969 3300025920 Bacteria 1408
508 Ga0207652_10195673 3300025921 Bacteria 1819
509 Ga0207652_10301872 3300025921 Bacteria 1445
510 Ga0207646_10013456 3300025922 Bacteria 7824
511 Ga0207646_10039976 3300025922 Bacteria 4221
512 Ga0207646_10056251 3300025922 Bacteria 3517
513 Ga0207646_10108997 3300025922 Bacteria 2485
514 Ga0207646_10166952 3300025922 Bacteria 1987
515 Ga0207646_10371024 3300025922 Unclassified 1293
516 Ga0207681_10003731 3300025923 Bacteria 9468
517 Ga0207681_10004579 3300025923 Bacteria 8500
518 Ga0207681_10026134 3300025923 Bacteria 3763
519 Ga0207681_10032446 3300025923 Bacteria 3419
520 Ga0207681_10053850 3300025923 Bacteria 2733
521 Ga0207681_10089169 3300025923 Bacteria 2198
522 Ga0207681_10284529 3300025923 Bacteria 1303
523 Ga0207681_10289520 3300025923 Bacteria 1292
524 Ga0207681_10301499 3300025923 Bacteria 1268
525 Ga0207681_10527040 3300025923 Bacteria 970
526 Ga0207681_10581863 3300025923 Bacteria 924
527 Ga0207694_10026389 3300025924 Bacteria 4418
528 Ga0207650_10032136 3300025925 Bacteria 3796
529 Ga0207650_10061361 3300025925 Bacteria 2807
530 Ga0207650_10066522 3300025925 Bacteria 2703
531 Ga0207650_10131700 3300025925 Bacteria 1957
532 Ga0207650_10148182 3300025925 Bacteria 1850
533 Ga0207650_10312302 3300025925 Bacteria 1286
534 Ga0207659_10025452 3300025926 Bacteria 3977
535 Ga0207659_10026190 3300025926 Bacteria 3932
536 Ga0207659_10029835 3300025926 Bacteria 3721
537 Ga0207659_10033708 3300025926 Bacteria 3527
538 Ga0207659_10131450 3300025926 Bacteria 1933
539 Ga0207659_10142294 3300025926 Bacteria 1863
540 Ga0207659_10195647 3300025926 Bacteria 1611
541 Ga0207659_10198001 3300025926 Bacteria 1602
542 Ga0207659_10221223 3300025926 Unclassified 1522
543 Ga0207659_10398105 3300025926 Bacteria 1151
544 Ga0207687_10053456 3300025927 Bacteria 2822
545 Ga0207687_10068424 3300025927 Bacteria 2530
546 Ga0207687_10432382 3300025927 Bacteria 1088
547 Ga0207700_10007409 3300025928 Bacteria 6702
548 Ga0207644_10080814 3300025931 Bacteria 2401
549 Ga0207644_10294682 3300025931 Bacteria 1306
550 Ga0207644_10423154 3300025931 Bacteria 1091
551 Ga0207644_10445665 3300025931 Unclassified 1063
552 Ga0207690_10345104 3300025932 Bacteria 1176
553 Ga0207690_10438990 3300025932 Bacteria 1047
554 Ga0207706_10006239 3300025933 Bacteria 11079
555 Ga0207706_10032950 3300025933 Bacteria 4610
556 Ga0207706_10062056 3300025933 Bacteria 3292
557 Ga0207706_10224648 3300025933 Bacteria 1644
558 Ga0207706_10281534 3300025933 Bacteria 1450
559 Ga0207706_10510127 3300025933 Bacteria 1037
560 Ga0207706_10567655 3300025933 Bacteria 976
561 Ga0207686_10028890 3300025934 Bacteria 3265
562 Ga0207686_10502244 3300025934 Bacteria 941
563 Ga0207709_10272006 3300025935 Bacteria 1247
564 Ga0207670_10023497 3300025936 Bacteria 3839
565 Ga0207670_10096590 3300025936 Bacteria 2102
566 Ga0207670_10110037 3300025936 Bacteria 1984
567 Ga0207670_10144946 3300025936 Bacteria 1755
568 Ga0207670_10173939 3300025936 Bacteria 1616
569 Ga0207669_10003086 3300025937 Bacteria 7172
570 Ga0207669_10013691 3300025937 Bacteria 4040
571 Ga0207669_10027586 3300025937 Bacteria 3112
572 Ga0207669_10030350 3300025937 Unclassified 3003
573 Ga0207669_10323608 3300025937 Bacteria 1181
574 Ga0207704_10039208 3300025938 Bacteria 2756
575 Ga0207704_10144030 3300025938 Bacteria 1671
576 Ga0207704_10155403 3300025938 Bacteria 1621
577 Ga0207665_10095637 3300025939 Bacteria 2065
578 Ga0207665_10475223 3300025939 Bacteria 962
579 Ga0207665_10612855 3300025939 Bacteria 851
580 Ga0207691_10000746 3300025940 Bacteria 32120
581 Ga0207691_10009248 3300025940 Bacteria 9455
582 Ga0207691_10014087 3300025940 Bacteria 7631
583 Ga0207691_10041594 3300025940 Bacteria 4242
584 Ga0207691_10053112 3300025940 Bacteria 3701
585 Ga0207691_10182302 3300025940 Bacteria 1834
586 Ga0207691_10197878 3300025940 Bacteria 1750
587 Ga0207691_10203692 3300025940 Bacteria 1721
588 Ga0207691_10287667 3300025940 Bacteria 1414
589 Ga0207691_10303085 3300025940 Bacteria 1372
590 Ga0207691_10628336 3300025940 Bacteria 908
591 Ga0207711_10010648 3300025941 Bacteria 7647
592 Ga0207711_10032117 3300025941 Bacteria 4438
593 Ga0207711_10044307 3300025941 Bacteria 3798
594 Ga0207711_10054927 3300025941 Bacteria 3419
595 Ga0207711_10062707 3300025941 Bacteria 3207
596 Ga0207711_10088454 3300025941 Bacteria 2719
597 Ga0207711_10124323 3300025941 Bacteria 2306
598 Ga0207711_10136365 3300025941 Bacteria 2205
599 Ga0207711_10870288 3300025941 Bacteria 838
600 Ga0207689_10031580 3300025942 Bacteria 4408
601 Ga0207689_10041009 3300025942 Bacteria 3830
602 Ga0207689_10064887 3300025942 Bacteria 3004
603 Ga0207689_10081187 3300025942 Bacteria 2666
604 Ga0207689_10085172 3300025942 Bacteria 2598
605 Ga0207689_10419123 3300025942 Bacteria 1117
606 Ga0207689_10420022 3300025942 Bacteria 1116
607 Ga0207661_10233701 3300025944 Bacteria 1629
608 Ga0207661_10588033 3300025944 Bacteria 1021
609 Ga0207679_10010061 3300025945 Bacteria 6077
610 Ga0207679_10011514 3300025945 Bacteria 5734
611 Ga0207679_10047765 3300025945 Bacteria 3112
612 Ga0207679_10048370 3300025945 Bacteria 3095
613 Ga0207679_10094828 3300025945 Bacteria 2318
614 Ga0207679_10102064 3300025945 Bacteria 2245
615 Ga0207679_10157204 3300025945 Bacteria 1858
616 Ga0207679_10245966 3300025945 Bacteria 1518
617 Ga0207667_10063749 3300025949 Bacteria 3850
618 Ga0207667_10357177 3300025949 Bacteria 1490
619 Ga0207651_10020627 3300025960 Bacteria 3983
620 Ga0207651_10057110 3300025960 Bacteria 2690
621 Ga0207651_10077506 3300025960 Bacteria 2380
622 Ga0207651_10090801 3300025960 Bacteria 2234
623 Ga0207651_10097168 3300025960 Bacteria 2174
624 Ga0207651_10152427 3300025960 Bacteria 1801
625 Ga0207651_10433700 3300025960 Bacteria 1124
626 Ga0207651_10480303 3300025960 Unclassified 1071
627 Ga0207651_10524509 3300025960 Bacteria 1027
628 Ga0207651_10728121 3300025960 Bacteria 875
629 Ga0207651_10745820 3300025960 Bacteria 865
630 Ga0207712_10044343 3300025961 Bacteria 3073
631 Ga0207712_10483203 3300025961 Bacteria 1056
632 Ga0207712_10547339 3300025961 Bacteria 995
633 Ga0207668_10124437 3300025972 Bacteria 1958
634 Ga0207668_10201925 3300025972 Bacteria 1584
635 Ga0207668_10276435 3300025972 Bacteria 1375
636 Ga0207668_10690753 3300025972 Unclassified 896
637 Ga0207668_10872684 3300025972 Bacteria 800
638 Ga0207640_10229041 3300025981 Bacteria 1428
639 Ga0207640_10517103 3300025981 Bacteria 997
640 Ga0207658_10029962 3300025986 Bacteria 3849
641 Ga0207658_10207236 3300025986 Bacteria 1641
642 Ga0207677_10008908 3300026023 Bacteria 5628
643 Ga0207677_10063139 3300026023 Bacteria 2573
644 Ga0207677_10597915 3300026023 Bacteria 968
645 Ga0207677_10740053 3300026023 Bacteria 875
646 Ga0207703_10007615 3300026035 Bacteria 8583
647 Ga0207703_10009592 3300026035 Bacteria 7602
648 Ga0207703_10143572 3300026035 Bacteria 2074
649 Ga0207703_11049229 3300026035 Bacteria 782
650 Ga0207678_10147464 3300026067 Bacteria 2008
651 Ga0207678_10364030 3300026067 Unclassified 1248
652 Ga0207678_10464528 3300026067 Bacteria 1101
653 Ga0207708_10014828 3300026075 Bacteria 5833
654 Ga0207708_10022872 3300026075 Bacteria 4721
655 Ga0207708_10022911 3300026075 Bacteria 4717
656 Ga0207708_10079206 3300026075 Bacteria 2524
657 Ga0207708_10112183 3300026075 Bacteria 2118
658 Ga0207708_10301189 3300026075 Bacteria 1304
659 Ga0207708_10323295 3300026075 Bacteria 1259
660 Ga0207641_10000519 3300026088 Bacteria 43225
661 Ga0207641_10029947 3300026088 Bacteria 4503
662 Ga0207641_10058726 3300026088 Bacteria 3275
663 Ga0207641_10140039 3300026088 Bacteria 2182
664 Ga0207641_10353052 3300026088 Bacteria 1402
665 Ga0207641_10611061 3300026088 Bacteria 1068
666 Ga0207648_10011700 3300026089 Bacteria 8256
667 Ga0207648_10035373 3300026089 Bacteria 4399
668 Ga0207648_10049088 3300026089 Bacteria 3695
669 Ga0207648_10090908 3300026089 Bacteria 2668
670 Ga0207648_10173011 3300026089 Bacteria 1909
671 Ga0207648_10381258 3300026089 Unclassified 1275
672 Ga0207648_10452366 3300026089 Bacteria 1169
673 Ga0207676_10015477 3300026095 Bacteria 5503
674 Ga0207676_10028700 3300026095 Bacteria 4159
675 Ga0207676_10168817 3300026095 Bacteria 1904
676 Ga0207676_10195287 3300026095 Bacteria 1784
677 Ga0207676_10260720 3300026095 Bacteria 1565
678 Ga0207676_10425014 3300026095 Bacteria 1247
679 Ga0207676_10975023 3300026095 Bacteria 834
680 Ga0207676_11143319 3300026095 Bacteria 770
681 Ga0207676_11156615 3300026095 Bacteria 766
682 Ga0207674_10227543 3300026116 Bacteria 1813
683 Ga0207674_10374898 3300026116 Bacteria 1375
684 Ga0207674_10386745 3300026116 Bacteria 1352
685 Ga0207674_10574285 3300026116 Bacteria 1089
686 Ga0207674_10940452 3300026116 Bacteria 833
687 Ga0207675_100001393 3300026118 Bacteria 24240
688 Ga0207675_100017627 3300026118 Bacteria 6661
689 Ga0207675_100023512 3300026118 Bacteria 5733
690 Ga0207675_100070686 3300026118 Bacteria 3262
691 Ga0207675_100111501 3300026118 Bacteria 2581
692 Ga0207675_100246695 3300026118 Bacteria 1727
693 Ga0207683_10005091 3300026121 Bacteria 11281
694 Ga0207683_10006921 3300026121 Bacteria 9709
695 Ga0207683_10054784 3300026121 Bacteria 3497
696 Ga0207683_10092093 3300026121 Bacteria 2701
697 Ga0207683_10136916 3300026121 Bacteria 2204
698 Ga0207683_10258681 3300026121 Bacteria 1589
699 Ga0207683_10259730 3300026121 Bacteria 1586
700 Ga0207698_10067528 3300026142 Bacteria 2820
701 Ga0207698_10129600 3300026142 Bacteria 2153
702 Ga0207698_10216694 3300026142 Bacteria 1727
703 Ga0207698_10823562 3300026142 Bacteria 932
704 Ga0207428_10000008 3300027907 Bacteria 423201
705 Ga0207428_10009348 3300027907 Bacteria 8793
706 Ga0207428_10028600 3300027907 Bacteria 4630
707 Ga0207428_10053528 3300027907 Bacteria 3218
708 Ga0207428_10110579 3300027907 Bacteria 2115
709 Ga0207428_10175313 3300027907 Bacteria 1622
710 Ga0268266_10008835 3300028379 Bacteria 8920
711 Ga0268266_10049692 3300028379 Bacteria 3597
712 Ga0268265_10007559 3300028380 Bacteria 7335
713 Ga0268265_10034068 3300028380 Bacteria 3709
714 Ga0268265_10161625 3300028380 Bacteria 1903
715 Ga0268265_10352950 3300028380 Bacteria 1343
716 Ga0268265_10509262 3300028380 Bacteria 1136
717 Ga0268265_10522910 3300028380 Bacteria 1122
718 Ga0268265_10589855 3300028380 Bacteria 1060
719 Ga0268264_10177121 3300028381 Bacteria 1933
720 Ga0268264_10334340 3300028381 Bacteria 1437
721 Ga0307408_100013567 3300031548 Bacteria 5410
722 Ga0307408_100037926 3300031548 Bacteria 3397
723 Ga0307408_100273140 3300031548 Bacteria 1404
724 Ga0307405_10000207 3300031731 Bacteria 21153
725 Ga0307405_10268090 3300031731 Bacteria 1279
726 Ga0307413_10022987 3300031824 Unclassified 3372
727 Ga0307413_10037080 3300031824 Bacteria 2813
728 Ga0307410_10000834 3300031852 Bacteria 13106
729 Ga0307410_10217097 3300031852 Bacteria 1469
730 Ga0307406_10014746 3300031901 Bacteria 4503
731 Ga0307406_10590751 3300031901 Bacteria 914
732 Ga0307406_10629692 3300031901 Bacteria 888
733 Ga0307407_10005151 3300031903 Bacteria 5639
734 Ga0307407_10059405 3300031903 Bacteria 2227
735 Ga0307412_10151800 3300031911 Bacteria 1710
736 Ga0307409_100028969 3300031995 Bacteria 3955
737 Ga0307409_100187364 3300031995 Bacteria 1838
738 Ga0307409_100257806 3300031995 Bacteria 1598
739 Ga0307409_100579091 3300031995 Bacteria 1106
740 Ga0307409_100938489 3300031995 Bacteria 881
741 Ga0307416_100000407 3300032002 Bacteria 22111
742 Ga0307416_100059956 3300032002 Bacteria 3096
743 Ga0307416_100078958 3300032002 Bacteria 2772
744 Ga0307416_100394062 3300032002 Bacteria 1420
745 Ga0307416_100577675 3300032002 Bacteria 1201
746 Ga0307411_10045704 3300032005 Bacteria 2818
747 Ga0307411_10279927 3300032005 Bacteria 1327
748 Ga0307415_100001492 3300032126 Bacteria 11217
749 Ga0373948_0000877 3300034817 Bacteria 4004
750 Ga0373958_0009263 3300034819 Bacteria 1617
751 Ga0373938_0045922 3300034957 Bacteria 984
752 Ga0373938_0111105 3300034957 Unclassified 698
753 Ga0373926_0035786 3300035083 Bacteria 1762
754 Ga0373929_0002891 3300035085 Bacteria 3135
755 Ga0373934_0017392 3300035086 Bacteria 2745
756 Ga0373940_0000159 3300035088 Bacteria 8926
757 Ga0373940_0129490 3300035088 Bacteria 789
758 Ga0373949_0017975 3300035090 Bacteria 1598
759 Ga0373951_0010256 3300035091 Bacteria 2103
760 Ga0373952_0043926 3300035092 Bacteria 1043
761 Ga0373923_0095718 3300035111 Bacteria 1304
762 Ga0373923_0181243 3300035111 Unclassified 968
763 Ga0373932_0038386 3300035112 Bacteria 1369
764 Ga0373932_0109544 3300035112 Bacteria 908
765 Ga0373936_0097750 3300035113 Bacteria 1236
766 Ga0373941_0024575 3300035115 Bacteria 1732
767 Ga0373945_0041147 3300035116 Bacteria 1670
768 Ga0373953_0056895 3300035117 Bacteria 1591
769 Ga0373956_0085864 3300035119 Bacteria 1448
770 Ga0373960_0013119 3300035121 Bacteria 2073
771 Ga0373943_0004142 3300035170 Bacteria 6582
772 Ga0373946_0010477 3300035171 Bacteria 3432
773 Ga0373946_0250123 3300035171 Bacteria 864
774 Ga0373946_0323540 3300035171 Bacteria 767
775 Ga0373955_0045221 3300035172 Bacteria 2375
776 Ga0373955_0276283 3300035172 Bacteria 1010
777 Ga0373961_0001267 3300035241 Bacteria 7690
778 Ga0373962_0000274 3300035242 Bacteria 11112
779 Ga0373962_0040582 3300035242 Bacteria 1309
780 Ga0373924_0003677 3300035410 Bacteria 5290
781 Ga0373931_0012073 3300035691 Bacteria 4181
782 Ga0373931_0124086 3300035691 Bacteria 1479
783 Ga0373931_0315105 3300035691 Bacteria 970
784 Ga0373935_0064403 3300035692 Bacteria 2351
785 Ga0373935_0517358 3300035692 Bacteria 868
786 Ga0373927_0346172 3300035695 Bacteria 979
787 Ga0373933_0238183 3300035724 Bacteria 1170
788 Ga0373933_0609322 3300035724 Unclassified 717
789 Ga0373947_0037362 3300035725 Bacteria 2882
790 Ga0373947_0054844 3300035725 Bacteria 2406
791 Ga0373947_0231973 3300035725 Bacteria 1216
792 Ga0373937_0000833 3300036401 Bacteria 26482
793 Ga0373937_0145185 3300036401 Bacteria 2221
794 Ga0373937_0480055 3300036401 Bacteria 1181
795 Ga0373937_0812430 3300036401 Bacteria 883
796 Ga0373925_0006208 3300037068 Bacteria 8827
797 Ga0373925_0253356 3300037068 Bacteria 1412
798 Ga0373925_0341900 3300037068 Bacteria 1214
799 Ga0373925_0678112 3300037068 Bacteria 850
800 Ga0451853_0926118 3300041512 Bacteria 1032
801 Ga0439443_022110 3300042003 Bacteria 1008
802 Ga0439445_0034483 3300042004 Bacteria 1326
803 Ga0439450_019497 3300042008 Bacteria 1438
804 Ga0450923_016382 3300042125 Bacteria 1396
805 Ga0439434_0067534 3300042435 Bacteria 1123
806 Ga0439435_0034376 3300042436 Bacteria 1393
807 Ga0439444_0014590 3300042437 Bacteria 1316
808 Ga0439464_0091089 3300042439 Bacteria 919
809 Ga0439464_0103794 3300042439 Bacteria 866
810 Ga0439440_0006013 3300042993 Bacteria 2429
811 Ga0451576_0009616 3300045051 Bacteria 11184
812 Ga0451576_0015343 3300045051 Bacteria 8489
813 Ga0451576_0071845 3300045051 Bacteria 3601
814 Ga0451576_0348513 3300045051 Bacteria 1550
815 Ga0495592_0021182 3300046454 Bacteria 4944
816 Ga0495592_0450612 3300046454 Bacteria 806
817 Ga0495603_0021893 3300046455 Bacteria 3870
818 Ga0495603_0213500 3300046455 Bacteria 1114
819 Ga0495629_0060341 3300046459 Bacteria 2651
820 Ga0495580_0080606 3300046472 Bacteria 2269
821 Ga0495639_0172976 3300046475 Bacteria 1049
822 Ga0495639_0345731 3300046475 Bacteria 746
823 Ga0495584_0282258 3300046491 Bacteria 844
824 Ga0495585_0339331 3300046492 Bacteria 732
825 Ga0495594_0038941 3300046499 Bacteria 2597
826 Ga0495594_0065528 3300046499 Bacteria 2015
827 Ga0495608_0059346 3300046511 Bacteria 2521
828 Ga0495608_0144368 3300046511 Bacteria 1518
829 Ga0495618_0030229 3300046514 Bacteria 3383
830 Ga0495628_0200625 3300046516 Bacteria 1503
831 Ga0495628_0344841 3300046516 Unclassified 1096
832 Ga0495630_0003069 3300046517 Bacteria 11577
833 Ga0495643_0002854 3300046522 Bacteria 13137
834 Ga0495663_0058903 3300046525 Bacteria 1204
835 Ga0495640_0066222 3300046533 Bacteria 2437
836 Ga0495640_0158979 3300046533 Bacteria 1449
837 Ga0495598_0011162 3300046537 Bacteria 2170
838 Ga0495598_0030723 3300046537 Bacteria 1507
839 Ga0495598_0129173 3300046537 Bacteria 865
840 Ga0495609_0104190 3300046538 Bacteria 1228
841 Ga0495621_0016004 3300046539 Bacteria 2400
842 Ga0495621_0019388 3300046539 Bacteria 2221
843 Ga0495621_0107277 3300046539 Bacteria 1068
844 Ga0495621_0113166 3300046539 Bacteria 1042
845 Ga0495621_0125221 3300046539 Bacteria 996
846 Ga0495645_0011590 3300046543 Bacteria 6208
847 Ga0495633_0167468 3300046558 Bacteria 1013
848 Ga0495667_0008198 3300046559 Bacteria 7092
849 Ga0495656_0120357 3300046615 Unclassified 1238
850 Ga0495656_0381953 3300046615 Bacteria 734
851 Ga0495634_0268905 3300046642 Bacteria 1038
852 Ga0495635_0054903 3300046663 Bacteria 2744
853 Ga0495635_0247887 3300046663 Bacteria 1201
854 Ga0495635_0414099 3300046663 Bacteria 894
855 Ga0495659_0227788 3300046664 Bacteria 771
856 Ga0495588_0005504 3300046674 Bacteria 5640
857 Ga0495657_0208352 3300046675 Bacteria 1189
858 Ga0495658_0038876 3300046683 Bacteria 2637
859 Ga0495658_0065687 3300046683 Bacteria 2094
860 Ga0495658_0090674 3300046683 Bacteria 1810
861 Ga0495658_0266990 3300046683 Bacteria 1078
862 Ga0495669_0225493 3300046684 Bacteria 899
863 Ga0495613_0018081 3300046689 Bacteria 5252
864 Ga0495613_0081807 3300046689 Bacteria 2346
865 Ga0495670_0214810 3300046691 Bacteria 1021
866 Ga0495670_0329584 3300046691 Bacteria 820
867 Ga0495600_0159429 3300046809 Bacteria 1459
868 Ga0495600_0280125 3300046809 Bacteria 1056
869 Ga0495581_0022788 3300047315 Bacteria 3627
870 Ga0495581_0084882 3300047315 Bacteria 1835
871 Ga0495581_0239610 3300047315 Bacteria 1061
872 Ga0495636_0030320 3300047318 Bacteria 2211
873 Ga0495636_0041160 3300047318 Bacteria 1917
874 Ga0495674_0054333 3300047319 Bacteria 3518
875 Ga0495674_0135919 3300047319 Bacteria 2069
876 Ga0495674_0159019 3300047319 Bacteria 1891
877 Ga0495674_0161689 3300047319 Unclassified 1873
878 Ga0495680_0191121 3300047322 Bacteria 1473
879 Ga0495680_0496653 3300047322 Bacteria 829
880 Ga0495684_0000190 3300047471 Bacteria 47246
881 Ga0495602_0751017 3300048088 Unclassified 658
882 Ga0496100_0130268 3300048903 Bacteria 1771
883 Ga0496104_0112791 3300048907 Bacteria 2607
884 Ga0496105_0021115 3300048908 Bacteria 5267
885 Ga0496105_0614885 3300048908 Unclassified 842
886 Ga0496107_0506196 3300048910 Bacteria 896
887 Ga0496108_0013344 3300048911 Bacteria 6699
888 Ga0496108_0043205 3300048911 Bacteria 3765
889 Ga0496109_0214724 3300048912 Bacteria 1809
890 Ga0496109_0460456 3300048912 Bacteria 1201
891 Ga0496109_0508232 3300048912 Bacteria 1137
892 Ga0496109_0904814 3300048912 Bacteria 820
893 Ga0496110_0201354 3300048913 Bacteria 1809
894 Ga0496112_0034032 3300048915 Bacteria 4957
895 Ga0496112_0194889 3300048915 Bacteria 1987
896 Ga0496112_0618170 3300048915 Bacteria 1015
897 Ga0496113_0083219 3300048916 Bacteria 2455
898 Ga0496113_0339215 3300048916 Bacteria 1205
899 Ga0496113_0404687 3300048916 Bacteria 1096
900 Ga0496114_0017528 3300048917 Bacteria 5782
901 Ga0496114_0036888 3300048917 Bacteria 4041
902 Ga0496115_0083041 3300048918 Bacteria 2611
903 Ga0501034_0029537 3300049571 Bacteria 5573
904 Ga0501034_0231845 3300049571 Bacteria 1795
905 Ga0501036_0109774 3300049572 Bacteria 2331
906 Ga0501038_0119671 3300049574 Bacteria 2173
907 Ga0501039_0011890 3300049575 Bacteria 6634
908 Ga0501039_0185408 3300049575 Bacteria 1636
909 Ga0501039_0299696 3300049575 Bacteria 1264
910 Ga0501040_0102810 3300049576 Bacteria 1994
911 Ga0501040_0109071 3300049576 Bacteria 1935
912 Ga0501042_0100241 3300049578 Bacteria 2082
913 Ga0501042_0301592 3300049578 Bacteria 1157
914 Ga0501043_0185924 3300049579 Bacteria 1618
915 Ga0501046_0035269 3300049580 Bacteria 4032
916 Ga0501047_0019886 3300049581 Bacteria 6445
917 Ga0501048_0106722 3300049582 Bacteria 1977
918 Ga0501072_0032114 3300049588 Bacteria 4111
919 Ga0501072_0039905 3300049588 Bacteria 3686
920 Ga0501072_0075562 3300049588 Unclassified 2665
921 Ga0501072_0244701 3300049588 Bacteria 1429
922 Ga0501073_0060886 3300049589 Bacteria 2635
923 Ga0501073_0258527 3300049589 Bacteria 1202
924 Ga0501074_0175600 3300049590 Bacteria 1529
925 Ga0501075_0026327 3300049591 Bacteria 4281
926 Ga0501075_0104355 3300049591 Unclassified 2154
927 Ga0501075_0119078 3300049591 Bacteria 2008
928 Ga0501075_0168688 3300049591 Archaea 1670
929 Ga0501076_0101399 3300049592 Bacteria 2320
930 Ga0501076_0119211 3300049592 Bacteria 2137
931 Ga0501076_0237540 3300049592 Bacteria 1490
932 Ga0501076_0347840 3300049592 Bacteria 1217
933 Ga0501077_0384040 3300049593 Unclassified 897
934 Ga0501079_0058568 3300049741 Bacteria 2972
935 Ga0501079_0159943 3300049741 Bacteria 1756
936 Ga0501079_0681033 3300049741 Bacteria 809
937 Ga0501079_0781057 3300049741 Bacteria 752
938 Ga0501080_0149724 3300049742 Bacteria 2158
939 Ga0501080_0247789 3300049742 Bacteria 1625
940 Ga0501080_0261439 3300049742 Bacteria 1577
941 Ga0501081_0018734 3300049743 Bacteria 4598
942 Ga0501081_0168900 3300049743 Bacteria 1579
943 Ga0501081_0197669 3300049743 Bacteria 1458
944 Ga0501273_027897 3300049770 Bacteria 793
945 Ga0501044_0032275 3300049823 Bacteria 5506
946 Ga0501045_0046792 3300049824 Bacteria 3150
947 Ga0501045_0069573 3300049824 Bacteria 2588
948 Ga0501045_0453565 3300049824 Bacteria 953
949 nmdc:mga0yw44_134039_c1 3300050492 Bacteria 1605
950 nmdc:mga07m45_9646_c1 3300050496 Bacteria 5017
951 nmdc:mga05p37_111753_c1 3300050507 Bacteria 3360
952 nmdc:mga05p37_152746_c1 3300050507 Bacteria 2823
953 nmdc:mga05p37_18505_c1 3300050507 Bacteria 8416
954 nmdc:mga05p37_188777_c1 3300050507 Bacteria 2504
955 nmdc:mga05p37_2363_c1 3300050507 Bacteria 21951
956 nmdc:mga05p37_25526_c1 3300050507 Bacteria 5214
957 nmdc:mga05p37_26251_c1 3300050507 Bacteria 7084
958 nmdc:mga05p37_267434_c1 3300050507 Bacteria 2044
959 nmdc:mga05p37_271969_c1 3300050507 Bacteria 2024
960 nmdc:mga05p37_485470_c1 3300050507 Unclassified 1422
961 nmdc:mga05p37_572981_c1 3300050507 Bacteria 1280
962 nmdc:mga05p37_593986_c1 3300050507 Bacteria 1251
963 nmdc:mga05p37_5951_c1 3300050507 Bacteria 14351
964 nmdc:mga05p37_598137_c1 3300050507 Bacteria 1246
965 nmdc:mga05p37_617876_c1 3300050507 Bacteria 1220
966 nmdc:mga05p37_714077_c1 3300050507 Bacteria 1111
967 nmdc:mga05p37_72015_c1 3300050507 Bacteria 4252
968 nmdc:mga05p37_790284_c1 3300050507 Bacteria 1040
969 nmdc:mga05p37_798132_c1 3300050507 Bacteria 1033
970 nmdc:mga09592_103320_c1 3300050508 Bacteria 2441
971 nmdc:mga09592_127476_c1 3300050508 Bacteria 2188
972 nmdc:mga09592_221090_c1 3300050508 Bacteria 1641
973 nmdc:mga09592_298254_c1 3300050508 Bacteria 1397
974 nmdc:mga09592_343662_c1 3300050508 Unclassified 1292
975 nmdc:mga09592_3678_c1 3300050508 Bacteria 12363
976 nmdc:mga09592_446639_c1 3300050508 Bacteria 1116
977 nmdc:mga09592_45867_c1 3300050508 Unclassified 3681
978 nmdc:mga09592_55013_c1 3300050508 Bacteria 3363
979 nmdc:mga09592_952674_c1 3300050508 Bacteria 719
980 nmdc:mga0qj67_23856_c1 3300050509 Bacteria 4711
981 nmdc:mga0qj67_3135_c1 3300050509 Bacteria 11899
982 nmdc:mga0qj67_3254_c1 3300050509 Bacteria 11697
983 nmdc:mga06r32_122600_c1 3300050510 Unclassified 2565
984 nmdc:mga06r32_17578_c1 3300050510 Bacteria 6531
985 nmdc:mga06r32_2563_c1 3300050510 Bacteria 16245
986 nmdc:mga06r32_278848_c1 3300050510 Bacteria 1659
987 nmdc:mga06r32_666134_c1 3300050510 Unclassified 1008
988 nmdc:mga08y16_122580_c1 3300050511 Unclassified 2705
989 nmdc:mga08y16_136295_c1 3300050511 Bacteria 2551
990 nmdc:mga08y16_13_c2 3300050511 Bacteria 418063
991 nmdc:mga08y16_22951_c1 3300050511 Bacteria 6587
992 nmdc:mga08y16_313638_c1 3300050511 Bacteria 1615
993 nmdc:mga08y16_31502_c1 3300050511 Bacteria 5577
994 nmdc:mga08y16_4302_c1 3300050511 Bacteria 14872
995 nmdc:mga08y16_46692_c1 3300050511 Bacteria 4534
996 nmdc:mga08y16_51938_c1 3300050511 Bacteria 4289
997 nmdc:mga08y16_625_c1 3300050511 Bacteria 33084
998 nmdc:mga08y16_758703_c1 3300050511 Unclassified 966
999 nmdc:mga08y16_79865_c1 3300050511 Bacteria 3410
1000 nmdc:mga08y16_87831_c1 3300050511 Bacteria 3240
1001 nmdc:mga0n895_207265_c1 3300050512 Bacteria 1991
1002 nmdc:mga0n895_257605_c1 3300050512 Bacteria 1771
1003 nmdc:mga0n895_262_c1 3300050512 Bacteria 34169
1004 nmdc:mga0n895_2869_c1 3300050512 Bacteria 13668
1005 nmdc:mga0n895_30020_c1 3300050512 Bacteria 5191
1006 nmdc:mga0n895_340938_c1 3300050512 Bacteria 1518
1007 nmdc:mga0n895_44405_c1 3300050512 Bacteria 4333
1008 nmdc:mga0n895_45581_c1 3300050512 Bacteria 4279
1009 nmdc:mga0n895_51398_c1 3300050512 Bacteria 4043
1010 nmdc:mga0n895_51955_c1 3300050512 Bacteria 4022
1011 nmdc:mga0n895_8166_c1 3300050512 Bacteria 9047
1012 nmdc:mga0n895_98086_c1 3300050512 Bacteria 2937
1013 nmdc:mga0rr50_266064_c1 3300050513 Bacteria 1428
1014 nmdc:mga0rr50_281952_c1 3300050513 Bacteria 1387
1015 nmdc:mga0rr50_2908_c1 3300050513 Bacteria 9772
1016 nmdc:mga0rr50_30_c1 3300050513 Bacteria 105385
1017 nmdc:mga0rr50_366152_c1 3300050513 Bacteria 1214
1018 nmdc:mga0rr50_37063_c1 3300050513 Bacteria 3517
1019 nmdc:mga0rr50_90144_c1 3300050513 Bacteria 2385
1020 nmdc:mga0rr50_97987_c1 3300050513 Bacteria 2297
1021 nmdc:mga08x19_17693_c1 3300050514 Bacteria 4365
1022 nmdc:mga08x19_307083_c1 3300050514 Bacteria 1102
1023 nmdc:mga08x19_308135_c1 3300050514 Bacteria 1100
1024 nmdc:mga08x19_47861_c1 3300050514 Bacteria 2738
1025 nmdc:mga08x19_73_c1 3300050514 Bacteria 96390
1026 nmdc:mga08x19_8290_c1 3300050514 Bacteria 6182
1027 nmdc:mga0a205_108604_c1 3300050515 Bacteria 2673
1028 nmdc:mga0a205_123033_c1 3300050515 Bacteria 2494
1029 nmdc:mga0a205_152622_c1 3300050515 Bacteria 2209
1030 nmdc:mga0a205_153405_c1 3300050515 Bacteria 2202
1031 nmdc:mga0a205_167697_c1 3300050515 Bacteria 2091
1032 nmdc:mga0a205_2597_c1 3300050515 Bacteria 15949
1033 nmdc:mga0a205_297_c1 3300050515 Bacteria 36766
1034 nmdc:mga0a205_3568_c1 3300050515 Bacteria 13928
1035 nmdc:mga0a205_50498_c1 3300050515 Bacteria 4016
1036 nmdc:mga0a205_628065_c1 3300050515 Unclassified 926
1037 nmdc:mga0a205_71761_c1 3300050515 Bacteria 3344
1038 nmdc:mga0a205_738232_c1 3300050515 Bacteria 833
1039 nmdc:mga0a205_752064_c1 3300050515 Bacteria 823
1040 nmdc:mga0a205_851647_c1 3300050515 Unclassified 759
1041 Ga0495601_0011587 3300053077 Bacteria 5284
1042 Ga0495601_0275203 3300053077 Bacteria 1098
1043 Ga0495601_0331707 3300053077 Bacteria 990
1044 Ga0495595_0035078 3300053084 Bacteria 2272
1045 Ga0495619_0034920 3300053085 Bacteria 3269
1046 Ga0495619_0080593 3300053085 Unclassified 2191
1047 Ga0495619_0122807 3300053085 Bacteria 1781
1048 Ga0495619_0136964 3300053085 Bacteria 1684
1049 Ga0495619_0205706 3300053085 Bacteria 1363
1050 Ga0501084_0054792 3300054114 Bacteria 3336
1051 Ga0501084_0310601 3300054114 Bacteria 1331
1052 Ga0501082_0252073 3300060353 Bacteria 1536
1053 Ga0466962_0265851 3300061719 Bacteria 845
1054 Ga0530510_0004563 3300061734 Bacteria 9581
1055 2884964075 2884960567 Bacteria 5437054
1056 Ga0075433_10099351
1057 JGI24746J21847_1001582
1058 JGI25406J46586_10080056
1059 Ga0065704_10156926
1060 Ga0065712_10025247
1061 Ga0065712_10068050
1062 Ga0065712_10183322
1063 Ga0065715_10041372
1064 Ga0065715_10102033
1065 Ga0065715_10113886
1066 Ga0065715_10114181
1067 Ga0065715_10165599
1068 Ga0065715_10372887
1069 Ga0065707_10103607
1070 Ga0065707_10104626
1071 Ga0065707_10118121
1072 Ga0065707_10142886
1073 Ga0065707_10151627
1074 Ga0065707_10251173
1075 Ga0070676_10004253
1076 Ga0070676_10071409
1077 Ga0070676_10156645
1078 Ga0070683_100064319
1079 Ga0070683_100269704
1080 Ga0070683_100453853
1081 Ga0070690_100000890
1082 Ga0070690_100007258
1083 Ga0070690_100017463
1084 Ga0070690_100110946
1085 Ga0070690_100652948
1086 Ga0070670_100011687
1087 Ga0070670_100026604
1088 Ga0070670_100046557
1089 Ga0070670_100084202
1090 Ga0070670_100097921
1091 Ga0070670_100206789
1092 Ga0070670_100299467
1093 Ga0070677_10000840
1094 Ga0070677_10020087
1095 Ga0070677_10310531
1096 Ga0068869_100001684
1097 Ga0068869_100002101
1098 Ga0068869_100009776
1099 Ga0068869_100106732
1100 Ga0068869_100195397
1101 Ga0068869_100199771
1102 Ga0068869_100267824
1103 Ga0068869_100453581
1104 Ga0070666_10014439
1105 Ga0070666_10047325
1106 Ga0070666_10108885
1107 Ga0070666_10135406
1108 Ga0070680_100064688
1109 Ga0070680_100633226
1110 Ga0068868_100016449
1111 Ga0068868_100099870
1112 Ga0068868_100165240
1113 Ga0068868_101061311
1114 Ga0070689_100026199
1115 Ga0070689_100084019
1116 Ga0070689_100204256
1117 Ga0070689_100542831
1118 Ga0070691_10125105
1119 Ga0070687_100007174
1120 Ga0070687_100110392
1121 Ga0070687_100173051
1122 Ga0070661_100045423
1123 Ga0070661_100235992
1124 Ga0070661_100293203
1125 Ga0070692_10227296
1126 Ga0070692_10286763
1127 Ga0070668_100081894
1128 Ga0070668_100087211
1129 Ga0070668_100156572
1130 Ga0070668_100176481
1131 Ga0070668_100346128
1132 Ga0070668_100349437
1133 Ga0070668_100653317
1134 Ga0070669_100004520
1135 Ga0070669_100034611
1136 Ga0070669_100057757
1137 Ga0070669_100064201
1138 Ga0070669_100124154
1139 Ga0070669_100169561
1140 Ga0070669_100194241
1141 Ga0070669_100234187
1142 Ga0070675_100002520
1143 Ga0070675_100027586
1144 Ga0070675_100039130
1145 Ga0070675_100072937
1146 Ga0070675_100080054
1147 Ga0070675_100169817
1148 Ga0070675_100193427
1149 Ga0070675_100445478
1150 Ga0070675_100479921
1151 Ga0070671_100110784
1152 Ga0070671_100143078
1153 Ga0070674_100000364
1154 Ga0070674_100006705
1155 Ga0070674_100025080
1156 Ga0070674_100031042
1157 Ga0070674_100285217
1158 Ga0070674_100985424
1159 Ga0070673_100035572
1160 Ga0070673_100043344
1161 Ga0070673_100099912
1162 Ga0070673_100131019
1163 Ga0070673_100289630
1164 Ga0070673_100756472
1165 Ga0070688_100010095
1166 Ga0070688_100031210
1167 Ga0070688_100049617
1168 Ga0070688_100095322
1169 Ga0070688_100199880
1170 Ga0070659_100515046
1171 Ga0070667_100099399
1172 Ga0070667_100212428
1173 Ga0070667_100502266
1174 Ga0070667_100856312
1175 Ga0070709_10353097
1176 Ga0070713_100020746
1177 Ga0070701_10033947
1178 Ga0070701_10065153
1179 Ga0070701_10065962
1180 Ga0070701_10085189
1181 Ga0070705_100000970
1182 Ga0070705_100224632
1183 Ga0070705_100275021
1184 Ga0070700_100036087
1185 Ga0070700_100152314
1186 Ga0070700_100242060
1187 Ga0070694_100004019
1188 Ga0070694_100007253
1189 Ga0070694_100525962
1190 Ga0070708_100022789
1191 Ga0070663_100001957
1192 Ga0070663_100185606
1193 Ga0070678_100005756
1194 Ga0070678_100034622
1195 Ga0070678_100137338
1196 Ga0070678_100213249
1197 Ga0070678_100307199
1198 Ga0070678_100522283
1199 Ga0070678_100578062
1200 Ga0070662_100085346
1201 Ga0070662_100136625
1202 Ga0070662_100204552
1203 Ga0070662_100550224
1204 Ga0070662_100588957
1205 Ga0070681_10015196
1206 Ga0068867_100047480
1207 Ga0070685_10006210
1208 Ga0070685_10054655
1209 Ga0070685_10064921
1210 Ga0070706_100208940
1211 Ga0070707_100077124
1212 Ga0070707_100093690
1213 Ga0070707_100131768
1214 Ga0070707_100194981
1215 Ga0070707_100712083
1216 Ga0070698_100004770
1217 Ga0070698_100010684
1218 Ga0070698_100023550
1219 Ga0070698_100171047
1220 Ga0070698_100278040
1221 Ga0070698_100305180
1222 Ga0070698_100592336
1223 Ga0070699_100008093
1224 Ga0070699_100017059
1225 Ga0070699_100050501
1226 Ga0070699_100064418
1227 Ga0070699_100175296
1228 Ga0070699_100355586
1229 Ga0070684_100018696
1230 Ga0070684_100078603
1231 Ga0070684_100165486
1232 Ga0070684_100180349
1233 Ga0070697_100068891
1234 Ga0070697_100180984
1235 Ga0070697_100273226
1236 Ga0070697_100315323
1237 Ga0070697_100377858
1238 Ga0070672_100011178
1239 Ga0070672_100094786
1240 Ga0070672_100166887
1241 Ga0070672_100219383
1242 Ga0070672_100518060
1243 Ga0070672_100671451
1244 Ga0070686_100000401
1245 Ga0070686_100011335
1246 Ga0070686_100032999
1247 Ga0070686_100055527
1248 Ga0070686_100063764
1249 Ga0070695_100003001
1250 Ga0070695_100003046
1251 Ga0070696_100001252
1252 Ga0070696_100010085
1253 Ga0070696_100125631
1254 Ga0070696_100133670
1255 Ga0070696_100138511
1256 Ga0070696_100235919
1257 Ga0070696_100391910
1258 Ga0070696_100632229
1259 Ga0070693_100012527
1260 Ga0070693_100059855
1261 Ga0070693_100240981
1262 Ga0070693_100659273
1263 Ga0070665_100001655
1264 Ga0070665_100017910
1265 Ga0070665_100019558
1266 Ga0070704_100028496
1267 Ga0070704_100044482
1268 Ga0070704_100064965
1269 Ga0070704_100073251
1270 Ga0070704_100110491
1271 Ga0070704_100413148
1272 Ga0070704_100944452
1273 Ga0070664_100015363
1274 Ga0070664_100052023
1275 Ga0070664_100089919
1276 Ga0070664_100117099
1277 Ga0070664_100123849
1278 Ga0070664_100207509
1279 Ga0070664_100488179
1280 Ga0070664_100549628
1281 Ga0068857_100068663
1282 Ga0068857_100105707
1283 Ga0068857_100145437
1284 Ga0068857_100399889
1285 Ga0068854_100003857
1286 Ga0068854_100077981
1287 Ga0070702_100283747
1288 Ga0070702_100441489
1289 Ga0068852_100550909
1290 Ga0068859_100017066
1291 Ga0068859_100030592
1292 Ga0068859_100281721
1293 Ga0068859_100310223
1294 Ga0068859_100313091
1295 Ga0068859_100332814
1296 Ga0068859_100419902
1297 Ga0068859_100430432
1298 Ga0068864_100004010
1299 Ga0068864_100015528
1300 Ga0068864_100018262
1301 Ga0068864_100028669
1302 Ga0068864_100029274
1303 Ga0068864_100246467
1304 Ga0068864_100275277
1305 Ga0068864_100328513
1306 Ga0068864_100548557
1307 Ga0068866_10134832
1308 Ga0068861_100016271
1309 Ga0068861_100069818
1310 Ga0068861_100129894
1311 Ga0068861_100159932
1312 Ga0068861_100309948
1313 Ga0068861_100323476
1314 Ga0068851_10032879
1315 Ga0068870_10009401
1316 Ga0068870_10027648
1317 Ga0068870_10175123
1318 Ga0068870_10249480
1319 Ga0068870_10440140
1320 Ga0068863_100089458
1321 Ga0068863_100435876
1322 Ga0068863_100772628
1323 Ga0068858_100011666
1324 Ga0068858_100198659
1325 Ga0068858_100390793
1326 Ga0068860_100005333
1327 Ga0068860_100316762
1328 Ga0068860_100427426
1329 Ga0068860_100483965
1330 Ga0068860_100824485
1331 Ga0068860_101041446
1332 Ga0068862_100002180
1333 Ga0068862_100031111
1334 Ga0068862_100090727
1335 Ga0068862_100114770
1336 Ga0068862_100152778
1337 Ga0068862_100175917
1338 Ga0068862_100497524
1339 Ga0068862_100994978
1340 Ga0081455_10041723
1341 Ga0081539_10020045
1342 Ga0075368_10059677
1343 Ga0075368_10094016
1344 Ga0075364_10032948
1345 Ga0075432_10015652
1346 Ga0070716_100513635
1347 Ga0075366_10012387
1348 Ga0075366_10066500
1349 Ga0097621_100000100
1350 Ga0097621_100235386
1351 Ga0097621_100464004
1352 Ga0075370_10006109
1353 Ga0068871_100000375
1354 Ga0068871_100052045
1355 Ga0068871_100190877
1356 Ga0068871_100214317
1357 Ga0075428_100012127
1358 Ga0075428_100013895
1359 Ga0075428_100028084
1360 Ga0075428_100052623
1361 Ga0075428_100075118
1362 Ga0075428_100171178
1363 Ga0075428_100212070
1364 Ga0075430_100001690
1365 Ga0075430_100017504
1366 Ga0075430_100178984
1367 Ga0075430_100223131
1368 Ga0075430_100278532
1369 Ga0075431_100004245
1370 Ga0075431_100082450
1371 Ga0075431_100520151
1372 Ga0075431_100540466
1373 Ga0075431_100715978
1374 Ga0075433_10002197
1375 Ga0075433_10033356
1376 Ga0075433_10077189
1377 Ga0075433_10125634
1378 Ga0075433_10161767
1379 Ga0075434_100000328
1380 Ga0075434_100001939
1381 Ga0075434_100002034
1382 Ga0075434_100020264
1383 Ga0075434_100020600
1384 Ga0075434_100035972
1385 Ga0075434_100058487
1386 Ga0075434_100062726
1387 Ga0075434_100327889
1388 Ga0075429_100004546
1389 Ga0075429_100023814
1390 Ga0075429_100043176
1391 Ga0075429_100076208
1392 Ga0075429_100139410
1393 Ga0075429_100181098
1394 Ga0075429_100346465
1395 Ga0068865_100072714
1396 Ga0068865_100093531
1397 Ga0068865_100176527
1398 Ga0068865_100720880
1399 Ga0068865_100742986
1400 Ga0075436_100001898
1401 Ga0075436_100021191
1402 Ga0075436_100515132
1403 Ga0097620_100017067
1404 Ga0097620_100030592
1405 Ga0097620_100281703
1406 Ga0097620_100310234
1407 Ga0097620_100313086
1408 Ga0097620_100332824
1409 Ga0097620_100419918
1410 Ga0097620_100430384
1411 Ga0075435_100000032
1412 Ga0075435_100000184
1413 Ga0075435_100005713
1414 Ga0075435_100034619
1415 Ga0075435_100034880
1416 Ga0075435_100076492
1417 Ga0075435_100119441
1418 Ga0075435_100168249
1419 Ga0105240_10789519
1420 Ga0111539_10000007
1421 Ga0111539_10000202
1422 Ga0111539_10002776
1423 Ga0111539_10008951
1424 Ga0111539_10035500
1425 Ga0111539_10040646
1426 Ga0111539_10080505
1427 Ga0111539_10087094
1428 Ga0111539_10101759
1429 Ga0111539_10177459
1430 Ga0111539_10378387
1431 Ga0111539_10625597
1432 Ga0111539_10745080
1433 Ga0111539_11266352
1434 Ga0105245_10011163
1435 Ga0105245_11112852
1436 Ga0105245_11477017
1437 Ga0105247_10052630
1438 Ga0105247_10237913
1439 Ga0105247_10310576
1440 Ga0114129_10000235
1441 Ga0114129_10000598
1442 Ga0114129_10001781
1443 Ga0114129_10005968
1444 Ga0114129_10034145
1445 Ga0114129_10044838
1446 Ga0114129_10070069
1447 Ga0114129_10110868
1448 Ga0114129_10117224
1449 Ga0114129_10146961
1450 Ga0114129_10200015
1451 Ga0114129_10257584
1452 Ga0114129_10320906
1453 Ga0114129_10880853
1454 Ga0114129_10992075
1455 Ga0114129_11105911
1456 Ga0105243_10267570
1457 Ga0105243_10739509
1458 Ga0105241_10030344
1459 Ga0105241_10610404
1460 Ga0105242_10050388
1461 Ga0105242_10094821
1462 Ga0105242_10154432
1463 Ga0105242_10179465
1464 Ga0105248_10012947
1465 Ga0105248_10015654
1466 Ga0105248_10043535
1467 Ga0105248_10046089
1468 Ga0105248_10063264
1469 Ga0105248_10068205
1470 Ga0105248_10068379
1471 Ga0105248_10152260
1472 Ga0105248_10177413
1473 Ga0105248_10185941
1474 Ga0105248_10574954
1475 Ga0105248_10658223
1476 Ga0105237_10845912
1477 Ga0105238_10007149
1478 Ga0105238_10253610
1479 Ga0105249_10008963
1480 Ga0105249_10153949
1481 Ga0105249_10212407
1482 Ga0105249_10221892
1483 Ga0105249_10422625
1484 Ga0105249_10790993
1485 Ga0105239_10832143
1486 Ga0105246_10013077
1487 Ga0105246_10421631
1488 Ga0105246_10770371
1489 Ga0157374_10114897
1490 Ga0157378_10280375
1491 Ga0157378_10688270
1492 Ga0163162_10005823
1493 Ga0163162_10016621
1494 Ga0163162_10504892
1495 Ga0163162_10711758
1496 Ga0157375_10011341
1497 Ga0157375_10259123
1498 Ga0157375_10507927
1499 Ga0163163_10012051
1500 Ga0163163_10066812
1501 Ga0163163_10068085
1502 Ga0163163_10093109
1503 Ga0163163_10098027
1504 Ga0157380_10006911
1505 Ga0157380_10016060
1506 Ga0157380_10016330
1507 Ga0157380_10149981
1508 Ga0157380_10284901
1509 Ga0157380_10294346
1510 Ga0157380_10317044
1511 Ga0157380_10831991
1512 Ga0157380_11060384
1513 Ga0157380_11311597
1514 Ga0157377_10026758
1515 Ga0157377_10040826
1516 Ga0157377_10041199
1517 Ga0157379_10044888
1518 Ga0157379_10082094
1519 Ga0157379_10389949
1520 Ga0157376_10019563
1521 Ga0157376_10192730
1522 Ga0157376_11307139
1523 Ga0157376_11526491
1524 Ga0163161_10012564
1525 Ga0163161_10380996
1526 Ga0207697_10000929
1527 Ga0207656_10005635
1528 Ga0207682_10000410
1529 Ga0207682_10006016
1530 Ga0207682_10019124
1531 Ga0207682_10134350
1532 Ga0207642_10060221
1533 Ga0207710_10110702
1534 Ga0207710_10125252
1535 Ga0207688_10001629
1536 Ga0207688_10039430
1537 Ga0207680_10005934
1538 Ga0207680_10034058
1539 Ga0207680_10174319
1540 Ga0207645_10006358
1541 Ga0207645_10012525
1542 Ga0207645_10031255
1543 Ga0207645_10145400
1544 Ga0207645_10233279
1545 Ga0207643_10000191
1546 Ga0207643_10011118
1547 Ga0207643_10016688
1548 Ga0207643_10081969
1549 Ga0207643_10109072
1550 Ga0207643_10264752
1551 Ga0207643_10339362
1552 Ga0207707_10017932
1553 Ga0207695_10594961
1554 Ga0207662_10001858
1555 Ga0207662_10008722
1556 Ga0207662_10061700
1557 Ga0207662_10210162
1558 Ga0207662_10333821
1559 Ga0207657_10056918
1560 Ga0207649_10063531
1561 Ga0207649_10198571
1562 Ga0207649_10200969
1563 Ga0207652_10195673
1564 Ga0207652_10301872
1565 Ga0207646_10013456
1566 Ga0207646_10039976
1567 Ga0207646_10056251
1568 Ga0207646_10108997
1569 Ga0207646_10166952
1570 Ga0207646_10371024
1571 Ga0207681_10003731
1572 Ga0207681_10004579
1573 Ga0207681_10026134
1574 Ga0207681_10032446
1575 Ga0207681_10053850
1576 Ga0207681_10089169
1577 Ga0207681_10284529
1578 Ga0207681_10289520
1579 Ga0207681_10301499
1580 Ga0207681_10527040
1581 Ga0207681_10581863
1582 Ga0207694_10026389
1583 Ga0207650_10032136
1584 Ga0207650_10061361
1585 Ga0207650_10066522
1586 Ga0207650_10131700
1587 Ga0207650_10148182
1588 Ga0207650_10312302
1589 Ga0207659_10025452
1590 Ga0207659_10026190
1591 Ga0207659_10029835
1592 Ga0207659_10033708
1593 Ga0207659_10131450
1594 Ga0207659_10142294
1595 Ga0207659_10195647
1596 Ga0207659_10198001
1597 Ga0207659_10221223
1598 Ga0207659_10398105
1599 Ga0207687_10053456
1600 Ga0207687_10068424
1601 Ga0207687_10432382
1602 Ga0207700_10007409
1603 Ga0207644_10080814
1604 Ga0207644_10294682
1605 Ga0207644_10423154
1606 Ga0207644_10445665
1607 Ga0207690_10345104
1608 Ga0207690_10438990
1609 Ga0207706_10006239
1610 Ga0207706_10032950
1611 Ga0207706_10062056
1612 Ga0207706_10224648
1613 Ga0207706_10281534
1614 Ga0207706_10510127
1615 Ga0207706_10567655
1616 Ga0207686_10028890
1617 Ga0207686_10502244
1618 Ga0207709_10272006
1619 Ga0207670_10023497
1620 Ga0207670_10096590
1621 Ga0207670_10110037
1622 Ga0207670_10144946
1623 Ga0207670_10173939
1624 Ga0207669_10003086
1625 Ga0207669_10013691
1626 Ga0207669_10027586
1627 Ga0207669_10030350
1628 Ga0207669_10323608
1629 Ga0207704_10039208
1630 Ga0207704_10144030
1631 Ga0207704_10155403
1632 Ga0207665_10095637
1633 Ga0207665_10475223
1634 Ga0207665_10612855
1635 Ga0207691_10000746
1636 Ga0207691_10009248
1637 Ga0207691_10014087
1638 Ga0207691_10041594
1639 Ga0207691_10053112
1640 Ga0207691_10182302
1641 Ga0207691_10197878
1642 Ga0207691_10203692
1643 Ga0207691_10287667
1644 Ga0207691_10303085
1645 Ga0207691_10628336
1646 Ga0207711_10010648
1647 Ga0207711_10032117
1648 Ga0207711_10044307
1649 Ga0207711_10054927
1650 Ga0207711_10062707
1651 Ga0207711_10088454
1652 Ga0207711_10124323
1653 Ga0207711_10136365
1654 Ga0207711_10870288
1655 Ga0207689_10031580
1656 Ga0207689_10041009
1657 Ga0207689_10064887
1658 Ga0207689_10081187
1659 Ga0207689_10085172
1660 Ga0207689_10419123
1661 Ga0207689_10420022
1662 Ga0207661_10233701
1663 Ga0207661_10588033
1664 Ga0207679_10010061
1665 Ga0207679_10011514
1666 Ga0207679_10047765
1667 Ga0207679_10048370
1668 Ga0207679_10094828
1669 Ga0207679_10102064
1670 Ga0207679_10157204
1671 Ga0207679_10245966
1672 Ga0207667_10063749
1673 Ga0207667_10357177
1674 Ga0207651_10020627
1675 Ga0207651_10057110
1676 Ga0207651_10077506
1677 Ga0207651_10090801
1678 Ga0207651_10097168
1679 Ga0207651_10152427
1680 Ga0207651_10433700
1681 Ga0207651_10480303
1682 Ga0207651_10524509
1683 Ga0207651_10728121
1684 Ga0207651_10745820
1685 Ga0207712_10044343
1686 Ga0207712_10483203
1687 Ga0207712_10547339
1688 Ga0207668_10124437
1689 Ga0207668_10201925
1690 Ga0207668_10276435
1691 Ga0207668_10690753
1692 Ga0207668_10872684
1693 Ga0207640_10229041
1694 Ga0207640_10517103
1695 Ga0207658_10029962
1696 Ga0207658_10207236
1697 Ga0207677_10008908
1698 Ga0207677_10063139
1699 Ga0207677_10597915
1700 Ga0207677_10740053
1701 Ga0207703_10007615
1702 Ga0207703_10009592
1703 Ga0207703_10143572
1704 Ga0207703_11049229
1705 Ga0207678_10147464
1706 Ga0207678_10364030
1707 Ga0207678_10464528
1708 Ga0207708_10014828
1709 Ga0207708_10022872
1710 Ga0207708_10022911
1711 Ga0207708_10079206
1712 Ga0207708_10112183
1713 Ga0207708_10301189
1714 Ga0207708_10323295
1715 Ga0207641_10000519
1716 Ga0207641_10029947
1717 Ga0207641_10058726
1718 Ga0207641_10140039
1719 Ga0207641_10353052
1720 Ga0207641_10611061
1721 Ga0207648_10011700
1722 Ga0207648_10035373
1723 Ga0207648_10049088
1724 Ga0207648_10090908
1725 Ga0207648_10173011
1726 Ga0207648_10381258
1727 Ga0207648_10452366
1728 Ga0207676_10015477
1729 Ga0207676_10028700
1730 Ga0207676_10168817
1731 Ga0207676_10195287
1732 Ga0207676_10260720
1733 Ga0207676_10425014
1734 Ga0207676_10975023
1735 Ga0207676_11143319
1736 Ga0207676_11156615
1737 Ga0207674_10227543
1738 Ga0207674_10374898
1739 Ga0207674_10386745
1740 Ga0207674_10574285
1741 Ga0207674_10940452
1742 Ga0207675_100001393
1743 Ga0207675_100017627
1744 Ga0207675_100023512
1745 Ga0207675_100070686
1746 Ga0207675_100111501
1747 Ga0207675_100246695
1748 Ga0207683_10005091
1749 Ga0207683_10006921
1750 Ga0207683_10054784
1751 Ga0207683_10092093
1752 Ga0207683_10136916
1753 Ga0207683_10258681
1754 Ga0207683_10259730
1755 Ga0207698_10067528
1756 Ga0207698_10129600
1757 Ga0207698_10216694
1758 Ga0207698_10823562
1759 Ga0207428_10000008
1760 Ga0207428_10009348
1761 Ga0207428_10028600
1762 Ga0207428_10053528
1763 Ga0207428_10110579
1764 Ga0207428_10175313
1765 Ga0268266_10008835
1766 Ga0268266_10049692
1767 Ga0268265_10007559
1768 Ga0268265_10034068
1769 Ga0268265_10161625
1770 Ga0268265_10352950
1771 Ga0268265_10509262
1772 Ga0268265_10522910
1773 Ga0268265_10589855
1774 Ga0268264_10177121
1775 Ga0268264_10334340
1776 Ga0307408_100013567
1777 Ga0307408_100037926
1778 Ga0307408_100273140
1779 Ga0307405_10000207
1780 Ga0307405_10268090
1781 Ga0307413_10022987
1782 Ga0307413_10037080
1783 Ga0307410_10000834
1784 Ga0307410_10217097
1785 Ga0307406_10014746
1786 Ga0307406_10590751
1787 Ga0307406_10629692
1788 Ga0307407_10005151
1789 Ga0307407_10059405
1790 Ga0307412_10151800
1791 Ga0307409_100028969
1792 Ga0307409_100187364
1793 Ga0307409_100257806
1794 Ga0307409_100579091
1795 Ga0307409_100938489
1796 Ga0307416_100000407
1797 Ga0307416_100059956
1798 Ga0307416_100078958
1799 Ga0307416_100394062
1800 Ga0307416_100577675
1801 Ga0307411_10045704
1802 Ga0307411_10279927
1803 Ga0307415_100001492
1804 Ga0373948_0000877
1805 Ga0373958_0009263
1806 Ga0373938_0045922
1807 Ga0373938_0111105
1808 Ga0373926_0035786
1809 Ga0373929_0002891
1810 Ga0373934_0017392
1811 Ga0373940_0000159
1812 Ga0373940_0129490
1813 Ga0373949_0017975
1814 Ga0373951_0010256
1815 Ga0373952_0043926
1816 Ga0373923_0095718
1817 Ga0373923_0181243
1818 Ga0373932_0038386
1819 Ga0373932_0109544
1820 Ga0373936_0097750
1821 Ga0373941_0024575
1822 Ga0373945_0041147
1823 Ga0373953_0056895
1824 Ga0373956_0085864
1825 Ga0373960_0013119
1826 Ga0373943_0004142
1827 Ga0373946_0010477
1828 Ga0373946_0250123
1829 Ga0373946_0323540
1830 Ga0373955_0045221
1831 Ga0373955_0276283
1832 Ga0373961_0001267
1833 Ga0373962_0000274
1834 Ga0373962_0040582
1835 Ga0373924_0003677
1836 Ga0373931_0012073
1837 Ga0373931_0124086
1838 Ga0373931_0315105
1839 Ga0373935_0064403
1840 Ga0373935_0517358
1841 Ga0373927_0346172
1842 Ga0373933_0238183
1843 Ga0373933_0609322
1844 Ga0373947_0037362
1845 Ga0373947_0054844
1846 Ga0373947_0231973
1847 Ga0373937_0000833
1848 Ga0373937_0145185
1849 Ga0373937_0480055
1850 Ga0373937_0812430
1851 Ga0373925_0006208
1852 Ga0373925_0253356
1853 Ga0373925_0341900
1854 Ga0373925_0678112
1855 Ga0451853_0926118
1856 Ga0439443_022110
1857 Ga0439445_0034483
1858 Ga0439450_019497
1859 Ga0450923_016382
1860 Ga0439434_0067534
1861 Ga0439435_0034376
1862 Ga0439444_0014590
1863 Ga0439464_0091089
1864 Ga0439464_0103794
1865 Ga0439440_0006013
1866 Ga0451576_0009616
1867 Ga0451576_0015343
1868 Ga0451576_0071845
1869 Ga0451576_0348513
1870 Ga0495592_0021182
1871 Ga0495592_0450612
1872 Ga0495603_0021893
1873 Ga0495603_0213500
1874 Ga0495629_0060341
1875 Ga0495580_0080606
1876 Ga0495639_0172976
1877 Ga0495639_0345731
1878 Ga0495584_0282258
1879 Ga0495585_0339331
1880 Ga0495594_0038941
1881 Ga0495594_0065528
1882 Ga0495608_0059346
1883 Ga0495608_0144368
1884 Ga0495618_0030229
1885 Ga0495628_0200625
1886 Ga0495628_0344841
1887 Ga0495630_0003069
1888 Ga0495643_0002854
1889 Ga0495663_0058903
1890 Ga0495640_0066222
1891 Ga0495640_0158979
1892 Ga0495598_0011162
1893 Ga0495598_0030723
1894 Ga0495598_0129173
1895 Ga0495609_0104190
1896 Ga0495621_0016004
1897 Ga0495621_0019388
1898 Ga0495621_0107277
1899 Ga0495621_0113166
1900 Ga0495621_0125221
1901 Ga0495645_0011590
1902 Ga0495633_0167468
1903 Ga0495667_0008198
1904 Ga0495656_0120357
1905 Ga0495656_0381953
1906 Ga0495634_0268905
1907 Ga0495635_0054903
1908 Ga0495635_0247887
1909 Ga0495635_0414099
1910 Ga0495659_0227788
1911 Ga0495588_0005504
1912 Ga0495657_0208352
1913 Ga0495658_0038876
1914 Ga0495658_0065687
1915 Ga0495658_0090674
1916 Ga0495658_0266990
1917 Ga0495669_0225493
1918 Ga0495613_0018081
1919 Ga0495613_0081807
1920 Ga0495670_0214810
1921 Ga0495670_0329584
1922 Ga0495600_0159429
1923 Ga0495600_0280125
1924 Ga0495581_0022788
1925 Ga0495581_0084882
1926 Ga0495581_0239610
1927 Ga0495636_0030320
1928 Ga0495636_0041160
1929 Ga0495674_0054333
1930 Ga0495674_0135919
1931 Ga0495674_0159019
1932 Ga0495674_0161689
1933 Ga0495680_0191121
1934 Ga0495680_0496653
1935 Ga0495684_0000190
1936 Ga0495602_0751017
1937 Ga0496100_0130268
1938 Ga0496104_0112791
1939 Ga0496105_0021115
1940 Ga0496105_0614885
1941 Ga0496107_0506196
1942 Ga0496108_0013344
1943 Ga0496108_0043205
1944 Ga0496109_0214724
1945 Ga0496109_0460456
1946 Ga0496109_0508232
1947 Ga0496109_0904814
1948 Ga0496110_0201354
1949 Ga0496112_0034032
1950 Ga0496112_0194889
1951 Ga0496112_0618170
1952 Ga0496113_0083219
1953 Ga0496113_0339215
1954 Ga0496113_0404687
1955 Ga0496114_0017528
1956 Ga0496114_0036888
1957 Ga0496115_0083041
1958 Ga0501034_0029537
1959 Ga0501034_0231845
1960 Ga0501036_0109774
1961 Ga0501038_0119671
1962 Ga0501039_0011890
1963 Ga0501039_0185408
1964 Ga0501039_0299696
1965 Ga0501040_0102810
1966 Ga0501040_0109071
1967 Ga0501042_0100241
1968 Ga0501042_0301592
1969 Ga0501043_0185924
1970 Ga0501046_0035269
1971 Ga0501047_0019886
1972 Ga0501048_0106722
1973 Ga0501072_0032114
1974 Ga0501072_0039905
1975 Ga0501072_0075562
1976 Ga0501072_0244701
1977 Ga0501073_0060886
1978 Ga0501073_0258527
1979 Ga0501074_0175600
1980 Ga0501075_0026327
1981 Ga0501075_0104355
1982 Ga0501075_0119078
1983 Ga0501075_0168688
1984 Ga0501076_0101399
1985 Ga0501076_0119211
1986 Ga0501076_0237540
1987 Ga0501076_0347840
1988 Ga0501077_0384040
1989 Ga0501079_0058568
1990 Ga0501079_0159943
1991 Ga0501079_0681033
1992 Ga0501079_0781057
1993 Ga0501080_0149724
1994 Ga0501080_0247789
1995 Ga0501080_0261439
1996 Ga0501081_0018734
1997 Ga0501081_0168900
1998 Ga0501081_0197669
1999 Ga0501273_027897
2000 Ga0501044_0032275
2001 Ga0501045_0046792
2002 Ga0501045_0069573
2003 Ga0501045_0453565
2004 nmdc:mga0yw44_134039_c1
2005 nmdc:mga07m45_9646_c1
2006 nmdc:mga05p37_111753_c1
2007 nmdc:mga05p37_152746_c1
2008 nmdc:mga05p37_18505_c1
2009 nmdc:mga05p37_188777_c1
2010 nmdc:mga05p37_2363_c1
2011 nmdc:mga05p37_25526_c1
2012 nmdc:mga05p37_26251_c1
2013 nmdc:mga05p37_267434_c1
2014 nmdc:mga05p37_271969_c1
2015 nmdc:mga05p37_485470_c1
2016 nmdc:mga05p37_572981_c1
2017 nmdc:mga05p37_593986_c1
2018 nmdc:mga05p37_5951_c1
2019 nmdc:mga05p37_598137_c1
2020 nmdc:mga05p37_617876_c1
2021 nmdc:mga05p37_714077_c1
2022 nmdc:mga05p37_72015_c1
2023 nmdc:mga05p37_790284_c1
2024 nmdc:mga05p37_798132_c1
2025 nmdc:mga09592_103320_c1
2026 nmdc:mga09592_127476_c1
2027 nmdc:mga09592_221090_c1
2028 nmdc:mga09592_298254_c1
2029 nmdc:mga09592_343662_c1
2030 nmdc:mga09592_3678_c1
2031 nmdc:mga09592_446639_c1
2032 nmdc:mga09592_45867_c1
2033 nmdc:mga09592_55013_c1
2034 nmdc:mga09592_952674_c1
2035 nmdc:mga0qj67_23856_c1
2036 nmdc:mga0qj67_3135_c1
2037 nmdc:mga0qj67_3254_c1
2038 nmdc:mga06r32_122600_c1
2039 nmdc:mga06r32_17578_c1
2040 nmdc:mga06r32_2563_c1
2041 nmdc:mga06r32_278848_c1
2042 nmdc:mga06r32_666134_c1
2043 nmdc:mga08y16_122580_c1
2044 nmdc:mga08y16_136295_c1
2045 nmdc:mga08y16_13_c2
2046 nmdc:mga08y16_22951_c1
2047 nmdc:mga08y16_313638_c1
2048 nmdc:mga08y16_31502_c1
2049 nmdc:mga08y16_4302_c1
2050 nmdc:mga08y16_46692_c1
2051 nmdc:mga08y16_51938_c1
2052 nmdc:mga08y16_625_c1
2053 nmdc:mga08y16_758703_c1
2054 nmdc:mga08y16_79865_c1
2055 nmdc:mga08y16_87831_c1
2056 nmdc:mga0n895_207265_c1
2057 nmdc:mga0n895_257605_c1
2058 nmdc:mga0n895_262_c1
2059 nmdc:mga0n895_2869_c1
2060 nmdc:mga0n895_30020_c1
2061 nmdc:mga0n895_340938_c1
2062 nmdc:mga0n895_44405_c1
2063 nmdc:mga0n895_45581_c1
2064 nmdc:mga0n895_51398_c1
2065 nmdc:mga0n895_51955_c1
2066 nmdc:mga0n895_8166_c1
2067 nmdc:mga0n895_98086_c1
2068 nmdc:mga0rr50_266064_c1
2069 nmdc:mga0rr50_281952_c1
2070 nmdc:mga0rr50_2908_c1
2071 nmdc:mga0rr50_30_c1
2072 nmdc:mga0rr50_366152_c1
2073 nmdc:mga0rr50_37063_c1
2074 nmdc:mga0rr50_90144_c1
2075 nmdc:mga0rr50_97987_c1
2076 nmdc:mga08x19_17693_c1
2077 nmdc:mga08x19_307083_c1
2078 nmdc:mga08x19_308135_c1
2079 nmdc:mga08x19_47861_c1
2080 nmdc:mga08x19_73_c1
2081 nmdc:mga08x19_8290_c1
2082 nmdc:mga0a205_108604_c1
2083 nmdc:mga0a205_123033_c1
2084 nmdc:mga0a205_152622_c1
2085 nmdc:mga0a205_153405_c1
2086 nmdc:mga0a205_167697_c1
2087 nmdc:mga0a205_2597_c1
2088 nmdc:mga0a205_297_c1
2089 nmdc:mga0a205_3568_c1
2090 nmdc:mga0a205_50498_c1
2091 nmdc:mga0a205_628065_c1
2092 nmdc:mga0a205_71761_c1
2093 nmdc:mga0a205_738232_c1
2094 nmdc:mga0a205_752064_c1
2095 nmdc:mga0a205_851647_c1
2096 Ga0495601_0011587
2097 Ga0495601_0275203
2098 Ga0495601_0331707
2099 Ga0495595_0035078
2100 Ga0495619_0034920
2101 Ga0495619_0080593
2102 Ga0495619_0122807
2103 Ga0495619_0136964
2104 Ga0495619_0205706
2105 Ga0501084_0054792
2106 Ga0501084_0310601
2107 Ga0501082_0252073
2108 Ga0466962_0265851
2109 Ga0530510_0004563
2110 2884964075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

38

150

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

174

230

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

174

218

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9791 152 208
1qmp-assembly2.cif.gz_B phosphorylated aspartate in the crystal structure of the sporulation response regulator, spo0a 0.9661 13 131
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9596 11 129
5wq0-assembly4.cif.gz_D receiver domain of spo0a from paenisporosarcina sp. tg-14 0.9582 11 130
5iul-assembly1.cif.gz_C crystal structure of the desk-desr complex in the phosphotransfer state with high mg2+ (150 mm) and bef3 0.9566 11 138
ID Description Score Start End Superfamily
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9791 152 208 1.10.10.10
1qmpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9661 13 131 3.40.50.2300
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9596 11 129 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9571 13 94 3.40.50.2300
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9556 12 130 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2S8L796-F1-model_v4 deleted 0.974 12 146
AF-T0ZTC4-F1-model_v4 Two component transcriptional regulator, LuxR family 0.9679 6 143 GO:0000160
GO:0003677
AF-A0A4Q3SH94-F1-model_v4 Response regulator transcription factor 0.9654 10 146 GO:0000160
GO:0003677
AF-A0A399TBJ3-F1-model_v4 deleted 0.9645 11 150
AF-A0A7C7C3A8-F1-model_v4 Response regulator transcription factor 0.9616 10 151 GO:0000160
GO:0003677

Map