F489144

General Info

Members Datasets Scaffolds Average Seq Length
1055 779 2110 177

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10012635|JGI25153J46596_100126356
Length 195
Sequence MASAATGILPNLDREDPDHKKAAGVKTPAPETFEGQILALLPSLRRYSRSLTRSDTDGEDLLQDCVEKVLTRRGQWRGVNLRGWVLTIMTNLYRNGRRGKARDGLVELDAAEDLAASEPPADPLERARLDDALNSLSEEHRAVLMLVVIEGYTYGEVAAALDIPIGTVMSRLSRARRRVAERLKADNIITLRRPK

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
49 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
59 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
60 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
61 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
62 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
63 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
64 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
94 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
110 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
113 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
114 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
115 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
116 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
117 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
118 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
121 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
122 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
123 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
124 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
125 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
126 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
127 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
132 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
133 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
134 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
135 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
136 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
242 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
243 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
244 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
245 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
246 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
247 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
248 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
249 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
254 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
255 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
258 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
259 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
260 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
261 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
262 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
274 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
275 2509276019 Ensifer aridi TW10 Isolate Nodule
276 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
277 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
278 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
279 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
280 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
281 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
282 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
283 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
284 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
285 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
286 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
287 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
288 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
289 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
290 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
291 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
292 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
293 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
294 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
295 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
296 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
297 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
298 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
299 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
300 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
301 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
302 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
303 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
304 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
305 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
306 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
307 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
308 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
309 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
310 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
311 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
312 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
313 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
314 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
315 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
316 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
317 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
318 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
319 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
320 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
321 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
322 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
323 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
324 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
325 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
326 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
327 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
328 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
329 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
330 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
331 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
332 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
333 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
334 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
335 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
336 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
337 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
338 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
339 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
340 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
341 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
342 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
343 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
344 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
345 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
346 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
347 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
348 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
349 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
350 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
351 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
352 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
353 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
354 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
355 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
356 2643221557 Ensifer sp. Root558 Isolate Unclassified
357 2643221582 Rhizobium sp. Root651 Isolate Unclassified
358 2643221599 Rhizobium sp. Root708 Isolate Unclassified
359 2643221607 Rhizobium sp. Root73 Isolate Unclassified
360 2643221610 Ensifer sp. Root74 Isolate Unclassified
361 2643221618 Ensifer sp. Root231 Isolate Unclassified
362 2643221626 Ensifer sp. Root31 Isolate Unclassified
363 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
364 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
365 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
366 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
367 2643221655 Ensifer sp. Root1252 Isolate Unclassified
368 2643221659 Ensifer sp. Root127 Isolate Unclassified
369 2643221668 Ensifer sp. Root423 Isolate Unclassified
370 2643221675 Ensifer sp. Root1298 Isolate Unclassified
371 2643221680 Ensifer sp. Root1312 Isolate Unclassified
372 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
373 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
374 2643221693 Rhizobium sp. Root491 Isolate Unclassified
375 2643221698 Ensifer sp. Root142 Isolate Unclassified
376 2643221712 Ensifer sp. Root258 Isolate Unclassified
377 2643221718 Rhizobium sp. Root268 Isolate Unclassified
378 2643221723 Ensifer sp. Root278 Isolate Unclassified
379 2643221726 Ensifer sp. Root954 Isolate Unclassified
380 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
381 2718217882 Rhizobium sp. N741 Isolate Nodule
382 2718217927 Rhizobium sp. N324 Isolate Nodule
383 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
384 2718218009 Rhizobium sp. N561 Isolate Nodule
385 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
386 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
387 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
388 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
389 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
390 2718218363 Rhizobium sp. N113 Isolate Nodule
391 2718218365 Rhizobium sp. N731 Isolate Nodule
392 2718218366 Rhizobium sp. N621 Isolate Nodule
393 2718218423 Rhizobium sp. N941 Isolate Nodule
394 2721755514 Rhizobium sp. N6212 Isolate Nodule
395 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
396 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
397 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
398 2721755809 Rhizobium sp. N541 Isolate Nodule
399 2721755810 Rhizobium sp. N871 Isolate Nodule
400 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
401 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
402 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
403 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
404 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
405 2728369365 Rhizobium sp. N1341 Isolate Nodule
406 2728369397 Rhizobium sp. N1314 Isolate Nodule
407 2738541293 Rhizobium sp. GV031 Isolate Unclassified
408 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
409 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
410 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
411 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
412 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
413 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
414 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
415 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
416 2791355256 Rhizobium sp. M10 Isolate Nodule
417 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
418 2791355260 Rhizobium sp. L9 Isolate Nodule
419 2791355261 Rhizobium sp. J15 Isolate Nodule
420 2791355262 Rhizobium sp. M1 Isolate Nodule
421 2791355263 Rhizobium chutanense C5 Isolate Nodule
422 2791355264 Rhizobium sp. S9 Isolate Nodule
423 2791355265 Rhizobium sp. H4 Isolate Nodule
424 2791355266 Rhizobium sp. L43 Isolate Nodule
425 2791355267 Rhizobium sp. L18 Isolate Nodule
426 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
427 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
428 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
429 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
430 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
431 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
432 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
433 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
434 2802429633 Rhizobium anhuiense J3 Isolate Nodule
435 2802429634 Rhizobium anhuiense S10 Isolate Nodule
436 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
437 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
438 2802429637 Rhizobium anhuiense C15 Isolate Nodule
439 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
440 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
441 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
442 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
443 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
444 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
445 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
446 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
447 2838048938 Rhizobium pisi 27/80 Isolate Nodule
448 2838061910 Rhizobium phaseoli L15 Isolate Nodule
449 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
450 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
451 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
452 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
453 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
454 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
455 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
456 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
457 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
458 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
459 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
460 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
461 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
462 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
463 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
464 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
465 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
466 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
467 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
468 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
469 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
470 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
471 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
472 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
473 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
474 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
475 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
476 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
477 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
478 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
479 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
480 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
481 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
482 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
483 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
484 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
485 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
486 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
487 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
488 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
489 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
490 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
491 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
492 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
493 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
494 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
495 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
496 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
497 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
498 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
499 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
500 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
501 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
502 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
503 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
504 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
505 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
506 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
507 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
508 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
509 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
510 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
511 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
512 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
513 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
514 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
515 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
516 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
517 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
518 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
519 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
520 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
521 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
522 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
523 2844163670 Ensifer sp. 1H6 Isolate Unclassified
524 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
525 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
526 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
527 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
528 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
529 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
530 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
531 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
532 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
533 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
534 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
535 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
536 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
537 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
538 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
539 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
540 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
541 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
542 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
543 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
544 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
545 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
546 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
547 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
548 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
549 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
550 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
551 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
552 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
553 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
554 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
555 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
556 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
557 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
558 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
559 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
560 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
561 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
562 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
563 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
564 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
565 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
566 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
567 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
568 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
569 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
570 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
571 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
572 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
573 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
574 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
575 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
576 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
577 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
578 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
579 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
580 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
581 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
582 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
583 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
584 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
585 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
586 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
587 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
588 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
589 2933599457 Rhizobium phaseoli M3 Isolate Nodule
590 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
591 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
592 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
593 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
594 2936381700 Rhizobium chutanense C16 Isolate Unclassified
595 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
596 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
597 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
598 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
599 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
600 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
601 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
602 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
603 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
604 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
605 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
606 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
607 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
608 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
609 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
610 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
611 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
612 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
613 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
614 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
615 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
616 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
617 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
618 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
619 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
620 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
621 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
622 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
623 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
624 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
625 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
626 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
627 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
628 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
629 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
630 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
631 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
632 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
633 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
634 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
635 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
636 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
637 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
638 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
639 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
640 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
641 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
642 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
643 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
644 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
645 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
646 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
647 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
648 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
649 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
650 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
651 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
652 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
653 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
654 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
655 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
656 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
657 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
658 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
659 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
660 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
661 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
662 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
663 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
664 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
665 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
666 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
667 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
668 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
669 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
670 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
671 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
672 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
673 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
674 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
675 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
676 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
677 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
678 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
679 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
680 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
681 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
682 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
683 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
684 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
685 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
686 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
687 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
688 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
689 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
690 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
691 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
692 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
693 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
694 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
695 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
696 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
697 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
698 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
699 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
700 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
701 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
702 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
703 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
704 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
705 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
706 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
707 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
708 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
709 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
710 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
711 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
712 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
713 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
714 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
715 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
716 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
717 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
718 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
719 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
720 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
721 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
722 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
723 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
724 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
725 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
726 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
727 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
728 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
729 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
730 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
731 2996887358 Rhizobium sp. R711 Isolate Nodule
732 2996893221 Rhizobium sp. R635 Isolate Nodule
733 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
734 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
735 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
736 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
737 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
738 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
739 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
740 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
741 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
742 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
743 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
744 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
745 8005258706 Rhizobium sp. R693 Isolate Nodule
746 8005275841 Rhizobium sp. N4311 Isolate Nodule
747 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
748 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
749 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
750 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
751 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
752 8005321885 Rhizobium sp. R72 Isolate Nodule
753 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
754 8005382845 Rhizobium sp. R634 Isolate Nodule
755 8005395548 Rhizobium sp. R339 Isolate Nodule
756 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
757 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
758 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
759 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
760 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
761 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
762 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
763 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
764 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
765 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
766 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
767 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
768 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
769 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
770 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
771 8018176218 Rhizobium sp. N122 Isolate Nodule
772 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
773 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
774 8024501048 Rhizobium sp. H4 Isolate Nodule
775 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
776 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
777 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
778 8056382006 Rhizobium croatiense 13T Isolate Nodule
779 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51
Metatranscriptomes 0.95
Isolates 48.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 19.05
Nodule 39.91
Rhizoplane 1.71
Rhizosphere 23.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10012635 3300003215 Bacteria 3623
2 JGI25158J39367_1000129 3300002739 Bacteria 17721
3 JGI25158J39367_1009928 3300002739 Bacteria 1294
4 JGI25152J39213_1006077 3300002773 Bacteria 3370
5 JGI25152J39213_1009532 3300002773 Bacteria 2300
6 JGI25152J39213_1012788 3300002773 Bacteria 1781
7 JGI25152J39213_1014300 3300002773 Bacteria 1615
8 JGI25150J39212_1000165 3300002774 Bacteria 37364
9 JGI25150J39212_1000307 3300002774 Bacteria 24463
10 JGI25150J39212_1006292 3300002774 Bacteria 2461
11 JGI25150J39212_1008769 3300002774 Bacteria 1961
12 JGI25150J39212_1010363 3300002774 Bacteria 1735
13 JGI25150J39212_1022659 3300002774 Bacteria 941
14 JGI25159J45721_1000040 3300002987 Bacteria 68143
15 JGI25159J45721_1000613 3300002987 Bacteria 15891
16 JGI25151J46595_10000329 3300003187 Bacteria 51364
17 JGI25151J46595_10000802 3300003187 Bacteria 25191
18 JGI25151J46595_10012257 3300003187 Bacteria 3905
19 JGI25151J46595_10030140 3300003187 Bacteria 2137
20 JGI25153J46596_10003058 3300003215 Bacteria 9445
21 JGI25153J46596_10003631 3300003215 Bacteria 8560
22 JGI25153J46596_10007975 3300003215 Bacteria 5126
23 rootH2_10206000 3300003320 Bacteria 2277
24 JGI25160J50197_1000128 3300003354 Bacteria 68143
25 JGI25160J50197_1039478 3300003354 Bacteria 1104
26 JGI25160J50197_1050029 3300003354 Bacteria 893
27 JGI25161J50226_1000099 3300003374 Bacteria 70186
28 JGI25161J50226_1000140 3300003374 Bacteria 50175
29 JGI25161J50226_1000921 3300003374 Bacteria 10544
30 Ga0055539_1007255 3300003752 Bacteria 1406
31 Ga0055526_1000484 3300003771 Bacteria 31547
32 Ga0055526_1001311 3300003771 Bacteria 17836
33 Ga0055526_1008437 3300003771 Bacteria 5141
34 Ga0055526_1013845 3300003771 Bacteria 3373
35 Ga0055526_1014150 3300003771 Bacteria 3307
36 Ga0055524_1002368 3300003775 Bacteria 9799
37 Ga0055524_1002535 3300003775 Bacteria 9355
38 Ga0055524_1016996 3300003775 Bacteria 2582
39 Ga0055524_1018151 3300003775 Bacteria 2452
40 Ga0055536_1023229 3300003781 Bacteria 1828
41 Ga0055528_1000962 3300003790 Bacteria 19094
42 Ga0055528_1001122 3300003790 Bacteria 17570
43 Ga0055528_1002431 3300003790 Bacteria 9980
44 Ga0055528_1004902 3300003790 Bacteria 6318
45 Ga0055528_1008708 3300003790 Bacteria 4307
46 Ga0055528_1027536 3300003790 Bacteria 1596
47 Ga0055540_1000283 3300003792 Bacteria 45546
48 Ga0055540_1001971 3300003792 Bacteria 11472
49 Ga0055531_10019414 3300003794 Bacteria 2749
50 Ga0058692_1001129 3300003856 Bacteria 10338
51 Ga0058692_1003154 3300003856 Bacteria 5224
52 Ga0055543_1000128 3300004625 Bacteria 63029
53 Ga0055543_1000130 3300004625 Bacteria 62045
54 Ga0055543_1000499 3300004625 Bacteria 22628
55 Ga0065165_1000013 3300005262 Bacteria 301887
56 Ga0065165_1013757 3300005262 Bacteria 3189
57 Ga0065165_1042015 3300005262 Bacteria 1352
58 Ga0065165_1054893 3300005262 Bacteria 1114
59 Ga0070661_100666856 3300005344 Bacteria 845
60 Ga0070668_100016609 3300005347 Bacteria 5502
61 Ga0070669_100129861 3300005353 Bacteria 1932
62 Ga0070671_100268725 3300005355 Bacteria 1449
63 Ga0070662_100177037 3300005457 Bacteria 1679
64 Ga0070665_100184361 3300005548 Bacteria 2088
65 Ga0070665_100366032 3300005548 Bacteria 1448
66 Ga0068855_100238040 3300005563 Bacteria 2035
67 Ga0070664_100894727 3300005564 Bacteria 832
68 Ga0068854_100285394 3300005578 Bacteria 1330
69 Ga0068862_100378232 3300005844 Bacteria 1320
70 Ga0075365_10012583 3300006038 Bacteria 5032
71 Ga0075365_10028024 3300006038 Bacteria 3589
72 Ga0075365_10280646 3300006038 Bacteria 1172
73 Ga0075368_10007212 3300006042 Bacteria 3918
74 Ga0075368_10124431 3300006042 Bacteria 1069
75 Ga0075363_100061008 3300006048 Bacteria 2031
76 Ga0075364_10112516 3300006051 Bacteria 1818
77 Ga0075364_10121805 3300006051 Bacteria 1746
78 Ga0075364_10329204 3300006051 Bacteria 1040
79 Ga0075362_10007401 3300006177 Bacteria 4157
80 Ga0075362_10082064 3300006177 Bacteria 1487
81 Ga0075367_10043918 3300006178 Bacteria 2618
82 Ga0075367_10082552 3300006178 Bacteria 1946
83 Ga0075367_10165862 3300006178 Bacteria 1374
84 Ga0075367_10303056 3300006178 Bacteria 1006
85 Ga0075369_10000132 3300006186 Bacteria 20799
86 Ga0075369_10001343 3300006186 Bacteria 8357
87 Ga0075369_10078153 3300006186 Bacteria 1465
88 Ga0075369_10122799 3300006186 Bacteria 1176
89 Ga0075369_10279098 3300006186 Bacteria 778
90 Ga0075366_10015109 3300006195 Bacteria 4418
91 Ga0075370_10019741 3300006353 Bacteria 3674
92 Ga0079104_1005344 3300006946 Bacteria 5157
93 Ga0079104_1009856 3300006946 Bacteria 3200
94 Ga0099826_10001077 3300006948 Bacteria 15493
95 Ga0105251_10116434 3300009011 Bacteria 1215
96 Ga0105250_10044004 3300009092 Bacteria 1790
97 Ga0105240_10000076 3300009093 Bacteria 198848
98 Ga0105247_10345341 3300009101 Bacteria 1045
99 Ga0105243_10012237 3300009148 Bacteria 6488
100 Ga0105237_10011962 3300009545 Bacteria 9171
101 Ga0105249_10978934 3300009553 Bacteria 914
102 Ga0123341_1000032 3300009765 Bacteria 62527
103 Ga0123342_1005565 3300009766 Bacteria 18132
104 Ga0123342_1018314 3300009766 Bacteria 5605
105 Ga0105239_10031666 3300010375 Bacteria 5813
106 Ga0105246_10149305 3300011119 Bacteria 1767
107 Ga0157313_1004872 3300012503 Bacteria 944
108 Ga0157373_10003305 3300013100 Bacteria 12183
109 Ga0157371_10000908 3300013102 Bacteria 33346
110 Ga0157370_10000282 3300013104 Bacteria 64601
111 Ga0157370_10000351 3300013104 Bacteria 58496
112 Ga0171463_1003 3300013249 Bacteria 695693
113 Ga0182007_10005359 3300015262 Bacteria 5651
114 Ga0183363_1104 3300015690 Bacteria 24110
115 Ga0214544_1000161 3300021320 Bacteria 101808
116 Ga0214542_1000012 3300021321 Bacteria 235800
117 Ga0214542_1049266 3300021321 Bacteria 837
118 Ga0214543_1000024 3300021327 Bacteria 235745
119 Ga0214543_1000038 3300021327 Bacteria 182106
120 Ga0228711_1000008 3300022739 Bacteria 169893
121 Ga0228710_1000009 3300022740 Bacteria 169770
122 Ga0209760_105344 3300025207 Bacteria 1062
123 Ga0209436_100029 3300025208 Bacteria 85964
124 Ga0209436_100478 3300025208 Bacteria 17685
125 Ga0209437_100242 3300025233 Bacteria 89060
126 Ga0207425_1000024 3300025245 Bacteria 328978
127 Ga0207425_1001403 3300025245 Bacteria 10139
128 Ga0209677_102528 3300025253 Bacteria 6783
129 Ga0209129_1000146 3300025258 Bacteria 115180
130 Ga0209129_1000161 3300025258 Bacteria 102017
131 Ga0209129_1000384 3300025258 Bacteria 35556
132 Ga0209129_1002472 3300025258 Bacteria 9034
133 Ga0209129_1002877 3300025258 Bacteria 7934
134 Ga0209129_1005300 3300025258 Bacteria 4632
135 Ga0209129_1011303 3300025258 Bacteria 2142
136 Ga0209129_1012316 3300025258 Bacteria 1971
137 Ga0209233_1000069 3300025261 Bacteria 367639
138 Ga0209233_1000260 3300025261 Bacteria 79607
139 Ga0209673_1000010 3300025273 Bacteria 596656
140 Ga0209673_1000384 3300025273 Bacteria 79540
141 Ga0209673_1000977 3300025273 Bacteria 35281
142 Ga0209673_1001611 3300025273 Bacteria 19722
143 Ga0209673_1004894 3300025273 Bacteria 6978
144 Ga0209673_1008249 3300025273 Bacteria 4658
145 Ga0209673_1008420 3300025273 Bacteria 4592
146 Ga0209673_1045112 3300025273 Bacteria 1214
147 Ga0209130_1000020 3300025284 Bacteria 379297
148 Ga0209130_1000034 3300025284 Bacteria 302439
149 Ga0209130_1024624 3300025284 Bacteria 1311
150 Ga0209675_1025908 3300025291 Bacteria 1469
151 Ga0209676_1006475 3300025292 Bacteria 5769
152 Ga0209025_1000050 3300025294 Bacteria 331531
153 Ga0209025_1000058 3300025294 Bacteria 311398
154 Ga0209025_1000216 3300025294 Bacteria 138307
155 Ga0209025_1006154 3300025294 Bacteria 9440
156 Ga0209025_1009763 3300025294 Bacteria 6626
157 Ga0209025_1016218 3300025294 Bacteria 4420
158 Ga0209025_1022771 3300025294 Bacteria 3306
159 Ga0209025_1050374 3300025294 Bacteria 1666
160 Ga0209564_1000013 3300025295 Bacteria 775755
161 Ga0209564_1000388 3300025295 Bacteria 79331
162 Ga0209564_1000512 3300025295 Bacteria 63708
163 Ga0209564_1001530 3300025295 Bacteria 22948
164 Ga0209564_1005163 3300025295 Bacteria 7580
165 Ga0209564_1017668 3300025295 Bacteria 2765
166 Ga0209564_1021395 3300025295 Bacteria 2327
167 Ga0209564_1027718 3300025295 Bacteria 1832
168 Ga0209758_1000083 3300025297 Bacteria 257283
169 Ga0209758_1002719 3300025297 Bacteria 17418
170 Ga0209758_1002951 3300025297 Bacteria 16327
171 Ga0209758_1003069 3300025297 Bacteria 15878
172 Ga0209758_1003364 3300025297 Bacteria 14653
173 Ga0209758_1028295 3300025297 Bacteria 2374
174 Ga0209758_1031036 3300025297 Bacteria 2201
175 Ga0209758_1038762 3300025297 Bacteria 1823
176 Ga0209050_1002022 3300025298 Bacteria 18857
177 Ga0209050_1007290 3300025298 Bacteria 6252
178 Ga0209256_1000442 3300025299 Bacteria 63395
179 Ga0209256_1001584 3300025299 Bacteria 22294
180 Ga0209256_1002304 3300025299 Bacteria 15989
181 Ga0209256_1003052 3300025299 Bacteria 12342
182 Ga0209256_1003997 3300025299 Bacteria 9665
183 Ga0209256_1004887 3300025299 Bacteria 8069
184 Ga0209256_1007815 3300025299 Bacteria 5147
185 Ga0209256_1087386 3300025299 Bacteria 669
186 Ga0207426_1000006 3300025302 Bacteria 1025969
187 Ga0207426_1000008 3300025302 Bacteria 848730
188 Ga0207426_1000221 3300025302 Bacteria 134756
189 Ga0207426_1002076 3300025302 Bacteria 13895
190 Ga0207426_1099920 3300025302 Bacteria 751
191 Ga0209051_1000308 3300025303 Bacteria 76477
192 Ga0209051_1004871 3300025303 Bacteria 8059
193 Ga0209051_1024646 3300025303 Bacteria 2467
194 Ga0209051_1034726 3300025303 Bacteria 1886
195 Ga0209051_1078284 3300025303 Bacteria 964
196 Ga0209257_1000853 3300025304 Bacteria 43617
197 Ga0209257_1015243 3300025304 Bacteria 3218
198 Ga0209257_1025860 3300025304 Bacteria 1995
199 Ga0209257_1032160 3300025304 Bacteria 1667
200 Ga0207695_10000011 3300025913 Bacteria 910221
201 Ga0207671_10000093 3300025914 Bacteria 138939
202 Ga0207649_10718442 3300025920 Bacteria 776
203 Ga0207681_10197957 3300025923 Bacteria 1541
204 Ga0207706_10326752 3300025933 Bacteria 1334
205 Ga0207711_10818667 3300025941 Bacteria 867
206 Ga0207667_10202684 3300025949 Bacteria 2035
207 Ga0207668_10007707 3300025972 Bacteria 6405
208 Ga0207639_10622397 3300026041 Bacteria 997
209 Ga0207683_10601596 3300026121 Bacteria 1018
210 Ga0209281_1000106 3300027111 Bacteria 219666
211 Ga0209281_1000426 3300027111 Bacteria 62651
212 Ga0209371_1000022 3300027312 Bacteria 536342
213 Ga0209371_1006783 3300027312 Bacteria 4152
214 Ga0209282_1000024 3300027666 Bacteria 170348
215 Ga0209282_1000646 3300027666 Bacteria 17203
216 Ga0209813_10013644 3300027866 Bacteria 2173
217 Ga0268266_10052975 3300028379 Bacteria 3485
218 Ga0268266_10470210 3300028379 Bacteria 1197
219 Ga0268265_10436818 3300028380 Bacteria 1219
220 Ga0307515_10017597 3300028794 Bacteria 13001
221 Ga0307515_10025749 3300028794 Bacteria 10161
222 Ga0268256_1000019 3300030500 Bacteria 587949
223 Ga0268256_1006970 3300030500 Bacteria 4120
224 Ga0307408_100014606 3300031548 Bacteria 5218
225 Ga0307405_10001398 3300031731 Bacteria 10146
226 Ga0307405_10271453 3300031731 Bacteria 1272
227 Ga0307413_11420574 3300031824 Bacteria 611
228 Ga0307406_10596431 3300031901 Bacteria 910
229 Ga0307412_10008584 3300031911 Bacteria 5839
230 Ga0315914_1000012 3300031967 Bacteria 169896
231 Ga0307409_100421724 3300031995 Bacteria 1280
232 Ga0307409_100742878 3300031995 Bacteria 984
233 Ga0307416_102571500 3300032002 Bacteria 607
234 Ga0315913_1000006 3300033430 Bacteria 169893
235 Ga0315915_1000010 3300033464 Bacteria 240214
236 Ga0439436_0073344 3300041404 Bacteria 954
237 Ga0439438_032784 3300041405 Bacteria 1375
238 Ga0439447_028769 3300041407 Bacteria 1410
239 Ga0439461_0172596 3300041410 Bacteria 569
240 Ga0439466_0028738 3300041411 Bacteria 1917
241 Ga0439466_0140906 3300041411 Bacteria 740
242 Ga0439465_0001082 3300041413 Bacteria 8718
243 Ga0439465_0016470 3300041413 Bacteria 2305
244 Ga0439465_0042915 3300041413 Bacteria 1466
245 Ga0439465_0104761 3300041413 Bacteria 979
246 Ga0439465_0164100 3300041413 Bacteria 798
247 Ga0451793_1070962 3300041452 Bacteria 3122
248 Ga0451798_0072889 3300041458 Bacteria 1954
249 Ga0451807_1785116 3300041486 Bacteria 1177
250 Ga0451833_0842248 3300041491 Bacteria 2433
251 Ga0451839_0269393 3300041496 Bacteria 747
252 Ga0451841_1049373 3300041498 Bacteria 2397
253 Ga0451845_0848447 3300041501 Bacteria 3529
254 Ga0451847_0949566 3300041503 Bacteria 925
255 Ga0451849_1165968 3300041505 Bacteria 1819
256 Ga0451851_0094177 3300041507 Bacteria 2546
257 Ga0451855_0564925 3300041511 Bacteria 2184
258 Ga0451853_0237820 3300041512 Bacteria 4543
259 Ga0439431_0040059 3300041997 Bacteria 1190
260 Ga0439432_026206 3300042006 Bacteria 1909
261 Ga0439449_0005176 3300042007 Bacteria 5008
262 Ga0439449_0027313 3300042007 Bacteria 2130
263 Ga0439462_0015125 3300042015 Bacteria 1987
264 Ga0439462_0062651 3300042015 Bacteria 1007
265 Ga0439462_0070090 3300042015 Bacteria 952
266 Ga0450906_005659 3300042145 Bacteria 2555
267 Ga0450907_010673 3300042146 Bacteria 1524
268 Ga0450918_005560 3300042531 Bacteria 2261
269 Ga0466982_0070043 3300044672 Bacteria 2165
270 Ga0466966_0044579 3300044684 Bacteria 2839
271 Ga0466963_0006812 3300044694 Bacteria 6796
272 Ga0466970_0011908 3300044765 Bacteria 4438
273 Ga0466958_0009384 3300045836 Bacteria 5453
274 Ga0466967_0068614 3300045976 Bacteria 3167
275 Ga0495617_043747 3300046452 Bacteria 1495
276 Ga0495617_115159 3300046452 Bacteria 868
277 Ga0495592_0188252 3300046454 Bacteria 1400
278 Ga0495590_0044578 3300046457 Bacteria 1546
279 Ga0495629_0028263 3300046459 Bacteria 3981
280 Ga0495638_0000195 3300046460 Bacteria 88030
281 Ga0495638_0289020 3300046460 Bacteria 888
282 Ga0495653_0634717 3300046463 Bacteria 654
283 Ga0495650_0049973 3300046471 Bacteria 1732
284 Ga0495650_0187148 3300046471 Bacteria 725
285 Ga0495582_0205943 3300046473 Bacteria 1124
286 Ga0495605_0007566 3300046474 Bacteria 6160
287 Ga0495605_0040619 3300046474 Bacteria 2321
288 Ga0495662_0026290 3300046476 Bacteria 2811
289 Ga0495585_0005933 3300046492 Bacteria 7646
290 Ga0495585_0006794 3300046492 Bacteria 7061
291 Ga0495585_0008217 3300046492 Bacteria 6337
292 Ga0495585_0063153 3300046492 Bacteria 2033
293 Ga0495583_0001630 3300046506 Bacteria 21886
294 Ga0495583_0017459 3300046506 Bacteria 3808
295 Ga0495583_0036003 3300046506 Bacteria 2358
296 Ga0495583_0118462 3300046506 Bacteria 1116
297 Ga0495606_0007242 3300046507 Bacteria 9996
298 Ga0495606_0017218 3300046507 Bacteria 5474
299 Ga0495606_0062964 3300046507 Bacteria 2366
300 Ga0495606_0140740 3300046507 Bacteria 1425
301 Ga0495606_0176376 3300046507 Bacteria 1236
302 Ga0495608_0562849 3300046511 Bacteria 686
303 Ga0495610_0001253 3300046512 Bacteria 22804
304 Ga0495610_0034388 3300046512 Bacteria 2611
305 Ga0495610_0160825 3300046512 Bacteria 949
306 Ga0495616_0020410 3300046513 Bacteria 3605
307 Ga0495616_0231704 3300046513 Bacteria 800
308 Ga0495618_0159817 3300046514 Bacteria 1437
309 Ga0495620_0033359 3300046515 Bacteria 2338
310 Ga0495620_0034223 3300046515 Bacteria 2298
311 Ga0495620_0044754 3300046515 Bacteria 1921
312 Ga0495620_0059923 3300046515 Bacteria 1589
313 Ga0495620_0062627 3300046515 Bacteria 1544
314 Ga0495631_0001628 3300046518 Bacteria 13398
315 Ga0495631_0027398 3300046518 Bacteria 2608
316 Ga0495631_0098837 3300046518 Bacteria 1256
317 Ga0495631_0307480 3300046518 Bacteria 674
318 Ga0495632_0001015 3300046519 Bacteria 24284
319 Ga0495632_0037950 3300046519 Bacteria 2440
320 Ga0495632_0102200 3300046519 Bacteria 1350
321 Ga0495632_0189237 3300046519 Bacteria 940
322 Ga0495643_0042857 3300046522 Bacteria 2464
323 Ga0495648_0011565 3300046524 Bacteria 6639
324 Ga0495648_0099019 3300046524 Bacteria 1614
325 Ga0495652_0066638 3300046529 Bacteria 3021
326 Ga0495654_0016736 3300046530 Bacteria 3867
327 Ga0495654_0047484 3300046530 Bacteria 2110
328 Ga0495640_0598415 3300046533 Bacteria 666
329 Ga0495587_0076197 3300046536 Bacteria 1948
330 Ga0495609_0019270 3300046538 Bacteria 3160
331 Ga0495609_0105898 3300046538 Bacteria 1216
332 Ga0495597_0065756 3300046542 Bacteria 1572
333 Ga0495622_0109028 3300046557 Bacteria 1268
334 Ga0495622_0128981 3300046557 Bacteria 1152
335 Ga0495633_0003256 3300046558 Bacteria 10942
336 Ga0495633_0087754 3300046558 Bacteria 1446
337 Ga0495633_0153450 3300046558 Bacteria 1063
338 Ga0495656_0009496 3300046615 Bacteria 3499
339 Ga0495656_0395421 3300046615 Bacteria 722
340 Ga0495668_0020849 3300046616 Bacteria 3764
341 Ga0495668_0205810 3300046616 Bacteria 1077
342 Ga0495611_0039406 3300046648 Bacteria 2103
343 Ga0495611_0072057 3300046648 Bacteria 1581
344 Ga0495625_0000621 3300046660 Bacteria 51568
345 Ga0495625_0003972 3300046660 Bacteria 14184
346 Ga0495625_0014945 3300046660 Bacteria 6170
347 Ga0495625_0024045 3300046660 Bacteria 4644
348 Ga0495625_0177961 3300046660 Bacteria 1416
349 Ga0495635_0163337 3300046663 Bacteria 1515
350 Ga0495661_0037834 3300046665 Bacteria 3010
351 Ga0495661_0066238 3300046665 Bacteria 2127
352 Ga0495588_0039180 3300046674 Bacteria 2413
353 Ga0495588_0188621 3300046674 Bacteria 1089
354 Ga0495657_0020297 3300046675 Bacteria 4779
355 Ga0495658_0107340 3300046683 Bacteria 1674
356 Ga0495670_0004526 3300046691 Bacteria 6813
357 Ga0495670_0302269 3300046691 Bacteria 858
358 Ga0495671_0012255 3300046692 Bacteria 4688
359 Ga0495671_0040454 3300046692 Bacteria 2351
360 Ga0495671_0109217 3300046692 Bacteria 1351
361 Ga0495649_0036699 3300046694 Bacteria 2692
362 Ga0495589_0115200 3300046794 Bacteria 1296
363 Ga0495600_0206303 3300046809 Bacteria 1260
364 Ga0495660_0004556 3300046810 Bacteria 8370
365 Ga0495660_0050595 3300046810 Bacteria 2262
366 Ga0495636_0344034 3300047318 Bacteria 703
367 Ga0495672_0005251 3300047320 Bacteria 10318
368 Ga0495676_0151763 3300047321 Bacteria 1648
369 Ga0495683_0121989 3300047323 Bacteria 1236
370 Ga0495687_023600 3300047443 Bacteria 2936
371 Ga0495687_068865 3300047443 Bacteria 1427
372 Ga0495673_0048639 3300047469 Bacteria 1869
373 Ga0495681_0006193 3300047470 Bacteria 7891
374 Ga0495681_0016371 3300047470 Bacteria 4158
375 Ga0495686_0000316 3300047472 Bacteria 80803
376 Ga0495686_0003045 3300047472 Bacteria 14859
377 Ga0495615_0007085 3300048090 Bacteria 2111
378 Ga0496100_0088065 3300048903 Bacteria 2112
379 Ga0496100_0224721 3300048903 Bacteria 1379
380 Ga0496101_0057726 3300048904 Bacteria 2808
381 Ga0496101_1226159 3300048904 Bacteria 587
382 Ga0496103_0082331 3300048906 Bacteria 2025
383 Ga0496105_1098822 3300048908 Bacteria 590
384 Ga0496106_0000578 3300048909 Bacteria 26182
385 Ga0496106_0324458 3300048909 Bacteria 1236
386 Ga0496107_0445726 3300048910 Bacteria 962
387 Ga0496113_0049999 3300048916 Bacteria 3115
388 Ga0496114_0050632 3300048917 Bacteria 3458
389 Ga0496116_0004831 3300048919 Bacteria 12714
390 Ga0496116_0007652 3300048919 Bacteria 9529
391 Ga0496116_0007744 3300048919 Bacteria 9449
392 Ga0496116_0021014 3300048919 Bacteria 4936
393 Ga0496116_0075698 3300048919 Bacteria 2111
394 Ga0496116_0085531 3300048919 Bacteria 1938
395 Ga0496116_0116603 3300048919 Bacteria 1556
396 Ga0496116_0178846 3300048919 Bacteria 1138
397 Ga0496117_0000002 3300048920 Bacteria 2483758
398 Ga0496117_0005629 3300048920 Bacteria 13083
399 Ga0496117_0011077 3300048920 Bacteria 8114
400 Ga0496117_0048248 3300048920 Bacteria 3044
401 Ga0496117_0061842 3300048920 Bacteria 2571
402 Ga0496117_0063042 3300048920 Bacteria 2536
403 Ga0496118_0000087 3300048921 Bacteria 176693
404 Ga0496118_0007840 3300048921 Bacteria 11196
405 Ga0496118_0013080 3300048921 Bacteria 7889
406 Ga0496118_0040236 3300048921 Bacteria 3719
407 Ga0496118_0049990 3300048921 Bacteria 3213
408 Ga0496118_0067810 3300048921 Bacteria 2594
409 Ga0496118_0540636 3300048921 Bacteria 570
410 Ga0496119_0038194 3300048922 Bacteria 3106
411 Ga0496119_0085939 3300048922 Bacteria 1799
412 Ga0496119_0100487 3300048922 Bacteria 1624
413 Ga0496119_0116811 3300048922 Bacteria 1472
414 Ga0496119_0274779 3300048922 Bacteria 840
415 Ga0496119_0354382 3300048922 Bacteria 710
416 Ga0496120_0000180 3300048923 Bacteria 107518
417 Ga0496120_0045548 3300048923 Bacteria 2540
418 Ga0496120_0067438 3300048923 Bacteria 1976
419 Ga0496121_0000003 3300048924 Bacteria 1191431
420 Ga0496121_0004088 3300048924 Bacteria 20038
421 Ga0496121_0005561 3300048924 Bacteria 16097
422 Ga0496121_0009569 3300048924 Bacteria 11104
423 Ga0496121_0011992 3300048924 Bacteria 9529
424 Ga0496121_0029632 3300048924 Bacteria 5052
425 Ga0496121_0074554 3300048924 Bacteria 2713
426 Ga0496121_0194076 3300048924 Bacteria 1453
427 Ga0496121_0490084 3300048924 Bacteria 783
428 Ga0496121_0539974 3300048924 Bacteria 731
429 Ga0496122_0000004 3300048925 Bacteria 645283
430 Ga0496122_0000369 3300048925 Bacteria 96672
431 Ga0496122_0011158 3300048925 Bacteria 9150
432 Ga0496122_0013904 3300048925 Bacteria 7829
433 Ga0496122_0016080 3300048925 Bacteria 7110
434 Ga0496122_0025840 3300048925 Bacteria 5084
435 Ga0496122_0050170 3300048925 Bacteria 3186
436 Ga0496122_0072997 3300048925 Bacteria 2436
437 Ga0496123_0000007 3300048926 Bacteria 645283
438 Ga0496123_0000054 3300048926 Bacteria 234046
439 Ga0496123_0009709 3300048926 Bacteria 8623
440 Ga0496123_0016919 3300048926 Bacteria 5892
441 Ga0496123_0033345 3300048926 Bacteria 3708
442 Ga0496123_0035598 3300048926 Bacteria 3544
443 Ga0496123_0051680 3300048926 Bacteria 2735
444 Ga0496123_0089213 3300048926 Bacteria 1837
445 Ga0496124_0000308 3300048927 Bacteria 90566
446 Ga0496124_0005246 3300048927 Bacteria 14679
447 Ga0496124_0006525 3300048927 Bacteria 12691
448 Ga0496124_0009382 3300048927 Bacteria 10083
449 Ga0496124_0022376 3300048927 Bacteria 5795
450 Ga0496124_0034946 3300048927 Bacteria 4401
451 Ga0496124_0085408 3300048927 Bacteria 2586
452 Ga0496124_0148466 3300048927 Bacteria 1842
453 Ga0496124_0184352 3300048927 Bacteria 1603
454 Ga0496124_0253166 3300048927 Bacteria 1301
455 Ga0496124_0291010 3300048927 Bacteria 1185
456 Ga0496124_0504752 3300048927 Bacteria 810
457 Ga0496124_0527912 3300048927 Bacteria 784
458 Ga0496124_0680115 3300048927 Bacteria 655
459 Ga0496125_0000039 3300048928 Bacteria 318665
460 Ga0496125_0012546 3300048928 Bacteria 8403
461 Ga0496125_0019255 3300048928 Bacteria 6446
462 Ga0496125_0046001 3300048928 Bacteria 3666
463 Ga0496125_0066643 3300048928 Bacteria 2843
464 Ga0496125_0124081 3300048928 Bacteria 1834
465 Ga0496126_0043918 3300048929 Bacteria 4119
466 Ga0496126_0065795 3300048929 Bacteria 3242
467 Ga0496126_0073083 3300048929 Bacteria 3049
468 Ga0496126_0315642 3300048929 Bacteria 1286
469 Ga0496126_0516353 3300048929 Bacteria 952
470 Ga0496126_0549758 3300048929 Bacteria 916
471 Ga0495678_007961 3300049459 Bacteria 5425
472 Ga0495678_008838 3300049459 Bacteria 5037
473 Ga0495678_013910 3300049459 Bacteria 3761
474 Ga0501033_0341413 3300049570 Bacteria 1050
475 Ga0501036_0191749 3300049572 Bacteria 1719
476 Ga0501037_0676418 3300049573 Bacteria 688
477 Ga0501038_0233038 3300049574 Bacteria 1464
478 Ga0501039_0192020 3300049575 Bacteria 1606
479 Ga0501043_0066840 3300049579 Bacteria 2823
480 Ga0501046_0069940 3300049580 Bacteria 2730
481 Ga0501047_0131146 3300049581 Bacteria 2387
482 Ga0501068_0060720 3300049584 Bacteria 2296
483 Ga0501068_0145718 3300049584 Bacteria 1486
484 Ga0501073_0111091 3300049589 Bacteria 1901
485 Ga0501073_0688388 3300049589 Bacteria 705
486 Ga0501080_0160256 3300049742 Bacteria 2078
487 Ga0501080_0332544 3300049742 Bacteria 1374
488 Ga0501083_0179994 3300049744 Bacteria 1380
489 Ga0501083_0679853 3300049744 Bacteria 669
490 Ga0501044_0056630 3300049823 Bacteria 4025
491 nmdc:mga03683_306573_c1 3300050489 Bacteria 746
492 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
493 nmdc:mga00v17_252419_c1 3300050491 Bacteria 1144
494 nmdc:mga00v17_94290_c1 3300050491 Bacteria 1883
495 nmdc:mga0yw44_312100_c1 3300050492 Bacteria 1055
496 nmdc:mga0k408_377513_c1 3300050493 Bacteria 845
497 nmdc:mga0k408_76422_c1 3300050493 Bacteria 1957
498 nmdc:mga06z11_69135_c1 3300050494 Bacteria 1863
499 nmdc:mga06z11_90122_c1 3300050494 Bacteria 1663
500 nmdc:mga04h51_160836_c1 3300050495 Bacteria 864
501 nmdc:mga07m45_123248_c1 3300050496 Bacteria 1498
502 nmdc:mga07m45_35978_c1 3300050496 Bacteria 2756
503 nmdc:mga0sz30_133211_c1 3300050516 Bacteria 1096
504 nmdc:mga0sz30_153932_c1 3300050516 Bacteria 1018
505 nmdc:mga0sz30_240_c1 3300050516 Bacteria 21031
506 nmdc:mga0sz30_308211_c1 3300050516 Bacteria 706
507 Ga0500610_0129251 3300053079 Bacteria 1286
508 Ga0495619_0130002 3300053085 Bacteria 1730
509 Ga0500644_0109177 3300053088 Bacteria 1063
510 Ga0500651_0069649 3300053093 Bacteria 2190
511 Ga0500654_088533 3300053099 Bacteria 1395
512 Ga0500557_000324 3300053105 Bacteria 6271
513 Ga0500560_000131 3300053107 Bacteria 8079
514 Ga0500560_197564 3300053107 Bacteria 651
515 Ga0500569_006712 3300053109 Bacteria 2543
516 Ga0500569_065539 3300053109 Bacteria 1131
517 Ga0500594_0021137 3300053118 Bacteria 1629
518 Ga0500607_131580 3300053121 Bacteria 1192
519 Ga0500618_018322 3300053125 Bacteria 1732
520 Ga0500621_143146 3300053126 Bacteria 905
521 Ga0500652_181370 3300053131 Bacteria 862
522 Ga0500658_0033614 3300053134 Bacteria 2018
523 Ga0500561_0000126 3300053137 Bacteria 14808
524 Ga0500568_0005767 3300053139 Bacteria 6338
525 Ga0500568_0068969 3300053139 Bacteria 1356
526 Ga0500577_0040604 3300053142 Bacteria 1693
527 Ga0500588_0027530 3300053146 Bacteria 1602
528 Ga0500590_026528 3300053148 Bacteria 3005
529 Ga0500616_0002961 3300053153 Bacteria 13495
530 Ga0500616_0013310 3300053153 Bacteria 4782
531 Ga0500622_0000899 3300053156 Bacteria 25323
532 Ga0500622_0058500 3300053156 Bacteria 1970
533 Ga0500624_001076 3300053157 Bacteria 5231
534 Ga0500627_0057796 3300053158 Bacteria 1702
535 Ga0500633_0002917 3300053160 Bacteria 3625
536 Ga0500634_0019039 3300053161 Bacteria 3694
537 Ga0587077_026413 3300059493 Bacteria 1072
538 Ga0587082_005703 3300059504 Bacteria 1629
539 Ga0587088_029267 3300059508 Bacteria 974
540 Ga0587090_005869 3300059510 Bacteria 1557
541 Ga0587091_010006 3300059511 Bacteria 1441
542 Ga0587062_008666 3300059639 Bacteria 1219
543 Ga0587072_005936 3300059643 Bacteria 1842
544 Ga0587075_011742 3300059644 Bacteria 1179
545 Ga0587102_004082 3300059649 Bacteria 1226
546 Ga0587111_0013804 3300060346 Bacteria 1450
547 Ga0501082_0086239 3300060353 Bacteria 2708
548 Ga0466962_0047436 3300061719 Bacteria 2053
549 2509111334 2508501122 Bacteria 6292184
550 2509376388 2509276019 Bacteria 6802256
551 2509392140 2509276021 Bacteria 7634384
552 2509445785 2509276033 Bacteria 7180565
553 2509446913 2509276033 Bacteria 7180565
554 2510133871 2510065019 Bacteria 6903379
555 2510304386 2510065057 Bacteria 6649661
556 2510895291 2510461076 Bacteria 8618824
557 2511186977 2510917028 Bacteria 6185411
558 2511196070 2510917030 Bacteria 7460662
559 2511502160 2511231052 Bacteria 6974333
560 2512533539 2512047086 Bacteria 6850303
561 2512970786 2512875026 Bacteria 6861065
562 2513573654 2513237084 Bacteria 7231967
563 2513576861 2513237085 Bacteria 7695351
564 2513582446 2513237086 Bacteria 7265287
565 2513604171 2513237089 Bacteria 6553624
566 2513617987 2513237091 Bacteria 6900273
567 2513629482 2513237093 Bacteria 7545552
568 2513708132 2513237103 Bacteria 7647401
569 2513865519 2513237138 Bacteria 7368160
570 2513903277 2513237143 Bacteria 6664116
571 2513909193 2513237144 Bacteria 7530820
572 2513925460 2513237146 Bacteria 7166346
573 2513985312 2513237156 Bacteria 6402557
574 2513996880 2513237159 Bacteria 6810126
575 2514006480 2513237160 Bacteria 6650282
576 2514020090 2513237162 Bacteria 7468464
577 2515112916 2515075009 Bacteria 7288508
578 2515608940 2515154107 Bacteria 6795637
579 2515636405 2515154113 Bacteria 7807172
580 2515640879 2515154114 Bacteria 7848616
581 2515655438 2515154116 Bacteria 7552979
582 2515739400 2515154134 Bacteria 7220242
583 2516893540 2516653046 Bacteria 6989037
584 2517036618 2516653077 Bacteria 7555578
585 2517076980 2516653085 Bacteria 7346596
586 2517095750 2517093000 Bacteria 7412387
587 2517407315 2517287029 Bacteria 6905599
588 2517570243 2517487022 Bacteria 7227575
589 2524448636 2524023207 Bacteria 6813453
590 2524459510 2524023209 Bacteria 6679728
591 2530646037 2529292951 Bacteria 6916614
592 2535516791 2534681796 Bacteria 7146037
593 2537875627 2537561587 Bacteria 5425293
594 2551674479 2551306084 Bacteria 8942552
595 2551685852 2551306085 Bacteria 7347181
596 2551695974 2551306086 Bacteria 6843938
597 2551697264 2551306087 Bacteria 7351905
598 2551715308 2551306089 Bacteria 7162724
599 2551719981 2551306090 Bacteria 7953713
600 2551725115 2551306091 Bacteria 7086830
601 2551733155 2551306092 Bacteria 6992595
602 2551743317 2551306093 Bacteria 7064773
603 2554248159 2554235003 Bacteria 5877155
604 2558867788 2558860100 Bacteria 8458965
605 2559295275 2558860242 Bacteria 5568029
606 2585166272 2582581283 Bacteria 6030556
607 2585200528 2582581294 Bacteria 6626667
608 2585222740 2582581298 Bacteria 7315509
609 2585232759 2582581299 Bacteria 6518058
610 2585255005 2582581304 Bacteria 5831370
611 2585267520 2582581306 Bacteria 6450535
612 2585277402 2582581308 Bacteria 7413247
613 2585386582 2582581865 Bacteria 6644329
614 2585393180 2582581866 Bacteria 6859583
615 2585402478 2582581867 Bacteria 7184437
616 2585527360 2585427526 Bacteria 7258840
617 2585535029 2585427527 Bacteria 7273426
618 2585538102 2585427528 Bacteria 6842387
619 2585545323 2585427529 Bacteria 7395659
620 2585555877 2585427530 Bacteria 7383882
621 2585822834 2585427590 Bacteria 6824633
622 2585836050 2585427593 Bacteria 7141551
623 2585843090 2585427594 Bacteria 6180594
624 2599417376 2599185170 Bacteria 7295545
625 2599601589 2599185210 Bacteria 5624189
626 2600194290 2599185352 Bacteria 7228948
627 2601610150 2600255279 Bacteria 5605316
628 2601746924 2600255308 Bacteria 5611129
629 2616293442 2615840624 Bacteria 6557588
630 2616308877 2615840626 Bacteria 7921970
631 2616556912 2615840698 Bacteria 7319877
632 2643803200 2643221557 Bacteria 7184309
633 2643920415 2643221582 Bacteria 5804683
634 2644003234 2643221599 Bacteria 6292121
635 2644050596 2643221607 Bacteria 6314006
636 2644063565 2643221610 Bacteria 7480339
637 2644107380 2643221618 Bacteria 7717186
638 2644150947 2643221626 Bacteria 8069654
639 2644193424 2643221634 Bacteria 6705461
640 2644205070 2643221636 Bacteria 6583769
641 2644210098 2643221637 Bacteria 5345260
642 2644238883 2643221643 Bacteria 5749658
643 2644308775 2643221655 Bacteria 7722067
644 2644335592 2643221659 Bacteria 7890716
645 2644374845 2643221668 Bacteria 7306521
646 2644414328 2643221675 Bacteria 7473456
647 2644447856 2643221680 Bacteria 7473610
648 2644483514 2643221686 Bacteria 6310811
649 2644499721 2643221689 Bacteria 6042950
650 2644522031 2643221693 Bacteria 5513853
651 2644539998 2643221698 Bacteria 7756764
652 2644614716 2643221712 Bacteria 7729434
653 2644653650 2643221718 Bacteria 5345506
654 2644676183 2643221723 Bacteria 7095460
655 2644690329 2643221726 Bacteria 7455827
656 2692315619 2690316117 Bacteria 6800650
657 2719181729 2718217882 Bacteria 6556348
658 2719386253 2718217927 Bacteria 6972593
659 2719666072 2718217997 Bacteria 6740740
660 2719732393 2718218009 Bacteria 6478651
661 2720492492 2718218199 Bacteria 6740745
662 2720613930 2718218232 Bacteria 6720332
663 2720620734 2718218233 Bacteria 6662049
664 2720632057 2718218235 Bacteria 6630699
665 2720775785 2718218269 Bacteria 6906114
666 2721147820 2718218363 Bacteria 6524337
667 2721159269 2718218365 Bacteria 6274507
668 2721164656 2718218366 Bacteria 6425255
669 2721400035 2718218423 Bacteria 6438183
670 2722840826 2721755514 Bacteria 6424414
671 2723027392 2721755556 Bacteria 6745503
672 2723561011 2721755684 Bacteria 6859907
673 2723567604 2721755685 Bacteria 6704835
674 2724038848 2721755809 Bacteria 6438790
675 2724045149 2721755810 Bacteria 6479005
676 2724090392 2721755819 Bacteria 6906405
677 2724104869 2721755822 Bacteria 6726041
678 2724110673 2721755823 Bacteria 6752556
679 2725952644 2724679232 Bacteria 7646494
680 2730108328 2728369352 Bacteria 6745171
681 2730164964 2728369365 Bacteria 6555560
682 2730298901 2728369397 Bacteria 6274511
683 2738800001 2738541293 Bacteria 7065685
684 2739032759 2738541333 Bacteria 7106503
685 2753459022 2751185821 Bacteria 6189929
686 2766065784 2765235942 Bacteria 7445910
687 2778175338 2775507266 Bacteria 7392367
688 2792585204 2791355082 Bacteria 5973319
689 2792620852 2791355091 Bacteria 6135441
690 2792626212 2791355092 Bacteria 6248105
691 2792639150 2791355094 Bacteria 7011481
692 2793294519 2791355256 Bacteria 6798008
693 2793314621 2791355259 Bacteria 7254731
694 2793320447 2791355260 Bacteria 6598818
695 2793330522 2791355261 Bacteria 6661293
696 2793336829 2791355262 Bacteria 6774204
697 2793339119 2791355263 Bacteria 6872478
698 2793348803 2791355264 Bacteria 6429314
699 2793351914 2791355265 Bacteria 6539969
700 2793363615 2791355266 Bacteria 7116587
701 2793370259 2791355267 Bacteria 7222458
702 2802719938 2802428858 Bacteria 6636079
703 2802727130 2802428859 Bacteria 6667919
704 2802731870 2802428860 Bacteria 6525526
705 2802739200 2802428861 Bacteria 6534206
706 2802745820 2802428862 Bacteria 6633353
707 2802752422 2802428863 Bacteria 6410669
708 2805931383 2802429605 Bacteria 6875453
709 2805937419 2802429606 Bacteria 6346811
710 2806043739 2802429633 Bacteria 7341974
711 2806050329 2802429634 Bacteria 7083200
712 2806057146 2802429635 Bacteria 7650140
713 2806064528 2802429636 Bacteria 7597525
714 2806071795 2802429637 Bacteria 7067217
715 2808987991 2808606387 Bacteria 5697198
716 2819558992 2818991439 Bacteria 6907412
717 2819609062 2818991448 Bacteria 6772224
718 2819637707 2818991453 Bacteria 7181617
719 2838017737 2838016132 Bacteria 6577831
720 2838028391 2838022645 Bacteria 6494267
721 2838038421 2838035591 Bacteria 7166484
722 2838043883 2838042994 Bacteria 6046894
723 2838051970 2838048938 Bacteria 6044578
724 2838067413 2838061910 Bacteria 6794874
725 2838070230 2838068647 Bacteria 6208656
726 2838076949 2838074704 Bacteria 6785777
727 2838661669 2838661181 Bacteria 7385261
728 2838670279 2838668709 Bacteria 6671819
729 2838675847 2838675328 Bacteria 4909118
730 2838681695 2838680041 Bacteria 6545511
731 2838687138 2838686498 Bacteria 7807632
732 2838696267 2838694306 Bacteria 6853137
733 2838702650 2838701080 Bacteria 6669771
734 2838710494 2838707686 Bacteria 6619912
735 2838714729 2838714209 Bacteria 5525906
736 2838721470 2838719591 Bacteria 5523910
737 2838725489 2838724970 Bacteria 4908691
738 2838729889 2838729681 Bacteria 7400765
739 2838743096 2838742623 Bacteria 7396178
740 2841848422 2841846520 Bacteria 5345850
741 2841852582 2841851746 Bacteria 7532261
742 2841862052 2841859092 Bacteria 5436171
743 2841869882 2841864319 Bacteria 6742987
744 2842078668 2842077413 Bacteria 6508645
745 2842114897 2842110456 Bacteria 7656360
746 2842118823 2842118031 Bacteria 7033875
747 2842125547 2842124991 Bacteria 5346824
748 2842130742 2842130223 Bacteria 4909145
749 2842148092 2842146304 Bacteria 5957337
750 2842154088 2842152218 Bacteria 4908957
751 2842157958 2842156927 Bacteria 6894975
752 2842167492 2842163707 Bacteria 6916235
753 2842170973 2842170452 Bacteria 5525737
754 2842177708 2842175837 Bacteria 4908771
755 2842181577 2842180545 Bacteria 6888678
756 2842187838 2842187318 Bacteria 5524014
757 2842198550 2842192696 Bacteria 6147454
758 2842204478 2842198810 Bacteria 6608673
759 2842205562 2842205361 Bacteria 6340321
760 2842212149 2842211629 Bacteria 5523832
761 2842217849 2842217011 Bacteria 7497767
762 2842226232 2842224351 Bacteria 5524473
763 2842230372 2842229732 Bacteria 7475766
764 2842239906 2842237096 Bacteria 6620661
765 2842244274 2842243621 Bacteria 7421798
766 2842253158 2842250916 Bacteria 6579627
767 2842257640 2842257432 Bacteria 7401195
768 2842266180 2842264693 Bacteria 6472963
769 2842271324 2842271015 Bacteria 7807131
770 2842279019 2842278818 Bacteria 6340002
771 2842285681 2842285085 Bacteria 6011953
772 2842292330 2842291075 Bacteria 7076806
773 2842301290 2842298080 Bacteria 6123127
774 2842304953 2842304105 Bacteria 7023636
775 2842314998 2842311132 Bacteria 6616990
776 2842320626 2842317721 Bacteria 6793725
777 2842346372 2842341865 Bacteria 7003929
778 2842357827 2842357229 Bacteria 6485165
779 2842369048 2842363717 Bacteria 6844742
780 2842372262 2842370503 Bacteria 7038661
781 2842378727 2842377471 Bacteria 7140707
782 2842385333 2842384541 Bacteria 7057858
783 2842399966 2842395702 Bacteria 6780583
784 2842403041 2842402390 Bacteria 6681310
785 2842409587 2842409023 Bacteria 6687331
786 2842416238 2842415677 Bacteria 6596907
787 2842423844 2842422224 Bacteria 6239196
788 2842430643 2842428310 Bacteria 6767288
789 2842437370 2842434925 Bacteria 6502746
790 2842443740 2842441272 Bacteria 6769273
791 2842453133 2842447887 Bacteria 6754142
792 2842464786 2842462802 Bacteria 6588055
793 2842471988 2842469257 Bacteria 6752936
794 2842491896 2842489311 Bacteria 6620893
795 2842496910 2842495871 Bacteria 6820686
796 2842511214 2842509118 Bacteria 6850950
797 2842518836 2842515876 Bacteria 5436280
798 2842522881 2842521101 Bacteria 6569494
799 2844166662 2844163670 Bacteria 7266046
800 2844458505 2844454524 Bacteria 7952546
801 2847419321 2847417321 Bacteria 6913799
802 2848994341 2848992105 Bacteria 6810864
803 2850081357 2850079185 Bacteria 6848280
804 2855826260 2855825444 Bacteria 6785811
805 2855841605 2855839649 Bacteria 7135830
806 2855876140 2855872281 Bacteria 6964271
807 2857517521 2857516855 Bacteria 7787325
808 2858801721 2858800743 Bacteria 6603254
809 2896388084 2896384573 Bacteria 7700774
810 2899796124 2899792073 Bacteria 4926588
811 2899850708 2899845264 Bacteria 5672268
812 2913299399 2913295892 Bacteria 6333755
813 2915981348 2915980308 Bacteria 6624279
814 2915990423 2915986958 Bacteria 6739310
815 2915998075 2915993759 Bacteria 7016183
816 2916006850 2916000859 Bacteria 6865702
817 2916013858 2916007675 Bacteria 6898660
818 2916017590 2916014648 Bacteria 6946486
819 2916025039 2916021584 Bacteria 6854472
820 2916033202 2916028427 Bacteria 6748433
821 2916040204 2916035215 Bacteria 6755766
822 2916044053 2916041962 Bacteria 6820487
823 2916054234 2916048683 Bacteria 6543552
824 2916059661 2916055098 Bacteria 6758838
825 2916064258 2916061851 Bacteria 6737736
826 2916069178 2916068649 Bacteria 6943657
827 2916079892 2916076590 Bacteria 6596108
828 2919106626 2919100787 Bacteria 7710546
829 2919114768 2919114240 Bacteria 5700270
830 2920761627 2920760137 Bacteria 7427611
831 2920825121 2920822456 Bacteria 6897201
832 2921208464 2921201388 Bacteria 6926299
833 2921214506 2921208531 Bacteria 6745326
834 2921244128 2921237296 Bacteria 6876710
835 2921248561 2921244191 Bacteria 6568419
836 2921251995 2921250672 Bacteria 6677771
837 2921261217 2921257292 Bacteria 6808382
838 2921268634 2921263974 Bacteria 6864552
839 2921285855 2921282425 Bacteria 6826397
840 2921289458 2921289301 Bacteria 7316391
841 2921299924 2921296804 Bacteria 7176999
842 2923558490 2923556063 Bacteria 6793593
843 2924148443 2924144063 Bacteria 6883928
844 2924158071 2924150972 Bacteria 7169444
845 2924159195 2924158325 Bacteria 7188855
846 2924171435 2924165586 Bacteria 7260590
847 2924177916 2924172951 Bacteria 6749356
848 2924183708 2924179722 Bacteria 6843264
849 2924191960 2924186466 Bacteria 6876637
850 2924197996 2924193448 Bacteria 6955718
851 2924204758 2924200457 Bacteria 6757188
852 2924211504 2924207177 Bacteria 6917007
853 2924218821 2924214083 Bacteria 7080103
854 2924225736 2924221636 Bacteria 7113495
855 2924233067 2924228884 Bacteria 6633132
856 2926755784 2926754445 Bacteria 5964435
857 2926762903 2926760298 Bacteria 5505990
858 2929140791 2929138655 Bacteria 5810547
859 2933008733 2933006813 Bacteria 4912075
860 2933014990 2933011516 Bacteria 5439334
861 2933017499 2933016740 Bacteria 6355406
862 2933570761 2933570622 Bacteria 7023390
863 2933591269 2933586486 Bacteria 7667493
864 2933596669 2933594066 Bacteria 5594265
865 2933601036 2933599457 Bacteria 5858799
866 2935900727 2935894831 Bacteria 6620579
867 2935902042 2935901341 Bacteria 7341747
868 2936372128 2936367885 Bacteria 7324495
869 2936381068 2936375103 Bacteria 6652732
870 2936382978 2936381700 Bacteria 7006523
871 2936999693 2936996657 Bacteria 6298727
872 2937007346 2937002841 Bacteria 6934057
873 2937012924 2937009748 Bacteria 6746052
874 2937021650 2937016420 Bacteria 6782579
875 2937026880 2937023124 Bacteria 6815156
876 2937030194 2937029754 Bacteria 6424026
877 2937042574 2937036028 Bacteria 6846469
878 2937047722 2937042894 Bacteria 6741576
879 2937053683 2937049772 Bacteria 6757901
880 2937063407 2937056579 Bacteria 7107896
881 2937070733 2937063883 Bacteria 7199456
882 2937077144 2937071275 Bacteria 6984483
883 2937080369 2937078374 Bacteria 6610289
884 2937085547 2937084907 Bacteria 6618516
885 2937098203 2937091812 Bacteria 6979387
886 2937102520 2937098957 Bacteria 7249374
887 2937111230 2937106411 Bacteria 6947143
888 2937117911 2937113482 Bacteria 6505872
889 2937124039 2937119839 Bacteria 6597547
890 2937130582 2937126314 Bacteria 6771275
891 2941502229 2941499720 Bacteria 7599444
892 2957376476 2957375807 Bacteria 6425588
893 2957386613 2957382221 Bacteria 6737050
894 2957392905 2957388812 Bacteria 6778072
895 2957395978 2957395598 Bacteria 6822399
896 2957406712 2957402308 Bacteria 6741770
897 2957410773 2957408893 Bacteria 6558585
898 2957417602 2957415311 Bacteria 6991633
899 2957423722 2957422303 Bacteria 7172205
900 2957434298 2957430029 Bacteria 7022557
901 2957437640 2957437181 Bacteria 6568994
902 2957446345 2957443900 Bacteria 6869977
903 2957454721 2957450854 Bacteria 6765715
904 2957461985 2957457609 Bacteria 6967680
905 2957468639 2957464669 Bacteria 6568877
906 2957476471 2957471148 Bacteria 6797643
907 2957482811 2957478035 Bacteria 6756658
908 2957488705 2957484790 Bacteria 6703082
909 2957496974 2957491536 Bacteria 6695180
910 2957503227 2957498199 Bacteria 7126688
911 2957507293 2957505466 Bacteria 7253085
912 2960584521 2960584000 Bacteria 6864594
913 2960591993 2960591022 Bacteria 6622873
914 2960602497 2960597568 Bacteria 6550735
915 2960606454 2960603979 Bacteria 6898737
916 2960612400 2960610863 Bacteria 6691244
917 2960621491 2960617483 Bacteria 6727748
918 2960630836 2960624210 Bacteria 6875384
919 2960631954 2960631154 Bacteria 6732508
920 2960644499 2960637947 Bacteria 7296468
921 2960650014 2960645483 Bacteria 7211087
922 2960654755 2960652885 Bacteria 7083688
923 2960665242 2960660292 Bacteria 7041660
924 2960671727 2960667422 Bacteria 6763020
925 2960678352 2960674078 Bacteria 6609048
926 2960681529 2960680706 Bacteria 6624464
927 2960692532 2960687367 Bacteria 6535474
928 2960698112 2960693952 Bacteria 6749742
929 2964614510 2964607997 Bacteria 7101408
930 2964621059 2964615318 Bacteria 6809089
931 2964625731 2964621998 Bacteria 6834995
932 2964632992 2964628898 Bacteria 7083044
933 2964640142 2964636051 Bacteria 7091832
934 2964646832 2964643177 Bacteria 6820887
935 2964655336 2964649959 Bacteria 6675118
936 2964663225 2964656573 Bacteria 7100150
937 2964668302 2964663802 Bacteria 7019362
938 2964671766 2964670856 Bacteria 6851364
939 2964681598 2964678106 Bacteria 6792020
940 2964691338 2964685014 Bacteria 6839111
941 2964698272 2964691889 Bacteria 6802758
942 2964704562 2964698721 Bacteria 6765331
943 2964709824 2964705432 Bacteria 7114648
944 2964716530 2964712639 Bacteria 6695970
945 2964724630 2964719344 Bacteria 7286602
946 2967665492 2967664464 Bacteria 6948836
947 2967675914 2967671571 Bacteria 7021409
948 2967684508 2967678726 Bacteria 7264382
949 2967688877 2967686174 Bacteria 6678622
950 2967697360 2967693043 Bacteria 6804451
951 2967706618 2967699805 Bacteria 6854538
952 2967711550 2967706974 Bacteria 7186053
953 2967714790 2967714385 Bacteria 7000047
954 2967725815 2967721400 Bacteria 7073753
955 2967729089 2967728569 Bacteria 6641507
956 2967738863 2967735183 Bacteria 6827012
957 2967743522 2967742019 Bacteria 6794534
958 2967753571 2967748971 Bacteria 6733771
959 2967758952 2967755722 Bacteria 6814706
960 2967768476 2967762386 Bacteria 6923502
961 2967773844 2967769361 Bacteria 6587838
962 2967781942 2967775926 Bacteria 6738189
963 2970023497 2970019648 Bacteria 7072033
964 2970030349 2970026789 Bacteria 6785236
965 2970040207 2970033650 Bacteria 7118744
966 2970045864 2970040964 Bacteria 6731123
967 2970053962 2970047711 Bacteria 7088379
968 2970059281 2970054988 Bacteria 6611507
969 2970065662 2970061556 Bacteria 7099761
970 2970075495 2970068827 Bacteria 7123112
971 2970080189 2970076120 Bacteria 6697332
972 2970087785 2970082768 Bacteria 6183754
973 2970093216 2970088815 Bacteria 6933825
974 2970100067 2970095765 Bacteria 6936963
975 2970108081 2970102677 Bacteria 6812532
976 2970113882 2970109326 Bacteria 6863976
977 2970120495 2970116247 Bacteria 6501857
978 2970127022 2970122695 Bacteria 6625855
979 2970133198 2970129317 Bacteria 6806560
980 2970140455 2970136068 Bacteria 7207982
981 2970146195 2970143518 Bacteria 6446480
982 2970155963 2970149975 Bacteria 6779706
983 2970161096 2970156795 Bacteria 7168044
984 2970168481 2970164137 Bacteria 6861252
985 2970171567 2970170962 Bacteria 6876229
986 2970182899 2970177841 Bacteria 6768001
987 2970188693 2970184632 Bacteria 7054431
988 2970196369 2970191845 Bacteria 7032787
989 2977522525 2977516862 Bacteria 6940108
990 2977526245 2977523885 Bacteria 6960446
991 2977534341 2977530762 Bacteria 6951399
992 2977542024 2977537788 Bacteria 6929320
993 2977547708 2977544691 Bacteria 6875412
994 2977558349 2977551784 Bacteria 7125765
995 2977562676 2977558990 Bacteria 6863948
996 2977570275 2977565890 Bacteria 6901543
997 2977577076 2977572785 Bacteria 6763888
998 2977583573 2977579622 Bacteria 6772100
999 2979094605 2979089926 Bacteria 5670289
1000 2979100830 2979095461 Bacteria 5669583
1001 2979103842 2979100975 Bacteria 5423623
1002 2984511591 2984509177 Bacteria 5274802
1003 2984522048 2984518228 Bacteria 5277463
1004 2984541346 2984537506 Bacteria 5277481
1005 2984603623 2984601300 Bacteria 5455244
1006 2989774212 2989771324 Bacteria 5605128
1007 2996889118 2996887358 Bacteria 5795980
1008 2996896440 2996893221 Bacteria 5823108
1009 3003933935 3003930520 Bacteria 5667563
1010 3005414707 3005409236 Bacteria 7188837
1011 3005419902 3005416602 Bacteria 7064308
1012 3005448353 3005445848 Bacteria 6906074
1013 3005454555 3005452660 Bacteria 5889319
1014 639649109 639633055 Bacteria 7751309
1015 643826207 643692032 Bacteria 6891900
1016 648740490 648276728 Bacteria 6968865
1017 650740484 650716007 Bacteria 5573770
1018 8003571551 8003570095 Bacteria 5747666
1019 8003994080 8003992118 Bacteria 7266902
1020 8004001704 8003999396 Bacteria 7063185
1021 8005262271 8005258706 Bacteria 6184835
1022 8005281044 8005275841 Bacteria 6929066
1023 8005283346 8005282627 Bacteria 6675747
1024 8005293553 8005289223 Bacteria 6634003
1025 8005303038 8005301065 Bacteria 6614431
1026 8005312747 8005307578 Bacteria 7395396
1027 8005316853 8005314921 Bacteria 7072929
1028 8005323645 8005321885 Bacteria 5795980
1029 8005380842 8005376324 Bacteria 6590079
1030 8005385290 8005382845 Bacteria 6732062
1031 8005396207 8005395548 Bacteria 6806915
1032 8005435068 8005430974 Bacteria 6689030
1033 8005463593 8005460587 Bacteria 7157962
1034 8005500807 8005497431 Bacteria 6477605
1035 8005545517 8005542996 Bacteria 7077758
1036 8005557100 8005556819 Bacteria 6908598
1037 8005567905 8005563573 Bacteria 7153261
1038 8005573549 8005570704 Bacteria 6957481
1039 8005622183 8005619151 Bacteria 7030230
1040 8005632340 8005626139 Bacteria 6534237
1041 8005649666 8005645114 Bacteria 6950293
1042 8005672225 8005668836 Bacteria 6953162
1043 8005692192 8005688590 Bacteria 6610080
1044 8005697314 8005695170 Bacteria 6912330
1045 8018134009 8018127388 Bacteria 7351159
1046 8018163862 8018163183 Bacteria 7277977
1047 8018181408 8018176218 Bacteria 6896178
1048 8023683254 8023680758 Bacteria 7729763
1049 8024482952 8024479707 Bacteria 6954785
1050 8024504275 8024501048 Bacteria 6427847
1051 8049295242 8049293176 Bacteria 6128433
1052 8054560756 8054558443 Bacteria 5204801
1053 8056378443 8056375014 Bacteria 7006639
1054 8056386640 8056382006 Bacteria 6408074
1055 8057877325 8057874678 Bacteria 7494653
1056 JGI25153J46596_10012635
1057 JGI25158J39367_1000129
1058 JGI25158J39367_1009928
1059 JGI25152J39213_1006077
1060 JGI25152J39213_1009532
1061 JGI25152J39213_1012788
1062 JGI25152J39213_1014300
1063 JGI25150J39212_1000165
1064 JGI25150J39212_1000307
1065 JGI25150J39212_1006292
1066 JGI25150J39212_1008769
1067 JGI25150J39212_1010363
1068 JGI25150J39212_1022659
1069 JGI25159J45721_1000040
1070 JGI25159J45721_1000613
1071 JGI25151J46595_10000329
1072 JGI25151J46595_10000802
1073 JGI25151J46595_10012257
1074 JGI25151J46595_10030140
1075 JGI25153J46596_10003058
1076 JGI25153J46596_10003631
1077 JGI25153J46596_10007975
1078 rootH2_10206000
1079 JGI25160J50197_1000128
1080 JGI25160J50197_1039478
1081 JGI25160J50197_1050029
1082 JGI25161J50226_1000099
1083 JGI25161J50226_1000140
1084 JGI25161J50226_1000921
1085 Ga0055539_1007255
1086 Ga0055526_1000484
1087 Ga0055526_1001311
1088 Ga0055526_1008437
1089 Ga0055526_1013845
1090 Ga0055526_1014150
1091 Ga0055524_1002368
1092 Ga0055524_1002535
1093 Ga0055524_1016996
1094 Ga0055524_1018151
1095 Ga0055536_1023229
1096 Ga0055528_1000962
1097 Ga0055528_1001122
1098 Ga0055528_1002431
1099 Ga0055528_1004902
1100 Ga0055528_1008708
1101 Ga0055528_1027536
1102 Ga0055540_1000283
1103 Ga0055540_1001971
1104 Ga0055531_10019414
1105 Ga0058692_1001129
1106 Ga0058692_1003154
1107 Ga0055543_1000128
1108 Ga0055543_1000130
1109 Ga0055543_1000499
1110 Ga0065165_1000013
1111 Ga0065165_1013757
1112 Ga0065165_1042015
1113 Ga0065165_1054893
1114 Ga0070661_100666856
1115 Ga0070668_100016609
1116 Ga0070669_100129861
1117 Ga0070671_100268725
1118 Ga0070662_100177037
1119 Ga0070665_100184361
1120 Ga0070665_100366032
1121 Ga0068855_100238040
1122 Ga0070664_100894727
1123 Ga0068854_100285394
1124 Ga0068862_100378232
1125 Ga0075365_10012583
1126 Ga0075365_10028024
1127 Ga0075365_10280646
1128 Ga0075368_10007212
1129 Ga0075368_10124431
1130 Ga0075363_100061008
1131 Ga0075364_10112516
1132 Ga0075364_10121805
1133 Ga0075364_10329204
1134 Ga0075362_10007401
1135 Ga0075362_10082064
1136 Ga0075367_10043918
1137 Ga0075367_10082552
1138 Ga0075367_10165862
1139 Ga0075367_10303056
1140 Ga0075369_10000132
1141 Ga0075369_10001343
1142 Ga0075369_10078153
1143 Ga0075369_10122799
1144 Ga0075369_10279098
1145 Ga0075366_10015109
1146 Ga0075370_10019741
1147 Ga0079104_1005344
1148 Ga0079104_1009856
1149 Ga0099826_10001077
1150 Ga0105251_10116434
1151 Ga0105250_10044004
1152 Ga0105240_10000076
1153 Ga0105247_10345341
1154 Ga0105243_10012237
1155 Ga0105237_10011962
1156 Ga0105249_10978934
1157 Ga0123341_1000032
1158 Ga0123342_1005565
1159 Ga0123342_1018314
1160 Ga0105239_10031666
1161 Ga0105246_10149305
1162 Ga0157313_1004872
1163 Ga0157373_10003305
1164 Ga0157371_10000908
1165 Ga0157370_10000282
1166 Ga0157370_10000351
1167 Ga0171463_1003
1168 Ga0182007_10005359
1169 Ga0183363_1104
1170 Ga0214544_1000161
1171 Ga0214542_1000012
1172 Ga0214542_1049266
1173 Ga0214543_1000024
1174 Ga0214543_1000038
1175 Ga0228711_1000008
1176 Ga0228710_1000009
1177 Ga0209760_105344
1178 Ga0209436_100029
1179 Ga0209436_100478
1180 Ga0209437_100242
1181 Ga0207425_1000024
1182 Ga0207425_1001403
1183 Ga0209677_102528
1184 Ga0209129_1000146
1185 Ga0209129_1000161
1186 Ga0209129_1000384
1187 Ga0209129_1002472
1188 Ga0209129_1002877
1189 Ga0209129_1005300
1190 Ga0209129_1011303
1191 Ga0209129_1012316
1192 Ga0209233_1000069
1193 Ga0209233_1000260
1194 Ga0209673_1000010
1195 Ga0209673_1000384
1196 Ga0209673_1000977
1197 Ga0209673_1001611
1198 Ga0209673_1004894
1199 Ga0209673_1008249
1200 Ga0209673_1008420
1201 Ga0209673_1045112
1202 Ga0209130_1000020
1203 Ga0209130_1000034
1204 Ga0209130_1024624
1205 Ga0209675_1025908
1206 Ga0209676_1006475
1207 Ga0209025_1000050
1208 Ga0209025_1000058
1209 Ga0209025_1000216
1210 Ga0209025_1006154
1211 Ga0209025_1009763
1212 Ga0209025_1016218
1213 Ga0209025_1022771
1214 Ga0209025_1050374
1215 Ga0209564_1000013
1216 Ga0209564_1000388
1217 Ga0209564_1000512
1218 Ga0209564_1001530
1219 Ga0209564_1005163
1220 Ga0209564_1017668
1221 Ga0209564_1021395
1222 Ga0209564_1027718
1223 Ga0209758_1000083
1224 Ga0209758_1002719
1225 Ga0209758_1002951
1226 Ga0209758_1003069
1227 Ga0209758_1003364
1228 Ga0209758_1028295
1229 Ga0209758_1031036
1230 Ga0209758_1038762
1231 Ga0209050_1002022
1232 Ga0209050_1007290
1233 Ga0209256_1000442
1234 Ga0209256_1001584
1235 Ga0209256_1002304
1236 Ga0209256_1003052
1237 Ga0209256_1003997
1238 Ga0209256_1004887
1239 Ga0209256_1007815
1240 Ga0209256_1087386
1241 Ga0207426_1000006
1242 Ga0207426_1000008
1243 Ga0207426_1000221
1244 Ga0207426_1002076
1245 Ga0207426_1099920
1246 Ga0209051_1000308
1247 Ga0209051_1004871
1248 Ga0209051_1024646
1249 Ga0209051_1034726
1250 Ga0209051_1078284
1251 Ga0209257_1000853
1252 Ga0209257_1015243
1253 Ga0209257_1025860
1254 Ga0209257_1032160
1255 Ga0207695_10000011
1256 Ga0207671_10000093
1257 Ga0207649_10718442
1258 Ga0207681_10197957
1259 Ga0207706_10326752
1260 Ga0207711_10818667
1261 Ga0207667_10202684
1262 Ga0207668_10007707
1263 Ga0207639_10622397
1264 Ga0207683_10601596
1265 Ga0209281_1000106
1266 Ga0209281_1000426
1267 Ga0209371_1000022
1268 Ga0209371_1006783
1269 Ga0209282_1000024
1270 Ga0209282_1000646
1271 Ga0209813_10013644
1272 Ga0268266_10052975
1273 Ga0268266_10470210
1274 Ga0268265_10436818
1275 Ga0307515_10017597
1276 Ga0307515_10025749
1277 Ga0268256_1000019
1278 Ga0268256_1006970
1279 Ga0307408_100014606
1280 Ga0307405_10001398
1281 Ga0307405_10271453
1282 Ga0307413_11420574
1283 Ga0307406_10596431
1284 Ga0307412_10008584
1285 Ga0315914_1000012
1286 Ga0307409_100421724
1287 Ga0307409_100742878
1288 Ga0307416_102571500
1289 Ga0315913_1000006
1290 Ga0315915_1000010
1291 Ga0439436_0073344
1292 Ga0439438_032784
1293 Ga0439447_028769
1294 Ga0439461_0172596
1295 Ga0439466_0028738
1296 Ga0439466_0140906
1297 Ga0439465_0001082
1298 Ga0439465_0016470
1299 Ga0439465_0042915
1300 Ga0439465_0104761
1301 Ga0439465_0164100
1302 Ga0451793_1070962
1303 Ga0451798_0072889
1304 Ga0451807_1785116
1305 Ga0451833_0842248
1306 Ga0451839_0269393
1307 Ga0451841_1049373
1308 Ga0451845_0848447
1309 Ga0451847_0949566
1310 Ga0451849_1165968
1311 Ga0451851_0094177
1312 Ga0451855_0564925
1313 Ga0451853_0237820
1314 Ga0439431_0040059
1315 Ga0439432_026206
1316 Ga0439449_0005176
1317 Ga0439449_0027313
1318 Ga0439462_0015125
1319 Ga0439462_0062651
1320 Ga0439462_0070090
1321 Ga0450906_005659
1322 Ga0450907_010673
1323 Ga0450918_005560
1324 Ga0466982_0070043
1325 Ga0466966_0044579
1326 Ga0466963_0006812
1327 Ga0466970_0011908
1328 Ga0466958_0009384
1329 Ga0466967_0068614
1330 Ga0495617_043747
1331 Ga0495617_115159
1332 Ga0495592_0188252
1333 Ga0495590_0044578
1334 Ga0495629_0028263
1335 Ga0495638_0000195
1336 Ga0495638_0289020
1337 Ga0495653_0634717
1338 Ga0495650_0049973
1339 Ga0495650_0187148
1340 Ga0495582_0205943
1341 Ga0495605_0007566
1342 Ga0495605_0040619
1343 Ga0495662_0026290
1344 Ga0495585_0005933
1345 Ga0495585_0006794
1346 Ga0495585_0008217
1347 Ga0495585_0063153
1348 Ga0495583_0001630
1349 Ga0495583_0017459
1350 Ga0495583_0036003
1351 Ga0495583_0118462
1352 Ga0495606_0007242
1353 Ga0495606_0017218
1354 Ga0495606_0062964
1355 Ga0495606_0140740
1356 Ga0495606_0176376
1357 Ga0495608_0562849
1358 Ga0495610_0001253
1359 Ga0495610_0034388
1360 Ga0495610_0160825
1361 Ga0495616_0020410
1362 Ga0495616_0231704
1363 Ga0495618_0159817
1364 Ga0495620_0033359
1365 Ga0495620_0034223
1366 Ga0495620_0044754
1367 Ga0495620_0059923
1368 Ga0495620_0062627
1369 Ga0495631_0001628
1370 Ga0495631_0027398
1371 Ga0495631_0098837
1372 Ga0495631_0307480
1373 Ga0495632_0001015
1374 Ga0495632_0037950
1375 Ga0495632_0102200
1376 Ga0495632_0189237
1377 Ga0495643_0042857
1378 Ga0495648_0011565
1379 Ga0495648_0099019
1380 Ga0495652_0066638
1381 Ga0495654_0016736
1382 Ga0495654_0047484
1383 Ga0495640_0598415
1384 Ga0495587_0076197
1385 Ga0495609_0019270
1386 Ga0495609_0105898
1387 Ga0495597_0065756
1388 Ga0495622_0109028
1389 Ga0495622_0128981
1390 Ga0495633_0003256
1391 Ga0495633_0087754
1392 Ga0495633_0153450
1393 Ga0495656_0009496
1394 Ga0495656_0395421
1395 Ga0495668_0020849
1396 Ga0495668_0205810
1397 Ga0495611_0039406
1398 Ga0495611_0072057
1399 Ga0495625_0000621
1400 Ga0495625_0003972
1401 Ga0495625_0014945
1402 Ga0495625_0024045
1403 Ga0495625_0177961
1404 Ga0495635_0163337
1405 Ga0495661_0037834
1406 Ga0495661_0066238
1407 Ga0495588_0039180
1408 Ga0495588_0188621
1409 Ga0495657_0020297
1410 Ga0495658_0107340
1411 Ga0495670_0004526
1412 Ga0495670_0302269
1413 Ga0495671_0012255
1414 Ga0495671_0040454
1415 Ga0495671_0109217
1416 Ga0495649_0036699
1417 Ga0495589_0115200
1418 Ga0495600_0206303
1419 Ga0495660_0004556
1420 Ga0495660_0050595
1421 Ga0495636_0344034
1422 Ga0495672_0005251
1423 Ga0495676_0151763
1424 Ga0495683_0121989
1425 Ga0495687_023600
1426 Ga0495687_068865
1427 Ga0495673_0048639
1428 Ga0495681_0006193
1429 Ga0495681_0016371
1430 Ga0495686_0000316
1431 Ga0495686_0003045
1432 Ga0495615_0007085
1433 Ga0496100_0088065
1434 Ga0496100_0224721
1435 Ga0496101_0057726
1436 Ga0496101_1226159
1437 Ga0496103_0082331
1438 Ga0496105_1098822
1439 Ga0496106_0000578
1440 Ga0496106_0324458
1441 Ga0496107_0445726
1442 Ga0496113_0049999
1443 Ga0496114_0050632
1444 Ga0496116_0004831
1445 Ga0496116_0007652
1446 Ga0496116_0007744
1447 Ga0496116_0021014
1448 Ga0496116_0075698
1449 Ga0496116_0085531
1450 Ga0496116_0116603
1451 Ga0496116_0178846
1452 Ga0496117_0000002
1453 Ga0496117_0005629
1454 Ga0496117_0011077
1455 Ga0496117_0048248
1456 Ga0496117_0061842
1457 Ga0496117_0063042
1458 Ga0496118_0000087
1459 Ga0496118_0007840
1460 Ga0496118_0013080
1461 Ga0496118_0040236
1462 Ga0496118_0049990
1463 Ga0496118_0067810
1464 Ga0496118_0540636
1465 Ga0496119_0038194
1466 Ga0496119_0085939
1467 Ga0496119_0100487
1468 Ga0496119_0116811
1469 Ga0496119_0274779
1470 Ga0496119_0354382
1471 Ga0496120_0000180
1472 Ga0496120_0045548
1473 Ga0496120_0067438
1474 Ga0496121_0000003
1475 Ga0496121_0004088
1476 Ga0496121_0005561
1477 Ga0496121_0009569
1478 Ga0496121_0011992
1479 Ga0496121_0029632
1480 Ga0496121_0074554
1481 Ga0496121_0194076
1482 Ga0496121_0490084
1483 Ga0496121_0539974
1484 Ga0496122_0000004
1485 Ga0496122_0000369
1486 Ga0496122_0011158
1487 Ga0496122_0013904
1488 Ga0496122_0016080
1489 Ga0496122_0025840
1490 Ga0496122_0050170
1491 Ga0496122_0072997
1492 Ga0496123_0000007
1493 Ga0496123_0000054
1494 Ga0496123_0009709
1495 Ga0496123_0016919
1496 Ga0496123_0033345
1497 Ga0496123_0035598
1498 Ga0496123_0051680
1499 Ga0496123_0089213
1500 Ga0496124_0000308
1501 Ga0496124_0005246
1502 Ga0496124_0006525
1503 Ga0496124_0009382
1504 Ga0496124_0022376
1505 Ga0496124_0034946
1506 Ga0496124_0085408
1507 Ga0496124_0148466
1508 Ga0496124_0184352
1509 Ga0496124_0253166
1510 Ga0496124_0291010
1511 Ga0496124_0504752
1512 Ga0496124_0527912
1513 Ga0496124_0680115
1514 Ga0496125_0000039
1515 Ga0496125_0012546
1516 Ga0496125_0019255
1517 Ga0496125_0046001
1518 Ga0496125_0066643
1519 Ga0496125_0124081
1520 Ga0496126_0043918
1521 Ga0496126_0065795
1522 Ga0496126_0073083
1523 Ga0496126_0315642
1524 Ga0496126_0516353
1525 Ga0496126_0549758
1526 Ga0495678_007961
1527 Ga0495678_008838
1528 Ga0495678_013910
1529 Ga0501033_0341413
1530 Ga0501036_0191749
1531 Ga0501037_0676418
1532 Ga0501038_0233038
1533 Ga0501039_0192020
1534 Ga0501043_0066840
1535 Ga0501046_0069940
1536 Ga0501047_0131146
1537 Ga0501068_0060720
1538 Ga0501068_0145718
1539 Ga0501073_0111091
1540 Ga0501073_0688388
1541 Ga0501080_0160256
1542 Ga0501080_0332544
1543 Ga0501083_0179994
1544 Ga0501083_0679853
1545 Ga0501044_0056630
1546 nmdc:mga03683_306573_c1
1547 nmdc:mga00v17_12_c1
1548 nmdc:mga00v17_252419_c1
1549 nmdc:mga00v17_94290_c1
1550 nmdc:mga0yw44_312100_c1
1551 nmdc:mga0k408_377513_c1
1552 nmdc:mga0k408_76422_c1
1553 nmdc:mga06z11_69135_c1
1554 nmdc:mga06z11_90122_c1
1555 nmdc:mga04h51_160836_c1
1556 nmdc:mga07m45_123248_c1
1557 nmdc:mga07m45_35978_c1
1558 nmdc:mga0sz30_133211_c1
1559 nmdc:mga0sz30_153932_c1
1560 nmdc:mga0sz30_240_c1
1561 nmdc:mga0sz30_308211_c1
1562 Ga0500610_0129251
1563 Ga0495619_0130002
1564 Ga0500644_0109177
1565 Ga0500651_0069649
1566 Ga0500654_088533
1567 Ga0500557_000324
1568 Ga0500560_000131
1569 Ga0500560_197564
1570 Ga0500569_006712
1571 Ga0500569_065539
1572 Ga0500594_0021137
1573 Ga0500607_131580
1574 Ga0500618_018322
1575 Ga0500621_143146
1576 Ga0500652_181370
1577 Ga0500658_0033614
1578 Ga0500561_0000126
1579 Ga0500568_0005767
1580 Ga0500568_0068969
1581 Ga0500577_0040604
1582 Ga0500588_0027530
1583 Ga0500590_026528
1584 Ga0500616_0002961
1585 Ga0500616_0013310
1586 Ga0500622_0000899
1587 Ga0500622_0058500
1588 Ga0500624_001076
1589 Ga0500627_0057796
1590 Ga0500633_0002917
1591 Ga0500634_0019039
1592 Ga0587077_026413
1593 Ga0587082_005703
1594 Ga0587088_029267
1595 Ga0587090_005869
1596 Ga0587091_010006
1597 Ga0587062_008666
1598 Ga0587072_005936
1599 Ga0587075_011742
1600 Ga0587102_004082
1601 Ga0587111_0013804
1602 Ga0501082_0086239
1603 Ga0466962_0047436
1604 2509111334
1605 2509376388
1606 2509392140
1607 2509445785
1608 2509446913
1609 2510133871
1610 2510304386
1611 2510895291
1612 2511186977
1613 2511196070
1614 2511502160
1615 2512533539
1616 2512970786
1617 2513573654
1618 2513576861
1619 2513582446
1620 2513604171
1621 2513617987
1622 2513629482
1623 2513708132
1624 2513865519
1625 2513903277
1626 2513909193
1627 2513925460
1628 2513985312
1629 2513996880
1630 2514006480
1631 2514020090
1632 2515112916
1633 2515608940
1634 2515636405
1635 2515640879
1636 2515655438
1637 2515739400
1638 2516893540
1639 2517036618
1640 2517076980
1641 2517095750
1642 2517407315
1643 2517570243
1644 2524448636
1645 2524459510
1646 2530646037
1647 2535516791
1648 2537875627
1649 2551674479
1650 2551685852
1651 2551695974
1652 2551697264
1653 2551715308
1654 2551719981
1655 2551725115
1656 2551733155
1657 2551743317
1658 2554248159
1659 2558867788
1660 2559295275
1661 2585166272
1662 2585200528
1663 2585222740
1664 2585232759
1665 2585255005
1666 2585267520
1667 2585277402
1668 2585386582
1669 2585393180
1670 2585402478
1671 2585527360
1672 2585535029
1673 2585538102
1674 2585545323
1675 2585555877
1676 2585822834
1677 2585836050
1678 2585843090
1679 2599417376
1680 2599601589
1681 2600194290
1682 2601610150
1683 2601746924
1684 2616293442
1685 2616308877
1686 2616556912
1687 2643803200
1688 2643920415
1689 2644003234
1690 2644050596
1691 2644063565
1692 2644107380
1693 2644150947
1694 2644193424
1695 2644205070
1696 2644210098
1697 2644238883
1698 2644308775
1699 2644335592
1700 2644374845
1701 2644414328
1702 2644447856
1703 2644483514
1704 2644499721
1705 2644522031
1706 2644539998
1707 2644614716
1708 2644653650
1709 2644676183
1710 2644690329
1711 2692315619
1712 2719181729
1713 2719386253
1714 2719666072
1715 2719732393
1716 2720492492
1717 2720613930
1718 2720620734
1719 2720632057
1720 2720775785
1721 2721147820
1722 2721159269
1723 2721164656
1724 2721400035
1725 2722840826
1726 2723027392
1727 2723561011
1728 2723567604
1729 2724038848
1730 2724045149
1731 2724090392
1732 2724104869
1733 2724110673
1734 2725952644
1735 2730108328
1736 2730164964
1737 2730298901
1738 2738800001
1739 2739032759
1740 2753459022
1741 2766065784
1742 2778175338
1743 2792585204
1744 2792620852
1745 2792626212
1746 2792639150
1747 2793294519
1748 2793314621
1749 2793320447
1750 2793330522
1751 2793336829
1752 2793339119
1753 2793348803
1754 2793351914
1755 2793363615
1756 2793370259
1757 2802719938
1758 2802727130
1759 2802731870
1760 2802739200
1761 2802745820
1762 2802752422
1763 2805931383
1764 2805937419
1765 2806043739
1766 2806050329
1767 2806057146
1768 2806064528
1769 2806071795
1770 2808987991
1771 2819558992
1772 2819609062
1773 2819637707
1774 2838017737
1775 2838028391
1776 2838038421
1777 2838043883
1778 2838051970
1779 2838067413
1780 2838070230
1781 2838076949
1782 2838661669
1783 2838670279
1784 2838675847
1785 2838681695
1786 2838687138
1787 2838696267
1788 2838702650
1789 2838710494
1790 2838714729
1791 2838721470
1792 2838725489
1793 2838729889
1794 2838743096
1795 2841848422
1796 2841852582
1797 2841862052
1798 2841869882
1799 2842078668
1800 2842114897
1801 2842118823
1802 2842125547
1803 2842130742
1804 2842148092
1805 2842154088
1806 2842157958
1807 2842167492
1808 2842170973
1809 2842177708
1810 2842181577
1811 2842187838
1812 2842198550
1813 2842204478
1814 2842205562
1815 2842212149
1816 2842217849
1817 2842226232
1818 2842230372
1819 2842239906
1820 2842244274
1821 2842253158
1822 2842257640
1823 2842266180
1824 2842271324
1825 2842279019
1826 2842285681
1827 2842292330
1828 2842301290
1829 2842304953
1830 2842314998
1831 2842320626
1832 2842346372
1833 2842357827
1834 2842369048
1835 2842372262
1836 2842378727
1837 2842385333
1838 2842399966
1839 2842403041
1840 2842409587
1841 2842416238
1842 2842423844
1843 2842430643
1844 2842437370
1845 2842443740
1846 2842453133
1847 2842464786
1848 2842471988
1849 2842491896
1850 2842496910
1851 2842511214
1852 2842518836
1853 2842522881
1854 2844166662
1855 2844458505
1856 2847419321
1857 2848994341
1858 2850081357
1859 2855826260
1860 2855841605
1861 2855876140
1862 2857517521
1863 2858801721
1864 2896388084
1865 2899796124
1866 2899850708
1867 2913299399
1868 2915981348
1869 2915990423
1870 2915998075
1871 2916006850
1872 2916013858
1873 2916017590
1874 2916025039
1875 2916033202
1876 2916040204
1877 2916044053
1878 2916054234
1879 2916059661
1880 2916064258
1881 2916069178
1882 2916079892
1883 2919106626
1884 2919114768
1885 2920761627
1886 2920825121
1887 2921208464
1888 2921214506
1889 2921244128
1890 2921248561
1891 2921251995
1892 2921261217
1893 2921268634
1894 2921285855
1895 2921289458
1896 2921299924
1897 2923558490
1898 2924148443
1899 2924158071
1900 2924159195
1901 2924171435
1902 2924177916
1903 2924183708
1904 2924191960
1905 2924197996
1906 2924204758
1907 2924211504
1908 2924218821
1909 2924225736
1910 2924233067
1911 2926755784
1912 2926762903
1913 2929140791
1914 2933008733
1915 2933014990
1916 2933017499
1917 2933570761
1918 2933591269
1919 2933596669
1920 2933601036
1921 2935900727
1922 2935902042
1923 2936372128
1924 2936381068
1925 2936382978
1926 2936999693
1927 2937007346
1928 2937012924
1929 2937021650
1930 2937026880
1931 2937030194
1932 2937042574
1933 2937047722
1934 2937053683
1935 2937063407
1936 2937070733
1937 2937077144
1938 2937080369
1939 2937085547
1940 2937098203
1941 2937102520
1942 2937111230
1943 2937117911
1944 2937124039
1945 2937130582
1946 2941502229
1947 2957376476
1948 2957386613
1949 2957392905
1950 2957395978
1951 2957406712
1952 2957410773
1953 2957417602
1954 2957423722
1955 2957434298
1956 2957437640
1957 2957446345
1958 2957454721
1959 2957461985
1960 2957468639
1961 2957476471
1962 2957482811
1963 2957488705
1964 2957496974
1965 2957503227
1966 2957507293
1967 2960584521
1968 2960591993
1969 2960602497
1970 2960606454
1971 2960612400
1972 2960621491
1973 2960630836
1974 2960631954
1975 2960644499
1976 2960650014
1977 2960654755
1978 2960665242
1979 2960671727
1980 2960678352
1981 2960681529
1982 2960692532
1983 2960698112
1984 2964614510
1985 2964621059
1986 2964625731
1987 2964632992
1988 2964640142
1989 2964646832
1990 2964655336
1991 2964663225
1992 2964668302
1993 2964671766
1994 2964681598
1995 2964691338
1996 2964698272
1997 2964704562
1998 2964709824
1999 2964716530
2000 2964724630
2001 2967665492
2002 2967675914
2003 2967684508
2004 2967688877
2005 2967697360
2006 2967706618
2007 2967711550
2008 2967714790
2009 2967725815
2010 2967729089
2011 2967738863
2012 2967743522
2013 2967753571
2014 2967758952
2015 2967768476
2016 2967773844
2017 2967781942
2018 2970023497
2019 2970030349
2020 2970040207
2021 2970045864
2022 2970053962
2023 2970059281
2024 2970065662
2025 2970075495
2026 2970080189
2027 2970087785
2028 2970093216
2029 2970100067
2030 2970108081
2031 2970113882
2032 2970120495
2033 2970127022
2034 2970133198
2035 2970140455
2036 2970146195
2037 2970155963
2038 2970161096
2039 2970168481
2040 2970171567
2041 2970182899
2042 2970188693
2043 2970196369
2044 2977522525
2045 2977526245
2046 2977534341
2047 2977542024
2048 2977547708
2049 2977558349
2050 2977562676
2051 2977570275
2052 2977577076
2053 2977583573
2054 2979094605
2055 2979100830
2056 2979103842
2057 2984511591
2058 2984522048
2059 2984541346
2060 2984603623
2061 2989774212
2062 2996889118
2063 2996896440
2064 3003933935
2065 3005414707
2066 3005419902
2067 3005448353
2068 3005454555
2069 639649109
2070 643826207
2071 648740490
2072 650740484
2073 8003571551
2074 8003994080
2075 8004001704
2076 8005262271
2077 8005281044
2078 8005283346
2079 8005293553
2080 8005303038
2081 8005312747
2082 8005316853
2083 8005323645
2084 8005380842
2085 8005385290
2086 8005396207
2087 8005435068
2088 8005463593
2089 8005500807
2090 8005545517
2091 8005557100
2092 8005567905
2093 8005573549
2094 8005622183
2095 8005632340
2096 8005649666
2097 8005672225
2098 8005692192
2099 8005697314
2100 8018134009
2101 8018163862
2102 8018181408
2103 8023683254
2104 8024482952
2105 8024504275
2106 8049295242
2107 8054560756
2108 8056378443
2109 8056386640
2110 8057877325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

132

181

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

126

179

0.96

PF22029

PhyR_sigma2

Sigma2 domain of PhyR

37

90

0.93

PF04542

Sigma70_r2

Sigma-70 region 2

37

103

0.91

PF07638

Sigma70_ECF

ECF sigma factor

88

185

0.74

Map