F489141

General Info

Members Datasets Scaffolds Average Seq Length
1054 780 501 260

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2996893221|2996897599
Length 275
Sequence VSLLAALLGGIKPRHGIVLGSGLGSLVGELEGAVHVPYKDLPGFPVSAVSGHAGEVVAGRLGGVPVIMLSGRVHYYEKGDAGAMRLPIEVLKALGVEVLILTNSAGSLRDDMPPGSVMQITDHINYSGMNPLIGEESDRRFVGMTNAYDAGLAAAMQKAAAKLEIELAQGVYMWLSGPSFETPAEIRMARILGADAVGMSTVPEVIIARMLGLRVAAASVITNYGAGMTGNELSHEETKDMAPIGGARLAAILKDMIAAGAIPGKVRSGFPSGIA

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
8 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
14 2512875024 Mesorhizobium loti R88b Isolate Nodule
15 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
16 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
17 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
18 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
19 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
20 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
21 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
22 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
23 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
24 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
25 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
26 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
27 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
28 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
29 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
30 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
31 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
32 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
33 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
34 2519899620 Rhizobium sp. Pop5 Isolate Nodule
35 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
36 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
37 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
38 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
39 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
40 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
41 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
42 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
43 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
44 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
45 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
46 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
47 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
48 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
49 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
50 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
51 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
52 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
53 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
54 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
55 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
56 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
57 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
58 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
59 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
60 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
61 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
62 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
63 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
64 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
65 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
66 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
67 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
68 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
69 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
70 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
71 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
72 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
73 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
74 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
75 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
76 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
77 2643221582 Rhizobium sp. Root651 Isolate Unclassified
78 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
79 2643221599 Rhizobium sp. Root708 Isolate Unclassified
80 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
81 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
82 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
83 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
84 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
85 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
86 2643221693 Rhizobium sp. Root491 Isolate Unclassified
87 2643221719 Rhizobium sp. Root274 Isolate Unclassified
88 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
89 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
90 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
91 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
92 2718217882 Rhizobium sp. N741 Isolate Nodule
93 2718217927 Rhizobium sp. N324 Isolate Nodule
94 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
95 2718218009 Rhizobium sp. N561 Isolate Nodule
96 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
97 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
98 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
99 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
100 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
101 2718218363 Rhizobium sp. N113 Isolate Nodule
102 2718218365 Rhizobium sp. N731 Isolate Nodule
103 2718218366 Rhizobium sp. N621 Isolate Nodule
104 2718218423 Rhizobium sp. N941 Isolate Nodule
105 2721755514 Rhizobium sp. N6212 Isolate Nodule
106 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
107 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
108 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
109 2721755809 Rhizobium sp. N541 Isolate Nodule
110 2721755810 Rhizobium sp. N871 Isolate Nodule
111 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
112 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
113 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
114 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
115 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
116 2728369365 Rhizobium sp. N1341 Isolate Nodule
117 2728369397 Rhizobium sp. N1314 Isolate Nodule
118 2738541293 Rhizobium sp. GV031 Isolate Unclassified
119 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
120 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
121 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
122 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
123 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
124 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
125 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
126 2791355256 Rhizobium sp. M10 Isolate Nodule
127 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
128 2791355260 Rhizobium sp. L9 Isolate Nodule
129 2791355261 Rhizobium sp. J15 Isolate Nodule
130 2791355262 Rhizobium sp. M1 Isolate Nodule
131 2791355263 Rhizobium chutanense C5 Isolate Nodule
132 2791355264 Rhizobium sp. S9 Isolate Nodule
133 2791355265 Rhizobium sp. H4 Isolate Nodule
134 2791355266 Rhizobium sp. L43 Isolate Nodule
135 2791355267 Rhizobium sp. L18 Isolate Nodule
136 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
137 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
138 2802429633 Rhizobium anhuiense J3 Isolate Nodule
139 2802429634 Rhizobium anhuiense S10 Isolate Nodule
140 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
141 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
142 2802429637 Rhizobium anhuiense C15 Isolate Nodule
143 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
144 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
145 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
146 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
147 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
148 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
149 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
150 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
151 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
152 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
153 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
154 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
155 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
156 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
157 2838048938 Rhizobium pisi 27/80 Isolate Nodule
158 2838061910 Rhizobium phaseoli L15 Isolate Nodule
159 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
160 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
161 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
162 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
163 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
164 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
165 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
166 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
167 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
168 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
169 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
170 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
171 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
172 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
173 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
174 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
175 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
176 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
177 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
178 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
179 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
180 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
181 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
182 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
183 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
184 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
185 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
186 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
187 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
188 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
189 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
190 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
191 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
192 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
193 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
194 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
195 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
196 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
197 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
198 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
199 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
200 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
201 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
202 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
203 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
204 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
205 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
206 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
207 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
208 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
209 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
210 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
211 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
212 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
213 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
214 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
215 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
216 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
217 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
218 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
219 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
220 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
221 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
222 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
223 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
224 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
225 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
226 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
227 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
228 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
229 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
230 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
231 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
232 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
233 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
234 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
235 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
236 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
237 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
238 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
239 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
240 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
241 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
242 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
243 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
244 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
245 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
246 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
247 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
248 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
249 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
250 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
251 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
252 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
253 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
254 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
255 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
256 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
257 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
258 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
259 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
260 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
261 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
262 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
263 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
264 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
265 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
266 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
267 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
268 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
269 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
270 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
271 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
272 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
273 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
274 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
275 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
276 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
277 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
278 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
279 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
280 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
281 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
282 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
283 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
284 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
285 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
286 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
287 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
288 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
289 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
290 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
291 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
292 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
293 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
294 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
295 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
296 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
297 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
298 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
299 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
300 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
301 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
302 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
303 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
304 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
305 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
306 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
307 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
308 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
309 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
310 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
311 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
312 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
313 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
314 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
315 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
316 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
317 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
318 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
319 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
320 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
321 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
322 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
323 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
324 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
325 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
326 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
327 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
328 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
329 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
330 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
331 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
332 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
333 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
334 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
335 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
336 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
337 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
338 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
339 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
340 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
341 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
342 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
343 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
344 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
345 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
346 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
347 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
348 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
349 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
350 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
351 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
352 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
353 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
354 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
355 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
356 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
357 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
358 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
359 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
360 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
361 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
362 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
363 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
364 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
365 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
366 2933599457 Rhizobium phaseoli M3 Isolate Nodule
367 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
368 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
369 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
370 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
371 2936381700 Rhizobium chutanense C16 Isolate Unclassified
372 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
373 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
374 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
375 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
376 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
377 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
378 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
379 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
380 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
381 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
382 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
383 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
384 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
385 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
386 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
387 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
388 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
389 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
390 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
391 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
392 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
393 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
394 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
395 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
396 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
397 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
398 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
399 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
400 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
401 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
402 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
403 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
404 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
405 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
406 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
407 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
408 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
409 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
410 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
411 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
412 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
413 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
414 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
415 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
416 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
417 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
418 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
419 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
420 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
421 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
422 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
423 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
424 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
425 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
426 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
427 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
428 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
429 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
430 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
431 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
432 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
433 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
434 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
435 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
436 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
437 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
438 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
439 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
440 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
441 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
442 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
443 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
444 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
445 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
446 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
447 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
448 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
449 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
450 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
451 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
452 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
453 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
454 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
455 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
456 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
457 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
458 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
459 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
460 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
461 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
462 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
463 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
464 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
465 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
466 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
467 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
468 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
469 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
470 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
471 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
472 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
473 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
474 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
475 2996887358 Rhizobium sp. R711 Isolate Nodule
476 2996893221 Rhizobium sp. R635 Isolate Nodule
477 3004167301 Mesorhizobium loti 582 Isolate Unclassified
478 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
479 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
480 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
481 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
482 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
483 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
484 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
485 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
486 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
487 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
488 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
489 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
490 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
491 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
492 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
493 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
494 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
495 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
496 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
497 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
498 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
499 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
500 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
501 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
502 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
503 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
504 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
505 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
506 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
507 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
508 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
509 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
510 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
511 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
512 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
513 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
514 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
515 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
516 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
517 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
518 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
519 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
520 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
521 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
522 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
523 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
524 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
525 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
526 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
527 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
528 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
529 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
530 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
531 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
532 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
533 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
534 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
535 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
536 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
537 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
538 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
539 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
540 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
541 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
542 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
543 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
544 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
545 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
546 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
547 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
548 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
549 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
550 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
551 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
552 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
553 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
554 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
555 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
556 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
557 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
558 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
559 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
560 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
561 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
562 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
563 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
564 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
565 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
566 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
567 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
568 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
569 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
570 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
571 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
572 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
573 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
574 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
575 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
576 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
577 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
578 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
579 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
580 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
581 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
582 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
586 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
593 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
594 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
596 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
597 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
598 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
599 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
600 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
601 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
602 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
604 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
605 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
606 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
607 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
608 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
609 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
610 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
611 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
612 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
613 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
614 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
615 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
616 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
617 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
618 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
619 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
620 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
621 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
622 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
623 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
624 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
625 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
626 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
627 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
628 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
629 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
630 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
631 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
632 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
633 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
634 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
635 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
636 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
637 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
638 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
639 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
640 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
641 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
642 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
643 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
644 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
645 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
646 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
647 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
648 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
649 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
650 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
651 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
652 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
653 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
654 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
655 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
656 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
657 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
658 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
659 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
660 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
661 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
662 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
663 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
664 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
665 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
666 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
667 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
668 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
669 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
670 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
671 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
672 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
673 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
674 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
675 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
676 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
677 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
678 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
679 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
680 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
681 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
682 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
683 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
684 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
685 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
686 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
687 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
688 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
689 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
690 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
691 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
692 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
693 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
694 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
695 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
696 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
697 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
698 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
699 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
700 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
701 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
702 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
703 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
704 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
705 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
706 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
707 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
708 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
709 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
710 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
711 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
712 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
713 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
714 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
715 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
716 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
717 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
718 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
719 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
720 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
721 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
722 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
723 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
724 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
725 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
726 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
727 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
728 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
729 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
730 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
731 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
732 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
733 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
734 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
735 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
736 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
737 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
738 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
739 8005258706 Rhizobium sp. R693 Isolate Nodule
740 8005275841 Rhizobium sp. N4311 Isolate Nodule
741 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
742 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
743 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
744 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
745 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
746 8005321885 Rhizobium sp. R72 Isolate Nodule
747 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
748 8005382845 Rhizobium sp. R634 Isolate Nodule
749 8005395548 Rhizobium sp. R339 Isolate Nodule
750 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
751 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
752 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
753 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
754 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
755 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
756 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
757 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
758 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
759 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
760 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
761 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
762 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
763 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
764 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
765 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
766 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
767 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
768 8018176218 Rhizobium sp. N122 Isolate Nodule
769 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
770 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
771 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
772 8024501048 Rhizobium sp. H4 Isolate Nodule
773 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
774 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
775 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
776 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
777 8056382006 Rhizobium croatiense 13T Isolate Nodule
778 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
779 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
780 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.53
Metatranscriptomes 0
Isolates 52.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 16.6
Nodule 40.7
Rhizoplane 1.33
Rhizosphere 25.71
Stem 0
Stem Tuber 0
Unclassified 15.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010356 3300001979 Bacteria 3600
2 JGI24740J21852_10012401 3300001979 Bacteria 3213
3 JGI24740J21852_10058101 3300001979 Bacteria 1077
4 JGI24739J22299_10020720 3300001989 Bacteria 2347
5 JGI25155J39150_1000110 3300002704 Bacteria 43893
6 JGI25156J39149_1000192 3300002705 Bacteria 44040
7 JGI25162J39368_1000302 3300002737 Bacteria 45304
8 JGI25162J39368_1001906 3300002737 Bacteria 9562
9 JGI25154J39366_1000196 3300002738 Bacteria 44040
10 JGI25158J39367_1001549 3300002739 Bacteria 3984
11 JGI25157J39369_1000228 3300002741 Bacteria 44040
12 JGI25157J39369_1001767 3300002741 Bacteria 7056
13 JGI25152J39213_1003523 3300002773 Bacteria 5300
14 JGI25152J39213_1003583 3300002773 Bacteria 5257
15 JGI25152J39213_1023689 3300002773 Bacteria 1041
16 JGI25150J39212_1001258 3300002774 Bacteria 7330
17 JGI25150J39212_1009522 3300002774 Bacteria 1842
18 JGI25159J45721_1000790 3300002987 Bacteria 13778
19 JGI25159J45721_1001258 3300002987 Bacteria 10693
20 JGI25151J46595_10000660 3300003187 Bacteria 29371
21 JGI25151J46595_10001587 3300003187 Bacteria 15099
22 JGI25151J46595_10007774 3300003187 Bacteria 5217
23 JGI25151J46595_10010521 3300003187 Bacteria 4293
24 JGI25151J46595_10031068 3300003187 Bacteria 2090
25 JGI25151J46595_10039452 3300003187 Bacteria 1744
26 JGI25165J46597_1000042 3300003214 Bacteria 271606
27 JGI25165J46597_1000390 3300003214 Bacteria 46779
28 JGI25165J46597_1001741 3300003214 Bacteria 9593
29 JGI25165J46597_1002721 3300003214 Bacteria 5226
30 JGI25153J46596_10007015 3300003215 Bacteria 5611
31 JGI25153J46596_10011601 3300003215 Bacteria 3879
32 JGI25153J46596_10032236 3300003215 Bacteria 1751
33 rootH1_10050935 3300003316 Bacteria 1444
34 rootH2_10047843 3300003320 Bacteria 3297
35 rootL2_10038374 3300003322 Bacteria 5013
36 JGI25160J50197_1000044 3300003354 Bacteria 145379
37 JGI25160J50197_1003769 3300003354 Bacteria 6672
38 JGI25161J50226_1000028 3300003374 Bacteria 145379
39 JGI25161J50226_1000078 3300003374 Bacteria 83416
40 Ga0055542_1000592 3300003762 Bacteria 31197
41 Ga0055526_1005787 3300003771 Bacteria 6969
42 Ga0055526_1006190 3300003771 Bacteria 6581
43 Ga0055526_1012978 3300003771 Bacteria 3572
44 Ga0055526_1019212 3300003771 Bacteria 2500
45 Ga0055526_1019223 3300003771 Bacteria 2500
46 Ga0055524_1004262 3300003775 Bacteria 6648
47 Ga0055524_1012492 3300003775 Bacteria 3257
48 Ga0055528_1000113 3300003790 Bacteria 65323
49 Ga0055528_1001190 3300003790 Bacteria 16795
50 Ga0055528_1006884 3300003790 Bacteria 5100
51 Ga0055540_1001653 3300003792 Bacteria 12938
52 Ga0055540_1007715 3300003792 Bacteria 4006
53 Ga0055540_1022741 3300003792 Bacteria 1596
54 Ga0058692_1002358 3300003856 Bacteria 6357
55 Ga0058692_1002936 3300003856 Bacteria 5486
56 Ga0055543_1000054 3300004625 Bacteria 104176
57 Ga0055543_1000069 3300004625 Bacteria 94040
58 Ga0065165_1000318 3300005262 Bacteria 78352
59 Ga0065165_1012288 3300005262 Bacteria 3496
60 Ga0065165_1016211 3300005262 Bacteria 2800
61 Ga0070670_100000105 3300005331 Bacteria 77938
62 Ga0070667_100596923 3300005367 Bacteria 1017
63 Ga0070663_100051355 3300005455 Bacteria 2937
64 Ga0068853_100006660 3300005539 Bacteria 9199
65 Ga0068853_100551688 3300005539 Bacteria 1092
66 Ga0068855_100128301 3300005563 Bacteria 2898
67 Ga0068857_100483178 3300005577 Bacteria 1161
68 Ga0068857_100493695 3300005577 Bacteria 1148
69 Ga0068856_100169981 3300005614 Bacteria 2192
70 Ga0068856_100314736 3300005614 Bacteria 1583
71 Ga0068852_100018469 3300005616 Bacteria 5495
72 Ga0068851_10037302 3300005834 Bacteria 2436
73 Ga0075365_10004347 3300006038 Bacteria 7489
74 Ga0075365_10017265 3300006038 Bacteria 4411
75 Ga0075365_10020968 3300006038 Bacteria 4066
76 Ga0075365_10038035 3300006038 Bacteria 3125
77 Ga0075365_10078395 3300006038 Bacteria 2234
78 Ga0075365_10083267 3300006038 Bacteria 2170
79 Ga0075365_10190669 3300006038 Bacteria 1434
80 Ga0075368_10001589 3300006042 Bacteria 7293
81 Ga0075368_10024080 3300006042 Bacteria 2329
82 Ga0075368_10035238 3300006042 Bacteria 1952
83 Ga0075363_100009448 3300006048 Bacteria 4585
84 Ga0075363_100023482 3300006048 Bacteria 3126
85 Ga0075363_100059151 3300006048 Bacteria 2060
86 Ga0075364_10042363 3300006051 Bacteria 2957
87 Ga0075362_10001417 3300006177 Bacteria 7642
88 Ga0075362_10092727 3300006177 Bacteria 1403
89 Ga0075367_10004267 3300006178 Bacteria 6952
90 Ga0075367_10010325 3300006178 Bacteria 4904
91 Ga0075367_10018946 3300006178 Bacteria 3807
92 Ga0075367_10089976 3300006178 Bacteria 1866
93 Ga0075367_10204296 3300006178 Bacteria 1234
94 Ga0075369_10044665 3300006186 Bacteria 1904
95 Ga0075366_10024153 3300006195 Bacteria 3546
96 Ga0075370_10000842 3300006353 Bacteria 12429
97 Ga0075370_10037597 3300006353 Bacteria 2722
98 Ga0075370_10039345 3300006353 Bacteria 2664
99 Ga0079104_1000082 3300006946 Bacteria 137722
100 Ga0099826_10006060 3300006948 Bacteria 8757
101 Ga0099826_10097192 3300006948 Bacteria 1785
102 Ga0105240_10001468 3300009093 Bacteria 40305
103 Ga0105240_10249736 3300009093 Bacteria 2052
104 Ga0105240_10398866 3300009093 Bacteria 1550
105 Ga0105240_10563129 3300009093 Bacteria 1259
106 Ga0105245_10672793 3300009098 Bacteria 1067
107 Ga0105243_10003711 3300009148 Bacteria 12270
108 Ga0105248_10054876 3300009177 Bacteria 4469
109 Ga0105237_10004445 3300009545 Bacteria 16237
110 Ga0105237_10011413 3300009545 Bacteria 9397
111 Ga0105238_10307068 3300009551 Bacteria 1571
112 Ga0105249_10365413 3300009553 Bacteria 1465
113 Ga0123341_1000642 3300009765 Bacteria 22722
114 Ga0123341_1057766 3300009765 Bacteria 1988
115 Ga0123342_1010090 3300009766 Bacteria 10966
116 Ga0123342_1021055 3300009766 Bacteria 4648
117 Ga0105239_10046215 3300010375 Bacteria 4770
118 Ga0105239_10048662 3300010375 Bacteria 4648
119 Ga0105239_10328115 3300010375 Bacteria 1726
120 Ga0105246_10185777 3300011119 Bacteria 1604
121 Ga0157373_10018682 3300013100 Bacteria 5045
122 Ga0157371_10000004 3300013102 Bacteria 512593
123 Ga0157370_10001047 3300013104 Bacteria 34825
124 Ga0157370_10001796 3300013104 Bacteria 26445
125 Ga0182008_10087338 3300014497 Bacteria 1536
126 Ga0182008_10095812 3300014497 Bacteria 1465
127 Ga0182006_1020401 3300015261 Bacteria 2777
128 Ga0163161_10396032 3300017792 Bacteria 1107
129 Ga0209435_100087 3300025206 Bacteria 44093
130 Ga0209436_100268 3300025208 Bacteria 23804
131 Ga0209436_112679 3300025208 Bacteria 1419
132 Ga0209672_105109 3300025228 Bacteria 2301
133 Ga0209563_107279 3300025230 Bacteria 1831
134 Ga0209437_100050 3300025233 Bacteria 394010
135 Ga0209437_100205 3300025233 Bacteria 115669
136 Ga0207425_1001736 3300025245 Bacteria 8600
137 Ga0209646_1000285 3300025246 Bacteria 44093
138 Ga0209026_1000029 3300025250 Bacteria 337109
139 Ga0209026_1000347 3300025250 Bacteria 44093
140 Ga0209677_109715 3300025253 Bacteria 1688
141 Ga0209148_1000069 3300025254 Bacteria 334444
142 Ga0209759_1000482 3300025256 Bacteria 44093
143 Ga0209759_1000637 3300025256 Bacteria 32759
144 Ga0209129_1000066 3300025258 Bacteria 226820
145 Ga0209129_1001099 3300025258 Bacteria 15766
146 Ga0209129_1001848 3300025258 Bacteria 11206
147 Ga0209129_1002246 3300025258 Bacteria 9651
148 Ga0209129_1006820 3300025258 Bacteria 3573
149 Ga0209233_1000028 3300025261 Bacteria 642062
150 Ga0209233_1000037 3300025261 Bacteria 554620
151 Ga0209233_1000187 3300025261 Bacteria 133091
152 Ga0209233_1000232 3300025261 Bacteria 96361
153 Ga0209565_1035287 3300025263 Bacteria 955
154 Ga0209455_1000219 3300025272 Bacteria 79850
155 Ga0209673_1000024 3300025273 Bacteria 409632
156 Ga0209673_1000911 3300025273 Bacteria 37766
157 Ga0209673_1002137 3300025273 Bacteria 14721
158 Ga0209673_1002283 3300025273 Bacteria 13700
159 Ga0209673_1003397 3300025273 Bacteria 9438
160 Ga0209673_1013102 3300025273 Bacteria 3297
161 Ga0209673_1034216 3300025273 Bacteria 1538
162 Ga0209130_1000002 3300025284 Bacteria 722648
163 Ga0209130_1000093 3300025284 Bacteria 145707
164 Ga0209025_1000274 3300025294 Bacteria 119322
165 Ga0209025_1000275 3300025294 Bacteria 119220
166 Ga0209025_1000377 3300025294 Bacteria 92728
167 Ga0209025_1000553 3300025294 Bacteria 69760
168 Ga0209025_1008610 3300025294 Bacteria 7302
169 Ga0209025_1015100 3300025294 Bacteria 4686
170 Ga0209564_1000262 3300025295 Bacteria 112256
171 Ga0209564_1000474 3300025295 Bacteria 67143
172 Ga0209564_1000486 3300025295 Bacteria 66011
173 Ga0209758_1000466 3300025297 Bacteria 66920
174 Ga0209758_1000971 3300025297 Bacteria 38600
175 Ga0209758_1003684 3300025297 Bacteria 13618
176 Ga0209758_1009079 3300025297 Bacteria 6272
177 Ga0209758_1009179 3300025297 Bacteria 6217
178 Ga0209758_1025882 3300025297 Bacteria 2560
179 Ga0209050_1006063 3300025298 Bacteria 7313
180 Ga0209256_1000868 3300025299 Bacteria 37527
181 Ga0209256_1003327 3300025299 Bacteria 11402
182 Ga0209256_1011210 3300025299 Bacteria 3618
183 Ga0209256_1038435 3300025299 Bacteria 1240
184 Ga0207426_1000012 3300025302 Bacteria 730942
185 Ga0207426_1000013 3300025302 Bacteria 721897
186 Ga0207426_1000142 3300025302 Bacteria 194023
187 Ga0209051_1000170 3300025303 Bacteria 119026
188 Ga0209051_1002082 3300025303 Bacteria 15092
189 Ga0209051_1027111 3300025303 Bacteria 2290
190 Ga0209051_1037438 3300025303 Bacteria 1778
191 Ga0209257_1007148 3300025304 Bacteria 6862
192 Ga0207688_10199146 3300025901 Bacteria 1200
193 Ga0207647_10058319 3300025904 Bacteria 2364
194 Ga0207695_10000427 3300025913 Bacteria 93089
195 Ga0207695_10635585 3300025913 Bacteria 948
196 Ga0207671_10002841 3300025914 Bacteria 18002
197 Ga0207671_10023638 3300025914 Bacteria 4633
198 Ga0207671_10500607 3300025914 Bacteria 969
199 Ga0207657_10211893 3300025919 Bacteria 1555
200 Ga0207650_10000302 3300025925 Bacteria 48702
201 Ga0207709_10231419 3300025935 Bacteria 1339
202 Ga0207711_10077431 3300025941 Bacteria 2899
203 Ga0207667_10214924 3300025949 Bacteria 1970
204 Ga0207667_10529655 3300025949 Bacteria 1193
205 Ga0207640_10650010 3300025981 Bacteria 898
206 Ga0207658_10519032 3300025986 Bacteria 1063
207 Ga0207639_10242013 3300026041 Bacteria 1569
208 Ga0207639_10473614 3300026041 Bacteria 1140
209 Ga0207678_10046447 3300026067 Bacteria 3755
210 Ga0207702_10034141 3300026078 Bacteria 4252
211 Ga0207702_10257221 3300026078 Bacteria 1642
212 Ga0207674_10144852 3300026116 Bacteria 2334
213 Ga0207674_10877123 3300026116 Bacteria 865
214 Ga0207698_10087512 3300026142 Bacteria 2537
215 Ga0209281_1000043 3300027111 Bacteria 341543
216 Ga0209371_1000009 3300027312 Bacteria 963030
217 Ga0209371_1000569 3300027312 Bacteria 33436
218 Ga0209371_1000597 3300027312 Bacteria 32346
219 Ga0209371_1002100 3300027312 Bacteria 11818
220 Ga0209282_1015117 3300027666 Bacteria 4913
221 Ga0209813_10015632 3300027866 Bacteria 2060
222 Ga0268266_10085620 3300028379 Bacteria 2754
223 Ga0268266_10204443 3300028379 Bacteria 1809
224 Ga0307515_10070922 3300028794 Bacteria 4732
225 Ga0307515_10316134 3300028794 Bacteria 1232
226 Ga0268256_1000010 3300030500 Bacteria 963034
227 Ga0268256_1003765 3300030500 Bacteria 6646
228 Ga0268256_1003954 3300030500 Bacteria 6388
229 Ga0307416_100409987 3300032002 Bacteria 1396
230 Ga0395900_0293062 3300037418 Bacteria 1615
231 Ga0395900_0318882 3300037418 Bacteria 1535
232 Ga0395898_0214279 3300037466 Bacteria 1837
233 Ga0395905_0473627 3300037471 Bacteria 1151
234 Ga0395901_0040590 3300038443 Bacteria 4821
235 Ga0395901_0102150 3300038443 Bacteria 3008
236 Ga0395901_0525704 3300038443 Bacteria 1201
237 Ga0439465_0004289 3300041413 Bacteria 4636
238 Ga0439465_0094693 3300041413 Bacteria 1025
239 Ga0439465_0115285 3300041413 Bacteria 938
240 Ga0451798_0437084 3300041458 Bacteria 1717
241 Ga0451833_0309501 3300041491 Bacteria 946
242 Ga0451839_1518067 3300041496 Bacteria 2007
243 Ga0451841_0823007 3300041498 Bacteria 1296
244 Ga0451845_0491534 3300041501 Bacteria 1916
245 Ga0451847_0530648 3300041503 Bacteria 1242
246 Ga0451849_1413814 3300041505 Bacteria 1033
247 Ga0439445_0067743 3300042004 Bacteria 984
248 Ga0439449_0036973 3300042007 Bacteria 1816
249 Ga0466972_0069426 3300044658 Bacteria 1682
250 Ga0466960_0034427 3300044901 Bacteria 2360
251 Ga0466967_0785893 3300045976 Bacteria 945
252 Ga0495617_013045 3300046452 Bacteria 2831
253 Ga0495627_028697 3300046453 Bacteria 1776
254 Ga0495590_0029742 3300046457 Bacteria 1914
255 Ga0495638_0000566 3300046460 Bacteria 41838
256 Ga0495638_0043090 3300046460 Bacteria 2848
257 Ga0495650_0027816 3300046471 Bacteria 2606
258 Ga0495605_0009235 3300046474 Bacteria 5540
259 Ga0495605_0041550 3300046474 Bacteria 2290
260 Ga0495585_0018694 3300046492 Bacteria 3997
261 Ga0495585_0047303 3300046492 Bacteria 2396
262 Ga0495585_0048677 3300046492 Bacteria 2356
263 Ga0495607_0022489 3300046501 Bacteria 3959
264 Ga0495607_0024783 3300046501 Bacteria 3736
265 Ga0495607_0191834 3300046501 Bacteria 1017
266 Ga0495583_0003929 3300046506 Bacteria 10998
267 Ga0495583_0019864 3300046506 Bacteria 3496
268 Ga0495606_0005067 3300046507 Bacteria 12819
269 Ga0495606_0049724 3300046507 Bacteria 2747
270 Ga0495606_0055336 3300046507 Bacteria 2566
271 Ga0495606_0077288 3300046507 Bacteria 2078
272 Ga0495610_0037953 3300046512 Bacteria 2447
273 Ga0495616_0025367 3300046513 Bacteria 3168
274 Ga0495620_0041131 3300046515 Bacteria 2029
275 Ga0495631_0003763 3300046518 Bacteria 8252
276 Ga0495632_0012650 3300046519 Bacteria 4856
277 Ga0495632_0024308 3300046519 Bacteria 3220
278 Ga0495643_0036691 3300046522 Bacteria 2691
279 Ga0495643_0109703 3300046522 Bacteria 1404
280 Ga0495654_0000314 3300046530 Bacteria 42570
281 Ga0495609_0022681 3300046538 Bacteria 2892
282 Ga0495597_0148905 3300046542 Bacteria 961
283 Ga0495633_0016834 3300046558 Bacteria 3754
284 Ga0495633_0036013 3300046558 Bacteria 2373
285 Ga0495656_0007518 3300046615 Bacteria 3853
286 Ga0495668_0011736 3300046616 Bacteria 5230
287 Ga0495668_0210932 3300046616 Bacteria 1063
288 Ga0495611_0009426 3300046648 Bacteria 4126
289 Ga0495625_0023496 3300046660 Bacteria 4709
290 Ga0495625_0049188 3300046660 Bacteria 3032
291 Ga0495625_0091282 3300046660 Bacteria 2105
292 Ga0495625_0095479 3300046660 Bacteria 2049
293 Ga0495661_0014352 3300046665 Bacteria 5309
294 Ga0495661_0270325 3300046665 Bacteria 860
295 Ga0495670_0032614 3300046691 Bacteria 2591
296 Ga0495670_0071710 3300046691 Bacteria 1754
297 Ga0495671_0014249 3300046692 Bacteria 4284
298 Ga0495671_0106694 3300046692 Bacteria 1368
299 Ga0495649_0023374 3300046694 Bacteria 3454
300 Ga0495636_0114020 3300047318 Bacteria 1191
301 Ga0495681_0009496 3300047470 Bacteria 5984
302 Ga0495686_0002334 3300047472 Bacteria 18121
303 Ga0495686_0020721 3300047472 Bacteria 4382
304 Ga0495686_0182194 3300047472 Bacteria 1216
305 Ga0496101_0192646 3300048904 Bacteria 1574
306 Ga0496102_0169134 3300048905 Bacteria 2058
307 Ga0496103_0188830 3300048906 Bacteria 1325
308 Ga0496106_0006761 3300048909 Bacteria 8490
309 Ga0496108_0453277 3300048911 Bacteria 1121
310 Ga0496112_0004626 3300048915 Bacteria 11705
311 Ga0496113_0037980 3300048916 Bacteria 3538
312 Ga0496116_0018149 3300048919 Bacteria 5433
313 Ga0496116_0141976 3300048919 Bacteria 1349
314 Ga0496117_0000002 3300048920 Bacteria 2483758
315 Ga0496117_0002038 3300048920 Bacteria 26746
316 Ga0496117_0005456 3300048920 Bacteria 13341
317 Ga0496117_0023070 3300048920 Bacteria 4972
318 Ga0496117_0031006 3300048920 Bacteria 4090
319 Ga0496117_0045021 3300048920 Bacteria 3192
320 Ga0496117_0070695 3300048920 Bacteria 2343
321 Ga0496118_0001167 3300048921 Bacteria 40506
322 Ga0496118_0017956 3300048921 Bacteria 6412
323 Ga0496118_0060628 3300048921 Bacteria 2808
324 Ga0496118_0109751 3300048921 Bacteria 1835
325 Ga0496118_0122183 3300048921 Bacteria 1694
326 Ga0496119_0014974 3300048922 Bacteria 6019
327 Ga0496119_0026777 3300048922 Bacteria 3986
328 Ga0496119_0047803 3300048922 Bacteria 2658
329 Ga0496119_0099572 3300048922 Bacteria 1635
330 Ga0496119_0171840 3300048922 Bacteria 1144
331 Ga0496119_0240112 3300048922 Bacteria 918
332 Ga0496120_0002729 3300048923 Bacteria 17241
333 Ga0496120_0015943 3300048923 Bacteria 4933
334 Ga0496120_0017924 3300048923 Bacteria 4575
335 Ga0496120_0020218 3300048923 Bacteria 4238
336 Ga0496121_0000001 3300048924 Bacteria 1830318
337 Ga0496121_0023381 3300048924 Bacteria 5954
338 Ga0496121_0044238 3300048924 Bacteria 3845
339 Ga0496121_0056726 3300048924 Bacteria 3251
340 Ga0496121_0107387 3300048924 Bacteria 2138
341 Ga0496121_0139533 3300048924 Bacteria 1800
342 Ga0496122_0000001 3300048925 Bacteria 1827766
343 Ga0496122_0000018 3300048925 Bacteria 426350
344 Ga0496122_0000321 3300048925 Bacteria 105353
345 Ga0496122_0025714 3300048925 Bacteria 5102
346 Ga0496122_0126865 3300048925 Bacteria 1631
347 Ga0496122_0141991 3300048925 Bacteria 1500
348 Ga0496123_0000001 3300048926 Bacteria 1831497
349 Ga0496123_0000015 3300048926 Bacteria 426088
350 Ga0496123_0000454 3300048926 Bacteria 72735
351 Ga0496123_0004823 3300048926 Bacteria 13917
352 Ga0496123_0139316 3300048926 Bacteria 1329
353 Ga0496124_0000558 3300048927 Bacteria 63070
354 Ga0496124_0006480 3300048927 Bacteria 12741
355 Ga0496124_0043463 3300048927 Bacteria 3863
356 Ga0496124_0046082 3300048927 Bacteria 3736
357 Ga0496124_0046414 3300048927 Bacteria 3719
358 Ga0496124_0131850 3300048927 Bacteria 1984
359 Ga0496125_0000001 3300048928 Bacteria 1766138
360 Ga0496125_0000628 3300048928 Bacteria 59302
361 Ga0496125_0006658 3300048928 Bacteria 12436
362 Ga0496125_0037411 3300048928 Bacteria 4220
363 Ga0496125_0049883 3300048928 Bacteria 3472
364 Ga0496125_0085026 3300048928 Bacteria 2399
365 Ga0496125_0090571 3300048928 Bacteria 2295
366 Ga0496125_0197038 3300048928 Bacteria 1323
367 Ga0496126_0000378 3300048929 Bacteria 92187
368 Ga0496126_0063882 3300048929 Bacteria 3298
369 Ga0496126_0177821 3300048929 Bacteria 1809
370 Ga0496126_0243423 3300048929 Bacteria 1501
371 Ga0496126_0306012 3300048929 Bacteria 1309
372 Ga0496126_0421783 3300048929 Bacteria 1078
373 Ga0495678_047945 3300049459 Bacteria 1669
374 Ga0501031_0004927 3300049568 Bacteria 8677
375 Ga0501031_0085938 3300049568 Bacteria 2051
376 Ga0501032_0000019 3300049569 Bacteria 155168
377 Ga0501032_0051426 3300049569 Bacteria 2778
378 Ga0501032_0055436 3300049569 Bacteria 2667
379 Ga0501032_0374855 3300049569 Bacteria 915
380 Ga0501033_0000260 3300049570 Bacteria 50590
381 Ga0501033_0000461 3300049570 Bacteria 38633
382 Ga0501033_0013860 3300049570 Bacteria 6133
383 Ga0501033_0034352 3300049570 Bacteria 3805
384 Ga0501033_0071969 3300049570 Bacteria 2539
385 Ga0501033_0149740 3300049570 Bacteria 1684
386 Ga0501033_0181834 3300049570 Bacteria 1507
387 Ga0501034_0002910 3300049571 Bacteria 19875
388 Ga0501034_0411430 3300049571 Bacteria 1274
389 Ga0501034_0636201 3300049571 Bacteria 969
390 Ga0501036_0001517 3300049572 Bacteria 17917
391 Ga0501036_0086723 3300049572 Bacteria 2646
392 Ga0501037_0000154 3300049573 Bacteria 64077
393 Ga0501037_0000870 3300049573 Bacteria 22576
394 Ga0501037_0040577 3300049573 Bacteria 3425
395 Ga0501037_0042753 3300049573 Bacteria 3330
396 Ga0501037_0082837 3300049573 Bacteria 2324
397 Ga0501038_0001781 3300049574 Bacteria 20003
398 Ga0501038_0088163 3300049574 Bacteria 2605
399 Ga0501038_0101706 3300049574 Bacteria 2392
400 Ga0501038_0576400 3300049574 Bacteria 853
401 Ga0501039_0001074 3300049575 Bacteria 20003
402 Ga0501039_0139292 3300049575 Bacteria 1906
403 Ga0501039_0438841 3300049575 Bacteria 1025
404 Ga0501043_0000007 3300049579 Bacteria 224595
405 Ga0501043_0000113 3300049579 Bacteria 76112
406 Ga0501043_0048312 3300049579 Bacteria 3345
407 Ga0501043_0069942 3300049579 Bacteria 2757
408 Ga0501043_0159911 3300049579 Bacteria 1760
409 Ga0501046_0191544 3300049580 Bacteria 1525
410 Ga0501047_0037568 3300049581 Bacteria 4682
411 Ga0501047_0092531 3300049581 Bacteria 2902
412 Ga0501047_0127106 3300049581 Bacteria 2429
413 Ga0501047_0186069 3300049581 Bacteria 1942
414 Ga0501047_0319073 3300049581 Bacteria 1394
415 Ga0501067_0176497 3300049583 Bacteria 1190
416 Ga0501068_0021893 3300049584 Bacteria 3735
417 Ga0501068_0109855 3300049584 Bacteria 1714
418 Ga0501068_0342680 3300049584 Bacteria 960
419 Ga0501069_0000027 3300049585 Bacteria 106217
420 Ga0501069_0052485 3300049585 Bacteria 2270
421 Ga0501069_0115122 3300049585 Bacteria 1533
422 Ga0501069_0137725 3300049585 Bacteria 1399
423 Ga0501070_0000231 3300049586 Bacteria 52768
424 Ga0501070_0000822 3300049586 Bacteria 28172
425 Ga0501070_0000825 3300049586 Bacteria 28139
426 Ga0501070_0034270 3300049586 Bacteria 4245
427 Ga0501070_0041305 3300049586 Bacteria 3843
428 Ga0501070_0162893 3300049586 Bacteria 1838
429 Ga0501070_0250959 3300049586 Bacteria 1447
430 Ga0501070_0493250 3300049586 Bacteria 984
431 Ga0501071_0035260 3300049587 Bacteria 3563
432 Ga0501073_0038563 3300049589 Bacteria 3388
433 Ga0501074_0000023 3300049590 Bacteria 68925
434 Ga0501074_0016561 3300049590 Bacteria 5351
435 Ga0501076_0217993 3300049592 Bacteria 1560
436 Ga0501080_0000300 3300049742 Bacteria 37703
437 Ga0501080_0122112 3300049742 Bacteria 2413
438 Ga0501080_0164697 3300049742 Bacteria 2046
439 Ga0501083_0000012 3300049744 Bacteria 178668
440 Ga0501083_0042127 3300049744 Bacteria 3096
441 Ga0501035_0000073 3300049822 Bacteria 122603
442 Ga0501035_0000201 3300049822 Bacteria 72627
443 Ga0501035_0000709 3300049822 Bacteria 36064
444 Ga0501035_0001226 3300049822 Bacteria 26728
445 Ga0501035_0001287 3300049822 Bacteria 25890
446 Ga0501035_0066684 3300049822 Bacteria 3194
447 Ga0501035_0071499 3300049822 Bacteria 3071
448 Ga0501035_0455009 3300049822 Bacteria 1058
449 Ga0501044_0000118 3300049823 Bacteria 95218
450 Ga0501044_0019989 3300049823 Bacteria 7151
451 Ga0501044_0054362 3300049823 Bacteria 4116
452 Ga0501044_0068483 3300049823 Bacteria 3615
453 Ga0501044_0176352 3300049823 Bacteria 2106
454 Ga0501044_0306819 3300049823 Bacteria 1514
455 Ga0501044_0364578 3300049823 Bacteria 1362
456 Ga0501044_0462262 3300049823 Bacteria 1174
457 nmdc:mga03683_203753_c1 3300050489 Bacteria 909
458 nmdc:mga03683_6637_c1 3300050489 Bacteria 3974
459 nmdc:mga03n38_168995_c1 3300050490 Bacteria 1112
460 nmdc:mga03n38_234855_c1 3300050490 Bacteria 963
461 nmdc:mga00v17_611_c1 3300050491 Bacteria 19769
462 nmdc:mga0yw44_16789_c1 3300050492 Bacteria 3965
463 nmdc:mga0yw44_2319_c1 3300050492 Bacteria 8052
464 nmdc:mga0yw44_24863_c1 3300050492 Bacteria 3396
465 nmdc:mga0yw44_55086_c1 3300050492 Bacteria 2419
466 nmdc:mga0yw44_60256_c1 3300050492 Bacteria 2324
467 nmdc:mga0k408_10280_c1 3300050493 Bacteria 5058
468 nmdc:mga06z11_12773_c1 3300050494 Bacteria 3663
469 nmdc:mga06z11_271014_c1 3300050494 Bacteria 1004
470 nmdc:mga06z11_36763_c1 3300050494 Bacteria 2420
471 nmdc:mga06z11_91619_c1 3300050494 Bacteria 1651
472 nmdc:mga04h51_13917_c1 3300050495 Bacteria 2288
473 nmdc:mga07m45_11183_c1 3300050496 Bacteria 4711
474 nmdc:mga0sz30_11473_c1 3300050516 Bacteria 2559
475 nmdc:mga0sz30_42457_c1 3300050516 Bacteria 1913
476 Ga0500610_0039841 3300053079 Bacteria 2426
477 Ga0500578_0035296 3300053086 Bacteria 3214
478 Ga0500578_0072312 3300053086 Bacteria 2197
479 Ga0500643_012418 3300053087 Bacteria 3050
480 Ga0500557_042031 3300053105 Bacteria 1437
481 Ga0500618_000203 3300053125 Bacteria 47421
482 Ga0500618_001739 3300053125 Bacteria 9246
483 Ga0500618_021138 3300053125 Bacteria 1590
484 Ga0500658_0009920 3300053134 Bacteria 3511
485 Ga0500561_0000139 3300053137 Bacteria 14052
486 Ga0500568_0001169 3300053139 Bacteria 17543
487 Ga0500568_0006185 3300053139 Bacteria 6052
488 Ga0500568_0053805 3300053139 Bacteria 1577
489 Ga0500577_0044998 3300053142 Bacteria 1629
490 Ga0500616_0007056 3300053153 Bacteria 7207
491 Ga0500616_0009183 3300053153 Bacteria 6035
492 Ga0500616_0070165 3300053153 Bacteria 1790
493 Ga0500616_0164888 3300053153 Bacteria 1012
494 Ga0500620_007279 3300053155 Bacteria 2723
495 Ga0500622_0009636 3300053156 Bacteria 5337
496 Ga0500624_002343 3300053157 Bacteria 2580
497 Ga0500627_0037793 3300053158 Bacteria 2062
498 Ga0500627_0055473 3300053158 Bacteria 1735
499 Ga0500634_0049682 3300053161 Bacteria 2261
500 Ga0500636_0000022 3300053177 Bacteria 93090
501 Ga0500636_0001307 3300053177 Bacteria 13519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2922130491 2922138713 214
2 3300048922 Ga0496119_0240112 Ga0496119_0240112_198_905 219
3 iso_pu_bacteria 2922178524 2922179713 224
4 3300002739 JGI25158J39367_1001549 JGI25158J39367_10015495 225
5 3300002774 JGI25150J39212_1001258 JGI25150J39212_10012582 225
6 3300002987 JGI25159J45721_1001258 JGI25159J45721_100125812 225
7 3300003374 JGI25161J50226_1000078 JGI25161J50226_100007837 225
8 3300004625 Ga0055543_1000069 Ga0055543_100006983 225
9 3300005262 Ga0065165_1016211 Ga0065165_10162113 225
10 3300025208 Ga0209436_100268 Ga0209436_10026825 225
11 3300025258 Ga0209129_1001099 Ga0209129_10010999 225
12 3300025284 Ga0209130_1000002 Ga0209130_1000002586 225
13 3300025297 Ga0209758_1000466 Ga0209758_100046610 225
14 3300025302 Ga0207426_1000013 Ga0207426_1000013586 225
15 3300046457 Ga0495590_0029742 Ga0495590_0029742_658_1452 225
16 3300048919 Ga0496116_0141976 Ga0496116_0141976_27_821 225
17 3300048920 Ga0496117_0045021 Ga0496117_0045021_1208_2002 225
18 3300048921 Ga0496118_0109751 Ga0496118_0109751_933_1727 225
19 3300048924 Ga0496121_0023381 Ga0496121_0023381_2602_3396 225
20 3300048925 Ga0496122_0126865 Ga0496122_0126865_748_1542 225
21 3300048928 Ga0496125_0037411 Ga0496125_0037411_488_1282 225
22 3300053139 Ga0500568_0053805 Ga0500568_0053805_53_847 225
23 3300053156 Ga0500622_0009636 Ga0500622_0009636_2179_2973 225
24 3300049581 Ga0501047_0319073 Ga0501047_0319073_51_845 226
25 3300049744 Ga0501083_0042127 Ga0501083_0042127_1638_2432 226
26 3300002773 JGI25152J39213_1003583 JGI25152J39213_10035833 227
27 3300003215 JGI25153J46596_10007015 JGI25153J46596_100070153 227
28 3300003771 Ga0055526_1006190 Ga0055526_10061906 227
29 3300003790 Ga0055528_1006884 Ga0055528_10068842 227
30 3300003792 Ga0055540_1007715 Ga0055540_10077154 227
31 3300025258 Ga0209129_1002246 Ga0209129_10022466 227
32 3300025263 Ga0209565_1035287 Ga0209565_10352871 227
33 3300025273 Ga0209673_1003397 Ga0209673_10033975 227
34 3300025273 Ga0209673_1034216 Ga0209673_10342163 227
35 3300025295 Ga0209564_1000262 Ga0209564_100026284 227
36 3300025297 Ga0209758_1009079 Ga0209758_10090793 227
37 3300025299 Ga0209256_1038435 Ga0209256_10384352 227
38 3300025303 Ga0209051_1002082 Ga0209051_10020824 227
39 3300041413 Ga0439465_0115285 Ga0439465_0115285_119_913 227
40 3300048909 Ga0496106_0006761 Ga0496106_0006761_2716_3510 229
41 3300053139 Ga0500568_0006185 Ga0500568_0006185_2749_3543 229
42 3300025914 Ga0207671_10500607 Ga0207671_105006071 230
43 3300047472 Ga0495686_0002334 Ga0495686_0002334_13759_14562 232
44 3300053125 Ga0500618_001739 Ga0500618_001739_5075_5863 232
45 3300003320 rootH2_10047843 rootH2_100478434 234
46 iso_pu_bacteria 2878788777 2878789503 234
47 iso_pu_bacteria 2977957713 2977963302 234
48 3300009765 Ga0123341_1000642 Ga0123341_10006425 236
49 3300009766 Ga0123342_1021055 Ga0123342_10210555 236
50 3300053087 Ga0500643_012418 Ga0500643_012418_1578_2375 236
51 3300048927 Ga0496124_0131850 Ga0496124_0131850_165_959 238
52 3300045976 Ga0466967_0785893 Ga0466967_0785893_165_932 239
53 3300048925 Ga0496122_0025714 Ga0496122_0025714_3996_4796 239
54 iso_pu_bacteria 2844454524 2844456588 239
55 3300028794 Ga0307515_10070922 Ga0307515_100709224 241
56 iso_pu_bacteria 2582581283 2585164442 243
57 iso_pu_bacteria 2643221689 2644498800 243
58 3300009551 Ga0105238_10307068 Ga0105238_103070682 244
59 iso_pu_bacteria 2510917030 2511200522 244
60 iso_pu_bacteria 2582581298 2585223259 244
61 iso_pu_bacteria 2585427529 2585546145 244
62 iso_pu_bacteria 2919100787 2919101862 244
63 iso_pu_bacteria 3005445848 3005450096 244
64 iso_pu_bacteria 8005658619 8005661545 244
65 3300006038 Ga0075365_10078395 Ga0075365_100783952 245
66 3300050492 nmdc:mga0yw44_55086_c1 nmdc:mga0yw44_55086_c1_397_1197 245
67 iso_pu_bacteria 2599185236 2599718716 245
68 iso_pu_bacteria 2818991461 2819685822 245
69 iso_pu_bacteria 2821123053 2821123231 245
70 iso_pu_bacteria 2837651117 2837651500 245
71 iso_pu_bacteria 2838736955 2838739746 245
72 iso_pu_bacteria 2841840854 2841844130 245
73 iso_pu_bacteria 2842140634 2842143851 245
74 iso_pu_bacteria 2857531043 2857533817 245
75 iso_pu_bacteria 2996336353 2996336884 245
76 iso_pu_bacteria 8056875544 8056878653 245
77 3300048925 Ga0496122_0000018 Ga0496122_0000018_272900_273688 246
78 3300048926 Ga0496123_0000015 Ga0496123_0000015_272900_273688 246
79 3300048927 Ga0496124_0046082 Ga0496124_0046082_324_1112 246
80 3300049568 Ga0501031_0085938 Ga0501031_0085938_1075_1872 246
81 3300049569 Ga0501032_0055436 Ga0501032_0055436_846_1643 246
82 3300049570 Ga0501033_0034352 Ga0501033_0034352_2648_3445 246
83 3300049570 Ga0501033_0071969 Ga0501033_0071969_590_1387 246
84 3300049573 Ga0501037_0042753 Ga0501037_0042753_799_1596 246
85 3300049574 Ga0501038_0088163 Ga0501038_0088163_1750_2547 246
86 3300049581 Ga0501047_0037568 Ga0501047_0037568_1456_2253 246
87 3300049583 Ga0501067_0176497 Ga0501067_0176497_229_1026 246
88 3300049585 Ga0501069_0052485 Ga0501069_0052485_642_1439 246
89 3300049585 Ga0501069_0115122 Ga0501069_0115122_13_810 246
90 3300049586 Ga0501070_0000822 Ga0501070_0000822_23812_24609 246
91 3300049586 Ga0501070_0000825 Ga0501070_0000825_4012_4809 246
92 3300049587 Ga0501071_0035260 Ga0501071_0035260_38_835 246
93 3300049590 Ga0501074_0016561 Ga0501074_0016561_2958_3755 246
94 3300049742 Ga0501080_0122112 Ga0501080_0122112_590_1387 246
95 3300049822 Ga0501035_0000709 Ga0501035_0000709_28344_29141 246
96 3300049822 Ga0501035_0001287 Ga0501035_0001287_939_1736 246
97 3300049823 Ga0501044_0068483 Ga0501044_0068483_1862_2659 246
98 3300049823 Ga0501044_0176352 Ga0501044_0176352_1131_1928 246
99 3300053153 Ga0500616_0070165 Ga0500616_0070165_119_919 246
100 iso_pu_bacteria 2509276021 2509388994 246
101 iso_pu_bacteria 2509276033 2509444584 246
102 iso_pu_bacteria 2510065019 2510135669 246
103 iso_pu_bacteria 2510461076 2510897142 246
104 iso_pu_bacteria 2510917022 2511136857 246
105 iso_pu_bacteria 2513237084 2513570830 246
106 iso_pu_bacteria 2513237085 2513574955 246
107 iso_pu_bacteria 2513237093 2513633739 246
108 iso_pu_bacteria 2513237103 2513707586 246
109 iso_pu_bacteria 2513237162 2514023680 246
110 iso_pu_bacteria 2515075009 2515114833 246
111 iso_pu_bacteria 2515154113 2515635810 246
112 iso_pu_bacteria 2515154114 2515641424 246
113 iso_pu_bacteria 2515154116 2515659313 246
114 iso_pu_bacteria 2515154134 2515741182 246
115 iso_pu_bacteria 2516653077 2517038451 246
116 iso_pu_bacteria 2516653085 2517078727 246
117 iso_pu_bacteria 2517093000 2517097469 246
118 iso_pu_bacteria 2517287029 2517408925 246
119 iso_pu_bacteria 2529292951 2530648344 246
120 iso_pu_bacteria 2537561587 2537877273 246
121 iso_pu_bacteria 2554235003 2554246169 246
122 iso_pu_bacteria 2558860242 2559293392 246
123 iso_pu_bacteria 2582581307 2585273458 246
124 iso_pu_bacteria 2585427526 2585523958 246
125 iso_pu_bacteria 2585427528 2585542102 246
126 iso_pu_bacteria 2585427531 2585564014 246
127 iso_pu_bacteria 2585427593 2585840688 246
128 iso_pu_bacteria 2585427608 2585900316 246
129 iso_pu_bacteria 2585427609 2585909278 246
130 iso_pu_bacteria 2585428125 2587984620 246
131 iso_pu_bacteria 2599185210 2599604276 246
132 iso_pu_bacteria 2600255279 2601609588 246
133 iso_pu_bacteria 2600255308 2601746363 246
134 iso_pu_bacteria 2643221582 2643920549 246
135 iso_pu_bacteria 2643221693 2644519642 246
136 iso_pu_bacteria 2718217927 2719388092 246
137 iso_pu_bacteria 2718217997 2719667715 246
138 iso_pu_bacteria 2718218199 2720494135 246
139 iso_pu_bacteria 2718218232 2720615598 246
140 iso_pu_bacteria 2718218233 2720622381 246
141 iso_pu_bacteria 2718218235 2720633735 246
142 iso_pu_bacteria 2718218269 2720777435 246
143 iso_pu_bacteria 2718218423 2721401725 246
144 iso_pu_bacteria 2721755556 2723029032 246
145 iso_pu_bacteria 2721755684 2723562649 246
146 iso_pu_bacteria 2721755685 2723569342 246
147 iso_pu_bacteria 2721755809 2724040539 246
148 iso_pu_bacteria 2721755819 2724092042 246
149 iso_pu_bacteria 2721755822 2724106607 246
150 iso_pu_bacteria 2721755823 2724112415 246
151 iso_pu_bacteria 2724679232 2725949667 246
152 iso_pu_bacteria 2728369352 2730109968 246
153 iso_pu_bacteria 2738541333 2739037351 246
154 iso_pu_bacteria 2765235942 2766067161 246
155 iso_pu_bacteria 2791355256 2793298460 246
156 iso_pu_bacteria 2791355259 2793315700 246
157 iso_pu_bacteria 2791355261 2793327571 246
158 iso_pu_bacteria 2791355262 2793335642 246
159 iso_pu_bacteria 2791355263 2793341036 246
160 iso_pu_bacteria 2791355265 2793354772 246
161 iso_pu_bacteria 2791355266 2793358531 246
162 iso_pu_bacteria 2791355267 2793368983 246
163 iso_pu_bacteria 2802429605 2805928907 246
164 iso_pu_bacteria 2802429606 2805934528 246
165 iso_pu_bacteria 2802429633 2806047078 246
166 iso_pu_bacteria 2802429634 2806054923 246
167 iso_pu_bacteria 2802429635 2806061849 246
168 iso_pu_bacteria 2802429636 2806069628 246
169 iso_pu_bacteria 2802429637 2806076001 246
170 iso_pu_bacteria 2808606387 2808986839 246
171 iso_pu_bacteria 2818991439 2819556911 246
172 iso_pu_bacteria 2838016132 2838020942 246
173 iso_pu_bacteria 2838042994 2838044856 246
174 iso_pu_bacteria 2838048938 2838052909 246
175 iso_pu_bacteria 2838061910 2838064702 246
176 iso_pu_bacteria 2838068647 2838070521 246
177 iso_pu_bacteria 2838668709 2838672531 246
178 iso_pu_bacteria 2838675328 2838677647 246
179 iso_pu_bacteria 2838680041 2838685584 246
180 iso_pu_bacteria 2838686498 2838689840 246
181 iso_pu_bacteria 2838694306 2838695960 246
182 iso_pu_bacteria 2838701080 2838705146 246
183 iso_pu_bacteria 2838707686 2838713359 246
184 iso_pu_bacteria 2838714209 2838716536 246
185 iso_pu_bacteria 2838719591 2838719664 246
186 iso_pu_bacteria 2838724970 2838727287 246
187 iso_pu_bacteria 2838729681 2838731464 246
188 iso_pu_bacteria 2838742623 2838744405 246
189 iso_pu_bacteria 2841846520 2841846595 246
190 iso_pu_bacteria 2841851746 2841852945 246
191 iso_pu_bacteria 2841859092 2841860876 246
192 iso_pu_bacteria 2841864319 2841870210 246
193 iso_pu_bacteria 2842077413 2842082593 246
194 iso_pu_bacteria 2842110456 2842112748 246
195 iso_pu_bacteria 2842118031 2842123848 246
196 iso_pu_bacteria 2842124991 2842127376 246
197 iso_pu_bacteria 2842130223 2842132540 246
198 iso_pu_bacteria 2842146304 2842150140 246
199 iso_pu_bacteria 2842152218 2842152291 246
200 iso_pu_bacteria 2842156927 2842160272 246
201 iso_pu_bacteria 2842163707 2842165750 246
202 iso_pu_bacteria 2842170452 2842172782 246
203 iso_pu_bacteria 2842175837 2842175910 246
204 iso_pu_bacteria 2842180545 2842184062 246
205 iso_pu_bacteria 2842187318 2842189644 246
206 iso_pu_bacteria 2842192696 2842196364 246
207 iso_pu_bacteria 2842205361 2842208910 246
208 iso_pu_bacteria 2842211629 2842213958 246
209 iso_pu_bacteria 2842217011 2842219426 246
210 iso_pu_bacteria 2842224351 2842224424 246
211 iso_pu_bacteria 2842229732 2842231644 246
212 iso_pu_bacteria 2842237096 2842242903 246
213 iso_pu_bacteria 2842243621 2842245887 246
214 iso_pu_bacteria 2842250916 2842254826 246
215 iso_pu_bacteria 2842257432 2842260265 246
216 iso_pu_bacteria 2842264693 2842267153 246
217 iso_pu_bacteria 2842271015 2842273676 246
218 iso_pu_bacteria 2842278818 2842282400 246
219 iso_pu_bacteria 2842285085 2842290060 246
220 iso_pu_bacteria 2842291075 2842296976 246
221 iso_pu_bacteria 2842304105 2842308472 246
222 iso_pu_bacteria 2842311132 2842312224 246
223 iso_pu_bacteria 2842317721 2842321818 246
224 iso_pu_bacteria 2842341865 2842344656 246
225 iso_pu_bacteria 2842363717 2842367769 246
226 iso_pu_bacteria 2842370503 2842376030 246
227 iso_pu_bacteria 2842377471 2842383240 246
228 iso_pu_bacteria 2842384541 2842390373 246
229 iso_pu_bacteria 2842395702 2842397841 246
230 iso_pu_bacteria 2842402390 2842407670 246
231 iso_pu_bacteria 2842409023 2842414301 246
232 iso_pu_bacteria 2842415677 2842420839 246
233 iso_pu_bacteria 2842422224 2842424135 246
234 iso_pu_bacteria 2842428310 2842431151 246
235 iso_pu_bacteria 2842434925 2842437486 246
236 iso_pu_bacteria 2842441272 2842444301 246
237 iso_pu_bacteria 2842447887 2842451272 246
238 iso_pu_bacteria 2842462802 2842465294 246
239 iso_pu_bacteria 2842469257 2842472237 246
240 iso_pu_bacteria 2842489311 2842494108 246
241 iso_pu_bacteria 2842495871 2842501247 246
242 iso_pu_bacteria 2842515876 2842517661 246
243 iso_pu_bacteria 2857516855 2857520884 246
244 iso_pu_bacteria 2874146452 2874152692 246
245 iso_pu_bacteria 2891373044 2891374796 246
246 iso_pu_bacteria 2899792073 2899794299 246
247 iso_pu_bacteria 2899845264 2899845679 246
248 iso_pu_bacteria 2919114240 2919116753 246
249 iso_pu_bacteria 2926754445 2926754763 246
250 iso_pu_bacteria 2926760298 2926761931 246
251 iso_pu_bacteria 2929138655 2929138880 246
252 iso_pu_bacteria 2933006813 2933006938 246
253 iso_pu_bacteria 2933011516 2933015472 246
254 iso_pu_bacteria 2933570622 2933574921 246
255 iso_pu_bacteria 2933586486 2933588363 246
256 iso_pu_bacteria 2933594066 2933594141 246
257 iso_pu_bacteria 2933599457 2933601326 246
258 iso_pu_bacteria 2935894831 2935899978 246
259 iso_pu_bacteria 2935901341 2935902325 246
260 iso_pu_bacteria 2936367885 2936369541 246
261 iso_pu_bacteria 2936375103 2936380282 246
262 iso_pu_bacteria 2979089926 2979092802 246
263 iso_pu_bacteria 2979095461 2979099809 246
264 iso_pu_bacteria 2979100975 2979104774 246
265 iso_pu_bacteria 2984509177 2984513426 246
266 iso_pu_bacteria 2984518228 2984520206 246
267 iso_pu_bacteria 2984537506 2984539502 246
268 iso_pu_bacteria 2984601300 2984601729 246
269 iso_pu_bacteria 639633055 639646068 246
270 iso_pu_bacteria 650716007 650738628 246
271 iso_pu_bacteria 8003570095 8003572174 246
272 iso_pu_bacteria 8005275841 8005278294 246
273 iso_pu_bacteria 8005282627 8005282672 246
274 iso_pu_bacteria 8005289223 8005291648 246
275 iso_pu_bacteria 8005307578 8005310255 246
276 iso_pu_bacteria 8005382845 8005384108 246
277 iso_pu_bacteria 8005395548 8005399614 246
278 iso_pu_bacteria 8005430974 8005433793 246
279 iso_pu_bacteria 8005460587 8005465529 246
280 iso_pu_bacteria 8005497431 8005498112 246
281 iso_pu_bacteria 8005556819 8005559979 246
282 iso_pu_bacteria 8005563573 8005564527 246
283 iso_pu_bacteria 8005570704 8005571213 246
284 iso_pu_bacteria 8005619151 8005619321 246
285 iso_pu_bacteria 8005626139 8005627886 246
286 iso_pu_bacteria 8005668836 8005669520 246
287 iso_pu_bacteria 8005695170 8005701457 246
288 iso_pu_bacteria 8018163183 8018167603 246
289 iso_pu_bacteria 8018176218 8018176616 246
290 iso_pu_bacteria 8023680758 8023681268 246
291 iso_pu_bacteria 8024479707 8024481901 246
292 iso_pu_bacteria 8024501048 8024506337 246
293 iso_pu_bacteria 8054460903 8054463958 246
294 iso_pu_bacteria 8056375014 8056381186 246
295 iso_pu_bacteria 8056382006 8056382679 246
296 iso_pu_bacteria 8057874678 8057878697 246
297 3300006042 Ga0075368_10035238 Ga0075368_100352383 247
298 3300006048 Ga0075363_100059151 Ga0075363_1000591512 247
299 3300049579 Ga0501043_0069942 Ga0501043_0069942_666_1463 247
300 3300049585 Ga0501069_0137725 Ga0501069_0137725_462_1259 247
301 3300049586 Ga0501070_0162893 Ga0501070_0162893_544_1341 247
302 3300049823 Ga0501044_0364578 Ga0501044_0364578_462_1259 247
303 3300050490 nmdc:mga03n38_168995_c1 nmdc:mga03n38_168995_c1_118_927 247
304 iso_pu_bacteria 2510917028 2511185326 247
305 iso_pu_bacteria 2513237088 2513595613 247
306 iso_pu_bacteria 2513237090 2513608777 247
307 iso_pu_bacteria 2513237138 2513865362 247
308 iso_pu_bacteria 2534681796 2535514574 247
309 iso_pu_bacteria 2582581294 2585201281 247
310 iso_pu_bacteria 2582581304 2585256424 247
311 iso_pu_bacteria 2582581867 2585399100 247
312 iso_pu_bacteria 2585427590 2585818750 247
313 iso_pu_bacteria 2599185301 2599936522 247
314 iso_pu_bacteria 2643221653 2644298211 247
315 iso_pu_bacteria 2643221719 2644656463 247
316 iso_pu_bacteria 2693429783 2694628810 247
317 iso_pu_bacteria 2693429784 2694637276 247
318 iso_pu_bacteria 2818991272 2819244208 247
319 iso_pu_bacteria 2856364286 2856367940 247
320 iso_pu_bacteria 2857349434 2857351937 247
321 iso_pu_bacteria 2869285874 2869290441 247
322 iso_pu_bacteria 2871429161 2871432725 247
323 iso_pu_bacteria 2874155637 2874160092 247
324 iso_pu_bacteria 2876377896 2876379857 247
325 iso_pu_bacteria 2876413966 2876418608 247
326 iso_pu_bacteria 2878745973 2878750339 247
327 iso_pu_bacteria 2888350351 2888355042 247
328 iso_pu_bacteria 2903492973 2903499993 247
329 iso_pu_bacteria 2906308376 2906312697 247
330 iso_pu_bacteria 2906321335 2906325406 247
331 iso_pu_bacteria 2906354277 2906360034 247
332 iso_pu_bacteria 2922185730 2922192928 247
333 iso_pu_bacteria 2923556063 2923556181 247
334 iso_pu_bacteria 2937813078 2937819158 247
335 iso_pu_bacteria 2958130278 2958134829 247
336 iso_pu_bacteria 2958179912 2958186391 247
337 iso_pu_bacteria 2961077736 2961084890 247
338 iso_pu_bacteria 2968117919 2968119182 247
339 iso_pu_bacteria 2977843712 2977848485 247
340 iso_pu_bacteria 2977942078 2977944893 247
341 iso_pu_bacteria 2977971508 2977977942 247
342 iso_pu_bacteria 2987636660 2987639121 247
343 iso_pu_bacteria 2989776772 2989776831 247
344 iso_pu_bacteria 2996887358 2996887968 247
345 iso_pu_bacteria 3004203850 3004204636 247
346 iso_pu_bacteria 3005409236 3005410635 247
347 iso_pu_bacteria 3005452660 3005456332 247
348 iso_pu_bacteria 8004387939 8004392647 247
349 iso_pu_bacteria 8004640170 8004645254 247
350 iso_pu_bacteria 8004714634 8004718956 247
351 iso_pu_bacteria 8005246636 8005247886 247
352 iso_pu_bacteria 8005258706 8005261466 247
353 iso_pu_bacteria 8005321885 8005322495 247
354 iso_pu_bacteria 8005542996 8005543234 247
355 3300003187 JGI25151J46595_10039452 JGI25151J46595_100394522 248
356 3300003215 JGI25153J46596_10032236 JGI25153J46596_100322362 248
357 3300003771 Ga0055526_1005787 Ga0055526_10057875 248
358 3300003775 Ga0055524_1012492 Ga0055524_10124922 248
359 3300003790 Ga0055528_1001190 Ga0055528_10011904 248
360 3300003792 Ga0055540_1001653 Ga0055540_10016535 248
361 3300003792 Ga0055540_1022741 Ga0055540_10227412 248
362 3300006048 Ga0075363_100023482 Ga0075363_1000234824 248
363 3300025230 Ga0209563_107279 Ga0209563_1072793 248
364 3300025258 Ga0209129_1001848 Ga0209129_10018486 248
365 3300025273 Ga0209673_1000911 Ga0209673_100091134 248
366 3300025273 Ga0209673_1002137 Ga0209673_10021376 248
367 3300025273 Ga0209673_1013102 Ga0209673_10131023 248
368 3300025294 Ga0209025_1015100 Ga0209025_10151004 248
369 3300025295 Ga0209564_1000486 Ga0209564_100048616 248
370 3300025297 Ga0209758_1003684 Ga0209758_100368410 248
371 3300025297 Ga0209758_1009179 Ga0209758_10091796 248
372 3300025298 Ga0209050_1006063 Ga0209050_10060635 248
373 3300025299 Ga0209256_1011210 Ga0209256_10112104 248
374 3300025303 Ga0209051_1000170 Ga0209051_100017086 248
375 3300025303 Ga0209051_1027111 Ga0209051_10271112 248
376 3300025304 Ga0209257_1007148 Ga0209257_10071483 248
377 3300025901 Ga0207688_10199146 Ga0207688_101991462 248
378 3300028794 Ga0307515_10316134 Ga0307515_103161342 248
379 3300041413 Ga0439465_0094693 Ga0439465_0094693_26_826 248
380 3300041458 Ga0451798_0437084 Ga0451798_0437084_146_946 248
381 3300041491 Ga0451833_0309501 Ga0451833_0309501_120_920 248
382 3300041496 Ga0451839_1518067 Ga0451839_1518067_288_1088 248
383 3300041498 Ga0451841_0823007 Ga0451841_0823007_68_868 248
384 3300041501 Ga0451845_0491534 Ga0451845_0491534_68_868 248
385 3300041503 Ga0451847_0530648 Ga0451847_0530648_86_886 248
386 3300041505 Ga0451849_1413814 Ga0451849_1413814_66_866 248
387 3300042007 Ga0439449_0036973 Ga0439449_0036973_121_921 248
388 3300046460 Ga0495638_0043090 Ga0495638_0043090_1956_2756 248
389 3300046474 Ga0495605_0041550 Ga0495605_0041550_1440_2240 248
390 3300046501 Ga0495607_0024783 Ga0495607_0024783_996_1796 248
391 3300046507 Ga0495606_0077288 Ga0495606_0077288_1100_1900 248
392 3300046512 Ga0495610_0037953 Ga0495610_0037953_297_1097 248
393 3300046515 Ga0495620_0041131 Ga0495620_0041131_101_901 248
394 3300046519 Ga0495632_0024308 Ga0495632_0024308_117_917 248
395 3300046522 Ga0495643_0036691 Ga0495643_0036691_1486_2286 248
396 3300046538 Ga0495609_0022681 Ga0495609_0022681_1797_2597 248
397 3300046660 Ga0495625_0095479 Ga0495625_0095479_544_1344 248
398 3300046692 Ga0495671_0106694 Ga0495671_0106694_308_1102 248
399 3300046694 Ga0495649_0023374 Ga0495649_0023374_1852_2652 248
400 3300047472 Ga0495686_0020721 Ga0495686_0020721_2350_3150 248
401 3300048921 Ga0496118_0017956 Ga0496118_0017956_2431_3231 248
402 3300049570 Ga0501033_0000260 Ga0501033_0000260_13863_14663 248
403 3300049822 Ga0501035_0001226 Ga0501035_0001226_18222_19022 248
404 3300050495 nmdc:mga04h51_13917_c1 nmdc:mga04h51_13917_c1_1382_2182 248
405 3300053086 Ga0500578_0072312 Ga0500578_0072312_849_1649 248
406 3300053134 Ga0500658_0009920 Ga0500658_0009920_2240_3040 248
407 3300053153 Ga0500616_0007056 Ga0500616_0007056_6145_6945 248
408 3300053158 Ga0500627_0037793 Ga0500627_0037793_145_945 248
409 iso_pu_bacteria 2510461069 2510838861 248
410 iso_pu_bacteria 2513237144 2513910998 248
411 iso_pu_bacteria 2513237146 2513924306 248
412 iso_pu_bacteria 2519899620 2520379181 248
413 iso_pu_bacteria 2524023209 2524461871 248
414 iso_pu_bacteria 2582581299 2585230949 248
415 iso_pu_bacteria 2582581308 2585283170 248
416 iso_pu_bacteria 2582581315 2585328201 248
417 iso_pu_bacteria 2582581316 2585330613 248
418 iso_pu_bacteria 2585427527 2585536018 248
419 iso_pu_bacteria 2585427530 2585556654 248
420 iso_pu_bacteria 2597489875 2597810915 248
421 iso_pu_bacteria 2599185170 2599419736 248
422 iso_pu_bacteria 2615840624 2616293961 248
423 iso_pu_bacteria 2615840626 2616311187 248
424 iso_pu_bacteria 2615840698 2616556079 248
425 iso_pu_bacteria 2617270742 2617380722 248
426 iso_pu_bacteria 2643221551 2643776674 248
427 iso_pu_bacteria 2643221555 2643795122 248
428 iso_pu_bacteria 2643221599 2644004417 248
429 iso_pu_bacteria 2643221623 2644133877 248
430 iso_pu_bacteria 2643221634 2644191215 248
431 iso_pu_bacteria 2643221643 2644237665 248
432 iso_pu_bacteria 2667528174 2671115836 248
433 iso_pu_bacteria 2718217882 2719183332 248
434 iso_pu_bacteria 2718218009 2719734049 248
435 iso_pu_bacteria 2718218363 2721149444 248
436 iso_pu_bacteria 2718218365 2721160847 248
437 iso_pu_bacteria 2718218366 2721166281 248
438 iso_pu_bacteria 2721755514 2722842451 248
439 iso_pu_bacteria 2721755810 2724046805 248
440 iso_pu_bacteria 2728369365 2730166567 248
441 iso_pu_bacteria 2728369397 2730300479 248
442 iso_pu_bacteria 2738541293 2738800769 248
443 iso_pu_bacteria 2775507049 2776915980 248
444 iso_pu_bacteria 2775507266 2778179507 248
445 iso_pu_bacteria 2791355260 2793323483 248
446 iso_pu_bacteria 2791355264 2793350287 248
447 iso_pu_bacteria 2818991448 2819608880 248
448 iso_pu_bacteria 2818991453 2819643305 248
449 iso_pu_bacteria 2837678835 2837679257 248
450 iso_pu_bacteria 2838022645 2838026845 248
451 iso_pu_bacteria 2838029111 2838033955 248
452 iso_pu_bacteria 2838035591 2838039731 248
453 iso_pu_bacteria 2838661181 2838664009 248
454 iso_pu_bacteria 2841734538 2841738025 248
455 iso_pu_bacteria 2842198810 2842202438 248
456 iso_pu_bacteria 2842298080 2842299937 248
457 iso_pu_bacteria 2842357229 2842359541 248
458 iso_pu_bacteria 2842475841 2842480701 248
459 iso_pu_bacteria 2842482326 2842487255 248
460 iso_pu_bacteria 2842502639 2842507256 248
461 iso_pu_bacteria 2842509118 2842514530 248
462 iso_pu_bacteria 2847670302 2847674926 248
463 iso_pu_bacteria 2852387548 2852387864 248
464 iso_pu_bacteria 2856314179 2856320645 248
465 iso_pu_bacteria 2856342000 2856345883 248
466 iso_pu_bacteria 2871474448 2871477418 248
467 iso_pu_bacteria 2871495908 2871499075 248
468 iso_pu_bacteria 2874102143 2874106505 248
469 iso_pu_bacteria 2876369609 2876374434 248
470 iso_pu_bacteria 2876392853 2876397913 248
471 iso_pu_bacteria 2878035449 2878036052 248
472 iso_pu_bacteria 2878760144 2878763274 248
473 iso_pu_bacteria 2878767105 2878770262 248
474 iso_pu_bacteria 2881147464 2881149806 248
475 iso_pu_bacteria 2881161766 2881166691 248
476 iso_pu_bacteria 2885305155 2885308210 248
477 iso_pu_bacteria 2885312484 2885312981 248
478 iso_pu_bacteria 2885326080 2885332741 248
479 iso_pu_bacteria 2885334103 2885334613 248
480 iso_pu_bacteria 2888343758 2888345782 248
481 iso_pu_bacteria 2899803654 2899805886 248
482 iso_pu_bacteria 2903540706 2903543877 248
483 iso_pu_bacteria 2904659560 2904664564 248
484 iso_pu_bacteria 2906328253 2906330790 248
485 iso_pu_bacteria 2906414383 2906419906 248
486 iso_pu_bacteria 2919408235 2919408328 248
487 iso_pu_bacteria 2924762789 2924767074 248
488 iso_pu_bacteria 2936381700 2936385261 248
489 iso_pu_bacteria 2937822353 2937827704 248
490 iso_pu_bacteria 2937836603 2937837329 248
491 iso_pu_bacteria 2937891427 2937893357 248
492 iso_pu_bacteria 2937994558 2937997726 248
493 iso_pu_bacteria 2958071322 2958073918 248
494 iso_pu_bacteria 2958115193 2958121086 248
495 iso_pu_bacteria 2958165035 2958168199 248
496 iso_pu_bacteria 2961114664 2961119563 248
497 iso_pu_bacteria 2961163497 2961166665 248
498 iso_pu_bacteria 2965018300 2965021488 248
499 iso_pu_bacteria 2965062239 2965064599 248
500 iso_pu_bacteria 2968091066 2968094664 248
501 iso_pu_bacteria 2968097103 2968098042 248
502 iso_pu_bacteria 2968110612 2968115818 248
503 iso_pu_bacteria 2968171901 2968175070 248
504 iso_pu_bacteria 2970524798 2970527254 248
505 iso_pu_bacteria 2970540015 2970541874 248
506 iso_pu_bacteria 2970554993 2970558119 248
507 iso_pu_bacteria 2977858184 2977864440 248
508 iso_pu_bacteria 2977864932 2977865066 248
509 iso_pu_bacteria 2979779861 2979786486 248
510 iso_pu_bacteria 2987659509 2987662677 248
511 iso_pu_bacteria 2987666974 2987671560 248
512 iso_pu_bacteria 2989771324 2989774544 248
513 iso_pu_bacteria 2996310559 2996311896 248
514 iso_pu_bacteria 2996893221 2996897599 248
515 iso_pu_bacteria 3004188549 3004191727 248
516 iso_pu_bacteria 3005416602 3005423299 248
517 iso_pu_bacteria 8004395343 8004396203 248
518 iso_pu_bacteria 8004445564 8004445985 248
519 iso_pu_bacteria 8004633249 8004636501 248
520 iso_pu_bacteria 8004703790 8004712161 248
521 iso_pu_bacteria 8005301065 8005305479 248
522 iso_pu_bacteria 8005314921 8005315626 248
523 iso_pu_bacteria 8005376324 8005378098 248
524 iso_pu_bacteria 8005484373 8005484467 248
525 iso_pu_bacteria 8005645114 8005647387 248
526 iso_pu_bacteria 8005682033 8005687457 248
527 iso_pu_bacteria 8005688590 8005692769 248
528 iso_pu_bacteria 8018127388 8018132537 248
529 iso_pu_bacteria 8024486573 8024488591 248
530 iso_pu_bacteria 8046767195 8046768681 248
531 iso_pu_bacteria 8055617313 8055619338 248
532 iso_pu_bacteria 8057575449 8057582456 248
533 3300002773 JGI25152J39213_1023689 JGI25152J39213_10236892 249
534 3300002774 JGI25150J39212_1009522 JGI25150J39212_10095222 249
535 3300003187 JGI25151J46595_10000660 JGI25151J46595_100006604 249
536 3300003187 JGI25151J46595_10001587 JGI25151J46595_1000158716 249
537 3300003187 JGI25151J46595_10031068 JGI25151J46595_100310683 249
538 3300003215 JGI25153J46596_10011601 JGI25153J46596_100116012 249
539 3300003354 JGI25160J50197_1003769 JGI25160J50197_10037695 249
540 3300003771 Ga0055526_1012978 Ga0055526_10129784 249
541 3300003856 Ga0058692_1002936 Ga0058692_10029366 249
542 3300005455 Ga0070663_100051355 Ga0070663_1000513553 249
543 3300005577 Ga0068857_100483178 Ga0068857_1004831782 249
544 3300006038 Ga0075365_10004347 Ga0075365_100043473 249
545 3300006038 Ga0075365_10017265 Ga0075365_100172653 249
546 3300006042 Ga0075368_10001589 Ga0075368_100015895 249
547 3300006042 Ga0075368_10024080 Ga0075368_100240804 249
548 3300006051 Ga0075364_10042363 Ga0075364_100423632 249
549 3300006177 Ga0075362_10001417 Ga0075362_100014174 249
550 3300006177 Ga0075362_10092727 Ga0075362_100927273 249
551 3300006178 Ga0075367_10018946 Ga0075367_100189464 249
552 3300006195 Ga0075366_10024153 Ga0075366_100241533 249
553 3300006353 Ga0075370_10000842 Ga0075370_1000084212 249
554 3300006353 Ga0075370_10037597 Ga0075370_100375973 249
555 3300006946 Ga0079104_1000082 Ga0079104_100008295 249
556 3300006948 Ga0099826_10006060 Ga0099826_100060605 249
557 3300006948 Ga0099826_10097192 Ga0099826_100971922 249
558 3300009148 Ga0105243_10003711 Ga0105243_100037116 249
559 3300009765 Ga0123341_1057766 Ga0123341_10577662 249
560 3300009766 Ga0123342_1010090 Ga0123342_101009011 249
561 3300011119 Ga0105246_10185777 Ga0105246_101857772 249
562 3300013102 Ga0157371_10000004 Ga0157371_1000000469 249
563 3300013104 Ga0157370_10001047 Ga0157370_1000104715 249
564 3300025245 Ga0207425_1001736 Ga0207425_10017364 249
565 3300025258 Ga0209129_1006820 Ga0209129_10068205 249
566 3300025273 Ga0209673_1002283 Ga0209673_100228310 249
567 3300025294 Ga0209025_1000274 Ga0209025_100027433 249
568 3300025294 Ga0209025_1000377 Ga0209025_100037742 249
569 3300025294 Ga0209025_1000553 Ga0209025_100055314 249
570 3300025295 Ga0209564_1000474 Ga0209564_100047455 249
571 3300025297 Ga0209758_1000971 Ga0209758_10009716 249
572 3300025299 Ga0209256_1003327 Ga0209256_10033277 249
573 3300025302 Ga0207426_1000142 Ga0207426_1000142111 249
574 3300025935 Ga0207709_10231419 Ga0207709_102314191 249
575 3300026067 Ga0207678_10046447 Ga0207678_100464473 249
576 3300026116 Ga0207674_10144852 Ga0207674_101448523 249
577 3300026116 Ga0207674_10877123 Ga0207674_108771231 249
578 3300027111 Ga0209281_1000043 Ga0209281_100004392 249
579 3300027312 Ga0209371_1000009 Ga0209371_1000009925 249
580 3300027312 Ga0209371_1000569 Ga0209371_10005697 249
581 3300027312 Ga0209371_1000597 Ga0209371_100059726 249
582 3300027666 Ga0209282_1015117 Ga0209282_10151175 249
583 3300027866 Ga0209813_10015632 Ga0209813_100156323 249
584 3300028379 Ga0268266_10204443 Ga0268266_102044432 249
585 3300030500 Ga0268256_1000010 Ga0268256_1000010924 249
586 3300030500 Ga0268256_1003954 Ga0268256_10039547 249
587 3300038443 Ga0395901_0040590 Ga0395901_0040590_79_882 249
588 3300046492 Ga0495585_0048677 Ga0495585_0048677_1419_2219 249
589 3300046530 Ga0495654_0000314 Ga0495654_0000314_9279_10076 249
590 3300046558 Ga0495633_0016834 Ga0495633_0016834_2544_3344 249
591 3300046558 Ga0495633_0036013 Ga0495633_0036013_761_1561 249
592 3300046660 Ga0495625_0091282 Ga0495625_0091282_609_1409 249
593 3300046665 Ga0495661_0014352 Ga0495661_0014352_3982_4782 249
594 3300046691 Ga0495670_0071710 Ga0495670_0071710_803_1603 249
595 3300046692 Ga0495671_0014249 Ga0495671_0014249_2897_3697 249
596 3300047470 Ga0495681_0009496 Ga0495681_0009496_3827_4627 249
597 3300048916 Ga0496113_0037980 Ga0496113_0037980_35_835 249
598 3300048919 Ga0496116_0018149 Ga0496116_0018149_827_1627 249
599 3300048920 Ga0496117_0000002 Ga0496117_0000002_2411600_2412400 249
600 3300048920 Ga0496117_0002038 Ga0496117_0002038_4483_5283 249
601 3300048920 Ga0496117_0023070 Ga0496117_0023070_3842_4642 249
602 3300048920 Ga0496117_0031006 Ga0496117_0031006_2939_3739 249
603 3300048921 Ga0496118_0001167 Ga0496118_0001167_31882_32682 249
604 3300048921 Ga0496118_0122183 Ga0496118_0122183_690_1490 249
605 3300048922 Ga0496119_0026777 Ga0496119_0026777_487_1287 249
606 3300048922 Ga0496119_0047803 Ga0496119_0047803_1498_2298 249
607 3300048922 Ga0496119_0099572 Ga0496119_0099572_249_1100 249
608 3300048923 Ga0496120_0002729 Ga0496120_0002729_7732_8532 249
609 3300048923 Ga0496120_0015943 Ga0496120_0015943_1416_2216 249
610 3300048923 Ga0496120_0020218 Ga0496120_0020218_1285_2085 249
611 3300048924 Ga0496121_0000001 Ga0496121_0000001_325491_326291 249
612 3300048925 Ga0496122_0000001 Ga0496122_0000001_1755608_1756408 249
613 3300048925 Ga0496122_0000321 Ga0496122_0000321_50854_51654 249
614 3300048926 Ga0496123_0000001 Ga0496123_0000001_1759339_1760139 249
615 3300048926 Ga0496123_0000454 Ga0496123_0000454_53695_54495 249
616 3300048926 Ga0496123_0004823 Ga0496123_0004823_3029_3826 249
617 3300048927 Ga0496124_0000558 Ga0496124_0000558_12866_13666 249
618 3300048927 Ga0496124_0006480 Ga0496124_0006480_6603_7403 249
619 3300048927 Ga0496124_0043463 Ga0496124_0043463_761_1558 249
620 3300048927 Ga0496124_0046414 Ga0496124_0046414_1390_2190 249
621 3300048928 Ga0496125_0000001 Ga0496125_0000001_437520_438320 249
622 3300048928 Ga0496125_0000628 Ga0496125_0000628_40959_41759 249
623 3300048928 Ga0496125_0006658 Ga0496125_0006658_4707_5507 249
624 3300048928 Ga0496125_0090571 Ga0496125_0090571_1316_2116 249
625 3300048929 Ga0496126_0000378 Ga0496126_0000378_53370_54170 249
626 3300048929 Ga0496126_0063882 Ga0496126_0063882_17_817 249
627 3300048929 Ga0496126_0243423 Ga0496126_0243423_469_1269 249
628 3300048929 Ga0496126_0306012 Ga0496126_0306012_410_1210 249
629 3300049568 Ga0501031_0004927 Ga0501031_0004927_2106_2903 249
630 3300049569 Ga0501032_0051426 Ga0501032_0051426_392_1189 249
631 3300049570 Ga0501033_0000461 Ga0501033_0000461_18832_19629 249
632 3300049573 Ga0501037_0000154 Ga0501037_0000154_5682_6479 249
633 3300049573 Ga0501037_0082837 Ga0501037_0082837_791_1588 249
634 3300049574 Ga0501038_0576400 Ga0501038_0576400_25_822 249
635 3300049575 Ga0501039_0139292 Ga0501039_0139292_199_996 249
636 3300049579 Ga0501043_0000007 Ga0501043_0000007_76025_76822 249
637 3300049579 Ga0501043_0159911 Ga0501043_0159911_497_1294 249
638 3300049580 Ga0501046_0191544 Ga0501046_0191544_28_825 249
639 3300049581 Ga0501047_0092531 Ga0501047_0092531_499_1296 249
640 3300049581 Ga0501047_0127106 Ga0501047_0127106_149_946 249
641 3300049584 Ga0501068_0021893 Ga0501068_0021893_1301_2098 249
642 3300049585 Ga0501069_0000027 Ga0501069_0000027_29391_30188 249
643 3300049586 Ga0501070_0000231 Ga0501070_0000231_32015_32812 249
644 3300049586 Ga0501070_0034270 Ga0501070_0034270_267_1064 249
645 3300049586 Ga0501070_0493250 Ga0501070_0493250_43_840 249
646 3300049589 Ga0501073_0038563 Ga0501073_0038563_691_1488 249
647 3300049590 Ga0501074_0000023 Ga0501074_0000023_19642_20439 249
648 3300049592 Ga0501076_0217993 Ga0501076_0217993_377_1174 249
649 3300049742 Ga0501080_0000300 Ga0501080_0000300_17409_18206 249
650 3300049744 Ga0501083_0000012 Ga0501083_0000012_101690_102487 249
651 3300049822 Ga0501035_0000073 Ga0501035_0000073_103524_104321 249
652 3300049822 Ga0501035_0066684 Ga0501035_0066684_1866_2663 249
653 3300049822 Ga0501035_0071499 Ga0501035_0071499_1062_1859 249
654 3300049823 Ga0501044_0000118 Ga0501044_0000118_18369_19166 249
655 3300049823 Ga0501044_0054362 Ga0501044_0054362_1395_2192 249
656 3300049823 Ga0501044_0462262 Ga0501044_0462262_228_1025 249
657 3300050489 nmdc:mga03683_203753_c1 nmdc:mga03683_203753_c1_20_820 249
658 3300050489 nmdc:mga03683_6637_c1 nmdc:mga03683_6637_c1_2333_3133 249
659 3300050490 nmdc:mga03n38_234855_c1 nmdc:mga03n38_234855_c1_90_890 249
660 3300050491 nmdc:mga00v17_611_c1 nmdc:mga00v17_611_c1_17419_18219 249
661 3300050492 nmdc:mga0yw44_2319_c1 nmdc:mga0yw44_2319_c1_7179_7979 249
662 3300050493 nmdc:mga0k408_10280_c1 nmdc:mga0k408_10280_c1_3183_3983 249
663 3300050494 nmdc:mga06z11_36763_c1 nmdc:mga06z11_36763_c1_1466_2266 249
664 3300053125 Ga0500618_000203 Ga0500618_000203_35770_36567 249
665 3300053125 Ga0500618_021138 Ga0500618_021138_593_1390 249
666 3300053137 Ga0500561_0000139 Ga0500561_0000139_7056_7856 249
667 3300053157 Ga0500624_002343 Ga0500624_002343_1505_2305 249
668 3300053161 Ga0500634_0049682 Ga0500634_0049682_369_1169 249
669 3300053177 Ga0500636_0000022 Ga0500636_0000022_89149_89949 249
670 3300053177 Ga0500636_0001307 Ga0500636_0001307_9242_10042 249
671 iso_pu_bacteria 2508501123 2509114670 249
672 iso_pu_bacteria 2509276018 2509369674 249
673 iso_pu_bacteria 2509276022 2509394771 249
674 iso_pu_bacteria 2510065059 2510318629 249
675 iso_pu_bacteria 2512875016 2512932689 249
676 iso_pu_bacteria 2512875024 2512960746 249
677 iso_pu_bacteria 2588253730 2588518775 249
678 iso_pu_bacteria 2643221595 2643987466 249
679 iso_pu_bacteria 2643221627 2644158014 249
680 iso_pu_bacteria 2687453392 2688597107 249
681 iso_pu_bacteria 2756170246 2756671181 249
682 iso_pu_bacteria 2791355123 2792748138 249
683 iso_pu_bacteria 2844002411 2844008825 249
684 iso_pu_bacteria 2844009547 2844012463 249
685 iso_pu_bacteria 2856320880 2856322952 249
686 iso_pu_bacteria 2856328259 2856334727 249
687 iso_pu_bacteria 2856334872 2856339617 249
688 iso_pu_bacteria 2856349417 2856349430 249
689 iso_pu_bacteria 2869162929 2869164779 249
690 iso_pu_bacteria 2869169390 2869173043 249
691 iso_pu_bacteria 2869234852 2869241470 249
692 iso_pu_bacteria 2869242130 2869244879 249
693 iso_pu_bacteria 2869249662 2869254131 249
694 iso_pu_bacteria 2869256925 2869259748 249
695 iso_pu_bacteria 2869264136 2869271105 249
696 iso_pu_bacteria 2869271264 2869276576 249
697 iso_pu_bacteria 2869278585 2869282504 249
698 iso_pu_bacteria 2871435913 2871437390 249
699 iso_pu_bacteria 2871451962 2871454229 249
700 iso_pu_bacteria 2871459585 2871466490 249
701 iso_pu_bacteria 2871466892 2871474301 249
702 iso_pu_bacteria 2871481445 2871484905 249
703 iso_pu_bacteria 2871488783 2871493335 249
704 iso_pu_bacteria 2874109183 2874111837 249
705 iso_pu_bacteria 2874116593 2874117156 249
706 iso_pu_bacteria 2874123672 2874126707 249
707 iso_pu_bacteria 2874131515 2874134939 249
708 iso_pu_bacteria 2874139085 2874142159 249
709 iso_pu_bacteria 2874162495 2874168095 249
710 iso_pu_bacteria 2874168670 2874174925 249
711 iso_pu_bacteria 2876363079 2876365059 249
712 iso_pu_bacteria 2876386047 2876386761 249
713 iso_pu_bacteria 2876399893 2876402721 249
714 iso_pu_bacteria 2876406927 2876407866 249
715 iso_pu_bacteria 2876420981 2876423015 249
716 iso_pu_bacteria 2878730984 2878733980 249
717 iso_pu_bacteria 2878738818 2878744655 249
718 iso_pu_bacteria 2878753008 2878757379 249
719 iso_pu_bacteria 2878774303 2878779744 249
720 iso_pu_bacteria 2878781027 2878785281 249
721 iso_pu_bacteria 2881155292 2881160951 249
722 iso_pu_bacteria 2881845957 2881848451 249
723 iso_pu_bacteria 2881853255 2881857243 249
724 iso_pu_bacteria 2881861095 2881868938 249
725 iso_pu_bacteria 2882912400 2882912660 249
726 iso_pu_bacteria 2885318864 2885321870 249
727 iso_pu_bacteria 2885342637 2885342853 249
728 iso_pu_bacteria 2885350715 2885353513 249
729 iso_pu_bacteria 2888337043 2888338186 249
730 iso_pu_bacteria 2903448605 2903450069 249
731 iso_pu_bacteria 2903492973 2903501107 249
732 iso_pu_bacteria 2903513507 2903520815 249
733 iso_pu_bacteria 2903521522 2903522206 249
734 iso_pu_bacteria 2903528002 2903528584 249
735 iso_pu_bacteria 2906363423 2906367501 249
736 iso_pu_bacteria 2906370794 2906373657 249
737 iso_pu_bacteria 2906378014 2906384463 249
738 iso_pu_bacteria 2906386501 2906391219 249
739 iso_pu_bacteria 2906393657 2906399469 249
740 iso_pu_bacteria 2906401398 2906401458 249
741 iso_pu_bacteria 2906408224 2906411007 249
742 iso_pu_bacteria 2906427513 2906432720 249
743 iso_pu_bacteria 2922151315 2922157139 249
744 iso_pu_bacteria 2922172374 2922172874 249
745 iso_pu_bacteria 2924710171 2924714854 249
746 iso_pu_bacteria 2924718760 2924725453 249
747 iso_pu_bacteria 2924733363 2924738036 249
748 iso_pu_bacteria 2924748358 2924749758 249
749 iso_pu_bacteria 2924776078 2924782685 249
750 iso_pu_bacteria 2924784321 2924786685 249
751 iso_pu_bacteria 2937848649 2937852167 249
752 iso_pu_bacteria 2937861824 2937863095 249
753 iso_pu_bacteria 2937868953 2937873092 249
754 iso_pu_bacteria 2937877337 2937881330 249
755 iso_pu_bacteria 2937972304 2937977422 249
756 iso_pu_bacteria 2937980651 2937984508 249
757 iso_pu_bacteria 2958034702 2958039286 249
758 iso_pu_bacteria 2958041894 2958053084 249
759 iso_pu_bacteria 2958064165 2958070482 249
760 iso_pu_bacteria 2958084443 2958088113 249
761 iso_pu_bacteria 2958092219 2958094120 249
762 iso_pu_bacteria 2958108152 2958110099 249
763 iso_pu_bacteria 2958122699 2958127419 249
764 iso_pu_bacteria 2958137437 2958143081 249
765 iso_pu_bacteria 2958144490 2958148863 249
766 iso_pu_bacteria 2958158011 2958164469 249
767 iso_pu_bacteria 2961127735 2961130872 249
768 iso_pu_bacteria 2961136820 2961140618 249
769 iso_pu_bacteria 2961170736 2961175292 249
770 iso_pu_bacteria 2961183825 2961186024 249
771 iso_pu_bacteria 2963644680 2963646514 249
772 iso_pu_bacteria 2965025482 2965027482 249
773 iso_pu_bacteria 2965032056 2965037944 249
774 iso_pu_bacteria 2965040258 2965042159 249
775 iso_pu_bacteria 2965047637 2965049605 249
776 iso_pu_bacteria 2965089291 2965091980 249
777 iso_pu_bacteria 2965110997 2965114393 249
778 iso_pu_bacteria 2967996073 2967999707 249
779 iso_pu_bacteria 2968003550 2968008065 249
780 iso_pu_bacteria 2968016561 2968020611 249
781 iso_pu_bacteria 2968083720 2968090684 249
782 iso_pu_bacteria 2968138860 2968140370 249
783 iso_pu_bacteria 2970469710 2970473908 249
784 iso_pu_bacteria 2970489779 2970490569 249
785 iso_pu_bacteria 2970503327 2970507880 249
786 iso_pu_bacteria 2970510686 2970514364 249
787 iso_pu_bacteria 2970532167 2970535922 249
788 iso_pu_bacteria 2970547951 2970548545 249
789 iso_pu_bacteria 2970593180 2970597113 249
790 iso_pu_bacteria 2970619444 2970623537 249
791 iso_pu_bacteria 2970627176 2970627662 249
792 iso_pu_bacteria 2977821940 2977826538 249
793 iso_pu_bacteria 2977851361 2977856009 249
794 iso_pu_bacteria 2977872689 2977880146 249
795 iso_pu_bacteria 2977898635 2977899149 249
796 iso_pu_bacteria 2977907340 2977912292 249
797 iso_pu_bacteria 2977915119 2977916494 249
798 iso_pu_bacteria 2977922695 2977926138 249
799 iso_pu_bacteria 2977935797 2977938052 249
800 iso_pu_bacteria 2977950692 2977956074 249
801 iso_pu_bacteria 2977986579 2977988620 249
802 iso_pu_bacteria 2979764755 2979771804 249
803 iso_pu_bacteria 2979772303 2979774721 249
804 iso_pu_bacteria 2979793036 2979798947 249
805 iso_pu_bacteria 2979808191 2979813064 249
806 iso_pu_bacteria 2987645492 2987651163 249
807 iso_pu_bacteria 2987673487 2987679866 249
808 iso_pu_bacteria 2996348954 2996352771 249
809 iso_pu_bacteria 2996386984 2996387326 249
810 iso_pu_bacteria 3004167301 3004167502 249
811 iso_pu_bacteria 3004195979 3004196234 249
812 iso_pu_bacteria 3004211236 3004217921 249
813 iso_pu_bacteria 3004218560 3004221031 249
814 iso_pu_bacteria 3004232784 3004238621 249
815 iso_pu_bacteria 3004248173 3004253093 249
816 iso_pu_bacteria 3004268573 3004274057 249
817 iso_pu_bacteria 3004275668 3004279453 249
818 iso_pu_bacteria 3004289098 3004293411 249
819 iso_pu_bacteria 3004334049 3004335901 249
820 iso_pu_bacteria 637000159 637075773 249
821 iso_pu_bacteria 649633066 649871663 249
822 iso_pu_bacteria 8004300914 8004301519 249
823 iso_pu_bacteria 8004361976 8004367006 249
824 iso_pu_bacteria 8004374579 8004378954 249
825 iso_pu_bacteria 8004695233 8004701560 249
826 3300006038 Ga0075365_10190669 Ga0075365_101906692 250
827 3300009093 Ga0105240_10563129 Ga0105240_105631292 250
828 3300013100 Ga0157373_10018682 Ga0157373_100186823 250
829 3300025919 Ga0207657_10211893 Ga0207657_102118931 250
830 3300041413 Ga0439465_0004289 Ga0439465_0004289_962_1771 250
831 3300042004 Ga0439445_0067743 Ga0439445_0067743_159_968 250
832 3300048924 Ga0496121_0107387 Ga0496121_0107387_1029_1838 250
833 3300001979 JGI24740J21852_10058101 JGI24740J21852_100581011 251
834 3300001989 JGI24739J22299_10020720 JGI24739J22299_100207202 251
835 3300002741 JGI25157J39369_1001767 JGI25157J39369_10017672 251
836 3300003214 JGI25165J46597_1000042 JGI25165J46597_100004223 251
837 3300003771 Ga0055526_1019223 Ga0055526_10192232 251
838 3300005539 Ga0068853_100006660 Ga0068853_1000066602 251
839 3300005577 Ga0068857_100493695 Ga0068857_1004936952 251
840 3300005614 Ga0068856_100314736 Ga0068856_1003147362 251
841 3300006178 Ga0075367_10004267 Ga0075367_100042675 251
842 3300006178 Ga0075367_10089976 Ga0075367_100899762 251
843 3300006178 Ga0075367_10204296 Ga0075367_102042962 251
844 3300009093 Ga0105240_10249736 Ga0105240_102497362 251
845 3300009093 Ga0105240_10398866 Ga0105240_103988662 251
846 3300009545 Ga0105237_10011413 Ga0105237_100114138 251
847 3300010375 Ga0105239_10048662 Ga0105239_100486625 251
848 3300025250 Ga0209026_1000029 Ga0209026_100002947 251
849 3300025256 Ga0209759_1000637 Ga0209759_100063727 251
850 3300025261 Ga0209233_1000028 Ga0209233_1000028319 251
851 3300025297 Ga0209758_1025882 Ga0209758_10258823 251
852 3300025904 Ga0207647_10058319 Ga0207647_100583193 251
853 3300025913 Ga0207695_10635585 Ga0207695_106355851 251
854 3300025914 Ga0207671_10023638 Ga0207671_100236384 251
855 3300025949 Ga0207667_10529655 Ga0207667_105296552 251
856 3300026041 Ga0207639_10473614 Ga0207639_104736142 251
857 3300026078 Ga0207702_10257221 Ga0207702_102572213 251
858 3300032002 Ga0307416_100409987 Ga0307416_1004099872 251
859 3300037418 Ga0395900_0293062 Ga0395900_0293062_729_1532 251
860 3300037418 Ga0395900_0318882 Ga0395900_0318882_87_890 251
861 3300037471 Ga0395905_0473627 Ga0395905_0473627_232_1035 251
862 3300044658 Ga0466972_0069426 Ga0466972_0069426_852_1655 251
863 3300044901 Ga0466960_0034427 Ga0466960_0034427_1102_1905 251
864 3300046507 Ga0495606_0005067 Ga0495606_0005067_4543_5346 251
865 3300046542 Ga0495597_0148905 Ga0495597_0148905_115_936 251
866 3300048904 Ga0496101_0192646 Ga0496101_0192646_445_1248 251
867 3300048905 Ga0496102_0169134 Ga0496102_0169134_640_1443 251
868 3300048906 Ga0496103_0188830 Ga0496103_0188830_13_816 251
869 3300048920 Ga0496117_0070695 Ga0496117_0070695_1036_1839 251
870 3300048922 Ga0496119_0014974 Ga0496119_0014974_3997_4800 251
871 3300048922 Ga0496119_0171840 Ga0496119_0171840_198_1001 251
872 3300048923 Ga0496120_0017924 Ga0496120_0017924_896_1699 251
873 3300048924 Ga0496121_0044238 Ga0496121_0044238_2737_3540 251
874 3300048928 Ga0496125_0049883 Ga0496125_0049883_584_1387 251
875 3300048928 Ga0496125_0197038 Ga0496125_0197038_279_1082 251
876 3300048929 Ga0496126_0177821 Ga0496126_0177821_403_1206 251
877 3300049570 Ga0501033_0181834 Ga0501033_0181834_688_1497 251
878 3300049571 Ga0501034_0636201 Ga0501034_0636201_79_888 251
879 3300049574 Ga0501038_0101706 Ga0501038_0101706_644_1453 251
880 3300049581 Ga0501047_0186069 Ga0501047_0186069_302_1111 251
881 3300049584 Ga0501068_0109855 Ga0501068_0109855_825_1634 251
882 3300049584 Ga0501068_0342680 Ga0501068_0342680_61_870 251
883 3300049586 Ga0501070_0250959 Ga0501070_0250959_590_1399 251
884 3300049742 Ga0501080_0164697 Ga0501080_0164697_230_1039 251
885 3300049823 Ga0501044_0306819 Ga0501044_0306819_206_1015 251
886 3300050494 nmdc:mga06z11_91619_c1 nmdc:mga06z11_91619_c1_249_1052 251
887 3300001979 JGI24740J21852_10012401 JGI24740J21852_100124014 252
888 3300002704 JGI25155J39150_1000110 JGI25155J39150_100011034 252
889 3300002705 JGI25156J39149_1000192 JGI25156J39149_100019235 252
890 3300002737 JGI25162J39368_1000302 JGI25162J39368_100030211 252
891 3300002737 JGI25162J39368_1001906 JGI25162J39368_10019067 252
892 3300002738 JGI25154J39366_1000196 JGI25154J39366_100019610 252
893 3300002741 JGI25157J39369_1000228 JGI25157J39369_100022810 252
894 3300002773 JGI25152J39213_1003523 JGI25152J39213_10035233 252
895 3300002987 JGI25159J45721_1000790 JGI25159J45721_100079016 252
896 3300003187 JGI25151J46595_10007774 JGI25151J46595_100077744 252
897 3300003187 JGI25151J46595_10010521 JGI25151J46595_100105212 252
898 3300003214 JGI25165J46597_1000390 JGI25165J46597_10003908 252
899 3300003214 JGI25165J46597_1001741 JGI25165J46597_10017417 252
900 3300003214 JGI25165J46597_1002721 JGI25165J46597_10027215 252
901 3300003316 rootH1_10050935 rootH1_100509353 252
902 3300003322 rootL2_10038374 rootL2_100383743 252
903 3300003354 JGI25160J50197_1000044 JGI25160J50197_1000044102 252
904 3300003374 JGI25161J50226_1000028 JGI25161J50226_100002837 252
905 3300003771 Ga0055526_1019212 Ga0055526_10192122 252
906 3300003775 Ga0055524_1004262 Ga0055524_10042624 252
907 3300003790 Ga0055528_1000113 Ga0055528_100011348 252
908 3300003856 Ga0058692_1002358 Ga0058692_10023586 252
909 3300004625 Ga0055543_1000054 Ga0055543_100005432 252
910 3300005262 Ga0065165_1000318 Ga0065165_100031831 252
911 3300005262 Ga0065165_1012288 Ga0065165_10122881 252
912 3300005331 Ga0070670_100000105 Ga0070670_10000010523 252
913 3300005367 Ga0070667_100596923 Ga0070667_1005969231 252
914 3300005563 Ga0068855_100128301 Ga0068855_1001283012 252
915 3300005614 Ga0068856_100169981 Ga0068856_1001699813 252
916 3300005616 Ga0068852_100018469 Ga0068852_1000184692 252
917 3300005834 Ga0068851_10037302 Ga0068851_100373022 252
918 3300006038 Ga0075365_10038035 Ga0075365_100380354 252
919 3300009093 Ga0105240_10001468 Ga0105240_1000146812 252
920 3300009177 Ga0105248_10054876 Ga0105248_100548765 252
921 3300009545 Ga0105237_10004445 Ga0105237_1000444510 252
922 3300010375 Ga0105239_10046215 Ga0105239_100462154 252
923 3300010375 Ga0105239_10328115 Ga0105239_103281152 252
924 3300013104 Ga0157370_10001796 Ga0157370_1000179612 252
925 3300014497 Ga0182008_10087338 Ga0182008_100873382 252
926 3300014497 Ga0182008_10095812 Ga0182008_100958122 252
927 3300015261 Ga0182006_1020401 Ga0182006_10204014 252
928 3300025206 Ga0209435_100087 Ga0209435_10008710 252
929 3300025208 Ga0209436_112679 Ga0209436_1126792 252
930 3300025228 Ga0209672_105109 Ga0209672_1051093 252
931 3300025233 Ga0209437_100050 Ga0209437_10005077 252
932 3300025233 Ga0209437_100205 Ga0209437_10020580 252
933 3300025246 Ga0209646_1000285 Ga0209646_100028510 252
934 3300025250 Ga0209026_1000347 Ga0209026_100034710 252
935 3300025256 Ga0209759_1000482 Ga0209759_100048210 252
936 3300025258 Ga0209129_1000066 Ga0209129_1000066163 252
937 3300025261 Ga0209233_1000037 Ga0209233_1000037119 252
938 3300025261 Ga0209233_1000187 Ga0209233_1000187100 252
939 3300025261 Ga0209233_1000232 Ga0209233_100023257 252
940 3300025273 Ga0209673_1000024 Ga0209673_1000024101 252
941 3300025284 Ga0209130_1000093 Ga0209130_1000093102 252
942 3300025294 Ga0209025_1000275 Ga0209025_100027566 252
943 3300025294 Ga0209025_1008610 Ga0209025_10086105 252
944 3300025299 Ga0209256_1000868 Ga0209256_100086816 252
945 3300025302 Ga0207426_1000012 Ga0207426_1000012615 252
946 3300025303 Ga0209051_1037438 Ga0209051_10374382 252
947 3300025913 Ga0207695_10000427 Ga0207695_1000042783 252
948 3300025914 Ga0207671_10002841 Ga0207671_1000284112 252
949 3300025925 Ga0207650_10000302 Ga0207650_1000030224 252
950 3300025941 Ga0207711_10077431 Ga0207711_100774313 252
951 3300025981 Ga0207640_10650010 Ga0207640_106500101 252
952 3300025986 Ga0207658_10519032 Ga0207658_105190322 252
953 3300026078 Ga0207702_10034141 Ga0207702_100341414 252
954 3300027312 Ga0209371_1002100 Ga0209371_10021007 252
955 3300028379 Ga0268266_10085620 Ga0268266_100856203 252
956 3300030500 Ga0268256_1003765 Ga0268256_10037657 252
957 3300037466 Ga0395898_0214279 Ga0395898_0214279_730_1536 252
958 3300038443 Ga0395901_0102150 Ga0395901_0102150_1632_2438 252
959 3300038443 Ga0395901_0525704 Ga0395901_0525704_120_926 252
960 3300046452 Ga0495617_013045 Ga0495617_013045_151_960 252
961 3300046453 Ga0495627_028697 Ga0495627_028697_953_1759 252
962 3300046460 Ga0495638_0000566 Ga0495638_0000566_2191_3000 252
963 3300046471 Ga0495650_0027816 Ga0495650_0027816_573_1385 252
964 3300046474 Ga0495605_0009235 Ga0495605_0009235_2164_2973 252
965 3300046492 Ga0495585_0018694 Ga0495585_0018694_2550_3356 252
966 3300046492 Ga0495585_0047303 Ga0495585_0047303_1130_1939 252
967 3300046501 Ga0495607_0022489 Ga0495607_0022489_1477_2286 252
968 3300046501 Ga0495607_0191834 Ga0495607_0191834_35_841 252
969 3300046506 Ga0495583_0003929 Ga0495583_0003929_173_979 252
970 3300046506 Ga0495583_0019864 Ga0495583_0019864_1928_2737 252
971 3300046507 Ga0495606_0049724 Ga0495606_0049724_277_1083 252
972 3300046507 Ga0495606_0055336 Ga0495606_0055336_74_886 252
973 3300046513 Ga0495616_0025367 Ga0495616_0025367_1064_1873 252
974 3300046518 Ga0495631_0003763 Ga0495631_0003763_6159_6968 252
975 3300046519 Ga0495632_0012650 Ga0495632_0012650_2280_3089 252
976 3300046522 Ga0495643_0109703 Ga0495643_0109703_80_889 252
977 3300046615 Ga0495656_0007518 Ga0495656_0007518_2596_3402 252
978 3300046616 Ga0495668_0011736 Ga0495668_0011736_2449_3258 252
979 3300046616 Ga0495668_0210932 Ga0495668_0210932_213_1019 252
980 3300046648 Ga0495611_0009426 Ga0495611_0009426_1307_2116 252
981 3300046660 Ga0495625_0023496 Ga0495625_0023496_1659_2468 252
982 3300046660 Ga0495625_0049188 Ga0495625_0049188_1316_2122 252
983 3300046665 Ga0495661_0270325 Ga0495661_0270325_34_840 252
984 3300046691 Ga0495670_0032614 Ga0495670_0032614_1276_2082 252
985 3300047318 Ga0495636_0114020 Ga0495636_0114020_136_945 252
986 3300047472 Ga0495686_0182194 Ga0495686_0182194_218_1024 252
987 3300048911 Ga0496108_0453277 Ga0496108_0453277_265_1074 252
988 3300048915 Ga0496112_0004626 Ga0496112_0004626_1656_2465 252
989 3300048920 Ga0496117_0005456 Ga0496117_0005456_8170_8976 252
990 3300048921 Ga0496118_0060628 Ga0496118_0060628_1412_2221 252
991 3300048924 Ga0496121_0056726 Ga0496121_0056726_123_932 252
992 3300048924 Ga0496121_0139533 Ga0496121_0139533_175_984 252
993 3300048925 Ga0496122_0141991 Ga0496122_0141991_533_1342 252
994 3300048926 Ga0496123_0139316 Ga0496123_0139316_209_1018 252
995 3300048929 Ga0496126_0421783 Ga0496126_0421783_98_907 252
996 3300049459 Ga0495678_047945 Ga0495678_047945_605_1414 252
997 3300049569 Ga0501032_0000019 Ga0501032_0000019_5370_6176 252
998 3300049569 Ga0501032_0374855 Ga0501032_0374855_21_833 252
999 3300049570 Ga0501033_0013860 Ga0501033_0013860_117_923 252
1000 3300049570 Ga0501033_0149740 Ga0501033_0149740_857_1669 252
1001 3300049571 Ga0501034_0002910 Ga0501034_0002910_9646_10452 252
1002 3300049571 Ga0501034_0411430 Ga0501034_0411430_152_964 252
1003 3300049572 Ga0501036_0001517 Ga0501036_0001517_5239_6045 252
1004 3300049572 Ga0501036_0086723 Ga0501036_0086723_61_873 252
1005 3300049573 Ga0501037_0000870 Ga0501037_0000870_9636_10442 252
1006 3300049573 Ga0501037_0040577 Ga0501037_0040577_224_1036 252
1007 3300049574 Ga0501038_0001781 Ga0501038_0001781_9646_10452 252
1008 3300049575 Ga0501039_0001074 Ga0501039_0001074_9646_10452 252
1009 3300049575 Ga0501039_0438841 Ga0501039_0438841_172_984 252
1010 3300049579 Ga0501043_0000113 Ga0501043_0000113_9632_10438 252
1011 3300049579 Ga0501043_0048312 Ga0501043_0048312_1267_2079 252
1012 3300049822 Ga0501035_0000201 Ga0501035_0000201_9630_10436 252
1013 3300049822 Ga0501035_0455009 Ga0501035_0455009_38_850 252
1014 3300049823 Ga0501044_0019989 Ga0501044_0019989_528_1334 252
1015 3300050492 nmdc:mga0yw44_16789_c1 nmdc:mga0yw44_16789_c1_2615_3424 252
1016 3300050494 nmdc:mga06z11_271014_c1 nmdc:mga06z11_271014_c1_25_834 252
1017 3300050516 nmdc:mga0sz30_11473_c1 nmdc:mga0sz30_11473_c1_138_947 252
1018 3300053079 Ga0500610_0039841 Ga0500610_0039841_1494_2303 252
1019 3300053086 Ga0500578_0035296 Ga0500578_0035296_2207_3016 252
1020 3300053105 Ga0500557_042031 Ga0500557_042031_54_863 252
1021 3300053139 Ga0500568_0001169 Ga0500568_0001169_14406_15215 252
1022 3300053142 Ga0500577_0044998 Ga0500577_0044998_270_1079 252
1023 3300053153 Ga0500616_0009183 Ga0500616_0009183_2487_3296 252
1024 3300053153 Ga0500616_0164888 Ga0500616_0164888_145_951 252
1025 3300053155 Ga0500620_007279 Ga0500620_007279_1290_2111 252
1026 3300053158 Ga0500627_0055473 Ga0500627_0055473_459_1268 252
1027 iso_pu_bacteria 2523231067 2523467759 252
1028 iso_pu_bacteria 2738543031 2739349209 252
1029 3300001979 JGI24740J21852_10010356 JGI24740J21852_100103562 253
1030 3300003762 Ga0055542_1000592 Ga0055542_10005929 253
1031 3300005539 Ga0068853_100551688 Ga0068853_1005516882 253
1032 3300006038 Ga0075365_10020968 Ga0075365_100209682 253
1033 3300006038 Ga0075365_10083267 Ga0075365_100832673 253
1034 3300006048 Ga0075363_100009448 Ga0075363_1000094484 253
1035 3300006178 Ga0075367_10010325 Ga0075367_100103255 253
1036 3300006186 Ga0075369_10044665 Ga0075369_100446652 253
1037 3300006353 Ga0075370_10039345 Ga0075370_100393452 253
1038 3300009098 Ga0105245_10672793 Ga0105245_106727932 253
1039 3300009553 Ga0105249_10365413 Ga0105249_103654132 253
1040 3300017792 Ga0163161_10396032 Ga0163161_103960322 253
1041 3300025253 Ga0209677_109715 Ga0209677_1097152 253
1042 3300025254 Ga0209148_1000069 Ga0209148_100006912 253
1043 3300025272 Ga0209455_1000219 Ga0209455_100021964 253
1044 3300025949 Ga0207667_10214924 Ga0207667_102149242 253
1045 3300026041 Ga0207639_10242013 Ga0207639_102420131 253
1046 3300026142 Ga0207698_10087512 Ga0207698_100875122 253
1047 3300048928 Ga0496125_0085026 Ga0496125_0085026_944_1753 253
1048 3300049586 Ga0501070_0041305 Ga0501070_0041305_309_1118 253
1049 3300050492 nmdc:mga0yw44_24863_c1 nmdc:mga0yw44_24863_c1_1123_1932 253
1050 3300050492 nmdc:mga0yw44_60256_c1 nmdc:mga0yw44_60256_c1_1145_1954 253
1051 3300050494 nmdc:mga06z11_12773_c1 nmdc:mga06z11_12773_c1_92_901 253
1052 3300050496 nmdc:mga07m45_11183_c1 nmdc:mga07m45_11183_c1_3126_3935 253
1053 3300050516 nmdc:mga0sz30_42457_c1 nmdc:mga0sz30_42457_c1_302_1111 253
1054 iso_pu_bacteria 8004312739 8004319265 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01048

PNP_UDP_1

Phosphorylase superfamily

14

258

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yqq-assembly1.cif.gz_A escherichia coli purine nucleoside phosphorylase ii, the product of the xapa gene 0.8424 2 248
3odg-assembly1.cif.gz_A-3 crystal structure of xanthosine phosphorylase bound with xanthine from yersinia pseudotuberculosis 0.8359 2 249
8swt-assembly1.cif.gz_A structure of bacteroides fragilis pnp bound to transition state analog immucillin h and sulfate 0.8316 2 248
4m1e-assembly1.cif.gz_B crystal structure of purine nucleoside phosphorylase i from planctomyces limnophilus dsm 3776, nysgrc target 029364. 0.8264 2 245
1fxu-assembly1.cif.gz_A purine nucleoside phosphorylase from calf spleen in complex with n(7)-acycloguanosine inhibitor and a phosphate ion 0.8241 2 248
ID Description Score Start End Superfamily
1yqqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8424 2 248 3.40.50.1580
1yqqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8204 2 248 3.40.50.1580
af_U4PSA1_35_317_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8183 2 248 3.40.50.1580
af_A0A1D8PJL8_4_307_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8151 2 248 3.40.50.1580
1td1C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8107 2 247 3.40.50.1580
ID Description Score Start End GO Terms
AF-A0A527GD43-F1-model_v4 Purine-nucleoside phosphorylase 0.9849 1 111 GO:0004731
GO:0005737
GO:0009116
AF-A0A527GD43-F1-model_v4 Purine-nucleoside phosphorylase 0.9762 1 111 GO:0004731
GO:0005737
GO:0009116
AF-A0A536QTZ5-F1-model_v4 purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9576 1 128 GO:0004731
GO:0005737
GO:0009116
AF-A0A2T3XJJ4-F1-model_v4 purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9557 2 124 GO:0004731
GO:0005737
GO:0009116
AF-A0A358PKT2-F1-model_v4 purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.955 2 124 GO:0004731
GO:0005737
GO:0009116

Feature Viewer

pLDDT pTM Quality
81.21 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map