F489012

General Info

Members Datasets Scaffolds Average Seq Length
1049 418 887 193

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000167|JGI25162J39368_100016764
Length 230
Sequence MFPAFLRRRARVLVSLHFPGLCYRCGIISVKIKENPCMDVAVLRTERILGWRQCVLSTILCLFSLLAFAQSEPPAAASLAEQRAKAVTQVVLGILSYARWPVEPAQLRLCVVGPTEYTDDLLKGTTQATGRPVLVRRLLANNPSLASECDSVYVGKLSNDERTRLFNSLTGQPVLSISEGGDQCTVGSLFCLRVGDSQVSFEVNLDSVARSGVKIHPSVLQLSRRRPAAP

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231018 Pseudomonas sp. GM60 Isolate Nodule
12 2511231019 Pseudomonas sp. GM67 Isolate Nodule
13 2511231020 Pseudomonas sp. GM74 Isolate Nodule
14 2511231022 Pseudomonas sp. GM79 Isolate Nodule
15 2511231023 Pseudomonas sp. GM80 Isolate Nodule
16 2511231031 Pseudomonas sp. GM16 Isolate Nodule
17 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
18 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
19 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
20 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
21 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
22 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
23 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
24 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
25 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
26 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
27 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
28 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
29 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
30 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
31 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
32 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
33 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
34 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
35 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
36 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
37 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
38 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
39 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
40 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
41 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
42 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
43 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
44 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
45 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
46 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
47 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
48 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
49 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
50 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
51 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
52 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
53 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
54 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
55 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
56 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
57 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
58 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
59 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
60 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
61 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
62 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
63 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
64 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
65 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
66 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
67 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
68 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
69 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
70 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
71 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
72 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
73 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
74 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
75 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
76 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
77 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
78 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
79 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
80 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
81 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
82 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
83 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
84 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
85 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
86 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
87 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
88 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
89 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
90 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
91 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
92 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
93 2773857670 Pseudomonas sp. 478 Isolate Unclassified
94 2773857673 Pseudomonas sp. 443 Isolate Unclassified
95 2784132063 Pseudomonas sp. 424 Isolate Unclassified
96 2784132072 Pseudomonas sp. 460 Isolate Unclassified
97 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
98 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
99 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
100 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
101 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
102 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
103 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
104 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
105 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
106 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
107 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
108 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
109 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
110 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
111 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
112 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
113 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
114 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
115 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
116 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
117 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
118 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
119 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
120 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
121 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
122 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
123 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
124 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
125 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
126 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
127 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
128 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
129 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
130 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
131 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
132 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
133 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
134 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
135 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
136 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
137 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
138 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
139 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
140 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
141 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
142 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
143 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
144 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
145 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
146 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
147 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
148 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
149 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
150 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
151 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
152 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
153 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
154 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
155 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
156 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
157 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
158 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
159 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
160 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
161 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
162 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
163 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
164 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
165 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
166 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
167 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
168 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
169 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
170 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
171 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
172 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
173 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
174 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
175 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
176 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
177 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
178 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
179 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
180 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
181 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
182 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
183 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
184 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
185 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
186 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
187 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
188 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
189 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
190 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
191 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
192 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
193 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
194 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
195 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
196 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
197 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
198 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
199 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
200 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
201 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
202 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
209 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
210 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
212 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
214 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
215 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
237 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
241 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
242 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
243 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
244 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
245 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
257 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
258 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
259 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
260 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
261 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
262 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
263 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
264 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
265 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
266 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
267 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
268 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
269 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
270 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
271 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
272 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
273 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
274 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
275 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
276 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
277 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
278 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
279 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
280 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
281 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
282 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
283 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
284 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
285 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
286 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
287 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
288 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
289 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
290 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
291 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
292 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
293 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
294 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
295 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
296 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
297 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
298 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
299 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
300 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
301 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
302 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
303 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
304 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
305 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
306 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
307 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
308 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
309 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
310 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
311 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
312 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
313 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
314 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
315 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
316 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
317 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
318 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
319 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
320 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
321 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
322 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
323 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
324 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
325 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
326 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
331 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
332 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
333 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
334 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
335 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
336 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
337 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
338 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
339 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
340 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
341 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
342 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
343 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
344 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
345 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
346 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
347 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
348 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
349 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
350 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
351 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
352 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
353 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
354 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
355 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
356 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
357 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
358 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
359 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
360 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
361 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
362 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
363 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
364 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
365 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
366 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
367 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
368 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
369 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
370 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
371 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
372 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
373 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
374 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
375 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
376 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
377 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
378 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
379 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
380 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
381 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
382 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
383 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
384 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
385 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
386 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
387 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
388 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
389 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
390 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
391 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
392 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
393 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
394 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
395 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
396 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
397 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
398 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
399 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
400 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
401 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
402 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
403 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
404 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
405 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
406 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
407 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
408 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
409 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
410 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
411 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
412 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
413 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
414 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
415 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
416 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
417 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
418 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.56
Metatranscriptomes 0
Isolates 15.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 2
Rhizoplane 6.67
Rhizosphere 75.69
Stem 0
Stem Tuber 0
Unclassified 8.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_391 2124908027 Bacteria 4199
2 MRS2a_Contig_90 2124908027 Bacteria 24233
3 SwRhRL2b_contig_710988 2162886007 Bacteria 9315
4 JGI25162J39368_1000167 3300002737 Bacteria 72147
5 JGI25162J39368_1000186 3300002737 Bacteria 65946
6 JGI25163J39215_1000185 3300002771 Bacteria 24073
7 JGI25163J39215_1000378 3300002771 Bacteria 14325
8 JGI25164J39214_1000131 3300002772 Bacteria 72147
9 JGI25164J39214_1000150 3300002772 Bacteria 65946
10 JGI25165J46597_1000252 3300003214 Bacteria 72147
11 JGI25165J46597_1000277 3300003214 Bacteria 65946
12 Ga0055538_1000028 3300003751 Bacteria 215806
13 Ga0055539_1000037 3300003752 Bacteria 215806
14 Ga0055533_1000047 3300003756 Bacteria 215806
15 Ga0055532_1000065 3300003758 Bacteria 141003
16 Ga0055525_1000176 3300003759 Bacteria 79649
17 Ga0055525_1007889 3300003759 Bacteria 900
18 Ga0055536_1000104 3300003781 Bacteria 73560
19 Ga0055536_1000105 3300003781 Bacteria 73391
20 Ga0055536_1000180 3300003781 Bacteria 52407
21 Ga0055530_10000213 3300003791 Bacteria 52407
22 Ga0055530_10000274 3300003791 Bacteria 46761
23 Ga0055530_10000768 3300003791 Bacteria 26738
24 Ga0055530_10048558 3300003791 Bacteria 996
25 Ga0055540_1000135 3300003792 Bacteria 73560
26 Ga0055540_1000270 3300003792 Bacteria 46761
27 Ga0055540_1000413 3300003792 Bacteria 34507
28 Ga0055531_10000350 3300003794 Bacteria 45099
29 Ga0055531_10063662 3300003794 Bacteria 885
30 Ga0055541_1000025 3300003841 Bacteria 215806
31 Ga0065714_10002436 3300005288 Bacteria 17721
32 Ga0065714_10014541 3300005288 Bacteria 2144
33 Ga0065714_10079296 3300005288 Bacteria 2527
34 Ga0065714_10084720 3300005288 Bacteria 2175
35 Ga0065704_10019143 3300005289 Bacteria 1697
36 Ga0065704_10071876 3300005289 Bacteria 9694
37 Ga0065704_10159964 3300005289 Bacteria 1362
38 Ga0070670_100001943 3300005331 Bacteria 16924
39 Ga0070660_100878713 3300005339 Bacteria 755
40 Ga0070661_100001008 3300005344 Bacteria 19964
41 Ga0070669_100000203 3300005353 Bacteria 51110
42 Ga0070669_100000746 3300005353 Bacteria 23697
43 Ga0070714_100098727 3300005435 Bacteria 2569
44 Ga0070662_100000469 3300005457 Bacteria 24003
45 Ga0070662_100031311 3300005457 Bacteria 3733
46 Ga0068853_100000107 3300005539 Bacteria 56373
47 Ga0070664_100001301 3300005564 Bacteria 19964
48 Ga0070664_100012771 3300005564 Bacteria 6833
49 Ga0068854_100053493 3300005578 Bacteria 2900
50 Ga0068851_10000032 3300005834 Bacteria 108531
51 Ga0075364_10070877 3300006051 Bacteria 2295
52 Ga0075364_10072244 3300006051 Bacteria 2274
53 Ga0075364_10323583 3300006051 Bacteria 1050
54 Ga0075432_10011413 3300006058 Bacteria 3018
55 Ga0075432_10029452 3300006058 Bacteria 1895
56 Ga0075432_10089782 3300006058 Bacteria 1123
57 Ga0075362_10066586 3300006177 Bacteria 1637
58 Ga0075362_10077407 3300006177 Bacteria 1528
59 Ga0075436_100069387 3300006914 Bacteria 2435
60 Ga0079104_1000362 3300006946 Bacteria 54502
61 Ga0099826_10011004 3300006948 Bacteria 6798
62 Ga0105251_10006139 3300009011 Bacteria 7734
63 Ga0105251_10155776 3300009011 Bacteria 1031
64 Ga0105244_10002516 3300009036 Bacteria 13785
65 Ga0105244_10002835 3300009036 Bacteria 12864
66 Ga0105244_10003144 3300009036 Bacteria 12019
67 Ga0105244_10008732 3300009036 Bacteria 6303
68 Ga0105244_10015291 3300009036 Bacteria 4404
69 Ga0105244_10018916 3300009036 Bacteria 3856
70 Ga0105244_10020581 3300009036 Bacteria 3662
71 Ga0105244_10055429 3300009036 Bacteria 2008
72 Ga0105244_10067683 3300009036 Bacteria 1786
73 Ga0105250_10000275 3300009092 Bacteria 41677
74 Ga0105250_10000297 3300009092 Bacteria 39195
75 Ga0105250_10003737 3300009092 Bacteria 7147
76 Ga0105250_10007997 3300009092 Bacteria 4510
77 Ga0105243_10000174 3300009148 Bacteria 73806
78 Ga0105243_10003246 3300009148 Bacteria 13263
79 Ga0105243_10057750 3300009148 Bacteria 3091
80 Ga0105242_10006290 3300009176 Bacteria 9149
81 Ga0105242_10792408 3300009176 Bacteria 937
82 Ga0105237_10003115 3300009545 Bacteria 19970
83 Ga0105246_10001653 3300011119 Bacteria 13294
84 Ga0105246_10003529 3300011119 Bacteria 9474
85 Ga0105246_10073019 3300011119 Bacteria 2421
86 Ga0105246_10095828 3300011119 Bacteria 2149
87 Ga0105246_10344871 3300011119 Bacteria 1218
88 Ga0105246_10430731 3300011119 Bacteria 1103
89 Ga0157345_1000142 3300012498 Bacteria 12906
90 Ga0157345_1001470 3300012498 Bacteria 1658
91 Ga0157347_1001370 3300012502 Bacteria 1893
92 Ga0157373_10002919 3300013100 Bacteria 12949
93 Ga0157373_10003453 3300013100 Bacteria 11960
94 Ga0157373_10009898 3300013100 Bacteria 7027
95 Ga0157373_10021739 3300013100 Bacteria 4656
96 Ga0157373_10069372 3300013100 Bacteria 2492
97 Ga0157371_10000244 3300013102 Bacteria 77369
98 Ga0157371_10001413 3300013102 Bacteria 25012
99 Ga0157371_10005069 3300013102 Bacteria 11251
100 Ga0157370_10024126 3300013104 Bacteria 6028
101 Ga0157370_10038317 3300013104 Bacteria 4637
102 Ga0157370_10053845 3300013104 Bacteria 3836
103 Ga0157370_10306529 3300013104 Bacteria 1465
104 Ga0157369_10003571 3300013105 Bacteria 18480
105 Ga0157369_10007090 3300013105 Bacteria 12930
106 Ga0157369_10007109 3300013105 Bacteria 12908
107 Ga0157369_10017894 3300013105 Bacteria 7954
108 Ga0163162_10000092 3300013306 Bacteria 82766
109 Ga0163162_10003797 3300013306 Bacteria 14490
110 Ga0157372_10004825 3300013307 Bacteria 14337
111 Ga0157375_10004942 3300013308 Bacteria 11596
112 Ga0157375_10150709 3300013308 Bacteria 2461
113 Ga0157375_10656918 3300013308 Bacteria 1204
114 Ga0182008_10000158 3300014497 Bacteria 53489
115 Ga0182008_10001704 3300014497 Bacteria 14417
116 Ga0182008_10005864 3300014497 Bacteria 6940
117 Ga0182008_10024454 3300014497 Bacteria 3076
118 Ga0182006_1000235 3300015261 Bacteria 52295
119 Ga0182006_1000653 3300015261 Bacteria 24647
120 Ga0182006_1001434 3300015261 Bacteria 14424
121 Ga0182006_1004794 3300015261 Bacteria 6586
122 Ga0182006_1103496 3300015261 Bacteria 1008
123 Ga0182006_1109663 3300015261 Bacteria 970
124 Ga0182006_1138919 3300015261 Bacteria 831
125 Ga0182007_10001596 3300015262 Bacteria 12051
126 Ga0182007_10012849 3300015262 Bacteria 3211
127 Ga0182005_1000742 3300015265 Bacteria 14928
128 Ga0182005_1025476 3300015265 Bacteria 1614
129 Ga0163161_10002110 3300017792 Bacteria 14386
130 Ga0163161_10002705 3300017792 Bacteria 12600
131 Ga0163161_10014922 3300017792 Bacteria 5411
132 Ga0163161_10019391 3300017792 Bacteria 4771
133 Ga0163161_10068681 3300017792 Bacteria 2590
134 Ga0163161_10086692 3300017792 Bacteria 2311
135 Ga0209760_100072 3300025207 Bacteria 81642
136 Ga0209760_100100 3300025207 Bacteria 66035
137 Ga0209784_100032 3300025224 Bacteria 314079
138 Ga0209566_100036 3300025225 Bacteria 314079
139 Ga0209674_100054 3300025226 Bacteria 314079
140 Ga0209147_100055 3300025229 Bacteria 262412
141 Ga0209563_100055 3300025230 Bacteria 314079
142 Ga0209563_100401 3300025230 Bacteria 15461
143 Ga0207427_100116 3300025231 Bacteria 104213
144 Ga0207427_100180 3300025231 Bacteria 65995
145 Ga0209437_100003 3300025233 Bacteria 1517827
146 Ga0209437_100309 3300025233 Bacteria 65994
147 Ga0209258_100239 3300025242 Bacteria 101232
148 Ga0209646_1000736 3300025246 Bacteria 11511
149 Ga0209677_100033 3300025253 Bacteria 314079
150 Ga0209759_1043999 3300025256 Bacteria 742
151 Ga0209233_1000008 3300025261 Bacteria 1356712
152 Ga0209233_1000220 3300025261 Bacteria 104213
153 Ga0209675_1001904 3300025291 Bacteria 11257
154 Ga0209676_1000255 3300025292 Bacteria 112911
155 Ga0209676_1000357 3300025292 Bacteria 86622
156 Ga0209676_1000428 3300025292 Bacteria 73542
157 Ga0209676_1013675 3300025292 Bacteria 3105
158 Ga0209676_1020328 3300025292 Bacteria 2259
159 Ga0209050_1000041 3300025298 Bacteria 408004
160 Ga0209050_1000287 3300025298 Bacteria 106507
161 Ga0209050_1000420 3300025298 Bacteria 78413
162 Ga0209050_1002033 3300025298 Bacteria 18716
163 Ga0209051_1000199 3300025303 Bacteria 106517
164 Ga0209051_1000229 3300025303 Bacteria 94109
165 Ga0209051_1000250 3300025303 Bacteria 90973
166 Ga0209051_1002350 3300025303 Bacteria 13689
167 Ga0209257_1000469 3300025304 Bacteria 73612
168 Ga0209257_1019861 3300025304 Bacteria 2511
169 Ga0207656_10000065 3300025321 Bacteria 40587
170 Ga0207696_1000220 3300025711 Bacteria 82790
171 Ga0207696_1000228 3300025711 Bacteria 79456
172 Ga0207696_1001630 3300025711 Bacteria 11834
173 Ga0207696_1002351 3300025711 Bacteria 9351
174 Ga0207696_1012066 3300025711 Bacteria 3073
175 Ga0207655_1001136 3300025728 Bacteria 25945
176 Ga0207655_1001232 3300025728 Bacteria 24606
177 Ga0207655_1002149 3300025728 Bacteria 16441
178 Ga0207655_1002877 3300025728 Bacteria 13299
179 Ga0207655_1003022 3300025728 Bacteria 12866
180 Ga0207655_1003278 3300025728 Bacteria 12147
181 Ga0207655_1005603 3300025728 Bacteria 8500
182 Ga0207655_1011951 3300025728 Bacteria 5118
183 Ga0207655_1041460 3300025728 Bacteria 1972
184 Ga0207655_1081799 3300025728 Bacteria 1163
185 Ga0207713_1000355 3300025735 Bacteria 50017
186 Ga0207713_1000499 3300025735 Bacteria 40375
187 Ga0207713_1000722 3300025735 Bacteria 30911
188 Ga0207713_1001537 3300025735 Bacteria 18165
189 Ga0207713_1003046 3300025735 Bacteria 11677
190 Ga0207713_1007282 3300025735 Bacteria 6564
191 Ga0207713_1007912 3300025735 Bacteria 6195
192 Ga0207713_1009034 3300025735 Bacteria 5662
193 Ga0207713_1091746 3300025735 Bacteria 1066
194 Ga0207713_1112866 3300025735 Bacteria 922
195 Ga0207671_10002416 3300025914 Bacteria 20020
196 Ga0207649_10000006 3300025920 Bacteria 349180
197 Ga0207681_10000095 3300025923 Bacteria 75012
198 Ga0207681_10003682 3300025923 Bacteria 9528
199 Ga0207650_10000276 3300025925 Bacteria 53717
200 Ga0207650_10000299 3300025925 Bacteria 49108
201 Ga0207664_10111425 3300025929 Bacteria 2277
202 Ga0207706_10000846 3300025933 Bacteria 31519
203 Ga0207706_10007081 3300025933 Bacteria 10371
204 Ga0207686_10078743 3300025934 Bacteria 2144
205 Ga0207709_10000125 3300025935 Bacteria 114144
206 Ga0207709_10000302 3300025935 Bacteria 53928
207 Ga0207709_10212748 3300025935 Bacteria 1389
208 Ga0207711_10078188 3300025941 Bacteria 2885
209 Ga0207679_10000010 3300025945 Bacteria 349180
210 Ga0207640_10402972 3300025981 Bacteria 1114
211 Ga0207639_10000167 3300026041 Bacteria 50855
212 Ga0209281_1000015 3300027111 Bacteria 590084
213 Ga0209281_1000256 3300027111 Bacteria 103502
214 Ga0209281_1013120 3300027111 Bacteria 1798
215 Ga0209282_1035142 3300027666 Bacteria 3041
216 Ga0207428_10004072 3300027907 Bacteria 14005
217 Ga0207428_10051124 3300027907 Bacteria 3304
218 Ga0207428_10336289 3300027907 Bacteria 1113
219 Ga0268266_10008427 3300028379 Bacteria 9165
220 Ga0268266_10463142 3300028379 Bacteria 1206
221 Ga0268266_11139905 3300028379 Bacteria 754
222 Ga0307511_10065146 3300030521 Bacteria 2731
223 Ga0316177_1185208 3300030731 Bacteria 3143
224 Ga0316179_1010585 3300030734 Bacteria 4487
225 Ga0316178_1004939 3300030735 Bacteria 26685
226 Ga0316181_1158599 3300030744 Bacteria 3678
227 Ga0307509_10032347 3300031507 Bacteria 5764
228 Ga0307408_100002080 3300031548 Bacteria 14415
229 Ga0307408_100002720 3300031548 Bacteria 12279
230 Ga0307408_100106913 3300031548 Bacteria 2141
231 Ga0307408_100434195 3300031548 Bacteria 1135
232 Ga0307516_10090513 3300031730 Bacteria 2888
233 Ga0307516_10092653 3300031730 Bacteria 2848
234 Ga0307516_10262732 3300031730 Bacteria 1416
235 Ga0307405_10000760 3300031731 Bacteria 12581
236 Ga0307405_10001020 3300031731 Bacteria 11336
237 Ga0307405_10006009 3300031731 Bacteria 5930
238 Ga0307405_10008491 3300031731 Bacteria 5210
239 Ga0307413_10026868 3300031824 Bacteria 3179
240 Ga0307413_10060076 3300031824 Bacteria 2338
241 Ga0307413_10079927 3300031824 Bacteria 2092
242 Ga0307406_10037375 3300031901 Bacteria 2998
243 Ga0307407_10116784 3300031903 Bacteria 1684
244 Ga0307407_10200422 3300031903 Bacteria 1337
245 Ga0307412_10000617 3300031911 Bacteria 20901
246 Ga0307412_10001102 3300031911 Bacteria 15467
247 Ga0307412_10001467 3300031911 Bacteria 13125
248 Ga0307412_10050604 3300031911 Bacteria 2742
249 Ga0307412_10076907 3300031911 Bacteria 2294
250 Ga0307412_10249065 3300031911 Bacteria 1378
251 Ga0307412_10364290 3300031911 Bacteria 1165
252 Ga0307409_100034418 3300031995 Bacteria 3699
253 Ga0307414_10002708 3300032004 Bacteria 9323
254 Ga0307414_10196071 3300032004 Bacteria 1638
255 Ga0307411_10005345 3300032005 Bacteria 6293
256 Ga0307411_10155211 3300032005 Bacteria 1706
257 Ga0307411_10246204 3300032005 Bacteria 1403
258 Ga0307510_10007724 3300033180 Bacteria 12829
259 Ga0237819_00983 3300038705 Bacteria 8634
260 Ga0439438_000216 3300041405 Bacteria 26512
261 Ga0439438_000921 3300041405 Bacteria 13124
262 Ga0439438_000970 3300041405 Bacteria 12813
263 Ga0439438_000971 3300041405 Bacteria 12809
264 Ga0439438_000987 3300041405 Bacteria 12711
265 Ga0439438_003415 3300041405 Bacteria 6427
266 Ga0439438_007725 3300041405 Bacteria 3641
267 Ga0439438_009691 3300041405 Bacteria 3101
268 Ga0439447_000438 3300041407 Bacteria 15499
269 Ga0439447_000941 3300041407 Bacteria 10643
270 Ga0439447_001589 3300041407 Bacteria 8317
271 Ga0439447_036170 3300041407 Bacteria 1220
272 Ga0439461_0007246 3300041410 Bacteria 1957
273 Ga0439466_0000198 3300041411 Bacteria 23790
274 Ga0439466_0000636 3300041411 Bacteria 13206
275 Ga0439466_0000803 3300041411 Bacteria 11947
276 Ga0439466_0000822 3300041411 Bacteria 11826
277 Ga0439466_0007430 3300041411 Bacteria 4149
278 Ga0439466_0009500 3300041411 Bacteria 3633
279 Ga0439466_0011877 3300041411 Bacteria 3216
280 Ga0439466_0052896 3300041411 Bacteria 1326
281 Ga0439466_0053660 3300041411 Bacteria 1314
282 Ga0439466_0102460 3300041411 Bacteria 891
283 Ga0439466_0104870 3300041411 Bacteria 879
284 Ga0439465_0007265 3300041413 Bacteria 3520
285 Ga0439465_0008308 3300041413 Bacteria 3276
286 Ga0439465_0053952 3300041413 Bacteria 1321
287 Ga0439431_0000175 3300041997 Bacteria 12354
288 Ga0439442_011964 3300042002 Bacteria 1770
289 Ga0439445_0000618 3300042004 Bacteria 7304
290 Ga0439445_0010120 3300042004 Bacteria 2227
291 Ga0439432_000118 3300042006 Bacteria 25847
292 Ga0439432_000668 3300042006 Bacteria 12825
293 Ga0439432_000765 3300042006 Bacteria 12050
294 Ga0439432_000781 3300042006 Bacteria 11928
295 Ga0439432_000960 3300042006 Bacteria 10892
296 Ga0439432_001756 3300042006 Bacteria 8123
297 Ga0439432_003401 3300042006 Bacteria 5907
298 Ga0439432_005090 3300042006 Bacteria 4755
299 Ga0439432_054859 3300042006 Bacteria 1237
300 Ga0439451_000187 3300042009 Bacteria 11751
301 Ga0439451_000218 3300042009 Bacteria 10980
302 Ga0439451_000752 3300042009 Bacteria 6153
303 Ga0439451_001335 3300042009 Bacteria 4859
304 Ga0439451_006474 3300042009 Bacteria 2394
305 Ga0439451_006996 3300042009 Bacteria 2306
306 Ga0439452_000152 3300042010 Bacteria 51070
307 Ga0439452_000379 3300042010 Bacteria 26660
308 Ga0439452_000529 3300042010 Bacteria 20421
309 Ga0439452_000975 3300042010 Bacteria 12845
310 Ga0439452_003073 3300042010 Bacteria 5924
311 Ga0439452_003121 3300042010 Bacteria 5874
312 Ga0439452_004190 3300042010 Bacteria 4889
313 Ga0439452_005654 3300042010 Bacteria 4004
314 Ga0439452_005740 3300042010 Bacteria 3966
315 Ga0439452_005823 3300042010 Bacteria 3930
316 Ga0439452_047855 3300042010 Bacteria 987
317 Ga0439456_000013 3300042013 Bacteria 72544
318 Ga0439456_000928 3300042013 Bacteria 5857
319 Ga0439456_002183 3300042013 Bacteria 3940
320 Ga0439456_002595 3300042013 Bacteria 3638
321 Ga0439456_002847 3300042013 Bacteria 3488
322 Ga0439456_005722 3300042013 Bacteria 2526
323 Ga0439456_013847 3300042013 Bacteria 1680
324 Ga0439456_015463 3300042013 Bacteria 1593
325 Ga0439456_015673 3300042013 Bacteria 1584
326 Ga0439456_043380 3300042013 Bacteria 977
327 Ga0439463_000108 3300042016 Bacteria 20212
328 Ga0439463_000407 3300042016 Bacteria 11928
329 Ga0439463_001893 3300042016 Bacteria 5432
330 Ga0439463_009927 3300042016 Bacteria 2339
331 Ga0439463_010205 3300042016 Bacteria 2308
332 Ga0439463_011079 3300042016 Bacteria 2215
333 Ga0450911_000387 3300042115 Bacteria 14613
334 Ga0450911_000478 3300042115 Bacteria 12844
335 Ga0450911_003172 3300042115 Bacteria 2969
336 Ga0450911_028694 3300042115 Bacteria 722
337 Ga0450912_004987 3300042116 Bacteria 1004
338 Ga0450919_001131 3300042121 Bacteria 3459
339 Ga0450922_000758 3300042124 Bacteria 3325
340 Ga0450922_001000 3300042124 Bacteria 2830
341 Ga0450890_000119 3300042127 Bacteria 12377
342 Ga0450892_001614 3300042130 Bacteria 2122
343 Ga0450902_002851 3300042137 Bacteria 2480
344 Ga0450902_003845 3300042137 Bacteria 2215
345 Ga0450902_009143 3300042137 Bacteria 1558
346 Ga0450902_015188 3300042137 Bacteria 1248
347 Ga0450903_000657 3300042138 Bacteria 6973
348 Ga0450903_000690 3300042138 Bacteria 6744
349 Ga0450903_007644 3300042138 Bacteria 1774
350 Ga0450903_027639 3300042138 Bacteria 862
351 Ga0450904_001279 3300042139 Bacteria 3701
352 Ga0450904_006689 3300042139 Bacteria 1148
353 Ga0450905_000040 3300042142 Bacteria 10921
354 Ga0450905_001001 3300042142 Bacteria 3544
355 Ga0450906_000161 3300042145 Bacteria 12610
356 Ga0450906_000993 3300042145 Bacteria 6227
357 Ga0450906_021069 3300042145 Bacteria 1165
358 Ga0450907_000045 3300042146 Bacteria 53501
359 Ga0450907_006455 3300042146 Bacteria 1960
360 Ga0450907_015425 3300042146 Bacteria 1275
361 Ga0450910_000052 3300042147 Bacteria 12114
362 Ga0450910_000272 3300042147 Bacteria 5975
363 Ga0450910_014098 3300042147 Bacteria 1168
364 Ga0439446_0001026 3300042156 Bacteria 6133
365 Ga0439446_0002040 3300042156 Bacteria 4785
366 Ga0439446_0008180 3300042156 Bacteria 2770
367 Ga0439446_0031134 3300042156 Bacteria 1544
368 Ga0450908_005995 3300042184 Bacteria 2320
369 Ga0450908_009473 3300042184 Bacteria 1808
370 Ga0450909_003910 3300042185 Bacteria 2120
371 Ga0450909_010971 3300042185 Bacteria 1326
372 Ga0439434_0000380 3300042435 Bacteria 12639
373 Ga0439434_0004012 3300042435 Bacteria 4295
374 Ga0439434_0034768 3300042435 Bacteria 1539
375 Ga0439464_0000127 3300042439 Bacteria 12100
376 Ga0439460_0000179 3300042461 Bacteria 12047
377 Ga0439460_0000347 3300042461 Bacteria 9726
378 Ga0450918_002342 3300042531 Bacteria 3586
379 Ga0450918_008337 3300042531 Bacteria 1819
380 Ga0450893_0000048 3300042532 Bacteria 12347
381 Ga0450901_000343 3300042533 Bacteria 5675
382 Ga0439440_0000288 3300042993 Bacteria 8204
383 Ga0439440_0000405 3300042993 Bacteria 7228
384 Ga0439440_0001163 3300042993 Bacteria 4719
385 Ga0439440_0055528 3300042993 Bacteria 999
386 Ga0495617_001033 3300046452 Bacteria 12805
387 Ga0495617_008359 3300046452 Bacteria 3570
388 Ga0495617_009834 3300046452 Bacteria 3280
389 Ga0495617_011381 3300046452 Bacteria 3035
390 Ga0495617_028067 3300046452 Bacteria 1893
391 Ga0495617_037290 3300046452 Bacteria 1628
392 Ga0495617_041368 3300046452 Bacteria 1540
393 Ga0495617_110235 3300046452 Bacteria 890
394 Ga0495627_001577 3300046453 Bacteria 12909
395 Ga0495627_001594 3300046453 Bacteria 12724
396 Ga0495627_001837 3300046453 Bacteria 11288
397 Ga0495627_007279 3300046453 Bacteria 4260
398 Ga0495627_007540 3300046453 Bacteria 4160
399 Ga0495627_021775 3300046453 Bacteria 2119
400 Ga0495627_111760 3300046453 Bacteria 775
401 Ga0495603_0097609 3300046455 Bacteria 1716
402 Ga0495603_0108196 3300046455 Bacteria 1622
403 Ga0495603_0127989 3300046455 Bacteria 1479
404 Ga0495590_0000783 3300046457 Bacteria 14449
405 Ga0495590_0000855 3300046457 Bacteria 13719
406 Ga0495590_0001718 3300046457 Bacteria 9316
407 Ga0495590_0042285 3300046457 Bacteria 1588
408 Ga0495590_0046556 3300046457 Bacteria 1513
409 Ga0495590_0066234 3300046457 Bacteria 1264
410 Ga0495591_001700 3300046458 Bacteria 13135
411 Ga0495591_001703 3300046458 Bacteria 13128
412 Ga0495591_001760 3300046458 Bacteria 12874
413 Ga0495591_001855 3300046458 Bacteria 12441
414 Ga0495591_001859 3300046458 Bacteria 12428
415 Ga0495591_005522 3300046458 Bacteria 5827
416 Ga0495591_006346 3300046458 Bacteria 5247
417 Ga0495591_007557 3300046458 Bacteria 4600
418 Ga0495591_014930 3300046458 Bacteria 2765
419 Ga0495638_0002812 3300046460 Bacteria 13931
420 Ga0495638_0003070 3300046460 Bacteria 13269
421 Ga0495638_0003856 3300046460 Bacteria 11638
422 Ga0495638_0006197 3300046460 Bacteria 8736
423 Ga0495638_0009585 3300046460 Bacteria 6778
424 Ga0495638_0030940 3300046460 Bacteria 3441
425 Ga0495638_0033591 3300046460 Bacteria 3280
426 Ga0495638_0084524 3300046460 Bacteria 1920
427 Ga0495638_0133430 3300046460 Bacteria 1456
428 Ga0495638_0151278 3300046460 Bacteria 1346
429 Ga0495653_0000899 3300046463 Bacteria 23030
430 Ga0495653_0024904 3300046463 Bacteria 4816
431 Ga0495653_0103518 3300046463 Bacteria 2058
432 Ga0495650_0002513 3300046471 Bacteria 14685
433 Ga0495650_0002934 3300046471 Bacteria 12934
434 Ga0495650_0003243 3300046471 Bacteria 12068
435 Ga0495650_0007254 3300046471 Bacteria 6713
436 Ga0495650_0011478 3300046471 Bacteria 4848
437 Ga0495650_0019607 3300046471 Bacteria 3320
438 Ga0495580_0136934 3300046472 Bacteria 1698
439 Ga0495580_0294324 3300046472 Bacteria 1106
440 Ga0495605_0002099 3300046474 Bacteria 12507
441 Ga0495605_0002641 3300046474 Bacteria 10980
442 Ga0495605_0003390 3300046474 Bacteria 9504
443 Ga0495605_0005362 3300046474 Bacteria 7475
444 Ga0495605_0006075 3300046474 Bacteria 6977
445 Ga0495605_0014059 3300046474 Bacteria 4390
446 Ga0495605_0136993 3300046474 Bacteria 1100
447 Ga0495605_0172006 3300046474 Bacteria 956
448 Ga0495639_0000152 3300046475 Bacteria 35525
449 Ga0495584_0000468 3300046491 Bacteria 27807
450 Ga0495584_0001549 3300046491 Bacteria 13655
451 Ga0495584_0001688 3300046491 Bacteria 12946
452 Ga0495584_0001709 3300046491 Bacteria 12878
453 Ga0495584_0001838 3300046491 Bacteria 12317
454 Ga0495584_0018951 3300046491 Bacteria 3496
455 Ga0495584_0028157 3300046491 Bacteria 2846
456 Ga0495584_0042422 3300046491 Bacteria 2296
457 Ga0495584_0072816 3300046491 Bacteria 1726
458 Ga0495584_0076065 3300046491 Bacteria 1688
459 Ga0495585_0000236 3300046492 Bacteria 57277
460 Ga0495585_0002024 3300046492 Bacteria 15006
461 Ga0495585_0002613 3300046492 Bacteria 12702
462 Ga0495585_0002640 3300046492 Bacteria 12627
463 Ga0495585_0002748 3300046492 Bacteria 12274
464 Ga0495585_0008744 3300046492 Bacteria 6122
465 Ga0495585_0011475 3300046492 Bacteria 5241
466 Ga0495585_0011760 3300046492 Bacteria 5171
467 Ga0495585_0026890 3300046492 Bacteria 3285
468 Ga0495585_0065759 3300046492 Bacteria 1986
469 Ga0495585_0145210 3300046492 Bacteria 1240
470 Ga0495594_0001402 3300046499 Bacteria 12506
471 Ga0495594_0005592 3300046499 Bacteria 6458
472 Ga0495594_0005762 3300046499 Bacteria 6362
473 Ga0495596_0001547 3300046500 Bacteria 13123
474 Ga0495596_0070385 3300046500 Bacteria 1359
475 Ga0495607_0001160 3300046501 Bacteria 23881
476 Ga0495607_0001357 3300046501 Bacteria 21823
477 Ga0495607_0003365 3300046501 Bacteria 12259
478 Ga0495607_0003368 3300046501 Bacteria 12253
479 Ga0495607_0004540 3300046501 Bacteria 10190
480 Ga0495607_0005703 3300046501 Bacteria 8869
481 Ga0495607_0007076 3300046501 Bacteria 7802
482 Ga0495607_0016038 3300046501 Bacteria 4841
483 Ga0495607_0023133 3300046501 Bacteria 3892
484 Ga0495607_0042908 3300046501 Bacteria 2678
485 Ga0495607_0065225 3300046501 Bacteria 2054
486 Ga0495583_0001658 3300046506 Bacteria 21608
487 Ga0495583_0002733 3300046506 Bacteria 14613
488 Ga0495583_0015629 3300046506 Bacteria 4118
489 Ga0495583_0061397 3300046506 Bacteria 1677
490 Ga0495583_0182518 3300046506 Bacteria 858
491 Ga0495606_0003435 3300046507 Bacteria 16811
492 Ga0495606_0005268 3300046507 Bacteria 12468
493 Ga0495606_0005972 3300046507 Bacteria 11421
494 Ga0495606_0005985 3300046507 Bacteria 11400
495 Ga0495606_0006686 3300046507 Bacteria 10566
496 Ga0495606_0047898 3300046507 Bacteria 2815
497 Ga0495606_0180225 3300046507 Bacteria 1218
498 Ga0495606_0244293 3300046507 Bacteria 999
499 Ga0495606_0397612 3300046507 Bacteria 718
500 Ga0495610_0003231 3300046512 Bacteria 12886
501 Ga0495610_0003484 3300046512 Bacteria 12243
502 Ga0495610_0003619 3300046512 Bacteria 11921
503 Ga0495610_0016075 3300046512 Bacteria 4326
504 Ga0495610_0023398 3300046512 Bacteria 3360
505 Ga0495610_0089400 3300046512 Bacteria 1398
506 Ga0495610_0118356 3300046512 Bacteria 1164
507 Ga0495610_0234975 3300046512 Bacteria 733
508 Ga0495616_0000931 3300046513 Bacteria 21075
509 Ga0495616_0001498 3300046513 Bacteria 16141
510 Ga0495616_0001947 3300046513 Bacteria 13896
511 Ga0495616_0002240 3300046513 Bacteria 12933
512 Ga0495616_0002422 3300046513 Bacteria 12415
513 Ga0495616_0007298 3300046513 Bacteria 6616
514 Ga0495616_0046494 3300046513 Bacteria 2190
515 Ga0495616_0098116 3300046513 Bacteria 1377
516 Ga0495620_0001353 3300046515 Bacteria 14839
517 Ga0495620_0003243 3300046515 Bacteria 9329
518 Ga0495620_0004042 3300046515 Bacteria 8326
519 Ga0495620_0007547 3300046515 Bacteria 5898
520 Ga0495620_0009108 3300046515 Bacteria 5297
521 Ga0495620_0019684 3300046515 Bacteria 3313
522 Ga0495620_0068671 3300046515 Bacteria 1455
523 Ga0495631_0000597 3300046518 Bacteria 23847
524 Ga0495631_0001741 3300046518 Bacteria 12926
525 Ga0495631_0001855 3300046518 Bacteria 12483
526 Ga0495631_0011377 3300046518 Bacteria 4377
527 Ga0495631_0014892 3300046518 Bacteria 3742
528 Ga0495631_0016414 3300046518 Bacteria 3529
529 Ga0495631_0021886 3300046518 Bacteria 2975
530 Ga0495631_0293977 3300046518 Bacteria 691
531 Ga0495632_0001382 3300046519 Bacteria 20342
532 Ga0495632_0002567 3300046519 Bacteria 13744
533 Ga0495632_0002803 3300046519 Bacteria 12907
534 Ga0495632_0002906 3300046519 Bacteria 12589
535 Ga0495632_0005239 3300046519 Bacteria 8628
536 Ga0495632_0005809 3300046519 Bacteria 8083
537 Ga0495632_0007448 3300046519 Bacteria 6874
538 Ga0495632_0073773 3300046519 Bacteria 1635
539 Ga0495637_0001655 3300046520 Bacteria 12878
540 Ga0495637_0001705 3300046520 Bacteria 12694
541 Ga0495637_0001726 3300046520 Bacteria 12542
542 Ga0495637_0001858 3300046520 Bacteria 12069
543 Ga0495637_0002370 3300046520 Bacteria 10439
544 Ga0495637_0002637 3300046520 Bacteria 9812
545 Ga0495637_0002984 3300046520 Bacteria 9097
546 Ga0495637_0010266 3300046520 Bacteria 4535
547 Ga0495637_0018032 3300046520 Bacteria 3278
548 Ga0495637_0052205 3300046520 Bacteria 1707
549 Ga0495637_0074995 3300046520 Bacteria 1357
550 Ga0495643_0003789 3300046522 Bacteria 10934
551 Ga0495643_0003918 3300046522 Bacteria 10664
552 Ga0495643_0011567 3300046522 Bacteria 5366
553 Ga0495643_0023577 3300046522 Bacteria 3498
554 Ga0495643_0069451 3300046522 Bacteria 1851
555 Ga0495643_0135622 3300046522 Bacteria 1232
556 Ga0495643_0144304 3300046522 Bacteria 1184
557 Ga0495644_0007599 3300046523 Bacteria 4178
558 Ga0495644_0019085 3300046523 Bacteria 2617
559 Ga0495644_0025718 3300046523 Bacteria 2234
560 Ga0495648_0003611 3300046524 Bacteria 13538
561 Ga0495648_0003802 3300046524 Bacteria 13114
562 Ga0495648_0003939 3300046524 Bacteria 12855
563 Ga0495648_0004313 3300046524 Bacteria 12186
564 Ga0495648_0004842 3300046524 Bacteria 11362
565 Ga0495648_0014956 3300046524 Bacteria 5653
566 Ga0495648_0027537 3300046524 Bacteria 3802
567 Ga0495648_0029030 3300046524 Bacteria 3676
568 Ga0495648_0033014 3300046524 Bacteria 3387
569 Ga0495648_0033669 3300046524 Bacteria 3343
570 Ga0495648_0042477 3300046524 Bacteria 2859
571 Ga0495648_0109928 3300046524 Bacteria 1502
572 Ga0495648_0214288 3300046524 Bacteria 954
573 Ga0495666_0002169 3300046526 Bacteria 9766
574 Ga0495666_0002936 3300046526 Bacteria 8544
575 Ga0495666_0111182 3300046526 Bacteria 1286
576 Ga0495642_0000129 3300046528 Bacteria 43448
577 Ga0495642_0000451 3300046528 Bacteria 21645
578 Ga0495642_0001117 3300046528 Bacteria 12374
579 Ga0495654_0002068 3300046530 Bacteria 13173
580 Ga0495654_0002329 3300046530 Bacteria 12274
581 Ga0495654_0002570 3300046530 Bacteria 11605
582 Ga0495654_0004652 3300046530 Bacteria 8098
583 Ga0495654_0006093 3300046530 Bacteria 6915
584 Ga0495654_0016124 3300046530 Bacteria 3956
585 Ga0495654_0021787 3300046530 Bacteria 3332
586 Ga0495654_0029803 3300046530 Bacteria 2781
587 Ga0495654_0070275 3300046530 Bacteria 1660
588 Ga0495654_0102770 3300046530 Bacteria 1313
589 Ga0495654_0106405 3300046530 Bacteria 1284
590 Ga0495654_0259165 3300046530 Bacteria 721
591 Ga0495587_0029164 3300046536 Bacteria 3351
592 Ga0495609_0001977 3300046538 Bacteria 12980
593 Ga0495609_0001996 3300046538 Bacteria 12893
594 Ga0495609_0002213 3300046538 Bacteria 12180
595 Ga0495609_0002280 3300046538 Bacteria 11959
596 Ga0495609_0002513 3300046538 Bacteria 11253
597 Ga0495609_0003524 3300046538 Bacteria 8921
598 Ga0495609_0007441 3300046538 Bacteria 5469
599 Ga0495609_0007745 3300046538 Bacteria 5324
600 Ga0495609_0013478 3300046538 Bacteria 3858
601 Ga0495597_0000786 3300046542 Bacteria 25054
602 Ga0495597_0002195 3300046542 Bacteria 12810
603 Ga0495597_0003354 3300046542 Bacteria 9424
604 Ga0495597_0008892 3300046542 Bacteria 5008
605 Ga0495597_0031312 3300046542 Bacteria 2421
606 Ga0495597_0104809 3300046542 Bacteria 1189
607 Ga0495597_0132402 3300046542 Bacteria 1033
608 Ga0495597_0216649 3300046542 Bacteria 761
609 Ga0495645_0004315 3300046543 Bacteria 9717
610 Ga0495622_0002101 3300046557 Bacteria 9738
611 Ga0495622_0002297 3300046557 Bacteria 9298
612 Ga0495622_0002956 3300046557 Bacteria 8096
613 Ga0495622_0024203 3300046557 Bacteria 2835
614 Ga0495633_0002525 3300046558 Bacteria 12864
615 Ga0495633_0003542 3300046558 Bacteria 10339
616 Ga0495633_0006568 3300046558 Bacteria 6873
617 Ga0495633_0073833 3300046558 Bacteria 1590
618 Ga0495656_0008102 3300046615 Bacteria 3740
619 Ga0495656_0010701 3300046615 Bacteria 3342
620 Ga0495668_0021999 3300046616 Bacteria 3648
621 Ga0495634_0000185 3300046642 Bacteria 57480
622 Ga0495634_0003382 3300046642 Bacteria 12805
623 Ga0495611_0001243 3300046648 Bacteria 13113
624 Ga0495611_0001320 3300046648 Bacteria 12601
625 Ga0495611_0050624 3300046648 Bacteria 1871
626 Ga0495611_0057041 3300046648 Bacteria 1769
627 Ga0495611_0075410 3300046648 Bacteria 1545
628 Ga0495611_0076777 3300046648 Bacteria 1531
629 Ga0495611_0187677 3300046648 Bacteria 965
630 Ga0495625_0003682 3300046660 Bacteria 14995
631 Ga0495625_0004511 3300046660 Bacteria 13132
632 Ga0495625_0005198 3300046660 Bacteria 11994
633 Ga0495625_0005490 3300046660 Bacteria 11545
634 Ga0495625_0022681 3300046660 Bacteria 4808
635 Ga0495625_0042362 3300046660 Bacteria 3309
636 Ga0495625_0049574 3300046660 Bacteria 3017
637 Ga0495625_0064046 3300046660 Bacteria 2594
638 Ga0495625_0101986 3300046660 Bacteria 1970
639 Ga0495625_0171286 3300046660 Bacteria 1449
640 Ga0495635_0001910 3300046663 Bacteria 14157
641 Ga0495659_0000303 3300046664 Bacteria 19513
642 Ga0495659_0003514 3300046664 Bacteria 4998
643 Ga0495659_0004826 3300046664 Bacteria 4245
644 Ga0495659_0022706 3300046664 Bacteria 2126
645 Ga0495659_0045182 3300046664 Bacteria 1586
646 Ga0495661_0005237 3300046665 Bacteria 9228
647 Ga0495661_0006410 3300046665 Bacteria 8270
648 Ga0495661_0021670 3300046665 Bacteria 4185
649 Ga0495661_0088665 3300046665 Bacteria 1765
650 Ga0495661_0121184 3300046665 Bacteria 1445
651 Ga0495588_0029489 3300046674 Bacteria 2752
652 Ga0495588_0036337 3300046674 Bacteria 2499
653 Ga0495599_0118418 3300046678 Bacteria 1647
654 Ga0495623_0001609 3300046679 Bacteria 15175
655 Ga0495646_0017027 3300046680 Bacteria 4614
656 Ga0495646_0032005 3300046680 Bacteria 3274
657 Ga0495669_0018466 3300046684 Bacteria 2998
658 Ga0495669_0158834 3300046684 Bacteria 1072
659 Ga0495613_0007193 3300046689 Bacteria 8289
660 Ga0495613_0291850 3300046689 Bacteria 1130
661 Ga0495624_0002859 3300046690 Bacteria 12930
662 Ga0495670_0001099 3300046691 Bacteria 13129
663 Ga0495670_0001137 3300046691 Bacteria 12924
664 Ga0495670_0001253 3300046691 Bacteria 12412
665 Ga0495670_0011321 3300046691 Bacteria 4386
666 Ga0495670_0023333 3300046691 Bacteria 3053
667 Ga0495670_0032752 3300046691 Bacteria 2585
668 Ga0495670_0271796 3300046691 Bacteria 905
669 Ga0495671_0001442 3300046692 Bacteria 15954
670 Ga0495671_0002093 3300046692 Bacteria 12787
671 Ga0495671_0002148 3300046692 Bacteria 12585
672 Ga0495671_0002252 3300046692 Bacteria 12266
673 Ga0495671_0002985 3300046692 Bacteria 10511
674 Ga0495671_0003677 3300046692 Bacteria 9337
675 Ga0495671_0115133 3300046692 Bacteria 1312
676 Ga0495671_0226476 3300046692 Bacteria 904
677 Ga0495649_0000164 3300046694 Bacteria 57766
678 Ga0495649_0002274 3300046694 Bacteria 13647
679 Ga0495649_0002501 3300046694 Bacteria 12908
680 Ga0495649_0008154 3300046694 Bacteria 6317
681 Ga0495649_0008266 3300046694 Bacteria 6270
682 Ga0495649_0027230 3300046694 Bacteria 3172
683 Ga0495649_0050150 3300046694 Bacteria 2266
684 Ga0495649_0074500 3300046694 Bacteria 1818
685 Ga0495649_0086526 3300046694 Bacteria 1672
686 Ga0495649_0088525 3300046694 Bacteria 1651
687 Ga0495649_0088528 3300046694 Bacteria 1651
688 Ga0495649_0218441 3300046694 Bacteria 986
689 Ga0495589_0000388 3300046794 Bacteria 33652
690 Ga0495589_0001589 3300046794 Bacteria 13032
691 Ga0495589_0002221 3300046794 Bacteria 10917
692 Ga0495589_0002244 3300046794 Bacteria 10860
693 Ga0495589_0002403 3300046794 Bacteria 10519
694 Ga0495589_0013539 3300046794 Bacteria 4206
695 Ga0495589_0032964 3300046794 Bacteria 2602
696 Ga0495600_0022154 3300046809 Bacteria 4077
697 Ga0495660_0001783 3300046810 Bacteria 14225
698 Ga0495660_0002108 3300046810 Bacteria 12874
699 Ga0495660_0002180 3300046810 Bacteria 12604
700 Ga0495660_0002294 3300046810 Bacteria 12280
701 Ga0495660_0002326 3300046810 Bacteria 12184
702 Ga0495660_0002371 3300046810 Bacteria 12049
703 Ga0495660_0003470 3300046810 Bacteria 9745
704 Ga0495660_0004585 3300046810 Bacteria 8340
705 Ga0495660_0009714 3300046810 Bacteria 5606
706 Ga0495660_0012261 3300046810 Bacteria 4973
707 Ga0495660_0015137 3300046810 Bacteria 4459
708 Ga0495660_0015738 3300046810 Bacteria 4367
709 Ga0495660_0024261 3300046810 Bacteria 3455
710 Ga0495660_0033494 3300046810 Bacteria 2880
711 Ga0495660_0038403 3300046810 Bacteria 2662
712 Ga0495660_0061248 3300046810 Bacteria 2019
713 Ga0495660_0074623 3300046810 Bacteria 1791
714 Ga0495581_0001624 3300047315 Bacteria 12529
715 Ga0495604_0012242 3300047317 Bacteria 6818
716 Ga0495604_0015937 3300047317 Bacteria 6000
717 Ga0495636_0002752 3300047318 Bacteria 6780
718 Ga0495636_0063579 3300047318 Bacteria 1564
719 Ga0495636_0194538 3300047318 Bacteria 924
720 Ga0495674_0010090 3300047319 Bacteria 8949
721 Ga0495672_0002092 3300047320 Bacteria 18711
722 Ga0495672_0003691 3300047320 Bacteria 12930
723 Ga0495672_0003740 3300047320 Bacteria 12842
724 Ga0495672_0004120 3300047320 Bacteria 12103
725 Ga0495672_0006514 3300047320 Bacteria 9018
726 Ga0495672_0007461 3300047320 Bacteria 8224
727 Ga0495672_0025057 3300047320 Bacteria 3827
728 Ga0495672_0027369 3300047320 Bacteria 3624
729 Ga0495672_0037126 3300047320 Bacteria 2984
730 Ga0495676_0004392 3300047321 Bacteria 12887
731 Ga0495676_0004452 3300047321 Bacteria 12815
732 Ga0495680_0012927 3300047322 Bacteria 7315
733 Ga0495680_0020278 3300047322 Bacteria 5596
734 Ga0495680_0026675 3300047322 Bacteria 4758
735 Ga0495683_0000730 3300047323 Bacteria 23860
736 Ga0495683_0001672 3300047323 Bacteria 14116
737 Ga0495683_0002276 3300047323 Bacteria 11717
738 Ga0495683_0002987 3300047323 Bacteria 9979
739 Ga0495683_0008455 3300047323 Bacteria 5504
740 Ga0495683_0009474 3300047323 Bacteria 5186
741 Ga0495683_0015110 3300047323 Bacteria 4020
742 Ga0495683_0108192 3300047323 Bacteria 1329
743 Ga0495683_0122419 3300047323 Bacteria 1233
744 Ga0495687_005151 3300047443 Bacteria 8458
745 Ga0495687_005862 3300047443 Bacteria 7691
746 Ga0495687_011281 3300047443 Bacteria 4816
747 Ga0495687_046477 3300047443 Bacteria 1874
748 Ga0495675_0084194 3300047444 Bacteria 2001
749 Ga0495677_0000637 3300047445 Bacteria 14132
750 Ga0495677_0041190 3300047445 Bacteria 1689
751 Ga0495679_001495 3300047446 Bacteria 13203
752 Ga0495679_001573 3300047446 Bacteria 12866
753 Ga0495679_002128 3300047446 Bacteria 10417
754 Ga0495679_004622 3300047446 Bacteria 6276
755 Ga0495685_003422 3300047447 Bacteria 5066
756 Ga0495673_0001034 3300047469 Bacteria 24508
757 Ga0495673_0002425 3300047469 Bacteria 13130
758 Ga0495673_0006993 3300047469 Bacteria 6555
759 Ga0495673_0007956 3300047469 Bacteria 6017
760 Ga0495673_0011490 3300047469 Bacteria 4758
761 Ga0495673_0029492 3300047469 Bacteria 2588
762 Ga0495673_0035386 3300047469 Bacteria 2301
763 Ga0495673_0039796 3300047469 Bacteria 2130
764 Ga0495673_0070352 3300047469 Bacteria 1473
765 Ga0495681_0000806 3300047470 Bacteria 24171
766 Ga0495681_0002142 3300047470 Bacteria 14310
767 Ga0495681_0002256 3300047470 Bacteria 13856
768 Ga0495681_0002454 3300047470 Bacteria 13238
769 Ga0495681_0003233 3300047470 Bacteria 11359
770 Ga0495681_0006531 3300047470 Bacteria 7641
771 Ga0495681_0006833 3300047470 Bacteria 7414
772 Ga0495681_0008447 3300047470 Bacteria 6460
773 Ga0495681_0009980 3300047470 Bacteria 5785
774 Ga0495681_0021924 3300047470 Bacteria 3430
775 Ga0495681_0232709 3300047470 Bacteria 734
776 Ga0495686_0002408 3300047472 Bacteria 17743
777 Ga0495686_0003772 3300047472 Bacteria 12877
778 Ga0495686_0003919 3300047472 Bacteria 12539
779 Ga0495686_0104074 3300047472 Bacteria 1709
780 Ga0495686_0245932 3300047472 Bacteria 1007
781 Ga0495593_0019133 3300047673 Bacteria 3843
782 Ga0495593_0021101 3300047673 Bacteria 3641
783 Ga0495602_0005869 3300048088 Bacteria 12889
784 Ga0495602_0077931 3300048088 Bacteria 2801
785 Ga0495626_0002272 3300048091 Bacteria 13681
786 Ga0495626_0002380 3300048091 Bacteria 13133
787 Ga0495626_0002569 3300048091 Bacteria 12436
788 Ga0495626_0002714 3300048091 Bacteria 11951
789 Ga0495626_0002991 3300048091 Bacteria 11197
790 Ga0495626_0006133 3300048091 Bacteria 6889
791 Ga0495626_0008711 3300048091 Bacteria 5527
792 Ga0495626_0148753 3300048091 Bacteria 989
793 Ga0496101_0499093 3300048904 Bacteria 961
794 Ga0496102_0000604 3300048905 Bacteria 37459
795 Ga0496103_0002176 3300048906 Bacteria 12448
796 Ga0496103_0333104 3300048906 Bacteria 976
797 Ga0496106_0007313 3300048909 Bacteria 8162
798 Ga0496106_0522325 3300048909 Bacteria 953
799 Ga0496107_0046072 3300048910 Bacteria 3138
800 Ga0496111_0092207 3300048914 Bacteria 2220
801 Ga0496112_0086937 3300048915 Bacteria 3093
802 Ga0496113_0725254 3300048916 Bacteria 792
803 Ga0496114_0440471 3300048917 Bacteria 1154
804 Ga0496115_0409177 3300048918 Bacteria 1100
805 Ga0496116_0000286 3300048919 Bacteria 86171
806 Ga0496116_0000730 3300048919 Bacteria 41965
807 Ga0496116_0004436 3300048919 Bacteria 13396
808 Ga0496116_0004518 3300048919 Bacteria 13241
809 Ga0496116_0004704 3300048919 Bacteria 12896
810 Ga0496117_0000773 3300048920 Bacteria 50373
811 Ga0496117_0006000 3300048920 Bacteria 12508
812 Ga0496117_0019564 3300048920 Bacteria 5555
813 Ga0496117_0043804 3300048920 Bacteria 3249
814 Ga0496117_0055149 3300048920 Bacteria 2779
815 Ga0496117_0058433 3300048920 Bacteria 2671
816 Ga0496117_0193059 3300048920 Bacteria 1157
817 Ga0496118_0003842 3300048921 Bacteria 18470
818 Ga0496118_0006159 3300048921 Bacteria 13304
819 Ga0496118_0007853 3300048921 Bacteria 11188
820 Ga0496118_0021304 3300048921 Bacteria 5711
821 Ga0496118_0123185 3300048921 Bacteria 1684
822 Ga0496118_0124459 3300048921 Bacteria 1672
823 Ga0496118_0196821 3300048921 Bacteria 1198
824 Ga0496119_0206963 3300048922 Bacteria 1012
825 Ga0496120_0012545 3300048923 Bacteria 5763
826 Ga0496120_0326430 3300048923 Bacteria 695
827 Ga0496121_0000404 3300048924 Bacteria 86102
828 Ga0496121_0007241 3300048924 Bacteria 13433
829 Ga0496121_0014324 3300048924 Bacteria 8428
830 Ga0496121_0071379 3300048924 Bacteria 2793
831 Ga0496121_0099767 3300048924 Bacteria 2243
832 Ga0496121_0122479 3300048924 Bacteria 1961
833 Ga0496121_0237758 3300048924 Bacteria 1271
834 Ga0496122_0005979 3300048925 Bacteria 14236
835 Ga0496122_0006393 3300048925 Bacteria 13542
836 Ga0496122_0010516 3300048925 Bacteria 9515
837 Ga0496122_0273899 3300048925 Bacteria 927
838 Ga0496123_0000908 3300048926 Bacteria 46619
839 Ga0496123_0005686 3300048926 Bacteria 12437
840 Ga0496123_0027389 3300048926 Bacteria 4246
841 Ga0496123_0050483 3300048926 Bacteria 2778
842 Ga0496123_0193566 3300048926 Bacteria 1049
843 Ga0496124_0020696 3300048927 Bacteria 6071
844 Ga0496124_0033789 3300048927 Bacteria 4495
845 Ga0496124_0041243 3300048927 Bacteria 3985
846 Ga0496124_0045904 3300048927 Bacteria 3744
847 Ga0496124_0048201 3300048927 Bacteria 3642
848 Ga0496124_0062162 3300048927 Bacteria 3126
849 Ga0496124_0287774 3300048927 Bacteria 1194
850 Ga0496125_0014923 3300048928 Bacteria 7544
851 Ga0496125_0026030 3300048928 Bacteria 5342
852 Ga0496125_0033046 3300048928 Bacteria 4585
853 Ga0496125_0034532 3300048928 Bacteria 4456
854 Ga0496125_0043408 3300048928 Bacteria 3816
855 Ga0496126_0273102 3300048929 Bacteria 1402
856 Ga0496126_0670010 3300048929 Bacteria 809
857 Ga0495678_002293 3300049459 Bacteria 13248
858 Ga0495678_002324 3300049459 Bacteria 13092
859 Ga0495678_002486 3300049459 Bacteria 12423
860 Ga0495678_002506 3300049459 Bacteria 12365
861 Ga0495678_002601 3300049459 Bacteria 12054
862 Ga0495678_002835 3300049459 Bacteria 11226
863 Ga0495678_004648 3300049459 Bacteria 7874
864 Ga0495678_027181 3300049459 Bacteria 2430
865 Ga0495678_037460 3300049459 Bacteria 1970
866 Ga0495678_039972 3300049459 Bacteria 1888
867 Ga0495678_096941 3300049459 Bacteria 1028
868 Ga0495678_110234 3300049459 Bacteria 939
869 Ga0495682_0001251 3300049460 Bacteria 14346
870 Ga0495682_0002016 3300049460 Bacteria 10020
871 Ga0495682_0003654 3300049460 Bacteria 6781
872 Ga0495682_0005470 3300049460 Bacteria 5271
873 Ga0495682_0011752 3300049460 Bacteria 3364
874 Ga0495682_0106812 3300049460 Bacteria 1003
875 Ga0501222_000201 3300049662 Bacteria 10660
876 Ga0501252_000802 3300049682 Bacteria 2638
877 Ga0501241_000086 3300049758 Bacteria 20208
878 Ga0501269_001630 3300049766 Bacteria 2885
879 Ga0501269_004107 3300049766 Bacteria 1751
880 nmdc:mga03683_7439_c1 3300050489 Bacteria 3802
881 nmdc:mga00v17_113143_c1 3300050491 Bacteria 1723
882 nmdc:mga00v17_69459_c1 3300050491 Bacteria 2180
883 nmdc:mga08x19_280063_c1 3300050514 Bacteria 1155
884 nmdc:mga08x19_317394_c1 3300050514 Bacteria 1084
885 Ga0500572_000540 3300053111 Bacteria 12837
886 Ga0500621_004535 3300053126 Bacteria 4147
887 Ga0500586_007980 3300053145 Bacteria 2859

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0048201 Ga0496124_0048201_2255_2854 183
2 iso_pu_bacteria 2713897148 2715751111 185
3 iso_pu_bacteria 2842832357 2842837847 185
4 iso_pu_bacteria 2842843487 2842847852 185
5 iso_pu_bacteria 2919385768 2919391019 185
6 iso_pu_bacteria 2919487758 2919492065 185
7 iso_pu_bacteria 2974289157 2974293074 185
8 iso_pu_bacteria 2998139840 2998140742 185
9 iso_pu_bacteria 3007855910 3007857653 185
10 iso_pu_bacteria 8029995093 8030000000 185
11 iso_pu_bacteria 8056166840 8056170306 185
12 iso_pu_bacteria 3007419365 3007420265 186
13 iso_pu_bacteria 8054285046 8054289640 186
14 iso_pu_bacteria 8056143049 8056144032 186
15 iso_pu_bacteria 2511231004 2511255340 187
16 iso_pu_bacteria 2511231006 2511263740 187
17 iso_pu_bacteria 2511231007 2511269301 187
18 iso_pu_bacteria 2511231010 2511289596 187
19 iso_pu_bacteria 2511231011 2511294183 187
20 iso_pu_bacteria 2511231012 2511300922 187
21 iso_pu_bacteria 2511231015 2511318125 187
22 iso_pu_bacteria 2511231016 2511323895 187
23 iso_pu_bacteria 2511231018 2511335790 187
24 iso_pu_bacteria 2511231019 2511344879 187
25 iso_pu_bacteria 2511231020 2511348933 187
26 iso_pu_bacteria 2511231022 2511360604 187
27 iso_pu_bacteria 2511231023 2511370021 187
28 iso_pu_bacteria 2511231031 2511412352 187
29 iso_pu_bacteria 2512047018 2512329094 187
30 iso_pu_bacteria 2582580891 2583790164 187
31 iso_pu_bacteria 2597489887 2597855926 187
32 iso_pu_bacteria 2599185167 2599399677 187
33 iso_pu_bacteria 2599185179 2599454376 187
34 iso_pu_bacteria 2599185185 2599487707 187
35 iso_pu_bacteria 2599185188 2599505140 187
36 iso_pu_bacteria 2599185190 2599515784 187
37 iso_pu_bacteria 2599185191 2599522183 187
38 iso_pu_bacteria 2599185212 2599613639 187
39 iso_pu_bacteria 2599185248 2599772148 187
40 iso_pu_bacteria 2599185257 2599805718 187
41 iso_pu_bacteria 2599185289 2599888169 187
42 iso_pu_bacteria 2599185290 2599895162 187
43 iso_pu_bacteria 2599185291 2599900186 187
44 iso_pu_bacteria 2599185300 2599934450 187
45 iso_pu_bacteria 2599185302 2599945974 187
46 iso_pu_bacteria 2599185304 2599957042 187
47 iso_pu_bacteria 2599185305 2599962370 187
48 iso_pu_bacteria 2599185306 2599965001 187
49 iso_pu_bacteria 2599185308 2599976275 187
50 iso_pu_bacteria 2599185309 2599986448 187
51 iso_pu_bacteria 2599185310 2599987585 187
52 iso_pu_bacteria 2599185311 2599997147 187
53 iso_pu_bacteria 2599185312 2600003031 187
54 iso_pu_bacteria 2599185313 2600006750 187
55 iso_pu_bacteria 2599185314 2600010411 187
56 iso_pu_bacteria 2599185315 2600018571 187
57 iso_pu_bacteria 2599185316 2600023868 187
58 iso_pu_bacteria 2599185317 2600031925 187
59 iso_pu_bacteria 2599185318 2600037227 187
60 iso_pu_bacteria 2599185319 2600044032 187
61 iso_pu_bacteria 2599185320 2600045913 187
62 iso_pu_bacteria 2599185321 2600053090 187
63 iso_pu_bacteria 2599185322 2600060663 187
64 iso_pu_bacteria 2599185323 2600067691 187
65 iso_pu_bacteria 2599185324 2600071408 187
66 iso_pu_bacteria 2599185325 2600077918 187
67 iso_pu_bacteria 2600254930 2600359854 187
68 iso_pu_bacteria 2600254931 2600365962 187
69 iso_pu_bacteria 2600255318 2601800911 187
70 iso_pu_bacteria 2603880185 2606074980 187
71 iso_pu_bacteria 2603880199 2606127844 187
72 iso_pu_bacteria 2623620443 2624478498 187
73 iso_pu_bacteria 2623620446 2624490036 187
74 iso_pu_bacteria 2643221565 2643843913 187
75 iso_pu_bacteria 2643221589 2643957162 187
76 iso_pu_bacteria 2643221602 2644020755 187
77 iso_pu_bacteria 2643221650 2644284083 187
78 iso_pu_bacteria 2651869719 2652548370 187
79 iso_pu_bacteria 2667528170 2671092497 187
80 iso_pu_bacteria 2667528176 2671128209 187
81 iso_pu_bacteria 2671180172 2671767546 187
82 iso_pu_bacteria 2675903515 2678261249 187
83 iso_pu_bacteria 2713897149 2715759955 187
84 iso_pu_bacteria 2738541265 2738671124 187
85 iso_pu_bacteria 2738541282 2738749518 187
86 iso_pu_bacteria 2738541303 2738858558 187
87 iso_pu_bacteria 2738543025 2739315379 187
88 iso_pu_bacteria 2740892503 2743735332 187
89 iso_pu_bacteria 2744054620 2745006564 187
90 iso_pu_bacteria 2773857670 2774120967 187
91 iso_pu_bacteria 2773857673 2774138260 187
92 iso_pu_bacteria 2784132063 2784260771 187
93 iso_pu_bacteria 2784132072 2784317198 187
94 iso_pu_bacteria 2791355520 2794598496 187
95 iso_pu_bacteria 2808606361 2808857944 187
96 iso_pu_bacteria 2808606376 2808926476 187
97 iso_pu_bacteria 2808606377 2808932080 187
98 iso_pu_bacteria 2808606378 2808938214 187
99 iso_pu_bacteria 2808606380 2808948600 187
100 iso_pu_bacteria 2808606381 2808954070 187
101 iso_pu_bacteria 2808606382 2808961748 187
102 iso_pu_bacteria 2808606383 2808966466 187
103 iso_pu_bacteria 2808606389 2809001296 187
104 iso_pu_bacteria 2808606445 2809215422 187
105 iso_pu_bacteria 2816332298 2817493343 187
106 iso_pu_bacteria 2818991456 2819658048 187
107 iso_pu_bacteria 2825651385 2825654016 187
108 iso_pu_bacteria 2834028612 2834034280 187
109 iso_pu_bacteria 2852657418 2852663233 187
110 iso_pu_bacteria 2860339153 2860343416 187
111 iso_pu_bacteria 2878029506 2878030440 187
112 iso_pu_bacteria 2880230671 2880231384 187
113 iso_pu_bacteria 2904518522 2904523476 187
114 iso_pu_bacteria 2904550169 2904550759 187
115 iso_pu_bacteria 2913036834 2913037533 187
116 iso_pu_bacteria 2919063839 2919067592 187
117 iso_pu_bacteria 2919456309 2919462191 187
118 iso_pu_bacteria 2919481497 2919482425 187
119 iso_pu_bacteria 2923153595 2923154333 187
120 iso_pu_bacteria 2923586266 2923591585 187
121 iso_pu_bacteria 2929144301 2929145070 187
122 iso_pu_bacteria 2931369376 2931371597 187
123 iso_pu_bacteria 2931390751 2931395776 187
124 iso_pu_bacteria 2931396565 2931399118 187
125 iso_pu_bacteria 2945928738 2945931568 187
126 iso_pu_bacteria 2969304461 2969305237 187
127 iso_pu_bacteria 2984286254 2984291712 187
128 iso_pu_bacteria 2988728565 2988732454 187
129 iso_pu_bacteria 3007395558 3007399887 187
130 iso_pu_bacteria 3007511990 3007512000 187
131 iso_pu_bacteria 3007614139 3007617156 187
132 iso_pu_bacteria 3007619802 3007623268 187
133 iso_pu_bacteria 3007718800 3007723269 187
134 iso_pu_bacteria 3007861166 3007864053 187
135 iso_pu_bacteria 3007866637 3007867279 187
136 iso_pu_bacteria 8015687852 8015688597 187
137 iso_pu_bacteria 8019769354 8019770562 187
138 iso_pu_bacteria 8019775933 8019782132 187
139 iso_pu_bacteria 8055770955 8055771695 187
140 iso_pu_bacteria 8055817908 8055823221 187
141 iso_pu_bacteria 8056155041 8056160865 187
142 iso_pu_bacteria 8056161164 8056162922 187
143 iso_pu_bacteria 8056172158 8056176443 187
144 iso_pu_bacteria 8056177738 8056180946 187
145 iso_pu_bacteria 8056569372 8056569375 187
146 iso_pu_bacteria 8057798959 8057802970 187
147 3300003751 Ga0055538_1000028 Ga0055538_1000028213 188
148 3300003752 Ga0055539_1000037 Ga0055539_1000037213 188
149 3300003756 Ga0055533_1000047 Ga0055533_1000047213 188
150 3300003758 Ga0055532_1000065 Ga0055532_10000654 188
151 3300003759 Ga0055525_1000176 Ga0055525_10001764 188
152 3300003841 Ga0055541_1000025 Ga0055541_1000025213 188
153 3300005344 Ga0070661_100001008 Ga0070661_1000010085 188
154 3300005564 Ga0070664_100001301 Ga0070664_1000013015 188
155 3300006051 Ga0075364_10072244 Ga0075364_100722442 188
156 3300009036 Ga0105244_10003144 Ga0105244_100031445 188
157 3300009092 Ga0105250_10000275 Ga0105250_1000027533 188
158 3300009176 Ga0105242_10006290 Ga0105242_100062903 188
159 3300009545 Ga0105237_10003115 Ga0105237_100031155 188
160 3300011119 Ga0105246_10001653 Ga0105246_100016534 188
161 3300011119 Ga0105246_10073019 Ga0105246_100730193 188
162 3300013105 Ga0157369_10003571 Ga0157369_100035714 188
163 3300013308 Ga0157375_10004942 Ga0157375_100049423 188
164 3300017792 Ga0163161_10002705 Ga0163161_100027054 188
165 3300017792 Ga0163161_10068681 Ga0163161_100686812 188
166 3300025224 Ga0209784_100032 Ga0209784_1000325 188
167 3300025225 Ga0209566_100036 Ga0209566_1000365 188
168 3300025226 Ga0209674_100054 Ga0209674_1000545 188
169 3300025229 Ga0209147_100055 Ga0209147_1000555 188
170 3300025230 Ga0209563_100055 Ga0209563_100055301 188
171 3300025242 Ga0209258_100239 Ga0209258_10023993 188
172 3300025246 Ga0209646_1000736 Ga0209646_10007363 188
173 3300025253 Ga0209677_100033 Ga0209677_1000335 188
174 3300025711 Ga0207696_1000220 Ga0207696_100022074 188
175 3300025728 Ga0207655_1001232 Ga0207655_100123219 188
176 3300025728 Ga0207655_1003278 Ga0207655_10032783 188
177 3300025735 Ga0207713_1003046 Ga0207713_10030463 188
178 3300025914 Ga0207671_10002416 Ga0207671_100024165 188
179 3300025920 Ga0207649_10000006 Ga0207649_100000065 188
180 3300025925 Ga0207650_10000276 Ga0207650_100002765 188
181 3300025934 Ga0207686_10078743 Ga0207686_100787432 188
182 3300025945 Ga0207679_10000010 Ga0207679_100000105 188
183 3300028379 Ga0268266_10463142 Ga0268266_104631422 188
184 3300031507 Ga0307509_10032347 Ga0307509_100323473 188
185 3300031731 Ga0307405_10000760 Ga0307405_100007604 188
186 3300031911 Ga0307412_10364290 Ga0307412_103642901 188
187 3300046512 Ga0495610_0003484 Ga0495610_0003484_2411_2977 188
188 3300046512 Ga0495610_0118356 Ga0495610_0118356_333_899 188
189 3300046530 Ga0495654_0021787 Ga0495654_0021787_281_847 188
190 3300046810 Ga0495660_0003470 Ga0495660_0003470_5933_6499 188
191 3300047446 Ga0495679_002128 Ga0495679_002128_384_950 188
192 3300048921 Ga0496118_0196821 Ga0496118_0196821_90_656 188
193 3300048923 Ga0496120_0326430 Ga0496120_0326430_97_663 188
194 3300048924 Ga0496121_0237758 Ga0496121_0237758_374_940 188
195 3300048925 Ga0496122_0273899 Ga0496122_0273899_104_670 188
196 3300048926 Ga0496123_0193566 Ga0496123_0193566_264_830 188
197 3300048928 Ga0496125_0026030 Ga0496125_0026030_2408_2974 188
198 3300048928 Ga0496125_0043408 Ga0496125_0043408_3031_3597 188
199 3300003781 Ga0055536_1000105 Ga0055536_100010551 189
200 3300005288 Ga0065714_10084720 Ga0065714_100847202 189
201 3300013100 Ga0157373_10021739 Ga0157373_100217394 189
202 3300013102 Ga0157371_10005069 Ga0157371_100050695 189
203 3300013105 Ga0157369_10007090 Ga0157369_100070904 189
204 3300013105 Ga0157369_10017894 Ga0157369_100178944 189
205 3300015261 Ga0182006_1001434 Ga0182006_10014345 189
206 3300025292 Ga0209676_1000428 Ga0209676_10004285 189
207 3300027111 Ga0209281_1013120 Ga0209281_10131201 189
208 3300028379 Ga0268266_10008427 Ga0268266_100084272 189
209 3300030734 Ga0316179_1010585 Ga0316179_10105854 189
210 3300030735 Ga0316178_1004939 Ga0316178_100493919 189
211 3300031548 Ga0307408_100002080 Ga0307408_1000020805 189
212 3300031548 Ga0307408_100434195 Ga0307408_1004341952 189
213 3300031824 Ga0307413_10079927 Ga0307413_100799272 189
214 3300031911 Ga0307412_10050604 Ga0307412_100506042 189
215 3300031911 Ga0307412_10076907 Ga0307412_100769072 189
216 3300031911 Ga0307412_10249065 Ga0307412_102490652 189
217 3300031995 Ga0307409_100034418 Ga0307409_1000344184 189
218 3300032004 Ga0307414_10002708 Ga0307414_100027084 189
219 3300032004 Ga0307414_10196071 Ga0307414_101960712 189
220 3300032005 Ga0307411_10246204 Ga0307411_102462042 189
221 3300041405 Ga0439438_000216 Ga0439438_000216_16551_17120 189
222 3300041405 Ga0439438_000987 Ga0439438_000987_9393_9962 189
223 3300041407 Ga0439447_036170 Ga0439447_036170_626_1195 189
224 3300041411 Ga0439466_0053660 Ga0439466_0053660_279_848 189
225 3300042002 Ga0439442_011964 Ga0439442_011964_1056_1625 189
226 3300042004 Ga0439445_0000618 Ga0439445_0000618_6037_6606 189
227 3300042006 Ga0439432_000960 Ga0439432_000960_907_1476 189
228 3300042006 Ga0439432_003401 Ga0439432_003401_1414_1983 189
229 3300042006 Ga0439432_005090 Ga0439432_005090_3472_4041 189
230 3300042010 Ga0439452_000975 Ga0439452_000975_2697_3266 189
231 3300042013 Ga0439456_015463 Ga0439456_015463_51_620 189
232 3300042016 Ga0439463_010205 Ga0439463_010205_1643_2212 189
233 3300042115 Ga0450911_000478 Ga0450911_000478_2696_3265 189
234 3300042130 Ga0450892_001614 Ga0450892_001614_130_699 189
235 3300042138 Ga0450903_007644 Ga0450903_007644_286_855 189
236 3300042139 Ga0450904_006689 Ga0450904_006689_322_891 189
237 3300042145 Ga0450906_000161 Ga0450906_000161_9559_10128 189
238 3300042146 Ga0450907_006455 Ga0450907_006455_1086_1655 189
239 3300042184 Ga0450908_009473 Ga0450908_009473_1179_1748 189
240 3300042531 Ga0450918_008337 Ga0450918_008337_152_721 189
241 3300049682 Ga0501252_000802 Ga0501252_000802_884_1453 189
242 3300049758 Ga0501241_000086 Ga0501241_000086_9554_10123 189
243 3300049766 Ga0501269_004107 Ga0501269_004107_687_1256 189
244 3300005331 Ga0070670_100001943 Ga0070670_1000019438 190
245 3300025925 Ga0207650_10000299 Ga0207650_100002995 190
246 3300031548 Ga0307408_100106913 Ga0307408_1001069132 190
247 3300031731 Ga0307405_10006009 Ga0307405_100060095 190
248 3300031824 Ga0307413_10060076 Ga0307413_100600762 190
249 3300031903 Ga0307407_10200422 Ga0307407_102004222 190
250 3300031911 Ga0307412_10000617 Ga0307412_100006175 190
251 3300031911 Ga0307412_10001467 Ga0307412_100014675 190
252 3300032005 Ga0307411_10005345 Ga0307411_100053453 190
253 3300042147 Ga0450910_014098 Ga0450910_014098_134_706 190
254 3300049766 Ga0501269_001630 Ga0501269_001630_1023_1595 190
255 2124908027 MRS2a_Contig_391 MRS2a_00281010 191
256 2124908027 MRS2a_Contig_90 MRS2a_00743340 191
257 2162886007 SwRhRL2b_contig_710988 SwRhRL2b_0795.00007670 191
258 3300002737 JGI25162J39368_1000167 JGI25162J39368_100016764 191
259 3300002737 JGI25162J39368_1000186 JGI25162J39368_100018643 191
260 3300002771 JGI25163J39215_1000185 JGI25163J39215_10001859 191
261 3300002771 JGI25163J39215_1000378 JGI25163J39215_10003785 191
262 3300002772 JGI25164J39214_1000131 JGI25164J39214_100013164 191
263 3300002772 JGI25164J39214_1000150 JGI25164J39214_10001509 191
264 3300003214 JGI25165J46597_1000252 JGI25165J46597_10002525 191
265 3300003214 JGI25165J46597_1000277 JGI25165J46597_10002779 191
266 3300003759 Ga0055525_1007889 Ga0055525_10078892 191
267 3300003781 Ga0055536_1000104 Ga0055536_10001045 191
268 3300003781 Ga0055536_1000180 Ga0055536_10001809 191
269 3300003791 Ga0055530_10000213 Ga0055530_100002139 191
270 3300003791 Ga0055530_10000274 Ga0055530_1000027427 191
271 3300003791 Ga0055530_10000768 Ga0055530_1000076815 191
272 3300003791 Ga0055530_10048558 Ga0055530_100485582 191
273 3300003792 Ga0055540_1000135 Ga0055540_10001355 191
274 3300003792 Ga0055540_1000270 Ga0055540_100027027 191
275 3300003792 Ga0055540_1000413 Ga0055540_10004138 191
276 3300003794 Ga0055531_10000350 Ga0055531_1000035035 191
277 3300003794 Ga0055531_10063662 Ga0055531_100636621 191
278 3300005288 Ga0065714_10002436 Ga0065714_100024365 191
279 3300005288 Ga0065714_10014541 Ga0065714_100145412 191
280 3300005288 Ga0065714_10079296 Ga0065714_100792962 191
281 3300005289 Ga0065704_10019143 Ga0065704_100191432 191
282 3300005289 Ga0065704_10071876 Ga0065704_100718762 191
283 3300005289 Ga0065704_10159964 Ga0065704_101599642 191
284 3300005339 Ga0070660_100878713 Ga0070660_1008787131 191
285 3300005353 Ga0070669_100000203 Ga0070669_10000020344 191
286 3300005353 Ga0070669_100000746 Ga0070669_10000074613 191
287 3300005435 Ga0070714_100098727 Ga0070714_1000987272 191
288 3300005457 Ga0070662_100000469 Ga0070662_1000004695 191
289 3300005457 Ga0070662_100031311 Ga0070662_1000313114 191
290 3300005539 Ga0068853_100000107 Ga0068853_1000001075 191
291 3300005564 Ga0070664_100012771 Ga0070664_1000127713 191
292 3300005578 Ga0068854_100053493 Ga0068854_1000534932 191
293 3300005834 Ga0068851_10000032 Ga0068851_100000325 191
294 3300006051 Ga0075364_10070877 Ga0075364_100708773 191
295 3300006051 Ga0075364_10323583 Ga0075364_103235832 191
296 3300006058 Ga0075432_10011413 Ga0075432_100114131 191
297 3300006058 Ga0075432_10029452 Ga0075432_100294521 191
298 3300006058 Ga0075432_10089782 Ga0075432_100897822 191
299 3300006177 Ga0075362_10066586 Ga0075362_100665862 191
300 3300006177 Ga0075362_10077407 Ga0075362_100774072 191
301 3300006914 Ga0075436_100069387 Ga0075436_1000693872 191
302 3300006946 Ga0079104_1000362 Ga0079104_10003625 191
303 3300006948 Ga0099826_10011004 Ga0099826_100110043 191
304 3300009011 Ga0105251_10006139 Ga0105251_100061392 191
305 3300009011 Ga0105251_10155776 Ga0105251_101557762 191
306 3300009036 Ga0105244_10002516 Ga0105244_100025164 191
307 3300009036 Ga0105244_10002835 Ga0105244_100028354 191
308 3300009036 Ga0105244_10008732 Ga0105244_100087323 191
309 3300009036 Ga0105244_10015291 Ga0105244_100152912 191
310 3300009036 Ga0105244_10018916 Ga0105244_100189162 191
311 3300009036 Ga0105244_10020581 Ga0105244_100205812 191
312 3300009036 Ga0105244_10055429 Ga0105244_100554291 191
313 3300009036 Ga0105244_10067683 Ga0105244_100676832 191
314 3300009092 Ga0105250_10000297 Ga0105250_1000029732 191
315 3300009092 Ga0105250_10003737 Ga0105250_100037373 191
316 3300009092 Ga0105250_10007997 Ga0105250_100079972 191
317 3300009148 Ga0105243_10000174 Ga0105243_1000017467 191
318 3300009148 Ga0105243_10003246 Ga0105243_100032465 191
319 3300009148 Ga0105243_10057750 Ga0105243_100577502 191
320 3300009176 Ga0105242_10792408 Ga0105242_107924082 191
321 3300011119 Ga0105246_10003529 Ga0105246_100035293 191
322 3300011119 Ga0105246_10095828 Ga0105246_100958282 191
323 3300011119 Ga0105246_10344871 Ga0105246_103448711 191
324 3300011119 Ga0105246_10430731 Ga0105246_104307312 191
325 3300012498 Ga0157345_1000142 Ga0157345_10001424 191
326 3300012498 Ga0157345_1001470 Ga0157345_10014702 191
327 3300012502 Ga0157347_1001370 Ga0157347_10013702 191
328 3300013100 Ga0157373_10002919 Ga0157373_100029195 191
329 3300013100 Ga0157373_10003453 Ga0157373_100034534 191
330 3300013100 Ga0157373_10009898 Ga0157373_100098985 191
331 3300013100 Ga0157373_10069372 Ga0157373_100693722 191
332 3300013102 Ga0157371_10000244 Ga0157371_100002445 191
333 3300013102 Ga0157371_10001413 Ga0157371_1000141318 191
334 3300013104 Ga0157370_10024126 Ga0157370_100241263 191
335 3300013104 Ga0157370_10038317 Ga0157370_100383174 191
336 3300013104 Ga0157370_10053845 Ga0157370_100538453 191
337 3300013104 Ga0157370_10306529 Ga0157370_103065292 191
338 3300013105 Ga0157369_10007109 Ga0157369_100071095 191
339 3300013306 Ga0163162_10000092 Ga0163162_1000009263 191
340 3300013306 Ga0163162_10003797 Ga0163162_1000379712 191
341 3300013307 Ga0157372_10004825 Ga0157372_100048255 191
342 3300013308 Ga0157375_10150709 Ga0157375_101507092 191
343 3300013308 Ga0157375_10656918 Ga0157375_106569182 191
344 3300014497 Ga0182008_10000158 Ga0182008_100001585 191
345 3300014497 Ga0182008_10001704 Ga0182008_100017045 191
346 3300014497 Ga0182008_10005864 Ga0182008_100058643 191
347 3300014497 Ga0182008_10024454 Ga0182008_100244543 191
348 3300015261 Ga0182006_1000235 Ga0182006_100023543 191
349 3300015261 Ga0182006_1000653 Ga0182006_10006533 191
350 3300015261 Ga0182006_1004794 Ga0182006_10047943 191
351 3300015261 Ga0182006_1103496 Ga0182006_11034962 191
352 3300015261 Ga0182006_1109663 Ga0182006_11096631 191
353 3300015261 Ga0182006_1138919 Ga0182006_11389192 191
354 3300015262 Ga0182007_10001596 Ga0182007_100015964 191
355 3300015262 Ga0182007_10012849 Ga0182007_100128492 191
356 3300015265 Ga0182005_1000742 Ga0182005_10007426 191
357 3300015265 Ga0182005_1025476 Ga0182005_10254761 191
358 3300017792 Ga0163161_10002110 Ga0163161_100021104 191
359 3300017792 Ga0163161_10014922 Ga0163161_100149225 191
360 3300017792 Ga0163161_10019391 Ga0163161_100193912 191
361 3300017792 Ga0163161_10086692 Ga0163161_100866923 191
362 3300025207 Ga0209760_100072 Ga0209760_1000725 191
363 3300025207 Ga0209760_100100 Ga0209760_1001009 191
364 3300025230 Ga0209563_100401 Ga0209563_1004016 191
365 3300025231 Ga0207427_100116 Ga0207427_10011692 191
366 3300025231 Ga0207427_100180 Ga0207427_1001809 191
367 3300025233 Ga0209437_100003 Ga0209437_1000031469 191
368 3300025233 Ga0209437_100309 Ga0209437_1003099 191
369 3300025256 Ga0209759_1043999 Ga0209759_10439991 191
370 3300025261 Ga0209233_1000008 Ga0209233_10000081249 191
371 3300025261 Ga0209233_1000220 Ga0209233_100022092 191
372 3300025291 Ga0209675_1001904 Ga0209675_10019041 191
373 3300025292 Ga0209676_1000255 Ga0209676_100025597 191
374 3300025292 Ga0209676_1000357 Ga0209676_100035767 191
375 3300025292 Ga0209676_1013675 Ga0209676_10136752 191
376 3300025292 Ga0209676_1020328 Ga0209676_10203282 191
377 3300025298 Ga0209050_1000041 Ga0209050_1000041362 191
378 3300025298 Ga0209050_1000287 Ga0209050_100028780 191
379 3300025298 Ga0209050_1000420 Ga0209050_10004209 191
380 3300025298 Ga0209050_1002033 Ga0209050_100203311 191
381 3300025303 Ga0209051_1000199 Ga0209051_100019980 191
382 3300025303 Ga0209051_1000229 Ga0209051_100022974 191
383 3300025303 Ga0209051_1000250 Ga0209051_100025076 191
384 3300025303 Ga0209051_1002350 Ga0209051_10023505 191
385 3300025304 Ga0209257_1000469 Ga0209257_100046955 191
386 3300025304 Ga0209257_1019861 Ga0209257_10198613 191
387 3300025321 Ga0207656_10000065 Ga0207656_1000006532 191
388 3300025711 Ga0207696_1000228 Ga0207696_100022867 191
389 3300025711 Ga0207696_1001630 Ga0207696_10016309 191
390 3300025711 Ga0207696_1002351 Ga0207696_10023514 191
391 3300025711 Ga0207696_1012066 Ga0207696_10120664 191
392 3300025728 Ga0207655_1001136 Ga0207655_100113618 191
393 3300025728 Ga0207655_1002149 Ga0207655_10021495 191
394 3300025728 Ga0207655_1002877 Ga0207655_10028774 191
395 3300025728 Ga0207655_1003022 Ga0207655_10030224 191
396 3300025728 Ga0207655_1005603 Ga0207655_10056033 191
397 3300025728 Ga0207655_1011951 Ga0207655_10119513 191
398 3300025728 Ga0207655_1041460 Ga0207655_10414602 191
399 3300025728 Ga0207655_1081799 Ga0207655_10817992 191
400 3300025735 Ga0207713_1000355 Ga0207713_100035541 191
401 3300025735 Ga0207713_1000499 Ga0207713_100049931 191
402 3300025735 Ga0207713_1000722 Ga0207713_10007224 191
403 3300025735 Ga0207713_1001537 Ga0207713_10015374 191
404 3300025735 Ga0207713_1007282 Ga0207713_10072822 191
405 3300025735 Ga0207713_1007912 Ga0207713_10079122 191
406 3300025735 Ga0207713_1009034 Ga0207713_10090344 191
407 3300025735 Ga0207713_1091746 Ga0207713_10917462 191
408 3300025735 Ga0207713_1112866 Ga0207713_11128662 191
409 3300025923 Ga0207681_10000095 Ga0207681_1000009572 191
410 3300025923 Ga0207681_10003682 Ga0207681_100036822 191
411 3300025929 Ga0207664_10111425 Ga0207664_101114252 191
412 3300025933 Ga0207706_10000846 Ga0207706_100008464 191
413 3300025933 Ga0207706_10007081 Ga0207706_100070817 191
414 3300025935 Ga0207709_10000125 Ga0207709_1000012590 191
415 3300025935 Ga0207709_10000302 Ga0207709_1000030245 191
416 3300025935 Ga0207709_10212748 Ga0207709_102127482 191
417 3300025941 Ga0207711_10078188 Ga0207711_100781882 191
418 3300025981 Ga0207640_10402972 Ga0207640_104029722 191
419 3300026041 Ga0207639_10000167 Ga0207639_1000016743 191
420 3300027111 Ga0209281_1000015 Ga0209281_10000155 191
421 3300027111 Ga0209281_1000256 Ga0209281_10002565 191
422 3300027666 Ga0209282_1035142 Ga0209282_10351422 191
423 3300027907 Ga0207428_10004072 Ga0207428_100040728 191
424 3300027907 Ga0207428_10051124 Ga0207428_100511243 191
425 3300027907 Ga0207428_10336289 Ga0207428_103362891 191
426 3300028379 Ga0268266_11139905 Ga0268266_111399051 191
427 3300030521 Ga0307511_10065146 Ga0307511_100651462 191
428 3300030731 Ga0316177_1185208 Ga0316177_11852083 191
429 3300030744 Ga0316181_1158599 Ga0316181_11585994 191
430 3300031548 Ga0307408_100002720 Ga0307408_1000027204 191
431 3300031730 Ga0307516_10090513 Ga0307516_100905132 191
432 3300031730 Ga0307516_10092653 Ga0307516_100926532 191
433 3300031730 Ga0307516_10262732 Ga0307516_102627322 191
434 3300031731 Ga0307405_10001020 Ga0307405_100010202 191
435 3300031731 Ga0307405_10008491 Ga0307405_100084914 191
436 3300031824 Ga0307413_10026868 Ga0307413_100268683 191
437 3300031901 Ga0307406_10037375 Ga0307406_100373752 191
438 3300031903 Ga0307407_10116784 Ga0307407_101167842 191
439 3300031911 Ga0307412_10001102 Ga0307412_100011025 191
440 3300032005 Ga0307411_10155211 Ga0307411_101552112 191
441 3300033180 Ga0307510_10007724 Ga0307510_100077244 191
442 3300038705 Ga0237819_00983 Ga0237819_00983_4195_4770 191
443 3300041405 Ga0439438_000921 Ga0439438_000921_9594_10169 191
444 3300041405 Ga0439438_000970 Ga0439438_000970_9601_10176 191
445 3300041405 Ga0439438_000971 Ga0439438_000971_2643_3218 191
446 3300041405 Ga0439438_003415 Ga0439438_003415_2182_2757 191
447 3300041405 Ga0439438_007725 Ga0439438_007725_2039_2614 191
448 3300041405 Ga0439438_009691 Ga0439438_009691_146_769 191
449 3300041407 Ga0439447_000438 Ga0439447_000438_5410_5985 191
450 3300041407 Ga0439447_000941 Ga0439447_000941_2152_2766 191
451 3300041407 Ga0439447_001589 Ga0439447_001589_1883_2458 191
452 3300041410 Ga0439461_0007246 Ga0439461_0007246_1219_1833 191
453 3300041411 Ga0439466_0000198 Ga0439466_0000198_10049_10648 191
454 3300041411 Ga0439466_0000636 Ga0439466_0000636_3094_3669 191
455 3300041411 Ga0439466_0000803 Ga0439466_0000803_9545_10159 191
456 3300041411 Ga0439466_0000822 Ga0439466_0000822_9592_10167 191
457 3300041411 Ga0439466_0007430 Ga0439466_0007430_2633_3208 191
458 3300041411 Ga0439466_0009500 Ga0439466_0009500_830_1453 191
459 3300041411 Ga0439466_0011877 Ga0439466_0011877_2089_2664 191
460 3300041411 Ga0439466_0052896 Ga0439466_0052896_571_1194 191
461 3300041411 Ga0439466_0102460 Ga0439466_0102460_28_603 191
462 3300041411 Ga0439466_0104870 Ga0439466_0104870_81_656 191
463 3300041413 Ga0439465_0007265 Ga0439465_0007265_920_1534 191
464 3300041413 Ga0439465_0008308 Ga0439465_0008308_416_991 191
465 3300041413 Ga0439465_0053952 Ga0439465_0053952_467_1090 191
466 3300041997 Ga0439431_0000175 Ga0439431_0000175_2182_2757 191
467 3300042004 Ga0439445_0010120 Ga0439445_0010120_95_670 191
468 3300042006 Ga0439432_000118 Ga0439432_000118_9524_10099 191
469 3300042006 Ga0439432_000668 Ga0439432_000668_2659_3234 191
470 3300042006 Ga0439432_000765 Ga0439432_000765_9517_10092 191
471 3300042006 Ga0439432_000781 Ga0439432_000781_1789_2403 191
472 3300042006 Ga0439432_001756 Ga0439432_001756_1842_2417 191
473 3300042006 Ga0439432_054859 Ga0439432_054859_235_810 191
474 3300042009 Ga0439451_000187 Ga0439451_000187_2372_2947 191
475 3300042009 Ga0439451_000218 Ga0439451_000218_1831_2445 191
476 3300042009 Ga0439451_000752 Ga0439451_000752_3096_3671 191
477 3300042009 Ga0439451_001335 Ga0439451_001335_2749_3324 191
478 3300042009 Ga0439451_006474 Ga0439451_006474_617_1192 191
479 3300042009 Ga0439451_006996 Ga0439451_006996_1354_1929 191
480 3300042010 Ga0439452_000152 Ga0439452_000152_40688_41311 191
481 3300042010 Ga0439452_000379 Ga0439452_000379_24136_24759 191
482 3300042010 Ga0439452_000529 Ga0439452_000529_13719_14294 191
483 3300042010 Ga0439452_003073 Ga0439452_003073_702_1277 191
484 3300042010 Ga0439452_003121 Ga0439452_003121_4299_4874 191
485 3300042010 Ga0439452_004190 Ga0439452_004190_3298_3912 191
486 3300042010 Ga0439452_005654 Ga0439452_005654_1498_2073 191
487 3300042010 Ga0439452_005740 Ga0439452_005740_690_1265 191
488 3300042010 Ga0439452_005823 Ga0439452_005823_1959_2534 191
489 3300042010 Ga0439452_047855 Ga0439452_047855_159_734 191
490 3300042013 Ga0439456_000013 Ga0439456_000013_9555_10130 191
491 3300042013 Ga0439456_000928 Ga0439456_000928_2672_3274 191
492 3300042013 Ga0439456_002183 Ga0439456_002183_1430_2044 191
493 3300042013 Ga0439456_002595 Ga0439456_002595_1621_2196 191
494 3300042013 Ga0439456_002847 Ga0439456_002847_2362_2958 191
495 3300042013 Ga0439456_005722 Ga0439456_005722_1335_1910 191
496 3300042013 Ga0439456_013847 Ga0439456_013847_92_667 191
497 3300042013 Ga0439456_015673 Ga0439456_015673_19_594 191
498 3300042013 Ga0439456_043380 Ga0439456_043380_46_621 191
499 3300042016 Ga0439463_000108 Ga0439463_000108_14198_14800 191
500 3300042016 Ga0439463_000407 Ga0439463_000407_9526_10140 191
501 3300042016 Ga0439463_001893 Ga0439463_001893_2699_3274 191
502 3300042016 Ga0439463_009927 Ga0439463_009927_451_1026 191
503 3300042016 Ga0439463_011079 Ga0439463_011079_219_794 191
504 3300042115 Ga0450911_000387 Ga0450911_000387_9522_10145 191
505 3300042115 Ga0450911_003172 Ga0450911_003172_1402_2016 191
506 3300042115 Ga0450911_028694 Ga0450911_028694_95_676 191
507 3300042116 Ga0450912_004987 Ga0450912_004987_342_917 191
508 3300042121 Ga0450919_001131 Ga0450919_001131_1240_1854 191
509 3300042124 Ga0450922_000758 Ga0450922_000758_157_771 191
510 3300042124 Ga0450922_001000 Ga0450922_001000_1295_1870 191
511 3300042127 Ga0450890_000119 Ga0450890_000119_9545_10159 191
512 3300042137 Ga0450902_002851 Ga0450902_002851_444_1058 191
513 3300042137 Ga0450902_003845 Ga0450902_003845_1422_1997 191
514 3300042137 Ga0450902_009143 Ga0450902_009143_970_1545 191
515 3300042137 Ga0450902_015188 Ga0450902_015188_287_862 191
516 3300042138 Ga0450903_000657 Ga0450903_000657_2054_2629 191
517 3300042138 Ga0450903_000690 Ga0450903_000690_1869_2483 191
518 3300042138 Ga0450903_027639 Ga0450903_027639_178_753 191
519 3300042139 Ga0450904_001279 Ga0450904_001279_889_1464 191
520 3300042142 Ga0450905_000040 Ga0450905_000040_2377_2952 191
521 3300042142 Ga0450905_001001 Ga0450905_001001_1657_2280 191
522 3300042145 Ga0450906_000993 Ga0450906_000993_4512_5126 191
523 3300042145 Ga0450906_021069 Ga0450906_021069_495_1070 191
524 3300042146 Ga0450907_000045 Ga0450907_000045_9597_10172 191
525 3300042146 Ga0450907_015425 Ga0450907_015425_198_812 191
526 3300042147 Ga0450910_000052 Ga0450910_000052_9589_10164 191
527 3300042147 Ga0450910_000272 Ga0450910_000272_1544_2158 191
528 3300042156 Ga0439446_0001026 Ga0439446_0001026_3657_4232 191
529 3300042156 Ga0439446_0002040 Ga0439446_0002040_2871_3485 191
530 3300042156 Ga0439446_0008180 Ga0439446_0008180_808_1383 191
531 3300042156 Ga0439446_0031134 Ga0439446_0031134_175_798 191
532 3300042184 Ga0450908_005995 Ga0450908_005995_1317_1931 191
533 3300042185 Ga0450909_003910 Ga0450909_003910_240_815 191
534 3300042185 Ga0450909_010971 Ga0450909_010971_288_863 191
535 3300042435 Ga0439434_0000380 Ga0439434_0000380_2480_3055 191
536 3300042435 Ga0439434_0004012 Ga0439434_0004012_1101_1715 191
537 3300042435 Ga0439434_0034768 Ga0439434_0034768_874_1449 191
538 3300042439 Ga0439464_0000127 Ga0439464_0000127_9483_10097 191
539 3300042461 Ga0439460_0000179 Ga0439460_0000179_1908_2522 191
540 3300042461 Ga0439460_0000347 Ga0439460_0000347_323_898 191
541 3300042531 Ga0450918_002342 Ga0450918_002342_2054_2668 191
542 3300042532 Ga0450893_0000048 Ga0450893_0000048_9627_10202 191
543 3300042533 Ga0450901_000343 Ga0450901_000343_4370_4945 191
544 3300042993 Ga0439440_0000288 Ga0439440_0000288_4038_4640 191
545 3300042993 Ga0439440_0000405 Ga0439440_0000405_4463_5077 191
546 3300042993 Ga0439440_0001163 Ga0439440_0001163_3605_4180 191
547 3300042993 Ga0439440_0055528 Ga0439440_0055528_144_719 191
548 3300046452 Ga0495617_001033 Ga0495617_001033_2763_3338 191
549 3300046452 Ga0495617_008359 Ga0495617_008359_2076_2651 191
550 3300046452 Ga0495617_009834 Ga0495617_009834_524_1099 191
551 3300046452 Ga0495617_011381 Ga0495617_011381_1109_1684 191
552 3300046452 Ga0495617_028067 Ga0495617_028067_271_894 191
553 3300046452 Ga0495617_037290 Ga0495617_037290_418_1041 191
554 3300046452 Ga0495617_041368 Ga0495617_041368_905_1480 191
555 3300046452 Ga0495617_110235 Ga0495617_110235_293_868 191
556 3300046453 Ga0495627_001577 Ga0495627_001577_2763_3338 191
557 3300046453 Ga0495627_001594 Ga0495627_001594_2341_2916 191
558 3300046453 Ga0495627_001837 Ga0495627_001837_1293_1868 191
559 3300046453 Ga0495627_007279 Ga0495627_007279_1229_1852 191
560 3300046453 Ga0495627_007540 Ga0495627_007540_2575_3150 191
561 3300046453 Ga0495627_021775 Ga0495627_021775_399_995 191
562 3300046453 Ga0495627_111760 Ga0495627_111760_85_660 191
563 3300046455 Ga0495603_0097609 Ga0495603_0097609_317_892 191
564 3300046455 Ga0495603_0108196 Ga0495603_0108196_437_1033 191
565 3300046455 Ga0495603_0127989 Ga0495603_0127989_445_1020 191
566 3300046457 Ga0495590_0000783 Ga0495590_0000783_9552_10127 191
567 3300046457 Ga0495590_0000855 Ga0495590_0000855_9654_10229 191
568 3300046457 Ga0495590_0001718 Ga0495590_0001718_3940_4554 191
569 3300046457 Ga0495590_0042285 Ga0495590_0042285_716_1291 191
570 3300046457 Ga0495590_0046556 Ga0495590_0046556_898_1473 191
571 3300046457 Ga0495590_0066234 Ga0495590_0066234_282_875 191
572 3300046458 Ga0495591_001700 Ga0495591_001700_2728_3303 191
573 3300046458 Ga0495591_001703 Ga0495591_001703_9797_10372 191
574 3300046458 Ga0495591_001760 Ga0495591_001760_9569_10144 191
575 3300046458 Ga0495591_001855 Ga0495591_001855_9583_10158 191
576 3300046458 Ga0495591_001859 Ga0495591_001859_9567_10142 191
577 3300046458 Ga0495591_005522 Ga0495591_005522_3324_3899 191
578 3300046458 Ga0495591_006346 Ga0495591_006346_2493_3068 191
579 3300046458 Ga0495591_007557 Ga0495591_007557_2022_2645 191
580 3300046458 Ga0495591_014930 Ga0495591_014930_105_680 191
581 3300046460 Ga0495638_0002812 Ga0495638_0002812_9508_10131 191
582 3300046460 Ga0495638_0003070 Ga0495638_0003070_9586_10161 191
583 3300046460 Ga0495638_0003856 Ga0495638_0003856_1601_2176 191
584 3300046460 Ga0495638_0006197 Ga0495638_0006197_2535_3149 191
585 3300046460 Ga0495638_0009585 Ga0495638_0009585_1508_2083 191
586 3300046460 Ga0495638_0030940 Ga0495638_0030940_570_1145 191
587 3300046460 Ga0495638_0033591 Ga0495638_0033591_583_1158 191
588 3300046460 Ga0495638_0084524 Ga0495638_0084524_135_710 191
589 3300046460 Ga0495638_0133430 Ga0495638_0133430_735_1310 191
590 3300046460 Ga0495638_0151278 Ga0495638_0151278_241_816 191
591 3300046463 Ga0495653_0000899 Ga0495653_0000899_9574_10149 191
592 3300046463 Ga0495653_0024904 Ga0495653_0024904_3667_4242 191
593 3300046463 Ga0495653_0103518 Ga0495653_0103518_58_633 191
594 3300046471 Ga0495650_0002513 Ga0495650_0002513_4217_4792 191
595 3300046471 Ga0495650_0002934 Ga0495650_0002934_9574_10149 191
596 3300046471 Ga0495650_0003243 Ga0495650_0003243_9523_10137 191
597 3300046471 Ga0495650_0007254 Ga0495650_0007254_5331_5906 191
598 3300046471 Ga0495650_0011478 Ga0495650_0011478_1927_2550 191
599 3300046471 Ga0495650_0019607 Ga0495650_0019607_1689_2264 191
600 3300046472 Ga0495580_0136934 Ga0495580_0136934_581_1156 191
601 3300046472 Ga0495580_0294324 Ga0495580_0294324_122_697 191
602 3300046474 Ga0495605_0002099 Ga0495605_0002099_2352_2927 191
603 3300046474 Ga0495605_0002641 Ga0495605_0002641_9547_10161 191
604 3300046474 Ga0495605_0003390 Ga0495605_0003390_8809_9384 191
605 3300046474 Ga0495605_0005362 Ga0495605_0005362_6373_6996 191
606 3300046474 Ga0495605_0006075 Ga0495605_0006075_2675_3250 191
607 3300046474 Ga0495605_0014059 Ga0495605_0014059_1016_1591 191
608 3300046474 Ga0495605_0136993 Ga0495605_0136993_467_1042 191
609 3300046474 Ga0495605_0172006 Ga0495605_0172006_308_883 191
610 3300046475 Ga0495639_0000152 Ga0495639_0000152_9837_10412 191
611 3300046491 Ga0495584_0000468 Ga0495584_0000468_17488_18063 191
612 3300046491 Ga0495584_0001549 Ga0495584_0001549_3897_4520 191
613 3300046491 Ga0495584_0001688 Ga0495584_0001688_2805_3419 191
614 3300046491 Ga0495584_0001709 Ga0495584_0001709_9529_10104 191
615 3300046491 Ga0495584_0001838 Ga0495584_0001838_2166_2780 191
616 3300046491 Ga0495584_0018951 Ga0495584_0018951_313_888 191
617 3300046491 Ga0495584_0028157 Ga0495584_0028157_522_1145 191
618 3300046491 Ga0495584_0042422 Ga0495584_0042422_1242_1817 191
619 3300046491 Ga0495584_0072816 Ga0495584_0072816_960_1535 191
620 3300046491 Ga0495584_0076065 Ga0495584_0076065_1073_1648 191
621 3300046492 Ga0495585_0000236 Ga0495585_0000236_9582_10157 191
622 3300046492 Ga0495585_0002024 Ga0495585_0002024_9531_10154 191
623 3300046492 Ga0495585_0002613 Ga0495585_0002613_9480_10055 191
624 3300046492 Ga0495585_0002640 Ga0495585_0002640_2744_3319 191
625 3300046492 Ga0495585_0002748 Ga0495585_0002748_9566_10141 191
626 3300046492 Ga0495585_0008744 Ga0495585_0008744_3285_3908 191
627 3300046492 Ga0495585_0011475 Ga0495585_0011475_1871_2494 191
628 3300046492 Ga0495585_0011760 Ga0495585_0011760_1963_2538 191
629 3300046492 Ga0495585_0026890 Ga0495585_0026890_2041_2616 191
630 3300046492 Ga0495585_0065759 Ga0495585_0065759_137_751 191
631 3300046492 Ga0495585_0145210 Ga0495585_0145210_66_641 191
632 3300046499 Ga0495594_0001402 Ga0495594_0001402_2353_2949 191
633 3300046499 Ga0495594_0005592 Ga0495594_0005592_2519_3094 191
634 3300046499 Ga0495594_0005762 Ga0495594_0005762_515_1090 191
635 3300046500 Ga0495596_0001547 Ga0495596_0001547_2760_3335 191
636 3300046500 Ga0495596_0070385 Ga0495596_0070385_25_600 191
637 3300046501 Ga0495607_0001160 Ga0495607_0001160_13706_14281 191
638 3300046501 Ga0495607_0001357 Ga0495607_0001357_11687_12301 191
639 3300046501 Ga0495607_0003365 Ga0495607_0003365_2188_2763 191
640 3300046501 Ga0495607_0003368 Ga0495607_0003368_9371_9994 191
641 3300046501 Ga0495607_0004540 Ga0495607_0004540_9520_10095 191
642 3300046501 Ga0495607_0005703 Ga0495607_0005703_2728_3303 191
643 3300046501 Ga0495607_0007076 Ga0495607_0007076_2555_3130 191
644 3300046501 Ga0495607_0016038 Ga0495607_0016038_3050_3664 191
645 3300046501 Ga0495607_0023133 Ga0495607_0023133_1005_1580 191
646 3300046501 Ga0495607_0042908 Ga0495607_0042908_1892_2467 191
647 3300046501 Ga0495607_0065225 Ga0495607_0065225_22_597 191
648 3300046506 Ga0495583_0001658 Ga0495583_0001658_13910_14485 191
649 3300046506 Ga0495583_0002733 Ga0495583_0002733_9783_10358 191
650 3300046506 Ga0495583_0015629 Ga0495583_0015629_2528_3103 191
651 3300046506 Ga0495583_0061397 Ga0495583_0061397_787_1401 191
652 3300046506 Ga0495583_0182518 Ga0495583_0182518_148_723 191
653 3300046507 Ga0495606_0003435 Ga0495606_0003435_6985_7560 191
654 3300046507 Ga0495606_0005268 Ga0495606_0005268_9551_10126 191
655 3300046507 Ga0495606_0005972 Ga0495606_0005972_9571_10146 191
656 3300046507 Ga0495606_0005985 Ga0495606_0005985_1276_1851 191
657 3300046507 Ga0495606_0006686 Ga0495606_0006686_9589_10164 191
658 3300046507 Ga0495606_0047898 Ga0495606_0047898_69_644 191
659 3300046507 Ga0495606_0180225 Ga0495606_0180225_345_938 191
660 3300046507 Ga0495606_0244293 Ga0495606_0244293_39_662 191
661 3300046507 Ga0495606_0397612 Ga0495606_0397612_85_660 191
662 3300046512 Ga0495610_0003231 Ga0495610_0003231_9554_10129 191
663 3300046512 Ga0495610_0003619 Ga0495610_0003619_1699_2274 191
664 3300046512 Ga0495610_0016075 Ga0495610_0016075_1160_1735 191
665 3300046512 Ga0495610_0023398 Ga0495610_0023398_962_1585 191
666 3300046512 Ga0495610_0089400 Ga0495610_0089400_419_994 191
667 3300046512 Ga0495610_0234975 Ga0495610_0234975_138_713 191
668 3300046513 Ga0495616_0000931 Ga0495616_0000931_13265_13879 191
669 3300046513 Ga0495616_0001498 Ga0495616_0001498_9568_10143 191
670 3300046513 Ga0495616_0001947 Ga0495616_0001947_9162_9785 191
671 3300046513 Ga0495616_0002240 Ga0495616_0002240_2765_3340 191
672 3300046513 Ga0495616_0002422 Ga0495616_0002422_2291_2866 191
673 3300046513 Ga0495616_0007298 Ga0495616_0007298_2167_2742 191
674 3300046513 Ga0495616_0046494 Ga0495616_0046494_1054_1629 191
675 3300046513 Ga0495616_0098116 Ga0495616_0098116_388_1011 191
676 3300046515 Ga0495620_0001353 Ga0495620_0001353_9582_10157 191
677 3300046515 Ga0495620_0003243 Ga0495620_0003243_1543_2118 191
678 3300046515 Ga0495620_0004042 Ga0495620_0004042_2196_2771 191
679 3300046515 Ga0495620_0007547 Ga0495620_0007547_2585_3160 191
680 3300046515 Ga0495620_0009108 Ga0495620_0009108_1337_1912 191
681 3300046515 Ga0495620_0019684 Ga0495620_0019684_2712_3287 191
682 3300046515 Ga0495620_0068671 Ga0495620_0068671_85_660 191
683 3300046518 Ga0495631_0000597 Ga0495631_0000597_9537_10160 191
684 3300046518 Ga0495631_0001741 Ga0495631_0001741_2778_3353 191
685 3300046518 Ga0495631_0001855 Ga0495631_0001855_9644_10219 191
686 3300046518 Ga0495631_0011377 Ga0495631_0011377_2799_3374 191
687 3300046518 Ga0495631_0014892 Ga0495631_0014892_1989_2603 191
688 3300046518 Ga0495631_0016414 Ga0495631_0016414_10_585 191
689 3300046518 Ga0495631_0021886 Ga0495631_0021886_294_869 191
690 3300046518 Ga0495631_0293977 Ga0495631_0293977_46_642 191
691 3300046519 Ga0495632_0001382 Ga0495632_0001382_11470_12045 191
692 3300046519 Ga0495632_0002567 Ga0495632_0002567_3613_4227 191
693 3300046519 Ga0495632_0002803 Ga0495632_0002803_2765_3340 191
694 3300046519 Ga0495632_0002906 Ga0495632_0002906_9837_10412 191
695 3300046519 Ga0495632_0005239 Ga0495632_0005239_2132_2707 191
696 3300046519 Ga0495632_0005809 Ga0495632_0005809_5595_6170 191
697 3300046519 Ga0495632_0007448 Ga0495632_0007448_3540_4163 191
698 3300046519 Ga0495632_0073773 Ga0495632_0073773_1016_1591 191
699 3300046520 Ga0495637_0001655 Ga0495637_0001655_2736_3311 191
700 3300046520 Ga0495637_0001705 Ga0495637_0001705_2572_3147 191
701 3300046520 Ga0495637_0001726 Ga0495637_0001726_2372_2986 191
702 3300046520 Ga0495637_0001858 Ga0495637_0001858_9495_10070 191
703 3300046520 Ga0495637_0002370 Ga0495637_0002370_9555_10130 191
704 3300046520 Ga0495637_0002637 Ga0495637_0002637_8308_8883 191
705 3300046520 Ga0495637_0002984 Ga0495637_0002984_759_1373 191
706 3300046520 Ga0495637_0010266 Ga0495637_0010266_173_748 191
707 3300046520 Ga0495637_0018032 Ga0495637_0018032_170_793 191
708 3300046520 Ga0495637_0052205 Ga0495637_0052205_873_1496 191
709 3300046520 Ga0495637_0074995 Ga0495637_0074995_468_1061 191
710 3300046522 Ga0495643_0003789 Ga0495643_0003789_2110_2724 191
711 3300046522 Ga0495643_0003918 Ga0495643_0003918_9349_9924 191
712 3300046522 Ga0495643_0011567 Ga0495643_0011567_2732_3307 191
713 3300046522 Ga0495643_0023577 Ga0495643_0023577_1614_2237 191
714 3300046522 Ga0495643_0069451 Ga0495643_0069451_1216_1791 191
715 3300046522 Ga0495643_0135622 Ga0495643_0135622_137_712 191
716 3300046522 Ga0495643_0144304 Ga0495643_0144304_245_820 191
717 3300046523 Ga0495644_0007599 Ga0495644_0007599_683_1258 191
718 3300046523 Ga0495644_0019085 Ga0495644_0019085_1395_1970 191
719 3300046523 Ga0495644_0025718 Ga0495644_0025718_734_1348 191
720 3300046524 Ga0495648_0003611 Ga0495648_0003611_9246_9821 191
721 3300046524 Ga0495648_0003802 Ga0495648_0003802_9783_10358 191
722 3300046524 Ga0495648_0003939 Ga0495648_0003939_9541_10116 191
723 3300046524 Ga0495648_0004313 Ga0495648_0004313_9659_10234 191
724 3300046524 Ga0495648_0004842 Ga0495648_0004842_1219_1794 191
725 3300046524 Ga0495648_0014956 Ga0495648_0014956_3295_3909 191
726 3300046524 Ga0495648_0027537 Ga0495648_0027537_2751_3374 191
727 3300046524 Ga0495648_0029030 Ga0495648_0029030_1239_1814 191
728 3300046524 Ga0495648_0033014 Ga0495648_0033014_1859_2473 191
729 3300046524 Ga0495648_0033669 Ga0495648_0033669_28_603 191
730 3300046524 Ga0495648_0042477 Ga0495648_0042477_146_721 191
731 3300046524 Ga0495648_0109928 Ga0495648_0109928_653_1228 191
732 3300046524 Ga0495648_0214288 Ga0495648_0214288_141_764 191
733 3300046526 Ga0495666_0002169 Ga0495666_0002169_2171_2746 191
734 3300046526 Ga0495666_0002936 Ga0495666_0002936_5911_6486 191
735 3300046526 Ga0495666_0111182 Ga0495666_0111182_311_886 191
736 3300046528 Ga0495642_0000129 Ga0495642_0000129_9650_10225 191
737 3300046528 Ga0495642_0000451 Ga0495642_0000451_9584_10159 191
738 3300046528 Ga0495642_0001117 Ga0495642_0001117_9548_10162 191
739 3300046530 Ga0495654_0002068 Ga0495654_0002068_9837_10412 191
740 3300046530 Ga0495654_0002329 Ga0495654_0002329_2118_2693 191
741 3300046530 Ga0495654_0002570 Ga0495654_0002570_9478_10101 191
742 3300046530 Ga0495654_0004652 Ga0495654_0004652_1070_1666 191
743 3300046530 Ga0495654_0006093 Ga0495654_0006093_419_994 191
744 3300046530 Ga0495654_0016124 Ga0495654_0016124_1234_1809 191
745 3300046530 Ga0495654_0029803 Ga0495654_0029803_441_1016 191
746 3300046530 Ga0495654_0070275 Ga0495654_0070275_747_1322 191
747 3300046530 Ga0495654_0102770 Ga0495654_0102770_460_1035 191
748 3300046530 Ga0495654_0106405 Ga0495654_0106405_379_972 191
749 3300046530 Ga0495654_0259165 Ga0495654_0259165_94_669 191
750 3300046536 Ga0495587_0029164 Ga0495587_0029164_1426_2001 191
751 3300046538 Ga0495609_0001977 Ga0495609_0001977_2618_3193 191
752 3300046538 Ga0495609_0001996 Ga0495609_0001996_2752_3327 191
753 3300046538 Ga0495609_0002213 Ga0495609_0002213_9445_10020 191
754 3300046538 Ga0495609_0002280 Ga0495609_0002280_1799_2413 191
755 3300046538 Ga0495609_0002513 Ga0495609_0002513_9286_9861 191
756 3300046538 Ga0495609_0003524 Ga0495609_0003524_2048_2623 191
757 3300046538 Ga0495609_0007441 Ga0495609_0007441_3819_4394 191
758 3300046538 Ga0495609_0007745 Ga0495609_0007745_3699_4274 191
759 3300046538 Ga0495609_0013478 Ga0495609_0013478_779_1375 191
760 3300046542 Ga0495597_0000786 Ga0495597_0000786_15201_15776 191
761 3300046542 Ga0495597_0002195 Ga0495597_0002195_2668_3243 191
762 3300046542 Ga0495597_0003354 Ga0495597_0003354_5282_5905 191
763 3300046542 Ga0495597_0008892 Ga0495597_0008892_1967_2542 191
764 3300046542 Ga0495597_0031312 Ga0495597_0031312_486_1100 191
765 3300046542 Ga0495597_0104809 Ga0495597_0104809_282_875 191
766 3300046542 Ga0495597_0132402 Ga0495597_0132402_121_696 191
767 3300046542 Ga0495597_0216649 Ga0495597_0216649_121_696 191
768 3300046543 Ga0495645_0004315 Ga0495645_0004315_7146_7721 191
769 3300046557 Ga0495622_0002101 Ga0495622_0002101_6391_6966 191
770 3300046557 Ga0495622_0002297 Ga0495622_0002297_1119_1694 191
771 3300046557 Ga0495622_0002956 Ga0495622_0002956_1154_1729 191
772 3300046557 Ga0495622_0024203 Ga0495622_0024203_1840_2436 191
773 3300046558 Ga0495633_0002525 Ga0495633_0002525_9570_10145 191
774 3300046558 Ga0495633_0003542 Ga0495633_0003542_1435_2058 191
775 3300046558 Ga0495633_0006568 Ga0495633_0006568_3883_4458 191
776 3300046558 Ga0495633_0073833 Ga0495633_0073833_539_1153 191
777 3300046615 Ga0495656_0008102 Ga0495656_0008102_2653_3228 191
778 3300046615 Ga0495656_0010701 Ga0495656_0010701_44_619 191
779 3300046616 Ga0495668_0021999 Ga0495668_0021999_1181_1756 191
780 3300046642 Ga0495634_0000185 Ga0495634_0000185_9886_10461 191
781 3300046642 Ga0495634_0003382 Ga0495634_0003382_2692_3267 191
782 3300046648 Ga0495611_0001243 Ga0495611_0001243_9788_10363 191
783 3300046648 Ga0495611_0001320 Ga0495611_0001320_10056_10670 191
784 3300046648 Ga0495611_0050624 Ga0495611_0050624_695_1270 191
785 3300046648 Ga0495611_0057041 Ga0495611_0057041_706_1281 191
786 3300046648 Ga0495611_0075410 Ga0495611_0075410_264_839 191
787 3300046648 Ga0495611_0076777 Ga0495611_0076777_415_990 191
788 3300046648 Ga0495611_0187677 Ga0495611_0187677_55_630 191
789 3300046660 Ga0495625_0003682 Ga0495625_0003682_5277_5852 191
790 3300046660 Ga0495625_0004511 Ga0495625_0004511_2757_3332 191
791 3300046660 Ga0495625_0005198 Ga0495625_0005198_9583_10158 191
792 3300046660 Ga0495625_0005490 Ga0495625_0005490_9659_10234 191
793 3300046660 Ga0495625_0022681 Ga0495625_0022681_1971_2594 191
794 3300046660 Ga0495625_0042362 Ga0495625_0042362_758_1372 191
795 3300046660 Ga0495625_0049574 Ga0495625_0049574_975_1550 191
796 3300046660 Ga0495625_0064046 Ga0495625_0064046_302_877 191
797 3300046660 Ga0495625_0101986 Ga0495625_0101986_1210_1785 191
798 3300046660 Ga0495625_0171286 Ga0495625_0171286_594_1169 191
799 3300046663 Ga0495635_0001910 Ga0495635_0001910_3943_4518 191
800 3300046664 Ga0495659_0000303 Ga0495659_0000303_9357_9932 191
801 3300046664 Ga0495659_0003514 Ga0495659_0003514_1935_2549 191
802 3300046664 Ga0495659_0004826 Ga0495659_0004826_43_618 191
803 3300046664 Ga0495659_0022706 Ga0495659_0022706_24_638 191
804 3300046664 Ga0495659_0045182 Ga0495659_0045182_241_816 191
805 3300046665 Ga0495661_0005237 Ga0495661_0005237_3290_3865 191
806 3300046665 Ga0495661_0006410 Ga0495661_0006410_2687_3310 191
807 3300046665 Ga0495661_0021670 Ga0495661_0021670_196_771 191
808 3300046665 Ga0495661_0088665 Ga0495661_0088665_1070_1645 191
809 3300046665 Ga0495661_0121184 Ga0495661_0121184_82_657 191
810 3300046674 Ga0495588_0029489 Ga0495588_0029489_23_598 191
811 3300046674 Ga0495588_0036337 Ga0495588_0036337_1230_1826 191
812 3300046678 Ga0495599_0118418 Ga0495599_0118418_806_1381 191
813 3300046679 Ga0495623_0001609 Ga0495623_0001609_9580_10155 191
814 3300046680 Ga0495646_0017027 Ga0495646_0017027_3753_4328 191
815 3300046680 Ga0495646_0032005 Ga0495646_0032005_1637_2212 191
816 3300046684 Ga0495669_0018466 Ga0495669_0018466_557_1132 191
817 3300046684 Ga0495669_0158834 Ga0495669_0158834_69_644 191
818 3300046689 Ga0495613_0007193 Ga0495613_0007193_2749_3324 191
819 3300046689 Ga0495613_0291850 Ga0495613_0291850_356_931 191
820 3300046690 Ga0495624_0002859 Ga0495624_0002859_2780_3355 191
821 3300046691 Ga0495670_0001099 Ga0495670_0001099_2767_3342 191
822 3300046691 Ga0495670_0001137 Ga0495670_0001137_9553_10149 191
823 3300046691 Ga0495670_0001253 Ga0495670_0001253_2277_2891 191
824 3300046691 Ga0495670_0011321 Ga0495670_0011321_2913_3488 191
825 3300046691 Ga0495670_0023333 Ga0495670_0023333_2406_2981 191
826 3300046691 Ga0495670_0032752 Ga0495670_0032752_1432_2007 191
827 3300046691 Ga0495670_0271796 Ga0495670_0271796_83_658 191
828 3300046692 Ga0495671_0001442 Ga0495671_0001442_9546_10160 191
829 3300046692 Ga0495671_0002093 Ga0495671_0002093_9509_10084 191
830 3300046692 Ga0495671_0002148 Ga0495671_0002148_9302_9877 191
831 3300046692 Ga0495671_0002252 Ga0495671_0002252_9548_10123 191
832 3300046692 Ga0495671_0002985 Ga0495671_0002985_7626_8201 191
833 3300046692 Ga0495671_0003677 Ga0495671_0003677_1515_2090 191
834 3300046692 Ga0495671_0115133 Ga0495671_0115133_281_856 191
835 3300046692 Ga0495671_0226476 Ga0495671_0226476_16_612 191
836 3300046694 Ga0495649_0000164 Ga0495649_0000164_9528_10142 191
837 3300046694 Ga0495649_0002274 Ga0495649_0002274_3491_4066 191
838 3300046694 Ga0495649_0002501 Ga0495649_0002501_2743_3318 191
839 3300046694 Ga0495649_0008154 Ga0495649_0008154_2703_3317 191
840 3300046694 Ga0495649_0008266 Ga0495649_0008266_3623_4246 191
841 3300046694 Ga0495649_0027230 Ga0495649_0027230_2304_2879 191
842 3300046694 Ga0495649_0050150 Ga0495649_0050150_737_1312 191
843 3300046694 Ga0495649_0074500 Ga0495649_0074500_1011_1586 191
844 3300046694 Ga0495649_0086526 Ga0495649_0086526_268_843 191
845 3300046694 Ga0495649_0088525 Ga0495649_0088525_424_999 191
846 3300046694 Ga0495649_0088528 Ga0495649_0088528_653_1228 191
847 3300046694 Ga0495649_0218441 Ga0495649_0218441_113_706 191
848 3300046794 Ga0495589_0000388 Ga0495589_0000388_29626_30240 191
849 3300046794 Ga0495589_0001589 Ga0495589_0001589_2751_3326 191
850 3300046794 Ga0495589_0002221 Ga0495589_0002221_9571_10146 191
851 3300046794 Ga0495589_0002244 Ga0495589_0002244_954_1529 191
852 3300046794 Ga0495589_0002403 Ga0495589_0002403_4726_5301 191
853 3300046794 Ga0495589_0013539 Ga0495589_0013539_2514_3089 191
854 3300046794 Ga0495589_0032964 Ga0495589_0032964_423_998 191
855 3300046809 Ga0495600_0022154 Ga0495600_0022154_2757_3332 191
856 3300046810 Ga0495660_0001783 Ga0495660_0001783_9191_9766 191
857 3300046810 Ga0495660_0002108 Ga0495660_0002108_9544_10119 191
858 3300046810 Ga0495660_0002180 Ga0495660_0002180_2147_2722 191
859 3300046810 Ga0495660_0002294 Ga0495660_0002294_2166_2741 191
860 3300046810 Ga0495660_0002326 Ga0495660_0002326_1818_2393 191
861 3300046810 Ga0495660_0002371 Ga0495660_0002371_1927_2502 191
862 3300046810 Ga0495660_0004585 Ga0495660_0004585_2126_2701 191
863 3300046810 Ga0495660_0009714 Ga0495660_0009714_2359_2934 191
864 3300046810 Ga0495660_0012261 Ga0495660_0012261_2922_3497 191
865 3300046810 Ga0495660_0015137 Ga0495660_0015137_1280_1855 191
866 3300046810 Ga0495660_0015738 Ga0495660_0015738_3434_4030 191
867 3300046810 Ga0495660_0024261 Ga0495660_0024261_1980_2603 191
868 3300046810 Ga0495660_0033494 Ga0495660_0033494_669_1292 191
869 3300046810 Ga0495660_0038403 Ga0495660_0038403_1967_2581 191
870 3300046810 Ga0495660_0061248 Ga0495660_0061248_138_713 191
871 3300046810 Ga0495660_0074623 Ga0495660_0074623_217_792 191
872 3300047315 Ga0495581_0001624 Ga0495581_0001624_2377_2952 191
873 3300047317 Ga0495604_0012242 Ga0495604_0012242_5741_6316 191
874 3300047317 Ga0495604_0015937 Ga0495604_0015937_1316_1891 191
875 3300047318 Ga0495636_0002752 Ga0495636_0002752_3227_3841 191
876 3300047318 Ga0495636_0063579 Ga0495636_0063579_459_1034 191
877 3300047318 Ga0495636_0194538 Ga0495636_0194538_259_873 191
878 3300047319 Ga0495674_0010090 Ga0495674_0010090_2700_3275 191
879 3300047320 Ga0495672_0002092 Ga0495672_0002092_8575_9189 191
880 3300047320 Ga0495672_0003691 Ga0495672_0003691_2781_3356 191
881 3300047320 Ga0495672_0003740 Ga0495672_0003740_2620_3195 191
882 3300047320 Ga0495672_0004120 Ga0495672_0004120_2159_2764 191
883 3300047320 Ga0495672_0006514 Ga0495672_0006514_8006_8581 191
884 3300047320 Ga0495672_0007461 Ga0495672_0007461_6074_6649 191
885 3300047320 Ga0495672_0025057 Ga0495672_0025057_1447_2022 191
886 3300047320 Ga0495672_0027369 Ga0495672_0027369_1591_2214 191
887 3300047320 Ga0495672_0037126 Ga0495672_0037126_1294_1869 191
888 3300047321 Ga0495676_0004392 Ga0495676_0004392_2744_3319 191
889 3300047321 Ga0495676_0004452 Ga0495676_0004452_2715_3290 191
890 3300047322 Ga0495680_0012927 Ga0495680_0012927_5221_5796 191
891 3300047322 Ga0495680_0020278 Ga0495680_0020278_2802_3377 191
892 3300047322 Ga0495680_0026675 Ga0495680_0026675_3112_3687 191
893 3300047323 Ga0495683_0000730 Ga0495683_0000730_13688_14311 191
894 3300047323 Ga0495683_0001672 Ga0495683_0001672_3883_4458 191
895 3300047323 Ga0495683_0002276 Ga0495683_0002276_2011_2586 191
896 3300047323 Ga0495683_0002987 Ga0495683_0002987_82_657 191
897 3300047323 Ga0495683_0008455 Ga0495683_0008455_2487_3062 191
898 3300047323 Ga0495683_0009474 Ga0495683_0009474_2530_3144 191
899 3300047323 Ga0495683_0015110 Ga0495683_0015110_1141_1716 191
900 3300047323 Ga0495683_0108192 Ga0495683_0108192_420_995 191
901 3300047323 Ga0495683_0122419 Ga0495683_0122419_442_1038 191
902 3300047443 Ga0495687_005151 Ga0495687_005151_2241_2816 191
903 3300047443 Ga0495687_005862 Ga0495687_005862_3893_4507 191
904 3300047443 Ga0495687_011281 Ga0495687_011281_2243_2818 191
905 3300047443 Ga0495687_046477 Ga0495687_046477_189_764 191
906 3300047444 Ga0495675_0084194 Ga0495675_0084194_420_995 191
907 3300047445 Ga0495677_0000637 Ga0495677_0000637_9554_10129 191
908 3300047445 Ga0495677_0041190 Ga0495677_0041190_829_1443 191
909 3300047446 Ga0495679_001495 Ga0495679_001495_9916_10491 191
910 3300047446 Ga0495679_001573 Ga0495679_001573_9560_10135 191
911 3300047446 Ga0495679_004622 Ga0495679_004622_3854_4429 191
912 3300047447 Ga0495685_003422 Ga0495685_003422_2938_3552 191
913 3300047469 Ga0495673_0001034 Ga0495673_0001034_14449_15024 191
914 3300047469 Ga0495673_0002425 Ga0495673_0002425_2755_3330 191
915 3300047469 Ga0495673_0006993 Ga0495673_0006993_4028_4642 191
916 3300047469 Ga0495673_0007956 Ga0495673_0007956_1248_1823 191
917 3300047469 Ga0495673_0011490 Ga0495673_0011490_1302_1877 191
918 3300047469 Ga0495673_0029492 Ga0495673_0029492_44_619 191
919 3300047469 Ga0495673_0035386 Ga0495673_0035386_29_604 191
920 3300047469 Ga0495673_0039796 Ga0495673_0039796_1284_1859 191
921 3300047469 Ga0495673_0070352 Ga0495673_0070352_625_1200 191
922 3300047470 Ga0495681_0000806 Ga0495681_0000806_13725_14300 191
923 3300047470 Ga0495681_0002142 Ga0495681_0002142_9756_10331 191
924 3300047470 Ga0495681_0002256 Ga0495681_0002256_9588_10163 191
925 3300047470 Ga0495681_0002454 Ga0495681_0002454_3119_3694 191
926 3300047470 Ga0495681_0003233 Ga0495681_0003233_1159_1734 191
927 3300047470 Ga0495681_0006531 Ga0495681_0006531_3641_4255 191
928 3300047470 Ga0495681_0006833 Ga0495681_0006833_1293_1916 191
929 3300047470 Ga0495681_0008447 Ga0495681_0008447_1027_1602 191
930 3300047470 Ga0495681_0009980 Ga0495681_0009980_2928_3551 191
931 3300047470 Ga0495681_0021924 Ga0495681_0021924_1795_2370 191
932 3300047470 Ga0495681_0232709 Ga0495681_0232709_108_683 191
933 3300047472 Ga0495686_0002408 Ga0495686_0002408_7381_8004 191
934 3300047472 Ga0495686_0003772 Ga0495686_0003772_9566_10141 191
935 3300047472 Ga0495686_0003919 Ga0495686_0003919_2458_3033 191
936 3300047472 Ga0495686_0104074 Ga0495686_0104074_421_996 191
937 3300047472 Ga0495686_0245932 Ga0495686_0245932_104_679 191
938 3300047673 Ga0495593_0019133 Ga0495593_0019133_3248_3823 191
939 3300047673 Ga0495593_0021101 Ga0495593_0021101_324_899 191
940 3300048088 Ga0495602_0005869 Ga0495602_0005869_2754_3329 191
941 3300048088 Ga0495602_0077931 Ga0495602_0077931_1254_1829 191
942 3300048091 Ga0495626_0002272 Ga0495626_0002272_9592_10167 191
943 3300048091 Ga0495626_0002380 Ga0495626_0002380_2722_3297 191
944 3300048091 Ga0495626_0002569 Ga0495626_0002569_9528_10142 191
945 3300048091 Ga0495626_0002714 Ga0495626_0002714_9300_9875 191
946 3300048091 Ga0495626_0002991 Ga0495626_0002991_1146_1721 191
947 3300048091 Ga0495626_0006133 Ga0495626_0006133_5507_6082 191
948 3300048091 Ga0495626_0008711 Ga0495626_0008711_1005_1580 191
949 3300048091 Ga0495626_0148753 Ga0495626_0148753_232_807 191
950 3300048904 Ga0496101_0499093 Ga0496101_0499093_47_622 191
951 3300048905 Ga0496102_0000604 Ga0496102_0000604_27302_27877 191
952 3300048906 Ga0496103_0002176 Ga0496103_0002176_2321_2896 191
953 3300048906 Ga0496103_0333104 Ga0496103_0333104_79_654 191
954 3300048909 Ga0496106_0007313 Ga0496106_0007313_5974_6549 191
955 3300048909 Ga0496106_0522325 Ga0496106_0522325_49_624 191
956 3300048910 Ga0496107_0046072 Ga0496107_0046072_2434_3009 191
957 3300048914 Ga0496111_0092207 Ga0496111_0092207_1080_1655 191
958 3300048915 Ga0496112_0086937 Ga0496112_0086937_1686_2285 191
959 3300048916 Ga0496113_0725254 Ga0496113_0725254_26_718 191
960 3300048917 Ga0496114_0440471 Ga0496114_0440471_453_1028 191
961 3300048918 Ga0496115_0409177 Ga0496115_0409177_85_660 191
962 3300048919 Ga0496116_0000286 Ga0496116_0000286_9476_10168 191
963 3300048919 Ga0496116_0000730 Ga0496116_0000730_31809_32384 191
964 3300048919 Ga0496116_0004436 Ga0496116_0004436_9576_10151 191
965 3300048919 Ga0496116_0004518 Ga0496116_0004518_9893_10468 191
966 3300048919 Ga0496116_0004704 Ga0496116_0004704_9573_10148 191
967 3300048920 Ga0496117_0000773 Ga0496117_0000773_40235_40927 191
968 3300048920 Ga0496117_0006000 Ga0496117_0006000_9577_10152 191
969 3300048920 Ga0496117_0019564 Ga0496117_0019564_3168_3743 191
970 3300048920 Ga0496117_0043804 Ga0496117_0043804_598_1173 191
971 3300048920 Ga0496117_0055149 Ga0496117_0055149_181_756 191
972 3300048920 Ga0496117_0058433 Ga0496117_0058433_2002_2625 191
973 3300048920 Ga0496117_0193059 Ga0496117_0193059_183_758 191
974 3300048921 Ga0496118_0003842 Ga0496118_0003842_9662_10237 191
975 3300048921 Ga0496118_0006159 Ga0496118_0006159_9570_10145 191
976 3300048921 Ga0496118_0007853 Ga0496118_0007853_9577_10152 191
977 3300048921 Ga0496118_0021304 Ga0496118_0021304_4744_5319 191
978 3300048921 Ga0496118_0123185 Ga0496118_0123185_256_948 191
979 3300048921 Ga0496118_0124459 Ga0496118_0124459_649_1224 191
980 3300048922 Ga0496119_0206963 Ga0496119_0206963_42_617 191
981 3300048923 Ga0496120_0012545 Ga0496120_0012545_4565_5140 191
982 3300048924 Ga0496121_0000404 Ga0496121_0000404_9464_10156 191
983 3300048924 Ga0496121_0007241 Ga0496121_0007241_9564_10139 191
984 3300048924 Ga0496121_0014324 Ga0496121_0014324_5402_5977 191
985 3300048924 Ga0496121_0071379 Ga0496121_0071379_1533_2108 191
986 3300048924 Ga0496121_0099767 Ga0496121_0099767_459_1034 191
987 3300048924 Ga0496121_0122479 Ga0496121_0122479_266_862 191
988 3300048925 Ga0496122_0005979 Ga0496122_0005979_4062_4754 191
989 3300048925 Ga0496122_0006393 Ga0496122_0006393_3386_3961 191
990 3300048925 Ga0496122_0010516 Ga0496122_0010516_7267_7842 191
991 3300048926 Ga0496123_0000908 Ga0496123_0000908_9492_10184 191
992 3300048926 Ga0496123_0005686 Ga0496123_0005686_5591_6166 191
993 3300048926 Ga0496123_0027389 Ga0496123_0027389_2441_3016 191
994 3300048926 Ga0496123_0050483 Ga0496123_0050483_1828_2403 191
995 3300048927 Ga0496124_0020696 Ga0496124_0020696_4684_5259 191
996 3300048927 Ga0496124_0033789 Ga0496124_0033789_1845_2420 191
997 3300048927 Ga0496124_0041243 Ga0496124_0041243_3156_3731 191
998 3300048927 Ga0496124_0045904 Ga0496124_0045904_2843_3418 191
999 3300048927 Ga0496124_0062162 Ga0496124_0062162_1268_1843 191
1000 3300048927 Ga0496124_0287774 Ga0496124_0287774_211_786 191
1001 3300048928 Ga0496125_0014923 Ga0496125_0014923_2208_2831 191
1002 3300048928 Ga0496125_0033046 Ga0496125_0033046_1783_2358 191
1003 3300048928 Ga0496125_0034532 Ga0496125_0034532_758_1354 191
1004 3300048929 Ga0496126_0273102 Ga0496126_0273102_239_814 191
1005 3300048929 Ga0496126_0670010 Ga0496126_0670010_190_765 191
1006 3300049459 Ga0495678_002293 Ga0495678_002293_2758_3333 191
1007 3300049459 Ga0495678_002324 Ga0495678_002324_2748_3323 191
1008 3300049459 Ga0495678_002486 Ga0495678_002486_2293_2868 191
1009 3300049459 Ga0495678_002506 Ga0495678_002506_2224_2838 191
1010 3300049459 Ga0495678_002601 Ga0495678_002601_9415_9990 191
1011 3300049459 Ga0495678_002835 Ga0495678_002835_1477_2052 191
1012 3300049459 Ga0495678_004648 Ga0495678_004648_2278_2892 191
1013 3300049459 Ga0495678_027181 Ga0495678_027181_550_1125 191
1014 3300049459 Ga0495678_037460 Ga0495678_037460_189_764 191
1015 3300049459 Ga0495678_039972 Ga0495678_039972_26_601 191
1016 3300049459 Ga0495678_096941 Ga0495678_096941_235_858 191
1017 3300049459 Ga0495678_110234 Ga0495678_110234_291_866 191
1018 3300049460 Ga0495682_0001251 Ga0495682_0001251_4157_4732 191
1019 3300049460 Ga0495682_0002016 Ga0495682_0002016_2747_3322 191
1020 3300049460 Ga0495682_0003654 Ga0495682_0003654_995_1609 191
1021 3300049460 Ga0495682_0005470 Ga0495682_0005470_2606_3181 191
1022 3300049460 Ga0495682_0011752 Ga0495682_0011752_1944_2558 191
1023 3300049460 Ga0495682_0106812 Ga0495682_0106812_191_766 191
1024 3300049662 Ga0501222_000201 Ga0501222_000201_8100_8675 191
1025 3300050489 nmdc:mga03683_7439_c1 nmdc:mga03683_7439_c1_402_977 191
1026 3300050491 nmdc:mga00v17_113143_c1 nmdc:mga00v17_113143_c1_265_840 191
1027 3300050491 nmdc:mga00v17_69459_c1 nmdc:mga00v17_69459_c1_1041_1616 191
1028 3300050514 nmdc:mga08x19_280063_c1 nmdc:mga08x19_280063_c1_443_1066 191
1029 3300050514 nmdc:mga08x19_317394_c1 nmdc:mga08x19_317394_c1_192_767 191
1030 3300053111 Ga0500572_000540 Ga0500572_000540_9562_10137 191
1031 3300053126 Ga0500621_004535 Ga0500621_004535_1053_1628 191
1032 3300053145 Ga0500586_007980 Ga0500586_007980_1212_1787 191
1033 iso_pu_bacteria 2599185160 2599354694 191
1034 iso_pu_bacteria 2599185161 2599361496 191
1035 iso_pu_bacteria 2599185162 2599367818 191
1036 iso_pu_bacteria 2599185163 2599374608 191
1037 iso_pu_bacteria 2599185164 2599379801 191
1038 iso_pu_bacteria 2599185165 2599386247 191
1039 iso_pu_bacteria 2599185166 2599393466 191
1040 iso_pu_bacteria 2599185168 2599405233 191
1041 iso_pu_bacteria 2599185181 2599461528 191
1042 iso_pu_bacteria 2599185182 2599467449 191
1043 iso_pu_bacteria 2599185186 2599491378 191
1044 iso_pu_bacteria 2599185356 2600214146 191
1045 iso_pu_bacteria 2600255313 2601775149 191
1046 iso_pu_bacteria 2667528171 2671097275 191
1047 iso_pu_bacteria 2818991464 2819702374 191
1048 iso_pu_bacteria 2935353572 2935353575 191
1049 iso_pu_bacteria 637000220 637318086 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13689

DUF4154

YfiR/HmsC-like

84

224

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xjy-assembly2.cif.gz_C periplasmic repressor protein yfir 0.9536 41 182
4zhy-assembly1.cif.gz_A crystal structure of a bacterial signalling complex 0.9521 41 186
4yna-assembly2.cif.gz_D oxidized yfir 0.9511 39 180
4yn9-assembly1.cif.gz_B yfir mutant-c110s 0.9421 39 184
4yna-assembly2.cif.gz_D oxidized yfir 0.926 39 180
ID Description Score Start End Superfamily
af_P64548_29_167_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8594 46 184 3.40.50.2300
af_P64548_29_167_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.848 46 184 3.40.50.2300
af_Q03144_12_224_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.6761 67 140 3.40.50.880
4pg7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.667 64 139 3.40.50.720
4rs3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6649 67 152 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7W4XNL2-F1-model_v4 deleted 0.9698 39 190
AF-A0A7U9Q3J3-F1-model_v4 deleted 0.9677 33 190
AF-A0A024EB96-F1-model_v4 YfiR family protein 0.9648 33 190
AF-A0A423E6Y0-F1-model_v4 deleted 0.9637 33 190
AF-U6ZVP7-F1-model_v4 deleted 0.9621 33 190

Feature Viewer

pLDDT pTM Quality
81.98 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map