F489012
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1049 | 418 | 887 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300002737|JGI25162J39368_1000167|JGI25162J39368_100016764 |
| Length | 230 |
| Sequence | MFPAFLRRRARVLVSLHFPGLCYRCGIISVKIKENPCMDVAVLRTERILGWRQCVLSTILCLFSLLAFAQSEPPAAASLAEQRAKAVTQVVLGILSYARWPVEPAQLRLCVVGPTEYTDDLLKGTTQATGRPVLVRRLLANNPSLASECDSVYVGKLSNDERTRLFNSLTGQPVLSISEGGDQCTVGSLFCLRVGDSQVSFEVNLDSVARSGVKIHPSVLQLSRRRPAAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 7 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 8 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 9 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 10 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 11 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 12 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 13 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 14 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 15 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 16 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 17 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 18 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 19 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 20 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 21 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 22 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 23 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 24 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 25 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 26 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 27 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 28 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 29 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 30 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 31 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 32 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 33 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 34 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 35 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 36 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 37 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 38 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 39 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 40 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 41 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 42 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 43 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 44 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 45 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 46 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 47 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 48 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 49 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 50 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 51 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 52 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 53 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 54 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 55 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 56 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 57 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 58 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 59 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 60 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 61 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 62 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 63 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 64 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 65 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 66 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 67 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 68 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 69 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 70 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 71 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 72 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 73 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 74 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 75 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 76 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 77 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 78 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 79 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 80 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 81 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 82 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 83 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 84 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 85 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 86 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 87 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 88 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 89 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 90 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 91 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 92 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 93 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 94 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 95 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 96 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 97 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 98 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 99 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 100 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 101 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 102 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 103 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 104 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 105 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 106 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 107 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 108 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 109 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 110 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 111 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 112 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 113 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 114 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 115 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 116 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 117 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 118 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 119 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 120 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 121 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 122 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 123 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 124 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 125 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 126 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 127 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 128 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 129 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 130 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 131 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 132 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 133 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 134 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 135 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 136 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 137 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 138 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 139 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 140 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 141 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 142 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 143 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 144 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 145 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 146 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 147 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 148 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 149 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 150 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 151 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 152 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 153 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 154 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 155 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 156 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 157 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 158 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 159 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 160 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 161 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 162 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 163 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 164 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 165 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 172 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 174 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 175 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 176 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 177 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 178 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 179 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 180 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 181 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 189 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 190 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 198 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 199 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 200 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 201 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 212 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 214 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 216 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 241 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 242 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 243 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 244 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 245 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 248 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 250 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 251 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 252 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 254 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 255 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 256 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 257 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 258 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 259 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 260 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 261 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 262 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 263 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 264 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 265 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 266 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 267 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 268 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 269 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 270 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 271 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 272 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 273 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 274 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 275 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 276 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 277 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 278 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 279 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 280 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 281 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 282 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 283 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 284 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 285 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 286 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 287 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 288 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 289 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 290 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 291 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 292 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 293 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 294 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 372 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 373 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 374 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 375 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 376 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 377 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 378 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 379 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 380 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 381 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 382 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 383 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 384 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 385 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 386 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 387 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 388 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 389 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 390 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 391 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 394 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 395 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 396 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 397 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 402 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 403 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 404 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 405 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 406 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 407 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 408 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 409 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 410 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 411 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 412 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 413 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 414 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 415 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 416 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 417 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 418 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.56 |
| Metatranscriptomes | 0 |
| Isolates | 15.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.67 |
| Nodule | 2 |
| Rhizoplane | 6.67 |
| Rhizosphere | 75.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_391 | 2124908027 | Bacteria | 4199 |
| 2 | MRS2a_Contig_90 | 2124908027 | Bacteria | 24233 |
| 3 | SwRhRL2b_contig_710988 | 2162886007 | Bacteria | 9315 |
| 4 | JGI25162J39368_1000167 | 3300002737 | Bacteria | 72147 |
| 5 | JGI25162J39368_1000186 | 3300002737 | Bacteria | 65946 |
| 6 | JGI25163J39215_1000185 | 3300002771 | Bacteria | 24073 |
| 7 | JGI25163J39215_1000378 | 3300002771 | Bacteria | 14325 |
| 8 | JGI25164J39214_1000131 | 3300002772 | Bacteria | 72147 |
| 9 | JGI25164J39214_1000150 | 3300002772 | Bacteria | 65946 |
| 10 | JGI25165J46597_1000252 | 3300003214 | Bacteria | 72147 |
| 11 | JGI25165J46597_1000277 | 3300003214 | Bacteria | 65946 |
| 12 | Ga0055538_1000028 | 3300003751 | Bacteria | 215806 |
| 13 | Ga0055539_1000037 | 3300003752 | Bacteria | 215806 |
| 14 | Ga0055533_1000047 | 3300003756 | Bacteria | 215806 |
| 15 | Ga0055532_1000065 | 3300003758 | Bacteria | 141003 |
| 16 | Ga0055525_1000176 | 3300003759 | Bacteria | 79649 |
| 17 | Ga0055525_1007889 | 3300003759 | Bacteria | 900 |
| 18 | Ga0055536_1000104 | 3300003781 | Bacteria | 73560 |
| 19 | Ga0055536_1000105 | 3300003781 | Bacteria | 73391 |
| 20 | Ga0055536_1000180 | 3300003781 | Bacteria | 52407 |
| 21 | Ga0055530_10000213 | 3300003791 | Bacteria | 52407 |
| 22 | Ga0055530_10000274 | 3300003791 | Bacteria | 46761 |
| 23 | Ga0055530_10000768 | 3300003791 | Bacteria | 26738 |
| 24 | Ga0055530_10048558 | 3300003791 | Bacteria | 996 |
| 25 | Ga0055540_1000135 | 3300003792 | Bacteria | 73560 |
| 26 | Ga0055540_1000270 | 3300003792 | Bacteria | 46761 |
| 27 | Ga0055540_1000413 | 3300003792 | Bacteria | 34507 |
| 28 | Ga0055531_10000350 | 3300003794 | Bacteria | 45099 |
| 29 | Ga0055531_10063662 | 3300003794 | Bacteria | 885 |
| 30 | Ga0055541_1000025 | 3300003841 | Bacteria | 215806 |
| 31 | Ga0065714_10002436 | 3300005288 | Bacteria | 17721 |
| 32 | Ga0065714_10014541 | 3300005288 | Bacteria | 2144 |
| 33 | Ga0065714_10079296 | 3300005288 | Bacteria | 2527 |
| 34 | Ga0065714_10084720 | 3300005288 | Bacteria | 2175 |
| 35 | Ga0065704_10019143 | 3300005289 | Bacteria | 1697 |
| 36 | Ga0065704_10071876 | 3300005289 | Bacteria | 9694 |
| 37 | Ga0065704_10159964 | 3300005289 | Bacteria | 1362 |
| 38 | Ga0070670_100001943 | 3300005331 | Bacteria | 16924 |
| 39 | Ga0070660_100878713 | 3300005339 | Bacteria | 755 |
| 40 | Ga0070661_100001008 | 3300005344 | Bacteria | 19964 |
| 41 | Ga0070669_100000203 | 3300005353 | Bacteria | 51110 |
| 42 | Ga0070669_100000746 | 3300005353 | Bacteria | 23697 |
| 43 | Ga0070714_100098727 | 3300005435 | Bacteria | 2569 |
| 44 | Ga0070662_100000469 | 3300005457 | Bacteria | 24003 |
| 45 | Ga0070662_100031311 | 3300005457 | Bacteria | 3733 |
| 46 | Ga0068853_100000107 | 3300005539 | Bacteria | 56373 |
| 47 | Ga0070664_100001301 | 3300005564 | Bacteria | 19964 |
| 48 | Ga0070664_100012771 | 3300005564 | Bacteria | 6833 |
| 49 | Ga0068854_100053493 | 3300005578 | Bacteria | 2900 |
| 50 | Ga0068851_10000032 | 3300005834 | Bacteria | 108531 |
| 51 | Ga0075364_10070877 | 3300006051 | Bacteria | 2295 |
| 52 | Ga0075364_10072244 | 3300006051 | Bacteria | 2274 |
| 53 | Ga0075364_10323583 | 3300006051 | Bacteria | 1050 |
| 54 | Ga0075432_10011413 | 3300006058 | Bacteria | 3018 |
| 55 | Ga0075432_10029452 | 3300006058 | Bacteria | 1895 |
| 56 | Ga0075432_10089782 | 3300006058 | Bacteria | 1123 |
| 57 | Ga0075362_10066586 | 3300006177 | Bacteria | 1637 |
| 58 | Ga0075362_10077407 | 3300006177 | Bacteria | 1528 |
| 59 | Ga0075436_100069387 | 3300006914 | Bacteria | 2435 |
| 60 | Ga0079104_1000362 | 3300006946 | Bacteria | 54502 |
| 61 | Ga0099826_10011004 | 3300006948 | Bacteria | 6798 |
| 62 | Ga0105251_10006139 | 3300009011 | Bacteria | 7734 |
| 63 | Ga0105251_10155776 | 3300009011 | Bacteria | 1031 |
| 64 | Ga0105244_10002516 | 3300009036 | Bacteria | 13785 |
| 65 | Ga0105244_10002835 | 3300009036 | Bacteria | 12864 |
| 66 | Ga0105244_10003144 | 3300009036 | Bacteria | 12019 |
| 67 | Ga0105244_10008732 | 3300009036 | Bacteria | 6303 |
| 68 | Ga0105244_10015291 | 3300009036 | Bacteria | 4404 |
| 69 | Ga0105244_10018916 | 3300009036 | Bacteria | 3856 |
| 70 | Ga0105244_10020581 | 3300009036 | Bacteria | 3662 |
| 71 | Ga0105244_10055429 | 3300009036 | Bacteria | 2008 |
| 72 | Ga0105244_10067683 | 3300009036 | Bacteria | 1786 |
| 73 | Ga0105250_10000275 | 3300009092 | Bacteria | 41677 |
| 74 | Ga0105250_10000297 | 3300009092 | Bacteria | 39195 |
| 75 | Ga0105250_10003737 | 3300009092 | Bacteria | 7147 |
| 76 | Ga0105250_10007997 | 3300009092 | Bacteria | 4510 |
| 77 | Ga0105243_10000174 | 3300009148 | Bacteria | 73806 |
| 78 | Ga0105243_10003246 | 3300009148 | Bacteria | 13263 |
| 79 | Ga0105243_10057750 | 3300009148 | Bacteria | 3091 |
| 80 | Ga0105242_10006290 | 3300009176 | Bacteria | 9149 |
| 81 | Ga0105242_10792408 | 3300009176 | Bacteria | 937 |
| 82 | Ga0105237_10003115 | 3300009545 | Bacteria | 19970 |
| 83 | Ga0105246_10001653 | 3300011119 | Bacteria | 13294 |
| 84 | Ga0105246_10003529 | 3300011119 | Bacteria | 9474 |
| 85 | Ga0105246_10073019 | 3300011119 | Bacteria | 2421 |
| 86 | Ga0105246_10095828 | 3300011119 | Bacteria | 2149 |
| 87 | Ga0105246_10344871 | 3300011119 | Bacteria | 1218 |
| 88 | Ga0105246_10430731 | 3300011119 | Bacteria | 1103 |
| 89 | Ga0157345_1000142 | 3300012498 | Bacteria | 12906 |
| 90 | Ga0157345_1001470 | 3300012498 | Bacteria | 1658 |
| 91 | Ga0157347_1001370 | 3300012502 | Bacteria | 1893 |
| 92 | Ga0157373_10002919 | 3300013100 | Bacteria | 12949 |
| 93 | Ga0157373_10003453 | 3300013100 | Bacteria | 11960 |
| 94 | Ga0157373_10009898 | 3300013100 | Bacteria | 7027 |
| 95 | Ga0157373_10021739 | 3300013100 | Bacteria | 4656 |
| 96 | Ga0157373_10069372 | 3300013100 | Bacteria | 2492 |
| 97 | Ga0157371_10000244 | 3300013102 | Bacteria | 77369 |
| 98 | Ga0157371_10001413 | 3300013102 | Bacteria | 25012 |
| 99 | Ga0157371_10005069 | 3300013102 | Bacteria | 11251 |
| 100 | Ga0157370_10024126 | 3300013104 | Bacteria | 6028 |
| 101 | Ga0157370_10038317 | 3300013104 | Bacteria | 4637 |
| 102 | Ga0157370_10053845 | 3300013104 | Bacteria | 3836 |
| 103 | Ga0157370_10306529 | 3300013104 | Bacteria | 1465 |
| 104 | Ga0157369_10003571 | 3300013105 | Bacteria | 18480 |
| 105 | Ga0157369_10007090 | 3300013105 | Bacteria | 12930 |
| 106 | Ga0157369_10007109 | 3300013105 | Bacteria | 12908 |
| 107 | Ga0157369_10017894 | 3300013105 | Bacteria | 7954 |
| 108 | Ga0163162_10000092 | 3300013306 | Bacteria | 82766 |
| 109 | Ga0163162_10003797 | 3300013306 | Bacteria | 14490 |
| 110 | Ga0157372_10004825 | 3300013307 | Bacteria | 14337 |
| 111 | Ga0157375_10004942 | 3300013308 | Bacteria | 11596 |
| 112 | Ga0157375_10150709 | 3300013308 | Bacteria | 2461 |
| 113 | Ga0157375_10656918 | 3300013308 | Bacteria | 1204 |
| 114 | Ga0182008_10000158 | 3300014497 | Bacteria | 53489 |
| 115 | Ga0182008_10001704 | 3300014497 | Bacteria | 14417 |
| 116 | Ga0182008_10005864 | 3300014497 | Bacteria | 6940 |
| 117 | Ga0182008_10024454 | 3300014497 | Bacteria | 3076 |
| 118 | Ga0182006_1000235 | 3300015261 | Bacteria | 52295 |
| 119 | Ga0182006_1000653 | 3300015261 | Bacteria | 24647 |
| 120 | Ga0182006_1001434 | 3300015261 | Bacteria | 14424 |
| 121 | Ga0182006_1004794 | 3300015261 | Bacteria | 6586 |
| 122 | Ga0182006_1103496 | 3300015261 | Bacteria | 1008 |
| 123 | Ga0182006_1109663 | 3300015261 | Bacteria | 970 |
| 124 | Ga0182006_1138919 | 3300015261 | Bacteria | 831 |
| 125 | Ga0182007_10001596 | 3300015262 | Bacteria | 12051 |
| 126 | Ga0182007_10012849 | 3300015262 | Bacteria | 3211 |
| 127 | Ga0182005_1000742 | 3300015265 | Bacteria | 14928 |
| 128 | Ga0182005_1025476 | 3300015265 | Bacteria | 1614 |
| 129 | Ga0163161_10002110 | 3300017792 | Bacteria | 14386 |
| 130 | Ga0163161_10002705 | 3300017792 | Bacteria | 12600 |
| 131 | Ga0163161_10014922 | 3300017792 | Bacteria | 5411 |
| 132 | Ga0163161_10019391 | 3300017792 | Bacteria | 4771 |
| 133 | Ga0163161_10068681 | 3300017792 | Bacteria | 2590 |
| 134 | Ga0163161_10086692 | 3300017792 | Bacteria | 2311 |
| 135 | Ga0209760_100072 | 3300025207 | Bacteria | 81642 |
| 136 | Ga0209760_100100 | 3300025207 | Bacteria | 66035 |
| 137 | Ga0209784_100032 | 3300025224 | Bacteria | 314079 |
| 138 | Ga0209566_100036 | 3300025225 | Bacteria | 314079 |
| 139 | Ga0209674_100054 | 3300025226 | Bacteria | 314079 |
| 140 | Ga0209147_100055 | 3300025229 | Bacteria | 262412 |
| 141 | Ga0209563_100055 | 3300025230 | Bacteria | 314079 |
| 142 | Ga0209563_100401 | 3300025230 | Bacteria | 15461 |
| 143 | Ga0207427_100116 | 3300025231 | Bacteria | 104213 |
| 144 | Ga0207427_100180 | 3300025231 | Bacteria | 65995 |
| 145 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 146 | Ga0209437_100309 | 3300025233 | Bacteria | 65994 |
| 147 | Ga0209258_100239 | 3300025242 | Bacteria | 101232 |
| 148 | Ga0209646_1000736 | 3300025246 | Bacteria | 11511 |
| 149 | Ga0209677_100033 | 3300025253 | Bacteria | 314079 |
| 150 | Ga0209759_1043999 | 3300025256 | Bacteria | 742 |
| 151 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 152 | Ga0209233_1000220 | 3300025261 | Bacteria | 104213 |
| 153 | Ga0209675_1001904 | 3300025291 | Bacteria | 11257 |
| 154 | Ga0209676_1000255 | 3300025292 | Bacteria | 112911 |
| 155 | Ga0209676_1000357 | 3300025292 | Bacteria | 86622 |
| 156 | Ga0209676_1000428 | 3300025292 | Bacteria | 73542 |
| 157 | Ga0209676_1013675 | 3300025292 | Bacteria | 3105 |
| 158 | Ga0209676_1020328 | 3300025292 | Bacteria | 2259 |
| 159 | Ga0209050_1000041 | 3300025298 | Bacteria | 408004 |
| 160 | Ga0209050_1000287 | 3300025298 | Bacteria | 106507 |
| 161 | Ga0209050_1000420 | 3300025298 | Bacteria | 78413 |
| 162 | Ga0209050_1002033 | 3300025298 | Bacteria | 18716 |
| 163 | Ga0209051_1000199 | 3300025303 | Bacteria | 106517 |
| 164 | Ga0209051_1000229 | 3300025303 | Bacteria | 94109 |
| 165 | Ga0209051_1000250 | 3300025303 | Bacteria | 90973 |
| 166 | Ga0209051_1002350 | 3300025303 | Bacteria | 13689 |
| 167 | Ga0209257_1000469 | 3300025304 | Bacteria | 73612 |
| 168 | Ga0209257_1019861 | 3300025304 | Bacteria | 2511 |
| 169 | Ga0207656_10000065 | 3300025321 | Bacteria | 40587 |
| 170 | Ga0207696_1000220 | 3300025711 | Bacteria | 82790 |
| 171 | Ga0207696_1000228 | 3300025711 | Bacteria | 79456 |
| 172 | Ga0207696_1001630 | 3300025711 | Bacteria | 11834 |
| 173 | Ga0207696_1002351 | 3300025711 | Bacteria | 9351 |
| 174 | Ga0207696_1012066 | 3300025711 | Bacteria | 3073 |
| 175 | Ga0207655_1001136 | 3300025728 | Bacteria | 25945 |
| 176 | Ga0207655_1001232 | 3300025728 | Bacteria | 24606 |
| 177 | Ga0207655_1002149 | 3300025728 | Bacteria | 16441 |
| 178 | Ga0207655_1002877 | 3300025728 | Bacteria | 13299 |
| 179 | Ga0207655_1003022 | 3300025728 | Bacteria | 12866 |
| 180 | Ga0207655_1003278 | 3300025728 | Bacteria | 12147 |
| 181 | Ga0207655_1005603 | 3300025728 | Bacteria | 8500 |
| 182 | Ga0207655_1011951 | 3300025728 | Bacteria | 5118 |
| 183 | Ga0207655_1041460 | 3300025728 | Bacteria | 1972 |
| 184 | Ga0207655_1081799 | 3300025728 | Bacteria | 1163 |
| 185 | Ga0207713_1000355 | 3300025735 | Bacteria | 50017 |
| 186 | Ga0207713_1000499 | 3300025735 | Bacteria | 40375 |
| 187 | Ga0207713_1000722 | 3300025735 | Bacteria | 30911 |
| 188 | Ga0207713_1001537 | 3300025735 | Bacteria | 18165 |
| 189 | Ga0207713_1003046 | 3300025735 | Bacteria | 11677 |
| 190 | Ga0207713_1007282 | 3300025735 | Bacteria | 6564 |
| 191 | Ga0207713_1007912 | 3300025735 | Bacteria | 6195 |
| 192 | Ga0207713_1009034 | 3300025735 | Bacteria | 5662 |
| 193 | Ga0207713_1091746 | 3300025735 | Bacteria | 1066 |
| 194 | Ga0207713_1112866 | 3300025735 | Bacteria | 922 |
| 195 | Ga0207671_10002416 | 3300025914 | Bacteria | 20020 |
| 196 | Ga0207649_10000006 | 3300025920 | Bacteria | 349180 |
| 197 | Ga0207681_10000095 | 3300025923 | Bacteria | 75012 |
| 198 | Ga0207681_10003682 | 3300025923 | Bacteria | 9528 |
| 199 | Ga0207650_10000276 | 3300025925 | Bacteria | 53717 |
| 200 | Ga0207650_10000299 | 3300025925 | Bacteria | 49108 |
| 201 | Ga0207664_10111425 | 3300025929 | Bacteria | 2277 |
| 202 | Ga0207706_10000846 | 3300025933 | Bacteria | 31519 |
| 203 | Ga0207706_10007081 | 3300025933 | Bacteria | 10371 |
| 204 | Ga0207686_10078743 | 3300025934 | Bacteria | 2144 |
| 205 | Ga0207709_10000125 | 3300025935 | Bacteria | 114144 |
| 206 | Ga0207709_10000302 | 3300025935 | Bacteria | 53928 |
| 207 | Ga0207709_10212748 | 3300025935 | Bacteria | 1389 |
| 208 | Ga0207711_10078188 | 3300025941 | Bacteria | 2885 |
| 209 | Ga0207679_10000010 | 3300025945 | Bacteria | 349180 |
| 210 | Ga0207640_10402972 | 3300025981 | Bacteria | 1114 |
| 211 | Ga0207639_10000167 | 3300026041 | Bacteria | 50855 |
| 212 | Ga0209281_1000015 | 3300027111 | Bacteria | 590084 |
| 213 | Ga0209281_1000256 | 3300027111 | Bacteria | 103502 |
| 214 | Ga0209281_1013120 | 3300027111 | Bacteria | 1798 |
| 215 | Ga0209282_1035142 | 3300027666 | Bacteria | 3041 |
| 216 | Ga0207428_10004072 | 3300027907 | Bacteria | 14005 |
| 217 | Ga0207428_10051124 | 3300027907 | Bacteria | 3304 |
| 218 | Ga0207428_10336289 | 3300027907 | Bacteria | 1113 |
| 219 | Ga0268266_10008427 | 3300028379 | Bacteria | 9165 |
| 220 | Ga0268266_10463142 | 3300028379 | Bacteria | 1206 |
| 221 | Ga0268266_11139905 | 3300028379 | Bacteria | 754 |
| 222 | Ga0307511_10065146 | 3300030521 | Bacteria | 2731 |
| 223 | Ga0316177_1185208 | 3300030731 | Bacteria | 3143 |
| 224 | Ga0316179_1010585 | 3300030734 | Bacteria | 4487 |
| 225 | Ga0316178_1004939 | 3300030735 | Bacteria | 26685 |
| 226 | Ga0316181_1158599 | 3300030744 | Bacteria | 3678 |
| 227 | Ga0307509_10032347 | 3300031507 | Bacteria | 5764 |
| 228 | Ga0307408_100002080 | 3300031548 | Bacteria | 14415 |
| 229 | Ga0307408_100002720 | 3300031548 | Bacteria | 12279 |
| 230 | Ga0307408_100106913 | 3300031548 | Bacteria | 2141 |
| 231 | Ga0307408_100434195 | 3300031548 | Bacteria | 1135 |
| 232 | Ga0307516_10090513 | 3300031730 | Bacteria | 2888 |
| 233 | Ga0307516_10092653 | 3300031730 | Bacteria | 2848 |
| 234 | Ga0307516_10262732 | 3300031730 | Bacteria | 1416 |
| 235 | Ga0307405_10000760 | 3300031731 | Bacteria | 12581 |
| 236 | Ga0307405_10001020 | 3300031731 | Bacteria | 11336 |
| 237 | Ga0307405_10006009 | 3300031731 | Bacteria | 5930 |
| 238 | Ga0307405_10008491 | 3300031731 | Bacteria | 5210 |
| 239 | Ga0307413_10026868 | 3300031824 | Bacteria | 3179 |
| 240 | Ga0307413_10060076 | 3300031824 | Bacteria | 2338 |
| 241 | Ga0307413_10079927 | 3300031824 | Bacteria | 2092 |
| 242 | Ga0307406_10037375 | 3300031901 | Bacteria | 2998 |
| 243 | Ga0307407_10116784 | 3300031903 | Bacteria | 1684 |
| 244 | Ga0307407_10200422 | 3300031903 | Bacteria | 1337 |
| 245 | Ga0307412_10000617 | 3300031911 | Bacteria | 20901 |
| 246 | Ga0307412_10001102 | 3300031911 | Bacteria | 15467 |
| 247 | Ga0307412_10001467 | 3300031911 | Bacteria | 13125 |
| 248 | Ga0307412_10050604 | 3300031911 | Bacteria | 2742 |
| 249 | Ga0307412_10076907 | 3300031911 | Bacteria | 2294 |
| 250 | Ga0307412_10249065 | 3300031911 | Bacteria | 1378 |
| 251 | Ga0307412_10364290 | 3300031911 | Bacteria | 1165 |
| 252 | Ga0307409_100034418 | 3300031995 | Bacteria | 3699 |
| 253 | Ga0307414_10002708 | 3300032004 | Bacteria | 9323 |
| 254 | Ga0307414_10196071 | 3300032004 | Bacteria | 1638 |
| 255 | Ga0307411_10005345 | 3300032005 | Bacteria | 6293 |
| 256 | Ga0307411_10155211 | 3300032005 | Bacteria | 1706 |
| 257 | Ga0307411_10246204 | 3300032005 | Bacteria | 1403 |
| 258 | Ga0307510_10007724 | 3300033180 | Bacteria | 12829 |
| 259 | Ga0237819_00983 | 3300038705 | Bacteria | 8634 |
| 260 | Ga0439438_000216 | 3300041405 | Bacteria | 26512 |
| 261 | Ga0439438_000921 | 3300041405 | Bacteria | 13124 |
| 262 | Ga0439438_000970 | 3300041405 | Bacteria | 12813 |
| 263 | Ga0439438_000971 | 3300041405 | Bacteria | 12809 |
| 264 | Ga0439438_000987 | 3300041405 | Bacteria | 12711 |
| 265 | Ga0439438_003415 | 3300041405 | Bacteria | 6427 |
| 266 | Ga0439438_007725 | 3300041405 | Bacteria | 3641 |
| 267 | Ga0439438_009691 | 3300041405 | Bacteria | 3101 |
| 268 | Ga0439447_000438 | 3300041407 | Bacteria | 15499 |
| 269 | Ga0439447_000941 | 3300041407 | Bacteria | 10643 |
| 270 | Ga0439447_001589 | 3300041407 | Bacteria | 8317 |
| 271 | Ga0439447_036170 | 3300041407 | Bacteria | 1220 |
| 272 | Ga0439461_0007246 | 3300041410 | Bacteria | 1957 |
| 273 | Ga0439466_0000198 | 3300041411 | Bacteria | 23790 |
| 274 | Ga0439466_0000636 | 3300041411 | Bacteria | 13206 |
| 275 | Ga0439466_0000803 | 3300041411 | Bacteria | 11947 |
| 276 | Ga0439466_0000822 | 3300041411 | Bacteria | 11826 |
| 277 | Ga0439466_0007430 | 3300041411 | Bacteria | 4149 |
| 278 | Ga0439466_0009500 | 3300041411 | Bacteria | 3633 |
| 279 | Ga0439466_0011877 | 3300041411 | Bacteria | 3216 |
| 280 | Ga0439466_0052896 | 3300041411 | Bacteria | 1326 |
| 281 | Ga0439466_0053660 | 3300041411 | Bacteria | 1314 |
| 282 | Ga0439466_0102460 | 3300041411 | Bacteria | 891 |
| 283 | Ga0439466_0104870 | 3300041411 | Bacteria | 879 |
| 284 | Ga0439465_0007265 | 3300041413 | Bacteria | 3520 |
| 285 | Ga0439465_0008308 | 3300041413 | Bacteria | 3276 |
| 286 | Ga0439465_0053952 | 3300041413 | Bacteria | 1321 |
| 287 | Ga0439431_0000175 | 3300041997 | Bacteria | 12354 |
| 288 | Ga0439442_011964 | 3300042002 | Bacteria | 1770 |
| 289 | Ga0439445_0000618 | 3300042004 | Bacteria | 7304 |
| 290 | Ga0439445_0010120 | 3300042004 | Bacteria | 2227 |
| 291 | Ga0439432_000118 | 3300042006 | Bacteria | 25847 |
| 292 | Ga0439432_000668 | 3300042006 | Bacteria | 12825 |
| 293 | Ga0439432_000765 | 3300042006 | Bacteria | 12050 |
| 294 | Ga0439432_000781 | 3300042006 | Bacteria | 11928 |
| 295 | Ga0439432_000960 | 3300042006 | Bacteria | 10892 |
| 296 | Ga0439432_001756 | 3300042006 | Bacteria | 8123 |
| 297 | Ga0439432_003401 | 3300042006 | Bacteria | 5907 |
| 298 | Ga0439432_005090 | 3300042006 | Bacteria | 4755 |
| 299 | Ga0439432_054859 | 3300042006 | Bacteria | 1237 |
| 300 | Ga0439451_000187 | 3300042009 | Bacteria | 11751 |
| 301 | Ga0439451_000218 | 3300042009 | Bacteria | 10980 |
| 302 | Ga0439451_000752 | 3300042009 | Bacteria | 6153 |
| 303 | Ga0439451_001335 | 3300042009 | Bacteria | 4859 |
| 304 | Ga0439451_006474 | 3300042009 | Bacteria | 2394 |
| 305 | Ga0439451_006996 | 3300042009 | Bacteria | 2306 |
| 306 | Ga0439452_000152 | 3300042010 | Bacteria | 51070 |
| 307 | Ga0439452_000379 | 3300042010 | Bacteria | 26660 |
| 308 | Ga0439452_000529 | 3300042010 | Bacteria | 20421 |
| 309 | Ga0439452_000975 | 3300042010 | Bacteria | 12845 |
| 310 | Ga0439452_003073 | 3300042010 | Bacteria | 5924 |
| 311 | Ga0439452_003121 | 3300042010 | Bacteria | 5874 |
| 312 | Ga0439452_004190 | 3300042010 | Bacteria | 4889 |
| 313 | Ga0439452_005654 | 3300042010 | Bacteria | 4004 |
| 314 | Ga0439452_005740 | 3300042010 | Bacteria | 3966 |
| 315 | Ga0439452_005823 | 3300042010 | Bacteria | 3930 |
| 316 | Ga0439452_047855 | 3300042010 | Bacteria | 987 |
| 317 | Ga0439456_000013 | 3300042013 | Bacteria | 72544 |
| 318 | Ga0439456_000928 | 3300042013 | Bacteria | 5857 |
| 319 | Ga0439456_002183 | 3300042013 | Bacteria | 3940 |
| 320 | Ga0439456_002595 | 3300042013 | Bacteria | 3638 |
| 321 | Ga0439456_002847 | 3300042013 | Bacteria | 3488 |
| 322 | Ga0439456_005722 | 3300042013 | Bacteria | 2526 |
| 323 | Ga0439456_013847 | 3300042013 | Bacteria | 1680 |
| 324 | Ga0439456_015463 | 3300042013 | Bacteria | 1593 |
| 325 | Ga0439456_015673 | 3300042013 | Bacteria | 1584 |
| 326 | Ga0439456_043380 | 3300042013 | Bacteria | 977 |
| 327 | Ga0439463_000108 | 3300042016 | Bacteria | 20212 |
| 328 | Ga0439463_000407 | 3300042016 | Bacteria | 11928 |
| 329 | Ga0439463_001893 | 3300042016 | Bacteria | 5432 |
| 330 | Ga0439463_009927 | 3300042016 | Bacteria | 2339 |
| 331 | Ga0439463_010205 | 3300042016 | Bacteria | 2308 |
| 332 | Ga0439463_011079 | 3300042016 | Bacteria | 2215 |
| 333 | Ga0450911_000387 | 3300042115 | Bacteria | 14613 |
| 334 | Ga0450911_000478 | 3300042115 | Bacteria | 12844 |
| 335 | Ga0450911_003172 | 3300042115 | Bacteria | 2969 |
| 336 | Ga0450911_028694 | 3300042115 | Bacteria | 722 |
| 337 | Ga0450912_004987 | 3300042116 | Bacteria | 1004 |
| 338 | Ga0450919_001131 | 3300042121 | Bacteria | 3459 |
| 339 | Ga0450922_000758 | 3300042124 | Bacteria | 3325 |
| 340 | Ga0450922_001000 | 3300042124 | Bacteria | 2830 |
| 341 | Ga0450890_000119 | 3300042127 | Bacteria | 12377 |
| 342 | Ga0450892_001614 | 3300042130 | Bacteria | 2122 |
| 343 | Ga0450902_002851 | 3300042137 | Bacteria | 2480 |
| 344 | Ga0450902_003845 | 3300042137 | Bacteria | 2215 |
| 345 | Ga0450902_009143 | 3300042137 | Bacteria | 1558 |
| 346 | Ga0450902_015188 | 3300042137 | Bacteria | 1248 |
| 347 | Ga0450903_000657 | 3300042138 | Bacteria | 6973 |
| 348 | Ga0450903_000690 | 3300042138 | Bacteria | 6744 |
| 349 | Ga0450903_007644 | 3300042138 | Bacteria | 1774 |
| 350 | Ga0450903_027639 | 3300042138 | Bacteria | 862 |
| 351 | Ga0450904_001279 | 3300042139 | Bacteria | 3701 |
| 352 | Ga0450904_006689 | 3300042139 | Bacteria | 1148 |
| 353 | Ga0450905_000040 | 3300042142 | Bacteria | 10921 |
| 354 | Ga0450905_001001 | 3300042142 | Bacteria | 3544 |
| 355 | Ga0450906_000161 | 3300042145 | Bacteria | 12610 |
| 356 | Ga0450906_000993 | 3300042145 | Bacteria | 6227 |
| 357 | Ga0450906_021069 | 3300042145 | Bacteria | 1165 |
| 358 | Ga0450907_000045 | 3300042146 | Bacteria | 53501 |
| 359 | Ga0450907_006455 | 3300042146 | Bacteria | 1960 |
| 360 | Ga0450907_015425 | 3300042146 | Bacteria | 1275 |
| 361 | Ga0450910_000052 | 3300042147 | Bacteria | 12114 |
| 362 | Ga0450910_000272 | 3300042147 | Bacteria | 5975 |
| 363 | Ga0450910_014098 | 3300042147 | Bacteria | 1168 |
| 364 | Ga0439446_0001026 | 3300042156 | Bacteria | 6133 |
| 365 | Ga0439446_0002040 | 3300042156 | Bacteria | 4785 |
| 366 | Ga0439446_0008180 | 3300042156 | Bacteria | 2770 |
| 367 | Ga0439446_0031134 | 3300042156 | Bacteria | 1544 |
| 368 | Ga0450908_005995 | 3300042184 | Bacteria | 2320 |
| 369 | Ga0450908_009473 | 3300042184 | Bacteria | 1808 |
| 370 | Ga0450909_003910 | 3300042185 | Bacteria | 2120 |
| 371 | Ga0450909_010971 | 3300042185 | Bacteria | 1326 |
| 372 | Ga0439434_0000380 | 3300042435 | Bacteria | 12639 |
| 373 | Ga0439434_0004012 | 3300042435 | Bacteria | 4295 |
| 374 | Ga0439434_0034768 | 3300042435 | Bacteria | 1539 |
| 375 | Ga0439464_0000127 | 3300042439 | Bacteria | 12100 |
| 376 | Ga0439460_0000179 | 3300042461 | Bacteria | 12047 |
| 377 | Ga0439460_0000347 | 3300042461 | Bacteria | 9726 |
| 378 | Ga0450918_002342 | 3300042531 | Bacteria | 3586 |
| 379 | Ga0450918_008337 | 3300042531 | Bacteria | 1819 |
| 380 | Ga0450893_0000048 | 3300042532 | Bacteria | 12347 |
| 381 | Ga0450901_000343 | 3300042533 | Bacteria | 5675 |
| 382 | Ga0439440_0000288 | 3300042993 | Bacteria | 8204 |
| 383 | Ga0439440_0000405 | 3300042993 | Bacteria | 7228 |
| 384 | Ga0439440_0001163 | 3300042993 | Bacteria | 4719 |
| 385 | Ga0439440_0055528 | 3300042993 | Bacteria | 999 |
| 386 | Ga0495617_001033 | 3300046452 | Bacteria | 12805 |
| 387 | Ga0495617_008359 | 3300046452 | Bacteria | 3570 |
| 388 | Ga0495617_009834 | 3300046452 | Bacteria | 3280 |
| 389 | Ga0495617_011381 | 3300046452 | Bacteria | 3035 |
| 390 | Ga0495617_028067 | 3300046452 | Bacteria | 1893 |
| 391 | Ga0495617_037290 | 3300046452 | Bacteria | 1628 |
| 392 | Ga0495617_041368 | 3300046452 | Bacteria | 1540 |
| 393 | Ga0495617_110235 | 3300046452 | Bacteria | 890 |
| 394 | Ga0495627_001577 | 3300046453 | Bacteria | 12909 |
| 395 | Ga0495627_001594 | 3300046453 | Bacteria | 12724 |
| 396 | Ga0495627_001837 | 3300046453 | Bacteria | 11288 |
| 397 | Ga0495627_007279 | 3300046453 | Bacteria | 4260 |
| 398 | Ga0495627_007540 | 3300046453 | Bacteria | 4160 |
| 399 | Ga0495627_021775 | 3300046453 | Bacteria | 2119 |
| 400 | Ga0495627_111760 | 3300046453 | Bacteria | 775 |
| 401 | Ga0495603_0097609 | 3300046455 | Bacteria | 1716 |
| 402 | Ga0495603_0108196 | 3300046455 | Bacteria | 1622 |
| 403 | Ga0495603_0127989 | 3300046455 | Bacteria | 1479 |
| 404 | Ga0495590_0000783 | 3300046457 | Bacteria | 14449 |
| 405 | Ga0495590_0000855 | 3300046457 | Bacteria | 13719 |
| 406 | Ga0495590_0001718 | 3300046457 | Bacteria | 9316 |
| 407 | Ga0495590_0042285 | 3300046457 | Bacteria | 1588 |
| 408 | Ga0495590_0046556 | 3300046457 | Bacteria | 1513 |
| 409 | Ga0495590_0066234 | 3300046457 | Bacteria | 1264 |
| 410 | Ga0495591_001700 | 3300046458 | Bacteria | 13135 |
| 411 | Ga0495591_001703 | 3300046458 | Bacteria | 13128 |
| 412 | Ga0495591_001760 | 3300046458 | Bacteria | 12874 |
| 413 | Ga0495591_001855 | 3300046458 | Bacteria | 12441 |
| 414 | Ga0495591_001859 | 3300046458 | Bacteria | 12428 |
| 415 | Ga0495591_005522 | 3300046458 | Bacteria | 5827 |
| 416 | Ga0495591_006346 | 3300046458 | Bacteria | 5247 |
| 417 | Ga0495591_007557 | 3300046458 | Bacteria | 4600 |
| 418 | Ga0495591_014930 | 3300046458 | Bacteria | 2765 |
| 419 | Ga0495638_0002812 | 3300046460 | Bacteria | 13931 |
| 420 | Ga0495638_0003070 | 3300046460 | Bacteria | 13269 |
| 421 | Ga0495638_0003856 | 3300046460 | Bacteria | 11638 |
| 422 | Ga0495638_0006197 | 3300046460 | Bacteria | 8736 |
| 423 | Ga0495638_0009585 | 3300046460 | Bacteria | 6778 |
| 424 | Ga0495638_0030940 | 3300046460 | Bacteria | 3441 |
| 425 | Ga0495638_0033591 | 3300046460 | Bacteria | 3280 |
| 426 | Ga0495638_0084524 | 3300046460 | Bacteria | 1920 |
| 427 | Ga0495638_0133430 | 3300046460 | Bacteria | 1456 |
| 428 | Ga0495638_0151278 | 3300046460 | Bacteria | 1346 |
| 429 | Ga0495653_0000899 | 3300046463 | Bacteria | 23030 |
| 430 | Ga0495653_0024904 | 3300046463 | Bacteria | 4816 |
| 431 | Ga0495653_0103518 | 3300046463 | Bacteria | 2058 |
| 432 | Ga0495650_0002513 | 3300046471 | Bacteria | 14685 |
| 433 | Ga0495650_0002934 | 3300046471 | Bacteria | 12934 |
| 434 | Ga0495650_0003243 | 3300046471 | Bacteria | 12068 |
| 435 | Ga0495650_0007254 | 3300046471 | Bacteria | 6713 |
| 436 | Ga0495650_0011478 | 3300046471 | Bacteria | 4848 |
| 437 | Ga0495650_0019607 | 3300046471 | Bacteria | 3320 |
| 438 | Ga0495580_0136934 | 3300046472 | Bacteria | 1698 |
| 439 | Ga0495580_0294324 | 3300046472 | Bacteria | 1106 |
| 440 | Ga0495605_0002099 | 3300046474 | Bacteria | 12507 |
| 441 | Ga0495605_0002641 | 3300046474 | Bacteria | 10980 |
| 442 | Ga0495605_0003390 | 3300046474 | Bacteria | 9504 |
| 443 | Ga0495605_0005362 | 3300046474 | Bacteria | 7475 |
| 444 | Ga0495605_0006075 | 3300046474 | Bacteria | 6977 |
| 445 | Ga0495605_0014059 | 3300046474 | Bacteria | 4390 |
| 446 | Ga0495605_0136993 | 3300046474 | Bacteria | 1100 |
| 447 | Ga0495605_0172006 | 3300046474 | Bacteria | 956 |
| 448 | Ga0495639_0000152 | 3300046475 | Bacteria | 35525 |
| 449 | Ga0495584_0000468 | 3300046491 | Bacteria | 27807 |
| 450 | Ga0495584_0001549 | 3300046491 | Bacteria | 13655 |
| 451 | Ga0495584_0001688 | 3300046491 | Bacteria | 12946 |
| 452 | Ga0495584_0001709 | 3300046491 | Bacteria | 12878 |
| 453 | Ga0495584_0001838 | 3300046491 | Bacteria | 12317 |
| 454 | Ga0495584_0018951 | 3300046491 | Bacteria | 3496 |
| 455 | Ga0495584_0028157 | 3300046491 | Bacteria | 2846 |
| 456 | Ga0495584_0042422 | 3300046491 | Bacteria | 2296 |
| 457 | Ga0495584_0072816 | 3300046491 | Bacteria | 1726 |
| 458 | Ga0495584_0076065 | 3300046491 | Bacteria | 1688 |
| 459 | Ga0495585_0000236 | 3300046492 | Bacteria | 57277 |
| 460 | Ga0495585_0002024 | 3300046492 | Bacteria | 15006 |
| 461 | Ga0495585_0002613 | 3300046492 | Bacteria | 12702 |
| 462 | Ga0495585_0002640 | 3300046492 | Bacteria | 12627 |
| 463 | Ga0495585_0002748 | 3300046492 | Bacteria | 12274 |
| 464 | Ga0495585_0008744 | 3300046492 | Bacteria | 6122 |
| 465 | Ga0495585_0011475 | 3300046492 | Bacteria | 5241 |
| 466 | Ga0495585_0011760 | 3300046492 | Bacteria | 5171 |
| 467 | Ga0495585_0026890 | 3300046492 | Bacteria | 3285 |
| 468 | Ga0495585_0065759 | 3300046492 | Bacteria | 1986 |
| 469 | Ga0495585_0145210 | 3300046492 | Bacteria | 1240 |
| 470 | Ga0495594_0001402 | 3300046499 | Bacteria | 12506 |
| 471 | Ga0495594_0005592 | 3300046499 | Bacteria | 6458 |
| 472 | Ga0495594_0005762 | 3300046499 | Bacteria | 6362 |
| 473 | Ga0495596_0001547 | 3300046500 | Bacteria | 13123 |
| 474 | Ga0495596_0070385 | 3300046500 | Bacteria | 1359 |
| 475 | Ga0495607_0001160 | 3300046501 | Bacteria | 23881 |
| 476 | Ga0495607_0001357 | 3300046501 | Bacteria | 21823 |
| 477 | Ga0495607_0003365 | 3300046501 | Bacteria | 12259 |
| 478 | Ga0495607_0003368 | 3300046501 | Bacteria | 12253 |
| 479 | Ga0495607_0004540 | 3300046501 | Bacteria | 10190 |
| 480 | Ga0495607_0005703 | 3300046501 | Bacteria | 8869 |
| 481 | Ga0495607_0007076 | 3300046501 | Bacteria | 7802 |
| 482 | Ga0495607_0016038 | 3300046501 | Bacteria | 4841 |
| 483 | Ga0495607_0023133 | 3300046501 | Bacteria | 3892 |
| 484 | Ga0495607_0042908 | 3300046501 | Bacteria | 2678 |
| 485 | Ga0495607_0065225 | 3300046501 | Bacteria | 2054 |
| 486 | Ga0495583_0001658 | 3300046506 | Bacteria | 21608 |
| 487 | Ga0495583_0002733 | 3300046506 | Bacteria | 14613 |
| 488 | Ga0495583_0015629 | 3300046506 | Bacteria | 4118 |
| 489 | Ga0495583_0061397 | 3300046506 | Bacteria | 1677 |
| 490 | Ga0495583_0182518 | 3300046506 | Bacteria | 858 |
| 491 | Ga0495606_0003435 | 3300046507 | Bacteria | 16811 |
| 492 | Ga0495606_0005268 | 3300046507 | Bacteria | 12468 |
| 493 | Ga0495606_0005972 | 3300046507 | Bacteria | 11421 |
| 494 | Ga0495606_0005985 | 3300046507 | Bacteria | 11400 |
| 495 | Ga0495606_0006686 | 3300046507 | Bacteria | 10566 |
| 496 | Ga0495606_0047898 | 3300046507 | Bacteria | 2815 |
| 497 | Ga0495606_0180225 | 3300046507 | Bacteria | 1218 |
| 498 | Ga0495606_0244293 | 3300046507 | Bacteria | 999 |
| 499 | Ga0495606_0397612 | 3300046507 | Bacteria | 718 |
| 500 | Ga0495610_0003231 | 3300046512 | Bacteria | 12886 |
| 501 | Ga0495610_0003484 | 3300046512 | Bacteria | 12243 |
| 502 | Ga0495610_0003619 | 3300046512 | Bacteria | 11921 |
| 503 | Ga0495610_0016075 | 3300046512 | Bacteria | 4326 |
| 504 | Ga0495610_0023398 | 3300046512 | Bacteria | 3360 |
| 505 | Ga0495610_0089400 | 3300046512 | Bacteria | 1398 |
| 506 | Ga0495610_0118356 | 3300046512 | Bacteria | 1164 |
| 507 | Ga0495610_0234975 | 3300046512 | Bacteria | 733 |
| 508 | Ga0495616_0000931 | 3300046513 | Bacteria | 21075 |
| 509 | Ga0495616_0001498 | 3300046513 | Bacteria | 16141 |
| 510 | Ga0495616_0001947 | 3300046513 | Bacteria | 13896 |
| 511 | Ga0495616_0002240 | 3300046513 | Bacteria | 12933 |
| 512 | Ga0495616_0002422 | 3300046513 | Bacteria | 12415 |
| 513 | Ga0495616_0007298 | 3300046513 | Bacteria | 6616 |
| 514 | Ga0495616_0046494 | 3300046513 | Bacteria | 2190 |
| 515 | Ga0495616_0098116 | 3300046513 | Bacteria | 1377 |
| 516 | Ga0495620_0001353 | 3300046515 | Bacteria | 14839 |
| 517 | Ga0495620_0003243 | 3300046515 | Bacteria | 9329 |
| 518 | Ga0495620_0004042 | 3300046515 | Bacteria | 8326 |
| 519 | Ga0495620_0007547 | 3300046515 | Bacteria | 5898 |
| 520 | Ga0495620_0009108 | 3300046515 | Bacteria | 5297 |
| 521 | Ga0495620_0019684 | 3300046515 | Bacteria | 3313 |
| 522 | Ga0495620_0068671 | 3300046515 | Bacteria | 1455 |
| 523 | Ga0495631_0000597 | 3300046518 | Bacteria | 23847 |
| 524 | Ga0495631_0001741 | 3300046518 | Bacteria | 12926 |
| 525 | Ga0495631_0001855 | 3300046518 | Bacteria | 12483 |
| 526 | Ga0495631_0011377 | 3300046518 | Bacteria | 4377 |
| 527 | Ga0495631_0014892 | 3300046518 | Bacteria | 3742 |
| 528 | Ga0495631_0016414 | 3300046518 | Bacteria | 3529 |
| 529 | Ga0495631_0021886 | 3300046518 | Bacteria | 2975 |
| 530 | Ga0495631_0293977 | 3300046518 | Bacteria | 691 |
| 531 | Ga0495632_0001382 | 3300046519 | Bacteria | 20342 |
| 532 | Ga0495632_0002567 | 3300046519 | Bacteria | 13744 |
| 533 | Ga0495632_0002803 | 3300046519 | Bacteria | 12907 |
| 534 | Ga0495632_0002906 | 3300046519 | Bacteria | 12589 |
| 535 | Ga0495632_0005239 | 3300046519 | Bacteria | 8628 |
| 536 | Ga0495632_0005809 | 3300046519 | Bacteria | 8083 |
| 537 | Ga0495632_0007448 | 3300046519 | Bacteria | 6874 |
| 538 | Ga0495632_0073773 | 3300046519 | Bacteria | 1635 |
| 539 | Ga0495637_0001655 | 3300046520 | Bacteria | 12878 |
| 540 | Ga0495637_0001705 | 3300046520 | Bacteria | 12694 |
| 541 | Ga0495637_0001726 | 3300046520 | Bacteria | 12542 |
| 542 | Ga0495637_0001858 | 3300046520 | Bacteria | 12069 |
| 543 | Ga0495637_0002370 | 3300046520 | Bacteria | 10439 |
| 544 | Ga0495637_0002637 | 3300046520 | Bacteria | 9812 |
| 545 | Ga0495637_0002984 | 3300046520 | Bacteria | 9097 |
| 546 | Ga0495637_0010266 | 3300046520 | Bacteria | 4535 |
| 547 | Ga0495637_0018032 | 3300046520 | Bacteria | 3278 |
| 548 | Ga0495637_0052205 | 3300046520 | Bacteria | 1707 |
| 549 | Ga0495637_0074995 | 3300046520 | Bacteria | 1357 |
| 550 | Ga0495643_0003789 | 3300046522 | Bacteria | 10934 |
| 551 | Ga0495643_0003918 | 3300046522 | Bacteria | 10664 |
| 552 | Ga0495643_0011567 | 3300046522 | Bacteria | 5366 |
| 553 | Ga0495643_0023577 | 3300046522 | Bacteria | 3498 |
| 554 | Ga0495643_0069451 | 3300046522 | Bacteria | 1851 |
| 555 | Ga0495643_0135622 | 3300046522 | Bacteria | 1232 |
| 556 | Ga0495643_0144304 | 3300046522 | Bacteria | 1184 |
| 557 | Ga0495644_0007599 | 3300046523 | Bacteria | 4178 |
| 558 | Ga0495644_0019085 | 3300046523 | Bacteria | 2617 |
| 559 | Ga0495644_0025718 | 3300046523 | Bacteria | 2234 |
| 560 | Ga0495648_0003611 | 3300046524 | Bacteria | 13538 |
| 561 | Ga0495648_0003802 | 3300046524 | Bacteria | 13114 |
| 562 | Ga0495648_0003939 | 3300046524 | Bacteria | 12855 |
| 563 | Ga0495648_0004313 | 3300046524 | Bacteria | 12186 |
| 564 | Ga0495648_0004842 | 3300046524 | Bacteria | 11362 |
| 565 | Ga0495648_0014956 | 3300046524 | Bacteria | 5653 |
| 566 | Ga0495648_0027537 | 3300046524 | Bacteria | 3802 |
| 567 | Ga0495648_0029030 | 3300046524 | Bacteria | 3676 |
| 568 | Ga0495648_0033014 | 3300046524 | Bacteria | 3387 |
| 569 | Ga0495648_0033669 | 3300046524 | Bacteria | 3343 |
| 570 | Ga0495648_0042477 | 3300046524 | Bacteria | 2859 |
| 571 | Ga0495648_0109928 | 3300046524 | Bacteria | 1502 |
| 572 | Ga0495648_0214288 | 3300046524 | Bacteria | 954 |
| 573 | Ga0495666_0002169 | 3300046526 | Bacteria | 9766 |
| 574 | Ga0495666_0002936 | 3300046526 | Bacteria | 8544 |
| 575 | Ga0495666_0111182 | 3300046526 | Bacteria | 1286 |
| 576 | Ga0495642_0000129 | 3300046528 | Bacteria | 43448 |
| 577 | Ga0495642_0000451 | 3300046528 | Bacteria | 21645 |
| 578 | Ga0495642_0001117 | 3300046528 | Bacteria | 12374 |
| 579 | Ga0495654_0002068 | 3300046530 | Bacteria | 13173 |
| 580 | Ga0495654_0002329 | 3300046530 | Bacteria | 12274 |
| 581 | Ga0495654_0002570 | 3300046530 | Bacteria | 11605 |
| 582 | Ga0495654_0004652 | 3300046530 | Bacteria | 8098 |
| 583 | Ga0495654_0006093 | 3300046530 | Bacteria | 6915 |
| 584 | Ga0495654_0016124 | 3300046530 | Bacteria | 3956 |
| 585 | Ga0495654_0021787 | 3300046530 | Bacteria | 3332 |
| 586 | Ga0495654_0029803 | 3300046530 | Bacteria | 2781 |
| 587 | Ga0495654_0070275 | 3300046530 | Bacteria | 1660 |
| 588 | Ga0495654_0102770 | 3300046530 | Bacteria | 1313 |
| 589 | Ga0495654_0106405 | 3300046530 | Bacteria | 1284 |
| 590 | Ga0495654_0259165 | 3300046530 | Bacteria | 721 |
| 591 | Ga0495587_0029164 | 3300046536 | Bacteria | 3351 |
| 592 | Ga0495609_0001977 | 3300046538 | Bacteria | 12980 |
| 593 | Ga0495609_0001996 | 3300046538 | Bacteria | 12893 |
| 594 | Ga0495609_0002213 | 3300046538 | Bacteria | 12180 |
| 595 | Ga0495609_0002280 | 3300046538 | Bacteria | 11959 |
| 596 | Ga0495609_0002513 | 3300046538 | Bacteria | 11253 |
| 597 | Ga0495609_0003524 | 3300046538 | Bacteria | 8921 |
| 598 | Ga0495609_0007441 | 3300046538 | Bacteria | 5469 |
| 599 | Ga0495609_0007745 | 3300046538 | Bacteria | 5324 |
| 600 | Ga0495609_0013478 | 3300046538 | Bacteria | 3858 |
| 601 | Ga0495597_0000786 | 3300046542 | Bacteria | 25054 |
| 602 | Ga0495597_0002195 | 3300046542 | Bacteria | 12810 |
| 603 | Ga0495597_0003354 | 3300046542 | Bacteria | 9424 |
| 604 | Ga0495597_0008892 | 3300046542 | Bacteria | 5008 |
| 605 | Ga0495597_0031312 | 3300046542 | Bacteria | 2421 |
| 606 | Ga0495597_0104809 | 3300046542 | Bacteria | 1189 |
| 607 | Ga0495597_0132402 | 3300046542 | Bacteria | 1033 |
| 608 | Ga0495597_0216649 | 3300046542 | Bacteria | 761 |
| 609 | Ga0495645_0004315 | 3300046543 | Bacteria | 9717 |
| 610 | Ga0495622_0002101 | 3300046557 | Bacteria | 9738 |
| 611 | Ga0495622_0002297 | 3300046557 | Bacteria | 9298 |
| 612 | Ga0495622_0002956 | 3300046557 | Bacteria | 8096 |
| 613 | Ga0495622_0024203 | 3300046557 | Bacteria | 2835 |
| 614 | Ga0495633_0002525 | 3300046558 | Bacteria | 12864 |
| 615 | Ga0495633_0003542 | 3300046558 | Bacteria | 10339 |
| 616 | Ga0495633_0006568 | 3300046558 | Bacteria | 6873 |
| 617 | Ga0495633_0073833 | 3300046558 | Bacteria | 1590 |
| 618 | Ga0495656_0008102 | 3300046615 | Bacteria | 3740 |
| 619 | Ga0495656_0010701 | 3300046615 | Bacteria | 3342 |
| 620 | Ga0495668_0021999 | 3300046616 | Bacteria | 3648 |
| 621 | Ga0495634_0000185 | 3300046642 | Bacteria | 57480 |
| 622 | Ga0495634_0003382 | 3300046642 | Bacteria | 12805 |
| 623 | Ga0495611_0001243 | 3300046648 | Bacteria | 13113 |
| 624 | Ga0495611_0001320 | 3300046648 | Bacteria | 12601 |
| 625 | Ga0495611_0050624 | 3300046648 | Bacteria | 1871 |
| 626 | Ga0495611_0057041 | 3300046648 | Bacteria | 1769 |
| 627 | Ga0495611_0075410 | 3300046648 | Bacteria | 1545 |
| 628 | Ga0495611_0076777 | 3300046648 | Bacteria | 1531 |
| 629 | Ga0495611_0187677 | 3300046648 | Bacteria | 965 |
| 630 | Ga0495625_0003682 | 3300046660 | Bacteria | 14995 |
| 631 | Ga0495625_0004511 | 3300046660 | Bacteria | 13132 |
| 632 | Ga0495625_0005198 | 3300046660 | Bacteria | 11994 |
| 633 | Ga0495625_0005490 | 3300046660 | Bacteria | 11545 |
| 634 | Ga0495625_0022681 | 3300046660 | Bacteria | 4808 |
| 635 | Ga0495625_0042362 | 3300046660 | Bacteria | 3309 |
| 636 | Ga0495625_0049574 | 3300046660 | Bacteria | 3017 |
| 637 | Ga0495625_0064046 | 3300046660 | Bacteria | 2594 |
| 638 | Ga0495625_0101986 | 3300046660 | Bacteria | 1970 |
| 639 | Ga0495625_0171286 | 3300046660 | Bacteria | 1449 |
| 640 | Ga0495635_0001910 | 3300046663 | Bacteria | 14157 |
| 641 | Ga0495659_0000303 | 3300046664 | Bacteria | 19513 |
| 642 | Ga0495659_0003514 | 3300046664 | Bacteria | 4998 |
| 643 | Ga0495659_0004826 | 3300046664 | Bacteria | 4245 |
| 644 | Ga0495659_0022706 | 3300046664 | Bacteria | 2126 |
| 645 | Ga0495659_0045182 | 3300046664 | Bacteria | 1586 |
| 646 | Ga0495661_0005237 | 3300046665 | Bacteria | 9228 |
| 647 | Ga0495661_0006410 | 3300046665 | Bacteria | 8270 |
| 648 | Ga0495661_0021670 | 3300046665 | Bacteria | 4185 |
| 649 | Ga0495661_0088665 | 3300046665 | Bacteria | 1765 |
| 650 | Ga0495661_0121184 | 3300046665 | Bacteria | 1445 |
| 651 | Ga0495588_0029489 | 3300046674 | Bacteria | 2752 |
| 652 | Ga0495588_0036337 | 3300046674 | Bacteria | 2499 |
| 653 | Ga0495599_0118418 | 3300046678 | Bacteria | 1647 |
| 654 | Ga0495623_0001609 | 3300046679 | Bacteria | 15175 |
| 655 | Ga0495646_0017027 | 3300046680 | Bacteria | 4614 |
| 656 | Ga0495646_0032005 | 3300046680 | Bacteria | 3274 |
| 657 | Ga0495669_0018466 | 3300046684 | Bacteria | 2998 |
| 658 | Ga0495669_0158834 | 3300046684 | Bacteria | 1072 |
| 659 | Ga0495613_0007193 | 3300046689 | Bacteria | 8289 |
| 660 | Ga0495613_0291850 | 3300046689 | Bacteria | 1130 |
| 661 | Ga0495624_0002859 | 3300046690 | Bacteria | 12930 |
| 662 | Ga0495670_0001099 | 3300046691 | Bacteria | 13129 |
| 663 | Ga0495670_0001137 | 3300046691 | Bacteria | 12924 |
| 664 | Ga0495670_0001253 | 3300046691 | Bacteria | 12412 |
| 665 | Ga0495670_0011321 | 3300046691 | Bacteria | 4386 |
| 666 | Ga0495670_0023333 | 3300046691 | Bacteria | 3053 |
| 667 | Ga0495670_0032752 | 3300046691 | Bacteria | 2585 |
| 668 | Ga0495670_0271796 | 3300046691 | Bacteria | 905 |
| 669 | Ga0495671_0001442 | 3300046692 | Bacteria | 15954 |
| 670 | Ga0495671_0002093 | 3300046692 | Bacteria | 12787 |
| 671 | Ga0495671_0002148 | 3300046692 | Bacteria | 12585 |
| 672 | Ga0495671_0002252 | 3300046692 | Bacteria | 12266 |
| 673 | Ga0495671_0002985 | 3300046692 | Bacteria | 10511 |
| 674 | Ga0495671_0003677 | 3300046692 | Bacteria | 9337 |
| 675 | Ga0495671_0115133 | 3300046692 | Bacteria | 1312 |
| 676 | Ga0495671_0226476 | 3300046692 | Bacteria | 904 |
| 677 | Ga0495649_0000164 | 3300046694 | Bacteria | 57766 |
| 678 | Ga0495649_0002274 | 3300046694 | Bacteria | 13647 |
| 679 | Ga0495649_0002501 | 3300046694 | Bacteria | 12908 |
| 680 | Ga0495649_0008154 | 3300046694 | Bacteria | 6317 |
| 681 | Ga0495649_0008266 | 3300046694 | Bacteria | 6270 |
| 682 | Ga0495649_0027230 | 3300046694 | Bacteria | 3172 |
| 683 | Ga0495649_0050150 | 3300046694 | Bacteria | 2266 |
| 684 | Ga0495649_0074500 | 3300046694 | Bacteria | 1818 |
| 685 | Ga0495649_0086526 | 3300046694 | Bacteria | 1672 |
| 686 | Ga0495649_0088525 | 3300046694 | Bacteria | 1651 |
| 687 | Ga0495649_0088528 | 3300046694 | Bacteria | 1651 |
| 688 | Ga0495649_0218441 | 3300046694 | Bacteria | 986 |
| 689 | Ga0495589_0000388 | 3300046794 | Bacteria | 33652 |
| 690 | Ga0495589_0001589 | 3300046794 | Bacteria | 13032 |
| 691 | Ga0495589_0002221 | 3300046794 | Bacteria | 10917 |
| 692 | Ga0495589_0002244 | 3300046794 | Bacteria | 10860 |
| 693 | Ga0495589_0002403 | 3300046794 | Bacteria | 10519 |
| 694 | Ga0495589_0013539 | 3300046794 | Bacteria | 4206 |
| 695 | Ga0495589_0032964 | 3300046794 | Bacteria | 2602 |
| 696 | Ga0495600_0022154 | 3300046809 | Bacteria | 4077 |
| 697 | Ga0495660_0001783 | 3300046810 | Bacteria | 14225 |
| 698 | Ga0495660_0002108 | 3300046810 | Bacteria | 12874 |
| 699 | Ga0495660_0002180 | 3300046810 | Bacteria | 12604 |
| 700 | Ga0495660_0002294 | 3300046810 | Bacteria | 12280 |
| 701 | Ga0495660_0002326 | 3300046810 | Bacteria | 12184 |
| 702 | Ga0495660_0002371 | 3300046810 | Bacteria | 12049 |
| 703 | Ga0495660_0003470 | 3300046810 | Bacteria | 9745 |
| 704 | Ga0495660_0004585 | 3300046810 | Bacteria | 8340 |
| 705 | Ga0495660_0009714 | 3300046810 | Bacteria | 5606 |
| 706 | Ga0495660_0012261 | 3300046810 | Bacteria | 4973 |
| 707 | Ga0495660_0015137 | 3300046810 | Bacteria | 4459 |
| 708 | Ga0495660_0015738 | 3300046810 | Bacteria | 4367 |
| 709 | Ga0495660_0024261 | 3300046810 | Bacteria | 3455 |
| 710 | Ga0495660_0033494 | 3300046810 | Bacteria | 2880 |
| 711 | Ga0495660_0038403 | 3300046810 | Bacteria | 2662 |
| 712 | Ga0495660_0061248 | 3300046810 | Bacteria | 2019 |
| 713 | Ga0495660_0074623 | 3300046810 | Bacteria | 1791 |
| 714 | Ga0495581_0001624 | 3300047315 | Bacteria | 12529 |
| 715 | Ga0495604_0012242 | 3300047317 | Bacteria | 6818 |
| 716 | Ga0495604_0015937 | 3300047317 | Bacteria | 6000 |
| 717 | Ga0495636_0002752 | 3300047318 | Bacteria | 6780 |
| 718 | Ga0495636_0063579 | 3300047318 | Bacteria | 1564 |
| 719 | Ga0495636_0194538 | 3300047318 | Bacteria | 924 |
| 720 | Ga0495674_0010090 | 3300047319 | Bacteria | 8949 |
| 721 | Ga0495672_0002092 | 3300047320 | Bacteria | 18711 |
| 722 | Ga0495672_0003691 | 3300047320 | Bacteria | 12930 |
| 723 | Ga0495672_0003740 | 3300047320 | Bacteria | 12842 |
| 724 | Ga0495672_0004120 | 3300047320 | Bacteria | 12103 |
| 725 | Ga0495672_0006514 | 3300047320 | Bacteria | 9018 |
| 726 | Ga0495672_0007461 | 3300047320 | Bacteria | 8224 |
| 727 | Ga0495672_0025057 | 3300047320 | Bacteria | 3827 |
| 728 | Ga0495672_0027369 | 3300047320 | Bacteria | 3624 |
| 729 | Ga0495672_0037126 | 3300047320 | Bacteria | 2984 |
| 730 | Ga0495676_0004392 | 3300047321 | Bacteria | 12887 |
| 731 | Ga0495676_0004452 | 3300047321 | Bacteria | 12815 |
| 732 | Ga0495680_0012927 | 3300047322 | Bacteria | 7315 |
| 733 | Ga0495680_0020278 | 3300047322 | Bacteria | 5596 |
| 734 | Ga0495680_0026675 | 3300047322 | Bacteria | 4758 |
| 735 | Ga0495683_0000730 | 3300047323 | Bacteria | 23860 |
| 736 | Ga0495683_0001672 | 3300047323 | Bacteria | 14116 |
| 737 | Ga0495683_0002276 | 3300047323 | Bacteria | 11717 |
| 738 | Ga0495683_0002987 | 3300047323 | Bacteria | 9979 |
| 739 | Ga0495683_0008455 | 3300047323 | Bacteria | 5504 |
| 740 | Ga0495683_0009474 | 3300047323 | Bacteria | 5186 |
| 741 | Ga0495683_0015110 | 3300047323 | Bacteria | 4020 |
| 742 | Ga0495683_0108192 | 3300047323 | Bacteria | 1329 |
| 743 | Ga0495683_0122419 | 3300047323 | Bacteria | 1233 |
| 744 | Ga0495687_005151 | 3300047443 | Bacteria | 8458 |
| 745 | Ga0495687_005862 | 3300047443 | Bacteria | 7691 |
| 746 | Ga0495687_011281 | 3300047443 | Bacteria | 4816 |
| 747 | Ga0495687_046477 | 3300047443 | Bacteria | 1874 |
| 748 | Ga0495675_0084194 | 3300047444 | Bacteria | 2001 |
| 749 | Ga0495677_0000637 | 3300047445 | Bacteria | 14132 |
| 750 | Ga0495677_0041190 | 3300047445 | Bacteria | 1689 |
| 751 | Ga0495679_001495 | 3300047446 | Bacteria | 13203 |
| 752 | Ga0495679_001573 | 3300047446 | Bacteria | 12866 |
| 753 | Ga0495679_002128 | 3300047446 | Bacteria | 10417 |
| 754 | Ga0495679_004622 | 3300047446 | Bacteria | 6276 |
| 755 | Ga0495685_003422 | 3300047447 | Bacteria | 5066 |
| 756 | Ga0495673_0001034 | 3300047469 | Bacteria | 24508 |
| 757 | Ga0495673_0002425 | 3300047469 | Bacteria | 13130 |
| 758 | Ga0495673_0006993 | 3300047469 | Bacteria | 6555 |
| 759 | Ga0495673_0007956 | 3300047469 | Bacteria | 6017 |
| 760 | Ga0495673_0011490 | 3300047469 | Bacteria | 4758 |
| 761 | Ga0495673_0029492 | 3300047469 | Bacteria | 2588 |
| 762 | Ga0495673_0035386 | 3300047469 | Bacteria | 2301 |
| 763 | Ga0495673_0039796 | 3300047469 | Bacteria | 2130 |
| 764 | Ga0495673_0070352 | 3300047469 | Bacteria | 1473 |
| 765 | Ga0495681_0000806 | 3300047470 | Bacteria | 24171 |
| 766 | Ga0495681_0002142 | 3300047470 | Bacteria | 14310 |
| 767 | Ga0495681_0002256 | 3300047470 | Bacteria | 13856 |
| 768 | Ga0495681_0002454 | 3300047470 | Bacteria | 13238 |
| 769 | Ga0495681_0003233 | 3300047470 | Bacteria | 11359 |
| 770 | Ga0495681_0006531 | 3300047470 | Bacteria | 7641 |
| 771 | Ga0495681_0006833 | 3300047470 | Bacteria | 7414 |
| 772 | Ga0495681_0008447 | 3300047470 | Bacteria | 6460 |
| 773 | Ga0495681_0009980 | 3300047470 | Bacteria | 5785 |
| 774 | Ga0495681_0021924 | 3300047470 | Bacteria | 3430 |
| 775 | Ga0495681_0232709 | 3300047470 | Bacteria | 734 |
| 776 | Ga0495686_0002408 | 3300047472 | Bacteria | 17743 |
| 777 | Ga0495686_0003772 | 3300047472 | Bacteria | 12877 |
| 778 | Ga0495686_0003919 | 3300047472 | Bacteria | 12539 |
| 779 | Ga0495686_0104074 | 3300047472 | Bacteria | 1709 |
| 780 | Ga0495686_0245932 | 3300047472 | Bacteria | 1007 |
| 781 | Ga0495593_0019133 | 3300047673 | Bacteria | 3843 |
| 782 | Ga0495593_0021101 | 3300047673 | Bacteria | 3641 |
| 783 | Ga0495602_0005869 | 3300048088 | Bacteria | 12889 |
| 784 | Ga0495602_0077931 | 3300048088 | Bacteria | 2801 |
| 785 | Ga0495626_0002272 | 3300048091 | Bacteria | 13681 |
| 786 | Ga0495626_0002380 | 3300048091 | Bacteria | 13133 |
| 787 | Ga0495626_0002569 | 3300048091 | Bacteria | 12436 |
| 788 | Ga0495626_0002714 | 3300048091 | Bacteria | 11951 |
| 789 | Ga0495626_0002991 | 3300048091 | Bacteria | 11197 |
| 790 | Ga0495626_0006133 | 3300048091 | Bacteria | 6889 |
| 791 | Ga0495626_0008711 | 3300048091 | Bacteria | 5527 |
| 792 | Ga0495626_0148753 | 3300048091 | Bacteria | 989 |
| 793 | Ga0496101_0499093 | 3300048904 | Bacteria | 961 |
| 794 | Ga0496102_0000604 | 3300048905 | Bacteria | 37459 |
| 795 | Ga0496103_0002176 | 3300048906 | Bacteria | 12448 |
| 796 | Ga0496103_0333104 | 3300048906 | Bacteria | 976 |
| 797 | Ga0496106_0007313 | 3300048909 | Bacteria | 8162 |
| 798 | Ga0496106_0522325 | 3300048909 | Bacteria | 953 |
| 799 | Ga0496107_0046072 | 3300048910 | Bacteria | 3138 |
| 800 | Ga0496111_0092207 | 3300048914 | Bacteria | 2220 |
| 801 | Ga0496112_0086937 | 3300048915 | Bacteria | 3093 |
| 802 | Ga0496113_0725254 | 3300048916 | Bacteria | 792 |
| 803 | Ga0496114_0440471 | 3300048917 | Bacteria | 1154 |
| 804 | Ga0496115_0409177 | 3300048918 | Bacteria | 1100 |
| 805 | Ga0496116_0000286 | 3300048919 | Bacteria | 86171 |
| 806 | Ga0496116_0000730 | 3300048919 | Bacteria | 41965 |
| 807 | Ga0496116_0004436 | 3300048919 | Bacteria | 13396 |
| 808 | Ga0496116_0004518 | 3300048919 | Bacteria | 13241 |
| 809 | Ga0496116_0004704 | 3300048919 | Bacteria | 12896 |
| 810 | Ga0496117_0000773 | 3300048920 | Bacteria | 50373 |
| 811 | Ga0496117_0006000 | 3300048920 | Bacteria | 12508 |
| 812 | Ga0496117_0019564 | 3300048920 | Bacteria | 5555 |
| 813 | Ga0496117_0043804 | 3300048920 | Bacteria | 3249 |
| 814 | Ga0496117_0055149 | 3300048920 | Bacteria | 2779 |
| 815 | Ga0496117_0058433 | 3300048920 | Bacteria | 2671 |
| 816 | Ga0496117_0193059 | 3300048920 | Bacteria | 1157 |
| 817 | Ga0496118_0003842 | 3300048921 | Bacteria | 18470 |
| 818 | Ga0496118_0006159 | 3300048921 | Bacteria | 13304 |
| 819 | Ga0496118_0007853 | 3300048921 | Bacteria | 11188 |
| 820 | Ga0496118_0021304 | 3300048921 | Bacteria | 5711 |
| 821 | Ga0496118_0123185 | 3300048921 | Bacteria | 1684 |
| 822 | Ga0496118_0124459 | 3300048921 | Bacteria | 1672 |
| 823 | Ga0496118_0196821 | 3300048921 | Bacteria | 1198 |
| 824 | Ga0496119_0206963 | 3300048922 | Bacteria | 1012 |
| 825 | Ga0496120_0012545 | 3300048923 | Bacteria | 5763 |
| 826 | Ga0496120_0326430 | 3300048923 | Bacteria | 695 |
| 827 | Ga0496121_0000404 | 3300048924 | Bacteria | 86102 |
| 828 | Ga0496121_0007241 | 3300048924 | Bacteria | 13433 |
| 829 | Ga0496121_0014324 | 3300048924 | Bacteria | 8428 |
| 830 | Ga0496121_0071379 | 3300048924 | Bacteria | 2793 |
| 831 | Ga0496121_0099767 | 3300048924 | Bacteria | 2243 |
| 832 | Ga0496121_0122479 | 3300048924 | Bacteria | 1961 |
| 833 | Ga0496121_0237758 | 3300048924 | Bacteria | 1271 |
| 834 | Ga0496122_0005979 | 3300048925 | Bacteria | 14236 |
| 835 | Ga0496122_0006393 | 3300048925 | Bacteria | 13542 |
| 836 | Ga0496122_0010516 | 3300048925 | Bacteria | 9515 |
| 837 | Ga0496122_0273899 | 3300048925 | Bacteria | 927 |
| 838 | Ga0496123_0000908 | 3300048926 | Bacteria | 46619 |
| 839 | Ga0496123_0005686 | 3300048926 | Bacteria | 12437 |
| 840 | Ga0496123_0027389 | 3300048926 | Bacteria | 4246 |
| 841 | Ga0496123_0050483 | 3300048926 | Bacteria | 2778 |
| 842 | Ga0496123_0193566 | 3300048926 | Bacteria | 1049 |
| 843 | Ga0496124_0020696 | 3300048927 | Bacteria | 6071 |
| 844 | Ga0496124_0033789 | 3300048927 | Bacteria | 4495 |
| 845 | Ga0496124_0041243 | 3300048927 | Bacteria | 3985 |
| 846 | Ga0496124_0045904 | 3300048927 | Bacteria | 3744 |
| 847 | Ga0496124_0048201 | 3300048927 | Bacteria | 3642 |
| 848 | Ga0496124_0062162 | 3300048927 | Bacteria | 3126 |
| 849 | Ga0496124_0287774 | 3300048927 | Bacteria | 1194 |
| 850 | Ga0496125_0014923 | 3300048928 | Bacteria | 7544 |
| 851 | Ga0496125_0026030 | 3300048928 | Bacteria | 5342 |
| 852 | Ga0496125_0033046 | 3300048928 | Bacteria | 4585 |
| 853 | Ga0496125_0034532 | 3300048928 | Bacteria | 4456 |
| 854 | Ga0496125_0043408 | 3300048928 | Bacteria | 3816 |
| 855 | Ga0496126_0273102 | 3300048929 | Bacteria | 1402 |
| 856 | Ga0496126_0670010 | 3300048929 | Bacteria | 809 |
| 857 | Ga0495678_002293 | 3300049459 | Bacteria | 13248 |
| 858 | Ga0495678_002324 | 3300049459 | Bacteria | 13092 |
| 859 | Ga0495678_002486 | 3300049459 | Bacteria | 12423 |
| 860 | Ga0495678_002506 | 3300049459 | Bacteria | 12365 |
| 861 | Ga0495678_002601 | 3300049459 | Bacteria | 12054 |
| 862 | Ga0495678_002835 | 3300049459 | Bacteria | 11226 |
| 863 | Ga0495678_004648 | 3300049459 | Bacteria | 7874 |
| 864 | Ga0495678_027181 | 3300049459 | Bacteria | 2430 |
| 865 | Ga0495678_037460 | 3300049459 | Bacteria | 1970 |
| 866 | Ga0495678_039972 | 3300049459 | Bacteria | 1888 |
| 867 | Ga0495678_096941 | 3300049459 | Bacteria | 1028 |
| 868 | Ga0495678_110234 | 3300049459 | Bacteria | 939 |
| 869 | Ga0495682_0001251 | 3300049460 | Bacteria | 14346 |
| 870 | Ga0495682_0002016 | 3300049460 | Bacteria | 10020 |
| 871 | Ga0495682_0003654 | 3300049460 | Bacteria | 6781 |
| 872 | Ga0495682_0005470 | 3300049460 | Bacteria | 5271 |
| 873 | Ga0495682_0011752 | 3300049460 | Bacteria | 3364 |
| 874 | Ga0495682_0106812 | 3300049460 | Bacteria | 1003 |
| 875 | Ga0501222_000201 | 3300049662 | Bacteria | 10660 |
| 876 | Ga0501252_000802 | 3300049682 | Bacteria | 2638 |
| 877 | Ga0501241_000086 | 3300049758 | Bacteria | 20208 |
| 878 | Ga0501269_001630 | 3300049766 | Bacteria | 2885 |
| 879 | Ga0501269_004107 | 3300049766 | Bacteria | 1751 |
| 880 | nmdc:mga03683_7439_c1 | 3300050489 | Bacteria | 3802 |
| 881 | nmdc:mga00v17_113143_c1 | 3300050491 | Bacteria | 1723 |
| 882 | nmdc:mga00v17_69459_c1 | 3300050491 | Bacteria | 2180 |
| 883 | nmdc:mga08x19_280063_c1 | 3300050514 | Bacteria | 1155 |
| 884 | nmdc:mga08x19_317394_c1 | 3300050514 | Bacteria | 1084 |
| 885 | Ga0500572_000540 | 3300053111 | Bacteria | 12837 |
| 886 | Ga0500621_004535 | 3300053126 | Bacteria | 4147 |
| 887 | Ga0500586_007980 | 3300053145 | Bacteria | 2859 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048927 | Ga0496124_0048201 | Ga0496124_0048201_2255_2854 | 183 |
| 2 | iso_pu_bacteria | 2713897148 | 2715751111 | 185 |
| 3 | iso_pu_bacteria | 2842832357 | 2842837847 | 185 |
| 4 | iso_pu_bacteria | 2842843487 | 2842847852 | 185 |
| 5 | iso_pu_bacteria | 2919385768 | 2919391019 | 185 |
| 6 | iso_pu_bacteria | 2919487758 | 2919492065 | 185 |
| 7 | iso_pu_bacteria | 2974289157 | 2974293074 | 185 |
| 8 | iso_pu_bacteria | 2998139840 | 2998140742 | 185 |
| 9 | iso_pu_bacteria | 3007855910 | 3007857653 | 185 |
| 10 | iso_pu_bacteria | 8029995093 | 8030000000 | 185 |
| 11 | iso_pu_bacteria | 8056166840 | 8056170306 | 185 |
| 12 | iso_pu_bacteria | 3007419365 | 3007420265 | 186 |
| 13 | iso_pu_bacteria | 8054285046 | 8054289640 | 186 |
| 14 | iso_pu_bacteria | 8056143049 | 8056144032 | 186 |
| 15 | iso_pu_bacteria | 2511231004 | 2511255340 | 187 |
| 16 | iso_pu_bacteria | 2511231006 | 2511263740 | 187 |
| 17 | iso_pu_bacteria | 2511231007 | 2511269301 | 187 |
| 18 | iso_pu_bacteria | 2511231010 | 2511289596 | 187 |
| 19 | iso_pu_bacteria | 2511231011 | 2511294183 | 187 |
| 20 | iso_pu_bacteria | 2511231012 | 2511300922 | 187 |
| 21 | iso_pu_bacteria | 2511231015 | 2511318125 | 187 |
| 22 | iso_pu_bacteria | 2511231016 | 2511323895 | 187 |
| 23 | iso_pu_bacteria | 2511231018 | 2511335790 | 187 |
| 24 | iso_pu_bacteria | 2511231019 | 2511344879 | 187 |
| 25 | iso_pu_bacteria | 2511231020 | 2511348933 | 187 |
| 26 | iso_pu_bacteria | 2511231022 | 2511360604 | 187 |
| 27 | iso_pu_bacteria | 2511231023 | 2511370021 | 187 |
| 28 | iso_pu_bacteria | 2511231031 | 2511412352 | 187 |
| 29 | iso_pu_bacteria | 2512047018 | 2512329094 | 187 |
| 30 | iso_pu_bacteria | 2582580891 | 2583790164 | 187 |
| 31 | iso_pu_bacteria | 2597489887 | 2597855926 | 187 |
| 32 | iso_pu_bacteria | 2599185167 | 2599399677 | 187 |
| 33 | iso_pu_bacteria | 2599185179 | 2599454376 | 187 |
| 34 | iso_pu_bacteria | 2599185185 | 2599487707 | 187 |
| 35 | iso_pu_bacteria | 2599185188 | 2599505140 | 187 |
| 36 | iso_pu_bacteria | 2599185190 | 2599515784 | 187 |
| 37 | iso_pu_bacteria | 2599185191 | 2599522183 | 187 |
| 38 | iso_pu_bacteria | 2599185212 | 2599613639 | 187 |
| 39 | iso_pu_bacteria | 2599185248 | 2599772148 | 187 |
| 40 | iso_pu_bacteria | 2599185257 | 2599805718 | 187 |
| 41 | iso_pu_bacteria | 2599185289 | 2599888169 | 187 |
| 42 | iso_pu_bacteria | 2599185290 | 2599895162 | 187 |
| 43 | iso_pu_bacteria | 2599185291 | 2599900186 | 187 |
| 44 | iso_pu_bacteria | 2599185300 | 2599934450 | 187 |
| 45 | iso_pu_bacteria | 2599185302 | 2599945974 | 187 |
| 46 | iso_pu_bacteria | 2599185304 | 2599957042 | 187 |
| 47 | iso_pu_bacteria | 2599185305 | 2599962370 | 187 |
| 48 | iso_pu_bacteria | 2599185306 | 2599965001 | 187 |
| 49 | iso_pu_bacteria | 2599185308 | 2599976275 | 187 |
| 50 | iso_pu_bacteria | 2599185309 | 2599986448 | 187 |
| 51 | iso_pu_bacteria | 2599185310 | 2599987585 | 187 |
| 52 | iso_pu_bacteria | 2599185311 | 2599997147 | 187 |
| 53 | iso_pu_bacteria | 2599185312 | 2600003031 | 187 |
| 54 | iso_pu_bacteria | 2599185313 | 2600006750 | 187 |
| 55 | iso_pu_bacteria | 2599185314 | 2600010411 | 187 |
| 56 | iso_pu_bacteria | 2599185315 | 2600018571 | 187 |
| 57 | iso_pu_bacteria | 2599185316 | 2600023868 | 187 |
| 58 | iso_pu_bacteria | 2599185317 | 2600031925 | 187 |
| 59 | iso_pu_bacteria | 2599185318 | 2600037227 | 187 |
| 60 | iso_pu_bacteria | 2599185319 | 2600044032 | 187 |
| 61 | iso_pu_bacteria | 2599185320 | 2600045913 | 187 |
| 62 | iso_pu_bacteria | 2599185321 | 2600053090 | 187 |
| 63 | iso_pu_bacteria | 2599185322 | 2600060663 | 187 |
| 64 | iso_pu_bacteria | 2599185323 | 2600067691 | 187 |
| 65 | iso_pu_bacteria | 2599185324 | 2600071408 | 187 |
| 66 | iso_pu_bacteria | 2599185325 | 2600077918 | 187 |
| 67 | iso_pu_bacteria | 2600254930 | 2600359854 | 187 |
| 68 | iso_pu_bacteria | 2600254931 | 2600365962 | 187 |
| 69 | iso_pu_bacteria | 2600255318 | 2601800911 | 187 |
| 70 | iso_pu_bacteria | 2603880185 | 2606074980 | 187 |
| 71 | iso_pu_bacteria | 2603880199 | 2606127844 | 187 |
| 72 | iso_pu_bacteria | 2623620443 | 2624478498 | 187 |
| 73 | iso_pu_bacteria | 2623620446 | 2624490036 | 187 |
| 74 | iso_pu_bacteria | 2643221565 | 2643843913 | 187 |
| 75 | iso_pu_bacteria | 2643221589 | 2643957162 | 187 |
| 76 | iso_pu_bacteria | 2643221602 | 2644020755 | 187 |
| 77 | iso_pu_bacteria | 2643221650 | 2644284083 | 187 |
| 78 | iso_pu_bacteria | 2651869719 | 2652548370 | 187 |
| 79 | iso_pu_bacteria | 2667528170 | 2671092497 | 187 |
| 80 | iso_pu_bacteria | 2667528176 | 2671128209 | 187 |
| 81 | iso_pu_bacteria | 2671180172 | 2671767546 | 187 |
| 82 | iso_pu_bacteria | 2675903515 | 2678261249 | 187 |
| 83 | iso_pu_bacteria | 2713897149 | 2715759955 | 187 |
| 84 | iso_pu_bacteria | 2738541265 | 2738671124 | 187 |
| 85 | iso_pu_bacteria | 2738541282 | 2738749518 | 187 |
| 86 | iso_pu_bacteria | 2738541303 | 2738858558 | 187 |
| 87 | iso_pu_bacteria | 2738543025 | 2739315379 | 187 |
| 88 | iso_pu_bacteria | 2740892503 | 2743735332 | 187 |
| 89 | iso_pu_bacteria | 2744054620 | 2745006564 | 187 |
| 90 | iso_pu_bacteria | 2773857670 | 2774120967 | 187 |
| 91 | iso_pu_bacteria | 2773857673 | 2774138260 | 187 |
| 92 | iso_pu_bacteria | 2784132063 | 2784260771 | 187 |
| 93 | iso_pu_bacteria | 2784132072 | 2784317198 | 187 |
| 94 | iso_pu_bacteria | 2791355520 | 2794598496 | 187 |
| 95 | iso_pu_bacteria | 2808606361 | 2808857944 | 187 |
| 96 | iso_pu_bacteria | 2808606376 | 2808926476 | 187 |
| 97 | iso_pu_bacteria | 2808606377 | 2808932080 | 187 |
| 98 | iso_pu_bacteria | 2808606378 | 2808938214 | 187 |
| 99 | iso_pu_bacteria | 2808606380 | 2808948600 | 187 |
| 100 | iso_pu_bacteria | 2808606381 | 2808954070 | 187 |
| 101 | iso_pu_bacteria | 2808606382 | 2808961748 | 187 |
| 102 | iso_pu_bacteria | 2808606383 | 2808966466 | 187 |
| 103 | iso_pu_bacteria | 2808606389 | 2809001296 | 187 |
| 104 | iso_pu_bacteria | 2808606445 | 2809215422 | 187 |
| 105 | iso_pu_bacteria | 2816332298 | 2817493343 | 187 |
| 106 | iso_pu_bacteria | 2818991456 | 2819658048 | 187 |
| 107 | iso_pu_bacteria | 2825651385 | 2825654016 | 187 |
| 108 | iso_pu_bacteria | 2834028612 | 2834034280 | 187 |
| 109 | iso_pu_bacteria | 2852657418 | 2852663233 | 187 |
| 110 | iso_pu_bacteria | 2860339153 | 2860343416 | 187 |
| 111 | iso_pu_bacteria | 2878029506 | 2878030440 | 187 |
| 112 | iso_pu_bacteria | 2880230671 | 2880231384 | 187 |
| 113 | iso_pu_bacteria | 2904518522 | 2904523476 | 187 |
| 114 | iso_pu_bacteria | 2904550169 | 2904550759 | 187 |
| 115 | iso_pu_bacteria | 2913036834 | 2913037533 | 187 |
| 116 | iso_pu_bacteria | 2919063839 | 2919067592 | 187 |
| 117 | iso_pu_bacteria | 2919456309 | 2919462191 | 187 |
| 118 | iso_pu_bacteria | 2919481497 | 2919482425 | 187 |
| 119 | iso_pu_bacteria | 2923153595 | 2923154333 | 187 |
| 120 | iso_pu_bacteria | 2923586266 | 2923591585 | 187 |
| 121 | iso_pu_bacteria | 2929144301 | 2929145070 | 187 |
| 122 | iso_pu_bacteria | 2931369376 | 2931371597 | 187 |
| 123 | iso_pu_bacteria | 2931390751 | 2931395776 | 187 |
| 124 | iso_pu_bacteria | 2931396565 | 2931399118 | 187 |
| 125 | iso_pu_bacteria | 2945928738 | 2945931568 | 187 |
| 126 | iso_pu_bacteria | 2969304461 | 2969305237 | 187 |
| 127 | iso_pu_bacteria | 2984286254 | 2984291712 | 187 |
| 128 | iso_pu_bacteria | 2988728565 | 2988732454 | 187 |
| 129 | iso_pu_bacteria | 3007395558 | 3007399887 | 187 |
| 130 | iso_pu_bacteria | 3007511990 | 3007512000 | 187 |
| 131 | iso_pu_bacteria | 3007614139 | 3007617156 | 187 |
| 132 | iso_pu_bacteria | 3007619802 | 3007623268 | 187 |
| 133 | iso_pu_bacteria | 3007718800 | 3007723269 | 187 |
| 134 | iso_pu_bacteria | 3007861166 | 3007864053 | 187 |
| 135 | iso_pu_bacteria | 3007866637 | 3007867279 | 187 |
| 136 | iso_pu_bacteria | 8015687852 | 8015688597 | 187 |
| 137 | iso_pu_bacteria | 8019769354 | 8019770562 | 187 |
| 138 | iso_pu_bacteria | 8019775933 | 8019782132 | 187 |
| 139 | iso_pu_bacteria | 8055770955 | 8055771695 | 187 |
| 140 | iso_pu_bacteria | 8055817908 | 8055823221 | 187 |
| 141 | iso_pu_bacteria | 8056155041 | 8056160865 | 187 |
| 142 | iso_pu_bacteria | 8056161164 | 8056162922 | 187 |
| 143 | iso_pu_bacteria | 8056172158 | 8056176443 | 187 |
| 144 | iso_pu_bacteria | 8056177738 | 8056180946 | 187 |
| 145 | iso_pu_bacteria | 8056569372 | 8056569375 | 187 |
| 146 | iso_pu_bacteria | 8057798959 | 8057802970 | 187 |
| 147 | 3300003751 | Ga0055538_1000028 | Ga0055538_1000028213 | 188 |
| 148 | 3300003752 | Ga0055539_1000037 | Ga0055539_1000037213 | 188 |
| 149 | 3300003756 | Ga0055533_1000047 | Ga0055533_1000047213 | 188 |
| 150 | 3300003758 | Ga0055532_1000065 | Ga0055532_10000654 | 188 |
| 151 | 3300003759 | Ga0055525_1000176 | Ga0055525_10001764 | 188 |
| 152 | 3300003841 | Ga0055541_1000025 | Ga0055541_1000025213 | 188 |
| 153 | 3300005344 | Ga0070661_100001008 | Ga0070661_1000010085 | 188 |
| 154 | 3300005564 | Ga0070664_100001301 | Ga0070664_1000013015 | 188 |
| 155 | 3300006051 | Ga0075364_10072244 | Ga0075364_100722442 | 188 |
| 156 | 3300009036 | Ga0105244_10003144 | Ga0105244_100031445 | 188 |
| 157 | 3300009092 | Ga0105250_10000275 | Ga0105250_1000027533 | 188 |
| 158 | 3300009176 | Ga0105242_10006290 | Ga0105242_100062903 | 188 |
| 159 | 3300009545 | Ga0105237_10003115 | Ga0105237_100031155 | 188 |
| 160 | 3300011119 | Ga0105246_10001653 | Ga0105246_100016534 | 188 |
| 161 | 3300011119 | Ga0105246_10073019 | Ga0105246_100730193 | 188 |
| 162 | 3300013105 | Ga0157369_10003571 | Ga0157369_100035714 | 188 |
| 163 | 3300013308 | Ga0157375_10004942 | Ga0157375_100049423 | 188 |
| 164 | 3300017792 | Ga0163161_10002705 | Ga0163161_100027054 | 188 |
| 165 | 3300017792 | Ga0163161_10068681 | Ga0163161_100686812 | 188 |
| 166 | 3300025224 | Ga0209784_100032 | Ga0209784_1000325 | 188 |
| 167 | 3300025225 | Ga0209566_100036 | Ga0209566_1000365 | 188 |
| 168 | 3300025226 | Ga0209674_100054 | Ga0209674_1000545 | 188 |
| 169 | 3300025229 | Ga0209147_100055 | Ga0209147_1000555 | 188 |
| 170 | 3300025230 | Ga0209563_100055 | Ga0209563_100055301 | 188 |
| 171 | 3300025242 | Ga0209258_100239 | Ga0209258_10023993 | 188 |
| 172 | 3300025246 | Ga0209646_1000736 | Ga0209646_10007363 | 188 |
| 173 | 3300025253 | Ga0209677_100033 | Ga0209677_1000335 | 188 |
| 174 | 3300025711 | Ga0207696_1000220 | Ga0207696_100022074 | 188 |
| 175 | 3300025728 | Ga0207655_1001232 | Ga0207655_100123219 | 188 |
| 176 | 3300025728 | Ga0207655_1003278 | Ga0207655_10032783 | 188 |
| 177 | 3300025735 | Ga0207713_1003046 | Ga0207713_10030463 | 188 |
| 178 | 3300025914 | Ga0207671_10002416 | Ga0207671_100024165 | 188 |
| 179 | 3300025920 | Ga0207649_10000006 | Ga0207649_100000065 | 188 |
| 180 | 3300025925 | Ga0207650_10000276 | Ga0207650_100002765 | 188 |
| 181 | 3300025934 | Ga0207686_10078743 | Ga0207686_100787432 | 188 |
| 182 | 3300025945 | Ga0207679_10000010 | Ga0207679_100000105 | 188 |
| 183 | 3300028379 | Ga0268266_10463142 | Ga0268266_104631422 | 188 |
| 184 | 3300031507 | Ga0307509_10032347 | Ga0307509_100323473 | 188 |
| 185 | 3300031731 | Ga0307405_10000760 | Ga0307405_100007604 | 188 |
| 186 | 3300031911 | Ga0307412_10364290 | Ga0307412_103642901 | 188 |
| 187 | 3300046512 | Ga0495610_0003484 | Ga0495610_0003484_2411_2977 | 188 |
| 188 | 3300046512 | Ga0495610_0118356 | Ga0495610_0118356_333_899 | 188 |
| 189 | 3300046530 | Ga0495654_0021787 | Ga0495654_0021787_281_847 | 188 |
| 190 | 3300046810 | Ga0495660_0003470 | Ga0495660_0003470_5933_6499 | 188 |
| 191 | 3300047446 | Ga0495679_002128 | Ga0495679_002128_384_950 | 188 |
| 192 | 3300048921 | Ga0496118_0196821 | Ga0496118_0196821_90_656 | 188 |
| 193 | 3300048923 | Ga0496120_0326430 | Ga0496120_0326430_97_663 | 188 |
| 194 | 3300048924 | Ga0496121_0237758 | Ga0496121_0237758_374_940 | 188 |
| 195 | 3300048925 | Ga0496122_0273899 | Ga0496122_0273899_104_670 | 188 |
| 196 | 3300048926 | Ga0496123_0193566 | Ga0496123_0193566_264_830 | 188 |
| 197 | 3300048928 | Ga0496125_0026030 | Ga0496125_0026030_2408_2974 | 188 |
| 198 | 3300048928 | Ga0496125_0043408 | Ga0496125_0043408_3031_3597 | 188 |
| 199 | 3300003781 | Ga0055536_1000105 | Ga0055536_100010551 | 189 |
| 200 | 3300005288 | Ga0065714_10084720 | Ga0065714_100847202 | 189 |
| 201 | 3300013100 | Ga0157373_10021739 | Ga0157373_100217394 | 189 |
| 202 | 3300013102 | Ga0157371_10005069 | Ga0157371_100050695 | 189 |
| 203 | 3300013105 | Ga0157369_10007090 | Ga0157369_100070904 | 189 |
| 204 | 3300013105 | Ga0157369_10017894 | Ga0157369_100178944 | 189 |
| 205 | 3300015261 | Ga0182006_1001434 | Ga0182006_10014345 | 189 |
| 206 | 3300025292 | Ga0209676_1000428 | Ga0209676_10004285 | 189 |
| 207 | 3300027111 | Ga0209281_1013120 | Ga0209281_10131201 | 189 |
| 208 | 3300028379 | Ga0268266_10008427 | Ga0268266_100084272 | 189 |
| 209 | 3300030734 | Ga0316179_1010585 | Ga0316179_10105854 | 189 |
| 210 | 3300030735 | Ga0316178_1004939 | Ga0316178_100493919 | 189 |
| 211 | 3300031548 | Ga0307408_100002080 | Ga0307408_1000020805 | 189 |
| 212 | 3300031548 | Ga0307408_100434195 | Ga0307408_1004341952 | 189 |
| 213 | 3300031824 | Ga0307413_10079927 | Ga0307413_100799272 | 189 |
| 214 | 3300031911 | Ga0307412_10050604 | Ga0307412_100506042 | 189 |
| 215 | 3300031911 | Ga0307412_10076907 | Ga0307412_100769072 | 189 |
| 216 | 3300031911 | Ga0307412_10249065 | Ga0307412_102490652 | 189 |
| 217 | 3300031995 | Ga0307409_100034418 | Ga0307409_1000344184 | 189 |
| 218 | 3300032004 | Ga0307414_10002708 | Ga0307414_100027084 | 189 |
| 219 | 3300032004 | Ga0307414_10196071 | Ga0307414_101960712 | 189 |
| 220 | 3300032005 | Ga0307411_10246204 | Ga0307411_102462042 | 189 |
| 221 | 3300041405 | Ga0439438_000216 | Ga0439438_000216_16551_17120 | 189 |
| 222 | 3300041405 | Ga0439438_000987 | Ga0439438_000987_9393_9962 | 189 |
| 223 | 3300041407 | Ga0439447_036170 | Ga0439447_036170_626_1195 | 189 |
| 224 | 3300041411 | Ga0439466_0053660 | Ga0439466_0053660_279_848 | 189 |
| 225 | 3300042002 | Ga0439442_011964 | Ga0439442_011964_1056_1625 | 189 |
| 226 | 3300042004 | Ga0439445_0000618 | Ga0439445_0000618_6037_6606 | 189 |
| 227 | 3300042006 | Ga0439432_000960 | Ga0439432_000960_907_1476 | 189 |
| 228 | 3300042006 | Ga0439432_003401 | Ga0439432_003401_1414_1983 | 189 |
| 229 | 3300042006 | Ga0439432_005090 | Ga0439432_005090_3472_4041 | 189 |
| 230 | 3300042010 | Ga0439452_000975 | Ga0439452_000975_2697_3266 | 189 |
| 231 | 3300042013 | Ga0439456_015463 | Ga0439456_015463_51_620 | 189 |
| 232 | 3300042016 | Ga0439463_010205 | Ga0439463_010205_1643_2212 | 189 |
| 233 | 3300042115 | Ga0450911_000478 | Ga0450911_000478_2696_3265 | 189 |
| 234 | 3300042130 | Ga0450892_001614 | Ga0450892_001614_130_699 | 189 |
| 235 | 3300042138 | Ga0450903_007644 | Ga0450903_007644_286_855 | 189 |
| 236 | 3300042139 | Ga0450904_006689 | Ga0450904_006689_322_891 | 189 |
| 237 | 3300042145 | Ga0450906_000161 | Ga0450906_000161_9559_10128 | 189 |
| 238 | 3300042146 | Ga0450907_006455 | Ga0450907_006455_1086_1655 | 189 |
| 239 | 3300042184 | Ga0450908_009473 | Ga0450908_009473_1179_1748 | 189 |
| 240 | 3300042531 | Ga0450918_008337 | Ga0450918_008337_152_721 | 189 |
| 241 | 3300049682 | Ga0501252_000802 | Ga0501252_000802_884_1453 | 189 |
| 242 | 3300049758 | Ga0501241_000086 | Ga0501241_000086_9554_10123 | 189 |
| 243 | 3300049766 | Ga0501269_004107 | Ga0501269_004107_687_1256 | 189 |
| 244 | 3300005331 | Ga0070670_100001943 | Ga0070670_1000019438 | 190 |
| 245 | 3300025925 | Ga0207650_10000299 | Ga0207650_100002995 | 190 |
| 246 | 3300031548 | Ga0307408_100106913 | Ga0307408_1001069132 | 190 |
| 247 | 3300031731 | Ga0307405_10006009 | Ga0307405_100060095 | 190 |
| 248 | 3300031824 | Ga0307413_10060076 | Ga0307413_100600762 | 190 |
| 249 | 3300031903 | Ga0307407_10200422 | Ga0307407_102004222 | 190 |
| 250 | 3300031911 | Ga0307412_10000617 | Ga0307412_100006175 | 190 |
| 251 | 3300031911 | Ga0307412_10001467 | Ga0307412_100014675 | 190 |
| 252 | 3300032005 | Ga0307411_10005345 | Ga0307411_100053453 | 190 |
| 253 | 3300042147 | Ga0450910_014098 | Ga0450910_014098_134_706 | 190 |
| 254 | 3300049766 | Ga0501269_001630 | Ga0501269_001630_1023_1595 | 190 |
| 255 | 2124908027 | MRS2a_Contig_391 | MRS2a_00281010 | 191 |
| 256 | 2124908027 | MRS2a_Contig_90 | MRS2a_00743340 | 191 |
| 257 | 2162886007 | SwRhRL2b_contig_710988 | SwRhRL2b_0795.00007670 | 191 |
| 258 | 3300002737 | JGI25162J39368_1000167 | JGI25162J39368_100016764 | 191 |
| 259 | 3300002737 | JGI25162J39368_1000186 | JGI25162J39368_100018643 | 191 |
| 260 | 3300002771 | JGI25163J39215_1000185 | JGI25163J39215_10001859 | 191 |
| 261 | 3300002771 | JGI25163J39215_1000378 | JGI25163J39215_10003785 | 191 |
| 262 | 3300002772 | JGI25164J39214_1000131 | JGI25164J39214_100013164 | 191 |
| 263 | 3300002772 | JGI25164J39214_1000150 | JGI25164J39214_10001509 | 191 |
| 264 | 3300003214 | JGI25165J46597_1000252 | JGI25165J46597_10002525 | 191 |
| 265 | 3300003214 | JGI25165J46597_1000277 | JGI25165J46597_10002779 | 191 |
| 266 | 3300003759 | Ga0055525_1007889 | Ga0055525_10078892 | 191 |
| 267 | 3300003781 | Ga0055536_1000104 | Ga0055536_10001045 | 191 |
| 268 | 3300003781 | Ga0055536_1000180 | Ga0055536_10001809 | 191 |
| 269 | 3300003791 | Ga0055530_10000213 | Ga0055530_100002139 | 191 |
| 270 | 3300003791 | Ga0055530_10000274 | Ga0055530_1000027427 | 191 |
| 271 | 3300003791 | Ga0055530_10000768 | Ga0055530_1000076815 | 191 |
| 272 | 3300003791 | Ga0055530_10048558 | Ga0055530_100485582 | 191 |
| 273 | 3300003792 | Ga0055540_1000135 | Ga0055540_10001355 | 191 |
| 274 | 3300003792 | Ga0055540_1000270 | Ga0055540_100027027 | 191 |
| 275 | 3300003792 | Ga0055540_1000413 | Ga0055540_10004138 | 191 |
| 276 | 3300003794 | Ga0055531_10000350 | Ga0055531_1000035035 | 191 |
| 277 | 3300003794 | Ga0055531_10063662 | Ga0055531_100636621 | 191 |
| 278 | 3300005288 | Ga0065714_10002436 | Ga0065714_100024365 | 191 |
| 279 | 3300005288 | Ga0065714_10014541 | Ga0065714_100145412 | 191 |
| 280 | 3300005288 | Ga0065714_10079296 | Ga0065714_100792962 | 191 |
| 281 | 3300005289 | Ga0065704_10019143 | Ga0065704_100191432 | 191 |
| 282 | 3300005289 | Ga0065704_10071876 | Ga0065704_100718762 | 191 |
| 283 | 3300005289 | Ga0065704_10159964 | Ga0065704_101599642 | 191 |
| 284 | 3300005339 | Ga0070660_100878713 | Ga0070660_1008787131 | 191 |
| 285 | 3300005353 | Ga0070669_100000203 | Ga0070669_10000020344 | 191 |
| 286 | 3300005353 | Ga0070669_100000746 | Ga0070669_10000074613 | 191 |
| 287 | 3300005435 | Ga0070714_100098727 | Ga0070714_1000987272 | 191 |
| 288 | 3300005457 | Ga0070662_100000469 | Ga0070662_1000004695 | 191 |
| 289 | 3300005457 | Ga0070662_100031311 | Ga0070662_1000313114 | 191 |
| 290 | 3300005539 | Ga0068853_100000107 | Ga0068853_1000001075 | 191 |
| 291 | 3300005564 | Ga0070664_100012771 | Ga0070664_1000127713 | 191 |
| 292 | 3300005578 | Ga0068854_100053493 | Ga0068854_1000534932 | 191 |
| 293 | 3300005834 | Ga0068851_10000032 | Ga0068851_100000325 | 191 |
| 294 | 3300006051 | Ga0075364_10070877 | Ga0075364_100708773 | 191 |
| 295 | 3300006051 | Ga0075364_10323583 | Ga0075364_103235832 | 191 |
| 296 | 3300006058 | Ga0075432_10011413 | Ga0075432_100114131 | 191 |
| 297 | 3300006058 | Ga0075432_10029452 | Ga0075432_100294521 | 191 |
| 298 | 3300006058 | Ga0075432_10089782 | Ga0075432_100897822 | 191 |
| 299 | 3300006177 | Ga0075362_10066586 | Ga0075362_100665862 | 191 |
| 300 | 3300006177 | Ga0075362_10077407 | Ga0075362_100774072 | 191 |
| 301 | 3300006914 | Ga0075436_100069387 | Ga0075436_1000693872 | 191 |
| 302 | 3300006946 | Ga0079104_1000362 | Ga0079104_10003625 | 191 |
| 303 | 3300006948 | Ga0099826_10011004 | Ga0099826_100110043 | 191 |
| 304 | 3300009011 | Ga0105251_10006139 | Ga0105251_100061392 | 191 |
| 305 | 3300009011 | Ga0105251_10155776 | Ga0105251_101557762 | 191 |
| 306 | 3300009036 | Ga0105244_10002516 | Ga0105244_100025164 | 191 |
| 307 | 3300009036 | Ga0105244_10002835 | Ga0105244_100028354 | 191 |
| 308 | 3300009036 | Ga0105244_10008732 | Ga0105244_100087323 | 191 |
| 309 | 3300009036 | Ga0105244_10015291 | Ga0105244_100152912 | 191 |
| 310 | 3300009036 | Ga0105244_10018916 | Ga0105244_100189162 | 191 |
| 311 | 3300009036 | Ga0105244_10020581 | Ga0105244_100205812 | 191 |
| 312 | 3300009036 | Ga0105244_10055429 | Ga0105244_100554291 | 191 |
| 313 | 3300009036 | Ga0105244_10067683 | Ga0105244_100676832 | 191 |
| 314 | 3300009092 | Ga0105250_10000297 | Ga0105250_1000029732 | 191 |
| 315 | 3300009092 | Ga0105250_10003737 | Ga0105250_100037373 | 191 |
| 316 | 3300009092 | Ga0105250_10007997 | Ga0105250_100079972 | 191 |
| 317 | 3300009148 | Ga0105243_10000174 | Ga0105243_1000017467 | 191 |
| 318 | 3300009148 | Ga0105243_10003246 | Ga0105243_100032465 | 191 |
| 319 | 3300009148 | Ga0105243_10057750 | Ga0105243_100577502 | 191 |
| 320 | 3300009176 | Ga0105242_10792408 | Ga0105242_107924082 | 191 |
| 321 | 3300011119 | Ga0105246_10003529 | Ga0105246_100035293 | 191 |
| 322 | 3300011119 | Ga0105246_10095828 | Ga0105246_100958282 | 191 |
| 323 | 3300011119 | Ga0105246_10344871 | Ga0105246_103448711 | 191 |
| 324 | 3300011119 | Ga0105246_10430731 | Ga0105246_104307312 | 191 |
| 325 | 3300012498 | Ga0157345_1000142 | Ga0157345_10001424 | 191 |
| 326 | 3300012498 | Ga0157345_1001470 | Ga0157345_10014702 | 191 |
| 327 | 3300012502 | Ga0157347_1001370 | Ga0157347_10013702 | 191 |
| 328 | 3300013100 | Ga0157373_10002919 | Ga0157373_100029195 | 191 |
| 329 | 3300013100 | Ga0157373_10003453 | Ga0157373_100034534 | 191 |
| 330 | 3300013100 | Ga0157373_10009898 | Ga0157373_100098985 | 191 |
| 331 | 3300013100 | Ga0157373_10069372 | Ga0157373_100693722 | 191 |
| 332 | 3300013102 | Ga0157371_10000244 | Ga0157371_100002445 | 191 |
| 333 | 3300013102 | Ga0157371_10001413 | Ga0157371_1000141318 | 191 |
| 334 | 3300013104 | Ga0157370_10024126 | Ga0157370_100241263 | 191 |
| 335 | 3300013104 | Ga0157370_10038317 | Ga0157370_100383174 | 191 |
| 336 | 3300013104 | Ga0157370_10053845 | Ga0157370_100538453 | 191 |
| 337 | 3300013104 | Ga0157370_10306529 | Ga0157370_103065292 | 191 |
| 338 | 3300013105 | Ga0157369_10007109 | Ga0157369_100071095 | 191 |
| 339 | 3300013306 | Ga0163162_10000092 | Ga0163162_1000009263 | 191 |
| 340 | 3300013306 | Ga0163162_10003797 | Ga0163162_1000379712 | 191 |
| 341 | 3300013307 | Ga0157372_10004825 | Ga0157372_100048255 | 191 |
| 342 | 3300013308 | Ga0157375_10150709 | Ga0157375_101507092 | 191 |
| 343 | 3300013308 | Ga0157375_10656918 | Ga0157375_106569182 | 191 |
| 344 | 3300014497 | Ga0182008_10000158 | Ga0182008_100001585 | 191 |
| 345 | 3300014497 | Ga0182008_10001704 | Ga0182008_100017045 | 191 |
| 346 | 3300014497 | Ga0182008_10005864 | Ga0182008_100058643 | 191 |
| 347 | 3300014497 | Ga0182008_10024454 | Ga0182008_100244543 | 191 |
| 348 | 3300015261 | Ga0182006_1000235 | Ga0182006_100023543 | 191 |
| 349 | 3300015261 | Ga0182006_1000653 | Ga0182006_10006533 | 191 |
| 350 | 3300015261 | Ga0182006_1004794 | Ga0182006_10047943 | 191 |
| 351 | 3300015261 | Ga0182006_1103496 | Ga0182006_11034962 | 191 |
| 352 | 3300015261 | Ga0182006_1109663 | Ga0182006_11096631 | 191 |
| 353 | 3300015261 | Ga0182006_1138919 | Ga0182006_11389192 | 191 |
| 354 | 3300015262 | Ga0182007_10001596 | Ga0182007_100015964 | 191 |
| 355 | 3300015262 | Ga0182007_10012849 | Ga0182007_100128492 | 191 |
| 356 | 3300015265 | Ga0182005_1000742 | Ga0182005_10007426 | 191 |
| 357 | 3300015265 | Ga0182005_1025476 | Ga0182005_10254761 | 191 |
| 358 | 3300017792 | Ga0163161_10002110 | Ga0163161_100021104 | 191 |
| 359 | 3300017792 | Ga0163161_10014922 | Ga0163161_100149225 | 191 |
| 360 | 3300017792 | Ga0163161_10019391 | Ga0163161_100193912 | 191 |
| 361 | 3300017792 | Ga0163161_10086692 | Ga0163161_100866923 | 191 |
| 362 | 3300025207 | Ga0209760_100072 | Ga0209760_1000725 | 191 |
| 363 | 3300025207 | Ga0209760_100100 | Ga0209760_1001009 | 191 |
| 364 | 3300025230 | Ga0209563_100401 | Ga0209563_1004016 | 191 |
| 365 | 3300025231 | Ga0207427_100116 | Ga0207427_10011692 | 191 |
| 366 | 3300025231 | Ga0207427_100180 | Ga0207427_1001809 | 191 |
| 367 | 3300025233 | Ga0209437_100003 | Ga0209437_1000031469 | 191 |
| 368 | 3300025233 | Ga0209437_100309 | Ga0209437_1003099 | 191 |
| 369 | 3300025256 | Ga0209759_1043999 | Ga0209759_10439991 | 191 |
| 370 | 3300025261 | Ga0209233_1000008 | Ga0209233_10000081249 | 191 |
| 371 | 3300025261 | Ga0209233_1000220 | Ga0209233_100022092 | 191 |
| 372 | 3300025291 | Ga0209675_1001904 | Ga0209675_10019041 | 191 |
| 373 | 3300025292 | Ga0209676_1000255 | Ga0209676_100025597 | 191 |
| 374 | 3300025292 | Ga0209676_1000357 | Ga0209676_100035767 | 191 |
| 375 | 3300025292 | Ga0209676_1013675 | Ga0209676_10136752 | 191 |
| 376 | 3300025292 | Ga0209676_1020328 | Ga0209676_10203282 | 191 |
| 377 | 3300025298 | Ga0209050_1000041 | Ga0209050_1000041362 | 191 |
| 378 | 3300025298 | Ga0209050_1000287 | Ga0209050_100028780 | 191 |
| 379 | 3300025298 | Ga0209050_1000420 | Ga0209050_10004209 | 191 |
| 380 | 3300025298 | Ga0209050_1002033 | Ga0209050_100203311 | 191 |
| 381 | 3300025303 | Ga0209051_1000199 | Ga0209051_100019980 | 191 |
| 382 | 3300025303 | Ga0209051_1000229 | Ga0209051_100022974 | 191 |
| 383 | 3300025303 | Ga0209051_1000250 | Ga0209051_100025076 | 191 |
| 384 | 3300025303 | Ga0209051_1002350 | Ga0209051_10023505 | 191 |
| 385 | 3300025304 | Ga0209257_1000469 | Ga0209257_100046955 | 191 |
| 386 | 3300025304 | Ga0209257_1019861 | Ga0209257_10198613 | 191 |
| 387 | 3300025321 | Ga0207656_10000065 | Ga0207656_1000006532 | 191 |
| 388 | 3300025711 | Ga0207696_1000228 | Ga0207696_100022867 | 191 |
| 389 | 3300025711 | Ga0207696_1001630 | Ga0207696_10016309 | 191 |
| 390 | 3300025711 | Ga0207696_1002351 | Ga0207696_10023514 | 191 |
| 391 | 3300025711 | Ga0207696_1012066 | Ga0207696_10120664 | 191 |
| 392 | 3300025728 | Ga0207655_1001136 | Ga0207655_100113618 | 191 |
| 393 | 3300025728 | Ga0207655_1002149 | Ga0207655_10021495 | 191 |
| 394 | 3300025728 | Ga0207655_1002877 | Ga0207655_10028774 | 191 |
| 395 | 3300025728 | Ga0207655_1003022 | Ga0207655_10030224 | 191 |
| 396 | 3300025728 | Ga0207655_1005603 | Ga0207655_10056033 | 191 |
| 397 | 3300025728 | Ga0207655_1011951 | Ga0207655_10119513 | 191 |
| 398 | 3300025728 | Ga0207655_1041460 | Ga0207655_10414602 | 191 |
| 399 | 3300025728 | Ga0207655_1081799 | Ga0207655_10817992 | 191 |
| 400 | 3300025735 | Ga0207713_1000355 | Ga0207713_100035541 | 191 |
| 401 | 3300025735 | Ga0207713_1000499 | Ga0207713_100049931 | 191 |
| 402 | 3300025735 | Ga0207713_1000722 | Ga0207713_10007224 | 191 |
| 403 | 3300025735 | Ga0207713_1001537 | Ga0207713_10015374 | 191 |
| 404 | 3300025735 | Ga0207713_1007282 | Ga0207713_10072822 | 191 |
| 405 | 3300025735 | Ga0207713_1007912 | Ga0207713_10079122 | 191 |
| 406 | 3300025735 | Ga0207713_1009034 | Ga0207713_10090344 | 191 |
| 407 | 3300025735 | Ga0207713_1091746 | Ga0207713_10917462 | 191 |
| 408 | 3300025735 | Ga0207713_1112866 | Ga0207713_11128662 | 191 |
| 409 | 3300025923 | Ga0207681_10000095 | Ga0207681_1000009572 | 191 |
| 410 | 3300025923 | Ga0207681_10003682 | Ga0207681_100036822 | 191 |
| 411 | 3300025929 | Ga0207664_10111425 | Ga0207664_101114252 | 191 |
| 412 | 3300025933 | Ga0207706_10000846 | Ga0207706_100008464 | 191 |
| 413 | 3300025933 | Ga0207706_10007081 | Ga0207706_100070817 | 191 |
| 414 | 3300025935 | Ga0207709_10000125 | Ga0207709_1000012590 | 191 |
| 415 | 3300025935 | Ga0207709_10000302 | Ga0207709_1000030245 | 191 |
| 416 | 3300025935 | Ga0207709_10212748 | Ga0207709_102127482 | 191 |
| 417 | 3300025941 | Ga0207711_10078188 | Ga0207711_100781882 | 191 |
| 418 | 3300025981 | Ga0207640_10402972 | Ga0207640_104029722 | 191 |
| 419 | 3300026041 | Ga0207639_10000167 | Ga0207639_1000016743 | 191 |
| 420 | 3300027111 | Ga0209281_1000015 | Ga0209281_10000155 | 191 |
| 421 | 3300027111 | Ga0209281_1000256 | Ga0209281_10002565 | 191 |
| 422 | 3300027666 | Ga0209282_1035142 | Ga0209282_10351422 | 191 |
| 423 | 3300027907 | Ga0207428_10004072 | Ga0207428_100040728 | 191 |
| 424 | 3300027907 | Ga0207428_10051124 | Ga0207428_100511243 | 191 |
| 425 | 3300027907 | Ga0207428_10336289 | Ga0207428_103362891 | 191 |
| 426 | 3300028379 | Ga0268266_11139905 | Ga0268266_111399051 | 191 |
| 427 | 3300030521 | Ga0307511_10065146 | Ga0307511_100651462 | 191 |
| 428 | 3300030731 | Ga0316177_1185208 | Ga0316177_11852083 | 191 |
| 429 | 3300030744 | Ga0316181_1158599 | Ga0316181_11585994 | 191 |
| 430 | 3300031548 | Ga0307408_100002720 | Ga0307408_1000027204 | 191 |
| 431 | 3300031730 | Ga0307516_10090513 | Ga0307516_100905132 | 191 |
| 432 | 3300031730 | Ga0307516_10092653 | Ga0307516_100926532 | 191 |
| 433 | 3300031730 | Ga0307516_10262732 | Ga0307516_102627322 | 191 |
| 434 | 3300031731 | Ga0307405_10001020 | Ga0307405_100010202 | 191 |
| 435 | 3300031731 | Ga0307405_10008491 | Ga0307405_100084914 | 191 |
| 436 | 3300031824 | Ga0307413_10026868 | Ga0307413_100268683 | 191 |
| 437 | 3300031901 | Ga0307406_10037375 | Ga0307406_100373752 | 191 |
| 438 | 3300031903 | Ga0307407_10116784 | Ga0307407_101167842 | 191 |
| 439 | 3300031911 | Ga0307412_10001102 | Ga0307412_100011025 | 191 |
| 440 | 3300032005 | Ga0307411_10155211 | Ga0307411_101552112 | 191 |
| 441 | 3300033180 | Ga0307510_10007724 | Ga0307510_100077244 | 191 |
| 442 | 3300038705 | Ga0237819_00983 | Ga0237819_00983_4195_4770 | 191 |
| 443 | 3300041405 | Ga0439438_000921 | Ga0439438_000921_9594_10169 | 191 |
| 444 | 3300041405 | Ga0439438_000970 | Ga0439438_000970_9601_10176 | 191 |
| 445 | 3300041405 | Ga0439438_000971 | Ga0439438_000971_2643_3218 | 191 |
| 446 | 3300041405 | Ga0439438_003415 | Ga0439438_003415_2182_2757 | 191 |
| 447 | 3300041405 | Ga0439438_007725 | Ga0439438_007725_2039_2614 | 191 |
| 448 | 3300041405 | Ga0439438_009691 | Ga0439438_009691_146_769 | 191 |
| 449 | 3300041407 | Ga0439447_000438 | Ga0439447_000438_5410_5985 | 191 |
| 450 | 3300041407 | Ga0439447_000941 | Ga0439447_000941_2152_2766 | 191 |
| 451 | 3300041407 | Ga0439447_001589 | Ga0439447_001589_1883_2458 | 191 |
| 452 | 3300041410 | Ga0439461_0007246 | Ga0439461_0007246_1219_1833 | 191 |
| 453 | 3300041411 | Ga0439466_0000198 | Ga0439466_0000198_10049_10648 | 191 |
| 454 | 3300041411 | Ga0439466_0000636 | Ga0439466_0000636_3094_3669 | 191 |
| 455 | 3300041411 | Ga0439466_0000803 | Ga0439466_0000803_9545_10159 | 191 |
| 456 | 3300041411 | Ga0439466_0000822 | Ga0439466_0000822_9592_10167 | 191 |
| 457 | 3300041411 | Ga0439466_0007430 | Ga0439466_0007430_2633_3208 | 191 |
| 458 | 3300041411 | Ga0439466_0009500 | Ga0439466_0009500_830_1453 | 191 |
| 459 | 3300041411 | Ga0439466_0011877 | Ga0439466_0011877_2089_2664 | 191 |
| 460 | 3300041411 | Ga0439466_0052896 | Ga0439466_0052896_571_1194 | 191 |
| 461 | 3300041411 | Ga0439466_0102460 | Ga0439466_0102460_28_603 | 191 |
| 462 | 3300041411 | Ga0439466_0104870 | Ga0439466_0104870_81_656 | 191 |
| 463 | 3300041413 | Ga0439465_0007265 | Ga0439465_0007265_920_1534 | 191 |
| 464 | 3300041413 | Ga0439465_0008308 | Ga0439465_0008308_416_991 | 191 |
| 465 | 3300041413 | Ga0439465_0053952 | Ga0439465_0053952_467_1090 | 191 |
| 466 | 3300041997 | Ga0439431_0000175 | Ga0439431_0000175_2182_2757 | 191 |
| 467 | 3300042004 | Ga0439445_0010120 | Ga0439445_0010120_95_670 | 191 |
| 468 | 3300042006 | Ga0439432_000118 | Ga0439432_000118_9524_10099 | 191 |
| 469 | 3300042006 | Ga0439432_000668 | Ga0439432_000668_2659_3234 | 191 |
| 470 | 3300042006 | Ga0439432_000765 | Ga0439432_000765_9517_10092 | 191 |
| 471 | 3300042006 | Ga0439432_000781 | Ga0439432_000781_1789_2403 | 191 |
| 472 | 3300042006 | Ga0439432_001756 | Ga0439432_001756_1842_2417 | 191 |
| 473 | 3300042006 | Ga0439432_054859 | Ga0439432_054859_235_810 | 191 |
| 474 | 3300042009 | Ga0439451_000187 | Ga0439451_000187_2372_2947 | 191 |
| 475 | 3300042009 | Ga0439451_000218 | Ga0439451_000218_1831_2445 | 191 |
| 476 | 3300042009 | Ga0439451_000752 | Ga0439451_000752_3096_3671 | 191 |
| 477 | 3300042009 | Ga0439451_001335 | Ga0439451_001335_2749_3324 | 191 |
| 478 | 3300042009 | Ga0439451_006474 | Ga0439451_006474_617_1192 | 191 |
| 479 | 3300042009 | Ga0439451_006996 | Ga0439451_006996_1354_1929 | 191 |
| 480 | 3300042010 | Ga0439452_000152 | Ga0439452_000152_40688_41311 | 191 |
| 481 | 3300042010 | Ga0439452_000379 | Ga0439452_000379_24136_24759 | 191 |
| 482 | 3300042010 | Ga0439452_000529 | Ga0439452_000529_13719_14294 | 191 |
| 483 | 3300042010 | Ga0439452_003073 | Ga0439452_003073_702_1277 | 191 |
| 484 | 3300042010 | Ga0439452_003121 | Ga0439452_003121_4299_4874 | 191 |
| 485 | 3300042010 | Ga0439452_004190 | Ga0439452_004190_3298_3912 | 191 |
| 486 | 3300042010 | Ga0439452_005654 | Ga0439452_005654_1498_2073 | 191 |
| 487 | 3300042010 | Ga0439452_005740 | Ga0439452_005740_690_1265 | 191 |
| 488 | 3300042010 | Ga0439452_005823 | Ga0439452_005823_1959_2534 | 191 |
| 489 | 3300042010 | Ga0439452_047855 | Ga0439452_047855_159_734 | 191 |
| 490 | 3300042013 | Ga0439456_000013 | Ga0439456_000013_9555_10130 | 191 |
| 491 | 3300042013 | Ga0439456_000928 | Ga0439456_000928_2672_3274 | 191 |
| 492 | 3300042013 | Ga0439456_002183 | Ga0439456_002183_1430_2044 | 191 |
| 493 | 3300042013 | Ga0439456_002595 | Ga0439456_002595_1621_2196 | 191 |
| 494 | 3300042013 | Ga0439456_002847 | Ga0439456_002847_2362_2958 | 191 |
| 495 | 3300042013 | Ga0439456_005722 | Ga0439456_005722_1335_1910 | 191 |
| 496 | 3300042013 | Ga0439456_013847 | Ga0439456_013847_92_667 | 191 |
| 497 | 3300042013 | Ga0439456_015673 | Ga0439456_015673_19_594 | 191 |
| 498 | 3300042013 | Ga0439456_043380 | Ga0439456_043380_46_621 | 191 |
| 499 | 3300042016 | Ga0439463_000108 | Ga0439463_000108_14198_14800 | 191 |
| 500 | 3300042016 | Ga0439463_000407 | Ga0439463_000407_9526_10140 | 191 |
| 501 | 3300042016 | Ga0439463_001893 | Ga0439463_001893_2699_3274 | 191 |
| 502 | 3300042016 | Ga0439463_009927 | Ga0439463_009927_451_1026 | 191 |
| 503 | 3300042016 | Ga0439463_011079 | Ga0439463_011079_219_794 | 191 |
| 504 | 3300042115 | Ga0450911_000387 | Ga0450911_000387_9522_10145 | 191 |
| 505 | 3300042115 | Ga0450911_003172 | Ga0450911_003172_1402_2016 | 191 |
| 506 | 3300042115 | Ga0450911_028694 | Ga0450911_028694_95_676 | 191 |
| 507 | 3300042116 | Ga0450912_004987 | Ga0450912_004987_342_917 | 191 |
| 508 | 3300042121 | Ga0450919_001131 | Ga0450919_001131_1240_1854 | 191 |
| 509 | 3300042124 | Ga0450922_000758 | Ga0450922_000758_157_771 | 191 |
| 510 | 3300042124 | Ga0450922_001000 | Ga0450922_001000_1295_1870 | 191 |
| 511 | 3300042127 | Ga0450890_000119 | Ga0450890_000119_9545_10159 | 191 |
| 512 | 3300042137 | Ga0450902_002851 | Ga0450902_002851_444_1058 | 191 |
| 513 | 3300042137 | Ga0450902_003845 | Ga0450902_003845_1422_1997 | 191 |
| 514 | 3300042137 | Ga0450902_009143 | Ga0450902_009143_970_1545 | 191 |
| 515 | 3300042137 | Ga0450902_015188 | Ga0450902_015188_287_862 | 191 |
| 516 | 3300042138 | Ga0450903_000657 | Ga0450903_000657_2054_2629 | 191 |
| 517 | 3300042138 | Ga0450903_000690 | Ga0450903_000690_1869_2483 | 191 |
| 518 | 3300042138 | Ga0450903_027639 | Ga0450903_027639_178_753 | 191 |
| 519 | 3300042139 | Ga0450904_001279 | Ga0450904_001279_889_1464 | 191 |
| 520 | 3300042142 | Ga0450905_000040 | Ga0450905_000040_2377_2952 | 191 |
| 521 | 3300042142 | Ga0450905_001001 | Ga0450905_001001_1657_2280 | 191 |
| 522 | 3300042145 | Ga0450906_000993 | Ga0450906_000993_4512_5126 | 191 |
| 523 | 3300042145 | Ga0450906_021069 | Ga0450906_021069_495_1070 | 191 |
| 524 | 3300042146 | Ga0450907_000045 | Ga0450907_000045_9597_10172 | 191 |
| 525 | 3300042146 | Ga0450907_015425 | Ga0450907_015425_198_812 | 191 |
| 526 | 3300042147 | Ga0450910_000052 | Ga0450910_000052_9589_10164 | 191 |
| 527 | 3300042147 | Ga0450910_000272 | Ga0450910_000272_1544_2158 | 191 |
| 528 | 3300042156 | Ga0439446_0001026 | Ga0439446_0001026_3657_4232 | 191 |
| 529 | 3300042156 | Ga0439446_0002040 | Ga0439446_0002040_2871_3485 | 191 |
| 530 | 3300042156 | Ga0439446_0008180 | Ga0439446_0008180_808_1383 | 191 |
| 531 | 3300042156 | Ga0439446_0031134 | Ga0439446_0031134_175_798 | 191 |
| 532 | 3300042184 | Ga0450908_005995 | Ga0450908_005995_1317_1931 | 191 |
| 533 | 3300042185 | Ga0450909_003910 | Ga0450909_003910_240_815 | 191 |
| 534 | 3300042185 | Ga0450909_010971 | Ga0450909_010971_288_863 | 191 |
| 535 | 3300042435 | Ga0439434_0000380 | Ga0439434_0000380_2480_3055 | 191 |
| 536 | 3300042435 | Ga0439434_0004012 | Ga0439434_0004012_1101_1715 | 191 |
| 537 | 3300042435 | Ga0439434_0034768 | Ga0439434_0034768_874_1449 | 191 |
| 538 | 3300042439 | Ga0439464_0000127 | Ga0439464_0000127_9483_10097 | 191 |
| 539 | 3300042461 | Ga0439460_0000179 | Ga0439460_0000179_1908_2522 | 191 |
| 540 | 3300042461 | Ga0439460_0000347 | Ga0439460_0000347_323_898 | 191 |
| 541 | 3300042531 | Ga0450918_002342 | Ga0450918_002342_2054_2668 | 191 |
| 542 | 3300042532 | Ga0450893_0000048 | Ga0450893_0000048_9627_10202 | 191 |
| 543 | 3300042533 | Ga0450901_000343 | Ga0450901_000343_4370_4945 | 191 |
| 544 | 3300042993 | Ga0439440_0000288 | Ga0439440_0000288_4038_4640 | 191 |
| 545 | 3300042993 | Ga0439440_0000405 | Ga0439440_0000405_4463_5077 | 191 |
| 546 | 3300042993 | Ga0439440_0001163 | Ga0439440_0001163_3605_4180 | 191 |
| 547 | 3300042993 | Ga0439440_0055528 | Ga0439440_0055528_144_719 | 191 |
| 548 | 3300046452 | Ga0495617_001033 | Ga0495617_001033_2763_3338 | 191 |
| 549 | 3300046452 | Ga0495617_008359 | Ga0495617_008359_2076_2651 | 191 |
| 550 | 3300046452 | Ga0495617_009834 | Ga0495617_009834_524_1099 | 191 |
| 551 | 3300046452 | Ga0495617_011381 | Ga0495617_011381_1109_1684 | 191 |
| 552 | 3300046452 | Ga0495617_028067 | Ga0495617_028067_271_894 | 191 |
| 553 | 3300046452 | Ga0495617_037290 | Ga0495617_037290_418_1041 | 191 |
| 554 | 3300046452 | Ga0495617_041368 | Ga0495617_041368_905_1480 | 191 |
| 555 | 3300046452 | Ga0495617_110235 | Ga0495617_110235_293_868 | 191 |
| 556 | 3300046453 | Ga0495627_001577 | Ga0495627_001577_2763_3338 | 191 |
| 557 | 3300046453 | Ga0495627_001594 | Ga0495627_001594_2341_2916 | 191 |
| 558 | 3300046453 | Ga0495627_001837 | Ga0495627_001837_1293_1868 | 191 |
| 559 | 3300046453 | Ga0495627_007279 | Ga0495627_007279_1229_1852 | 191 |
| 560 | 3300046453 | Ga0495627_007540 | Ga0495627_007540_2575_3150 | 191 |
| 561 | 3300046453 | Ga0495627_021775 | Ga0495627_021775_399_995 | 191 |
| 562 | 3300046453 | Ga0495627_111760 | Ga0495627_111760_85_660 | 191 |
| 563 | 3300046455 | Ga0495603_0097609 | Ga0495603_0097609_317_892 | 191 |
| 564 | 3300046455 | Ga0495603_0108196 | Ga0495603_0108196_437_1033 | 191 |
| 565 | 3300046455 | Ga0495603_0127989 | Ga0495603_0127989_445_1020 | 191 |
| 566 | 3300046457 | Ga0495590_0000783 | Ga0495590_0000783_9552_10127 | 191 |
| 567 | 3300046457 | Ga0495590_0000855 | Ga0495590_0000855_9654_10229 | 191 |
| 568 | 3300046457 | Ga0495590_0001718 | Ga0495590_0001718_3940_4554 | 191 |
| 569 | 3300046457 | Ga0495590_0042285 | Ga0495590_0042285_716_1291 | 191 |
| 570 | 3300046457 | Ga0495590_0046556 | Ga0495590_0046556_898_1473 | 191 |
| 571 | 3300046457 | Ga0495590_0066234 | Ga0495590_0066234_282_875 | 191 |
| 572 | 3300046458 | Ga0495591_001700 | Ga0495591_001700_2728_3303 | 191 |
| 573 | 3300046458 | Ga0495591_001703 | Ga0495591_001703_9797_10372 | 191 |
| 574 | 3300046458 | Ga0495591_001760 | Ga0495591_001760_9569_10144 | 191 |
| 575 | 3300046458 | Ga0495591_001855 | Ga0495591_001855_9583_10158 | 191 |
| 576 | 3300046458 | Ga0495591_001859 | Ga0495591_001859_9567_10142 | 191 |
| 577 | 3300046458 | Ga0495591_005522 | Ga0495591_005522_3324_3899 | 191 |
| 578 | 3300046458 | Ga0495591_006346 | Ga0495591_006346_2493_3068 | 191 |
| 579 | 3300046458 | Ga0495591_007557 | Ga0495591_007557_2022_2645 | 191 |
| 580 | 3300046458 | Ga0495591_014930 | Ga0495591_014930_105_680 | 191 |
| 581 | 3300046460 | Ga0495638_0002812 | Ga0495638_0002812_9508_10131 | 191 |
| 582 | 3300046460 | Ga0495638_0003070 | Ga0495638_0003070_9586_10161 | 191 |
| 583 | 3300046460 | Ga0495638_0003856 | Ga0495638_0003856_1601_2176 | 191 |
| 584 | 3300046460 | Ga0495638_0006197 | Ga0495638_0006197_2535_3149 | 191 |
| 585 | 3300046460 | Ga0495638_0009585 | Ga0495638_0009585_1508_2083 | 191 |
| 586 | 3300046460 | Ga0495638_0030940 | Ga0495638_0030940_570_1145 | 191 |
| 587 | 3300046460 | Ga0495638_0033591 | Ga0495638_0033591_583_1158 | 191 |
| 588 | 3300046460 | Ga0495638_0084524 | Ga0495638_0084524_135_710 | 191 |
| 589 | 3300046460 | Ga0495638_0133430 | Ga0495638_0133430_735_1310 | 191 |
| 590 | 3300046460 | Ga0495638_0151278 | Ga0495638_0151278_241_816 | 191 |
| 591 | 3300046463 | Ga0495653_0000899 | Ga0495653_0000899_9574_10149 | 191 |
| 592 | 3300046463 | Ga0495653_0024904 | Ga0495653_0024904_3667_4242 | 191 |
| 593 | 3300046463 | Ga0495653_0103518 | Ga0495653_0103518_58_633 | 191 |
| 594 | 3300046471 | Ga0495650_0002513 | Ga0495650_0002513_4217_4792 | 191 |
| 595 | 3300046471 | Ga0495650_0002934 | Ga0495650_0002934_9574_10149 | 191 |
| 596 | 3300046471 | Ga0495650_0003243 | Ga0495650_0003243_9523_10137 | 191 |
| 597 | 3300046471 | Ga0495650_0007254 | Ga0495650_0007254_5331_5906 | 191 |
| 598 | 3300046471 | Ga0495650_0011478 | Ga0495650_0011478_1927_2550 | 191 |
| 599 | 3300046471 | Ga0495650_0019607 | Ga0495650_0019607_1689_2264 | 191 |
| 600 | 3300046472 | Ga0495580_0136934 | Ga0495580_0136934_581_1156 | 191 |
| 601 | 3300046472 | Ga0495580_0294324 | Ga0495580_0294324_122_697 | 191 |
| 602 | 3300046474 | Ga0495605_0002099 | Ga0495605_0002099_2352_2927 | 191 |
| 603 | 3300046474 | Ga0495605_0002641 | Ga0495605_0002641_9547_10161 | 191 |
| 604 | 3300046474 | Ga0495605_0003390 | Ga0495605_0003390_8809_9384 | 191 |
| 605 | 3300046474 | Ga0495605_0005362 | Ga0495605_0005362_6373_6996 | 191 |
| 606 | 3300046474 | Ga0495605_0006075 | Ga0495605_0006075_2675_3250 | 191 |
| 607 | 3300046474 | Ga0495605_0014059 | Ga0495605_0014059_1016_1591 | 191 |
| 608 | 3300046474 | Ga0495605_0136993 | Ga0495605_0136993_467_1042 | 191 |
| 609 | 3300046474 | Ga0495605_0172006 | Ga0495605_0172006_308_883 | 191 |
| 610 | 3300046475 | Ga0495639_0000152 | Ga0495639_0000152_9837_10412 | 191 |
| 611 | 3300046491 | Ga0495584_0000468 | Ga0495584_0000468_17488_18063 | 191 |
| 612 | 3300046491 | Ga0495584_0001549 | Ga0495584_0001549_3897_4520 | 191 |
| 613 | 3300046491 | Ga0495584_0001688 | Ga0495584_0001688_2805_3419 | 191 |
| 614 | 3300046491 | Ga0495584_0001709 | Ga0495584_0001709_9529_10104 | 191 |
| 615 | 3300046491 | Ga0495584_0001838 | Ga0495584_0001838_2166_2780 | 191 |
| 616 | 3300046491 | Ga0495584_0018951 | Ga0495584_0018951_313_888 | 191 |
| 617 | 3300046491 | Ga0495584_0028157 | Ga0495584_0028157_522_1145 | 191 |
| 618 | 3300046491 | Ga0495584_0042422 | Ga0495584_0042422_1242_1817 | 191 |
| 619 | 3300046491 | Ga0495584_0072816 | Ga0495584_0072816_960_1535 | 191 |
| 620 | 3300046491 | Ga0495584_0076065 | Ga0495584_0076065_1073_1648 | 191 |
| 621 | 3300046492 | Ga0495585_0000236 | Ga0495585_0000236_9582_10157 | 191 |
| 622 | 3300046492 | Ga0495585_0002024 | Ga0495585_0002024_9531_10154 | 191 |
| 623 | 3300046492 | Ga0495585_0002613 | Ga0495585_0002613_9480_10055 | 191 |
| 624 | 3300046492 | Ga0495585_0002640 | Ga0495585_0002640_2744_3319 | 191 |
| 625 | 3300046492 | Ga0495585_0002748 | Ga0495585_0002748_9566_10141 | 191 |
| 626 | 3300046492 | Ga0495585_0008744 | Ga0495585_0008744_3285_3908 | 191 |
| 627 | 3300046492 | Ga0495585_0011475 | Ga0495585_0011475_1871_2494 | 191 |
| 628 | 3300046492 | Ga0495585_0011760 | Ga0495585_0011760_1963_2538 | 191 |
| 629 | 3300046492 | Ga0495585_0026890 | Ga0495585_0026890_2041_2616 | 191 |
| 630 | 3300046492 | Ga0495585_0065759 | Ga0495585_0065759_137_751 | 191 |
| 631 | 3300046492 | Ga0495585_0145210 | Ga0495585_0145210_66_641 | 191 |
| 632 | 3300046499 | Ga0495594_0001402 | Ga0495594_0001402_2353_2949 | 191 |
| 633 | 3300046499 | Ga0495594_0005592 | Ga0495594_0005592_2519_3094 | 191 |
| 634 | 3300046499 | Ga0495594_0005762 | Ga0495594_0005762_515_1090 | 191 |
| 635 | 3300046500 | Ga0495596_0001547 | Ga0495596_0001547_2760_3335 | 191 |
| 636 | 3300046500 | Ga0495596_0070385 | Ga0495596_0070385_25_600 | 191 |
| 637 | 3300046501 | Ga0495607_0001160 | Ga0495607_0001160_13706_14281 | 191 |
| 638 | 3300046501 | Ga0495607_0001357 | Ga0495607_0001357_11687_12301 | 191 |
| 639 | 3300046501 | Ga0495607_0003365 | Ga0495607_0003365_2188_2763 | 191 |
| 640 | 3300046501 | Ga0495607_0003368 | Ga0495607_0003368_9371_9994 | 191 |
| 641 | 3300046501 | Ga0495607_0004540 | Ga0495607_0004540_9520_10095 | 191 |
| 642 | 3300046501 | Ga0495607_0005703 | Ga0495607_0005703_2728_3303 | 191 |
| 643 | 3300046501 | Ga0495607_0007076 | Ga0495607_0007076_2555_3130 | 191 |
| 644 | 3300046501 | Ga0495607_0016038 | Ga0495607_0016038_3050_3664 | 191 |
| 645 | 3300046501 | Ga0495607_0023133 | Ga0495607_0023133_1005_1580 | 191 |
| 646 | 3300046501 | Ga0495607_0042908 | Ga0495607_0042908_1892_2467 | 191 |
| 647 | 3300046501 | Ga0495607_0065225 | Ga0495607_0065225_22_597 | 191 |
| 648 | 3300046506 | Ga0495583_0001658 | Ga0495583_0001658_13910_14485 | 191 |
| 649 | 3300046506 | Ga0495583_0002733 | Ga0495583_0002733_9783_10358 | 191 |
| 650 | 3300046506 | Ga0495583_0015629 | Ga0495583_0015629_2528_3103 | 191 |
| 651 | 3300046506 | Ga0495583_0061397 | Ga0495583_0061397_787_1401 | 191 |
| 652 | 3300046506 | Ga0495583_0182518 | Ga0495583_0182518_148_723 | 191 |
| 653 | 3300046507 | Ga0495606_0003435 | Ga0495606_0003435_6985_7560 | 191 |
| 654 | 3300046507 | Ga0495606_0005268 | Ga0495606_0005268_9551_10126 | 191 |
| 655 | 3300046507 | Ga0495606_0005972 | Ga0495606_0005972_9571_10146 | 191 |
| 656 | 3300046507 | Ga0495606_0005985 | Ga0495606_0005985_1276_1851 | 191 |
| 657 | 3300046507 | Ga0495606_0006686 | Ga0495606_0006686_9589_10164 | 191 |
| 658 | 3300046507 | Ga0495606_0047898 | Ga0495606_0047898_69_644 | 191 |
| 659 | 3300046507 | Ga0495606_0180225 | Ga0495606_0180225_345_938 | 191 |
| 660 | 3300046507 | Ga0495606_0244293 | Ga0495606_0244293_39_662 | 191 |
| 661 | 3300046507 | Ga0495606_0397612 | Ga0495606_0397612_85_660 | 191 |
| 662 | 3300046512 | Ga0495610_0003231 | Ga0495610_0003231_9554_10129 | 191 |
| 663 | 3300046512 | Ga0495610_0003619 | Ga0495610_0003619_1699_2274 | 191 |
| 664 | 3300046512 | Ga0495610_0016075 | Ga0495610_0016075_1160_1735 | 191 |
| 665 | 3300046512 | Ga0495610_0023398 | Ga0495610_0023398_962_1585 | 191 |
| 666 | 3300046512 | Ga0495610_0089400 | Ga0495610_0089400_419_994 | 191 |
| 667 | 3300046512 | Ga0495610_0234975 | Ga0495610_0234975_138_713 | 191 |
| 668 | 3300046513 | Ga0495616_0000931 | Ga0495616_0000931_13265_13879 | 191 |
| 669 | 3300046513 | Ga0495616_0001498 | Ga0495616_0001498_9568_10143 | 191 |
| 670 | 3300046513 | Ga0495616_0001947 | Ga0495616_0001947_9162_9785 | 191 |
| 671 | 3300046513 | Ga0495616_0002240 | Ga0495616_0002240_2765_3340 | 191 |
| 672 | 3300046513 | Ga0495616_0002422 | Ga0495616_0002422_2291_2866 | 191 |
| 673 | 3300046513 | Ga0495616_0007298 | Ga0495616_0007298_2167_2742 | 191 |
| 674 | 3300046513 | Ga0495616_0046494 | Ga0495616_0046494_1054_1629 | 191 |
| 675 | 3300046513 | Ga0495616_0098116 | Ga0495616_0098116_388_1011 | 191 |
| 676 | 3300046515 | Ga0495620_0001353 | Ga0495620_0001353_9582_10157 | 191 |
| 677 | 3300046515 | Ga0495620_0003243 | Ga0495620_0003243_1543_2118 | 191 |
| 678 | 3300046515 | Ga0495620_0004042 | Ga0495620_0004042_2196_2771 | 191 |
| 679 | 3300046515 | Ga0495620_0007547 | Ga0495620_0007547_2585_3160 | 191 |
| 680 | 3300046515 | Ga0495620_0009108 | Ga0495620_0009108_1337_1912 | 191 |
| 681 | 3300046515 | Ga0495620_0019684 | Ga0495620_0019684_2712_3287 | 191 |
| 682 | 3300046515 | Ga0495620_0068671 | Ga0495620_0068671_85_660 | 191 |
| 683 | 3300046518 | Ga0495631_0000597 | Ga0495631_0000597_9537_10160 | 191 |
| 684 | 3300046518 | Ga0495631_0001741 | Ga0495631_0001741_2778_3353 | 191 |
| 685 | 3300046518 | Ga0495631_0001855 | Ga0495631_0001855_9644_10219 | 191 |
| 686 | 3300046518 | Ga0495631_0011377 | Ga0495631_0011377_2799_3374 | 191 |
| 687 | 3300046518 | Ga0495631_0014892 | Ga0495631_0014892_1989_2603 | 191 |
| 688 | 3300046518 | Ga0495631_0016414 | Ga0495631_0016414_10_585 | 191 |
| 689 | 3300046518 | Ga0495631_0021886 | Ga0495631_0021886_294_869 | 191 |
| 690 | 3300046518 | Ga0495631_0293977 | Ga0495631_0293977_46_642 | 191 |
| 691 | 3300046519 | Ga0495632_0001382 | Ga0495632_0001382_11470_12045 | 191 |
| 692 | 3300046519 | Ga0495632_0002567 | Ga0495632_0002567_3613_4227 | 191 |
| 693 | 3300046519 | Ga0495632_0002803 | Ga0495632_0002803_2765_3340 | 191 |
| 694 | 3300046519 | Ga0495632_0002906 | Ga0495632_0002906_9837_10412 | 191 |
| 695 | 3300046519 | Ga0495632_0005239 | Ga0495632_0005239_2132_2707 | 191 |
| 696 | 3300046519 | Ga0495632_0005809 | Ga0495632_0005809_5595_6170 | 191 |
| 697 | 3300046519 | Ga0495632_0007448 | Ga0495632_0007448_3540_4163 | 191 |
| 698 | 3300046519 | Ga0495632_0073773 | Ga0495632_0073773_1016_1591 | 191 |
| 699 | 3300046520 | Ga0495637_0001655 | Ga0495637_0001655_2736_3311 | 191 |
| 700 | 3300046520 | Ga0495637_0001705 | Ga0495637_0001705_2572_3147 | 191 |
| 701 | 3300046520 | Ga0495637_0001726 | Ga0495637_0001726_2372_2986 | 191 |
| 702 | 3300046520 | Ga0495637_0001858 | Ga0495637_0001858_9495_10070 | 191 |
| 703 | 3300046520 | Ga0495637_0002370 | Ga0495637_0002370_9555_10130 | 191 |
| 704 | 3300046520 | Ga0495637_0002637 | Ga0495637_0002637_8308_8883 | 191 |
| 705 | 3300046520 | Ga0495637_0002984 | Ga0495637_0002984_759_1373 | 191 |
| 706 | 3300046520 | Ga0495637_0010266 | Ga0495637_0010266_173_748 | 191 |
| 707 | 3300046520 | Ga0495637_0018032 | Ga0495637_0018032_170_793 | 191 |
| 708 | 3300046520 | Ga0495637_0052205 | Ga0495637_0052205_873_1496 | 191 |
| 709 | 3300046520 | Ga0495637_0074995 | Ga0495637_0074995_468_1061 | 191 |
| 710 | 3300046522 | Ga0495643_0003789 | Ga0495643_0003789_2110_2724 | 191 |
| 711 | 3300046522 | Ga0495643_0003918 | Ga0495643_0003918_9349_9924 | 191 |
| 712 | 3300046522 | Ga0495643_0011567 | Ga0495643_0011567_2732_3307 | 191 |
| 713 | 3300046522 | Ga0495643_0023577 | Ga0495643_0023577_1614_2237 | 191 |
| 714 | 3300046522 | Ga0495643_0069451 | Ga0495643_0069451_1216_1791 | 191 |
| 715 | 3300046522 | Ga0495643_0135622 | Ga0495643_0135622_137_712 | 191 |
| 716 | 3300046522 | Ga0495643_0144304 | Ga0495643_0144304_245_820 | 191 |
| 717 | 3300046523 | Ga0495644_0007599 | Ga0495644_0007599_683_1258 | 191 |
| 718 | 3300046523 | Ga0495644_0019085 | Ga0495644_0019085_1395_1970 | 191 |
| 719 | 3300046523 | Ga0495644_0025718 | Ga0495644_0025718_734_1348 | 191 |
| 720 | 3300046524 | Ga0495648_0003611 | Ga0495648_0003611_9246_9821 | 191 |
| 721 | 3300046524 | Ga0495648_0003802 | Ga0495648_0003802_9783_10358 | 191 |
| 722 | 3300046524 | Ga0495648_0003939 | Ga0495648_0003939_9541_10116 | 191 |
| 723 | 3300046524 | Ga0495648_0004313 | Ga0495648_0004313_9659_10234 | 191 |
| 724 | 3300046524 | Ga0495648_0004842 | Ga0495648_0004842_1219_1794 | 191 |
| 725 | 3300046524 | Ga0495648_0014956 | Ga0495648_0014956_3295_3909 | 191 |
| 726 | 3300046524 | Ga0495648_0027537 | Ga0495648_0027537_2751_3374 | 191 |
| 727 | 3300046524 | Ga0495648_0029030 | Ga0495648_0029030_1239_1814 | 191 |
| 728 | 3300046524 | Ga0495648_0033014 | Ga0495648_0033014_1859_2473 | 191 |
| 729 | 3300046524 | Ga0495648_0033669 | Ga0495648_0033669_28_603 | 191 |
| 730 | 3300046524 | Ga0495648_0042477 | Ga0495648_0042477_146_721 | 191 |
| 731 | 3300046524 | Ga0495648_0109928 | Ga0495648_0109928_653_1228 | 191 |
| 732 | 3300046524 | Ga0495648_0214288 | Ga0495648_0214288_141_764 | 191 |
| 733 | 3300046526 | Ga0495666_0002169 | Ga0495666_0002169_2171_2746 | 191 |
| 734 | 3300046526 | Ga0495666_0002936 | Ga0495666_0002936_5911_6486 | 191 |
| 735 | 3300046526 | Ga0495666_0111182 | Ga0495666_0111182_311_886 | 191 |
| 736 | 3300046528 | Ga0495642_0000129 | Ga0495642_0000129_9650_10225 | 191 |
| 737 | 3300046528 | Ga0495642_0000451 | Ga0495642_0000451_9584_10159 | 191 |
| 738 | 3300046528 | Ga0495642_0001117 | Ga0495642_0001117_9548_10162 | 191 |
| 739 | 3300046530 | Ga0495654_0002068 | Ga0495654_0002068_9837_10412 | 191 |
| 740 | 3300046530 | Ga0495654_0002329 | Ga0495654_0002329_2118_2693 | 191 |
| 741 | 3300046530 | Ga0495654_0002570 | Ga0495654_0002570_9478_10101 | 191 |
| 742 | 3300046530 | Ga0495654_0004652 | Ga0495654_0004652_1070_1666 | 191 |
| 743 | 3300046530 | Ga0495654_0006093 | Ga0495654_0006093_419_994 | 191 |
| 744 | 3300046530 | Ga0495654_0016124 | Ga0495654_0016124_1234_1809 | 191 |
| 745 | 3300046530 | Ga0495654_0029803 | Ga0495654_0029803_441_1016 | 191 |
| 746 | 3300046530 | Ga0495654_0070275 | Ga0495654_0070275_747_1322 | 191 |
| 747 | 3300046530 | Ga0495654_0102770 | Ga0495654_0102770_460_1035 | 191 |
| 748 | 3300046530 | Ga0495654_0106405 | Ga0495654_0106405_379_972 | 191 |
| 749 | 3300046530 | Ga0495654_0259165 | Ga0495654_0259165_94_669 | 191 |
| 750 | 3300046536 | Ga0495587_0029164 | Ga0495587_0029164_1426_2001 | 191 |
| 751 | 3300046538 | Ga0495609_0001977 | Ga0495609_0001977_2618_3193 | 191 |
| 752 | 3300046538 | Ga0495609_0001996 | Ga0495609_0001996_2752_3327 | 191 |
| 753 | 3300046538 | Ga0495609_0002213 | Ga0495609_0002213_9445_10020 | 191 |
| 754 | 3300046538 | Ga0495609_0002280 | Ga0495609_0002280_1799_2413 | 191 |
| 755 | 3300046538 | Ga0495609_0002513 | Ga0495609_0002513_9286_9861 | 191 |
| 756 | 3300046538 | Ga0495609_0003524 | Ga0495609_0003524_2048_2623 | 191 |
| 757 | 3300046538 | Ga0495609_0007441 | Ga0495609_0007441_3819_4394 | 191 |
| 758 | 3300046538 | Ga0495609_0007745 | Ga0495609_0007745_3699_4274 | 191 |
| 759 | 3300046538 | Ga0495609_0013478 | Ga0495609_0013478_779_1375 | 191 |
| 760 | 3300046542 | Ga0495597_0000786 | Ga0495597_0000786_15201_15776 | 191 |
| 761 | 3300046542 | Ga0495597_0002195 | Ga0495597_0002195_2668_3243 | 191 |
| 762 | 3300046542 | Ga0495597_0003354 | Ga0495597_0003354_5282_5905 | 191 |
| 763 | 3300046542 | Ga0495597_0008892 | Ga0495597_0008892_1967_2542 | 191 |
| 764 | 3300046542 | Ga0495597_0031312 | Ga0495597_0031312_486_1100 | 191 |
| 765 | 3300046542 | Ga0495597_0104809 | Ga0495597_0104809_282_875 | 191 |
| 766 | 3300046542 | Ga0495597_0132402 | Ga0495597_0132402_121_696 | 191 |
| 767 | 3300046542 | Ga0495597_0216649 | Ga0495597_0216649_121_696 | 191 |
| 768 | 3300046543 | Ga0495645_0004315 | Ga0495645_0004315_7146_7721 | 191 |
| 769 | 3300046557 | Ga0495622_0002101 | Ga0495622_0002101_6391_6966 | 191 |
| 770 | 3300046557 | Ga0495622_0002297 | Ga0495622_0002297_1119_1694 | 191 |
| 771 | 3300046557 | Ga0495622_0002956 | Ga0495622_0002956_1154_1729 | 191 |
| 772 | 3300046557 | Ga0495622_0024203 | Ga0495622_0024203_1840_2436 | 191 |
| 773 | 3300046558 | Ga0495633_0002525 | Ga0495633_0002525_9570_10145 | 191 |
| 774 | 3300046558 | Ga0495633_0003542 | Ga0495633_0003542_1435_2058 | 191 |
| 775 | 3300046558 | Ga0495633_0006568 | Ga0495633_0006568_3883_4458 | 191 |
| 776 | 3300046558 | Ga0495633_0073833 | Ga0495633_0073833_539_1153 | 191 |
| 777 | 3300046615 | Ga0495656_0008102 | Ga0495656_0008102_2653_3228 | 191 |
| 778 | 3300046615 | Ga0495656_0010701 | Ga0495656_0010701_44_619 | 191 |
| 779 | 3300046616 | Ga0495668_0021999 | Ga0495668_0021999_1181_1756 | 191 |
| 780 | 3300046642 | Ga0495634_0000185 | Ga0495634_0000185_9886_10461 | 191 |
| 781 | 3300046642 | Ga0495634_0003382 | Ga0495634_0003382_2692_3267 | 191 |
| 782 | 3300046648 | Ga0495611_0001243 | Ga0495611_0001243_9788_10363 | 191 |
| 783 | 3300046648 | Ga0495611_0001320 | Ga0495611_0001320_10056_10670 | 191 |
| 784 | 3300046648 | Ga0495611_0050624 | Ga0495611_0050624_695_1270 | 191 |
| 785 | 3300046648 | Ga0495611_0057041 | Ga0495611_0057041_706_1281 | 191 |
| 786 | 3300046648 | Ga0495611_0075410 | Ga0495611_0075410_264_839 | 191 |
| 787 | 3300046648 | Ga0495611_0076777 | Ga0495611_0076777_415_990 | 191 |
| 788 | 3300046648 | Ga0495611_0187677 | Ga0495611_0187677_55_630 | 191 |
| 789 | 3300046660 | Ga0495625_0003682 | Ga0495625_0003682_5277_5852 | 191 |
| 790 | 3300046660 | Ga0495625_0004511 | Ga0495625_0004511_2757_3332 | 191 |
| 791 | 3300046660 | Ga0495625_0005198 | Ga0495625_0005198_9583_10158 | 191 |
| 792 | 3300046660 | Ga0495625_0005490 | Ga0495625_0005490_9659_10234 | 191 |
| 793 | 3300046660 | Ga0495625_0022681 | Ga0495625_0022681_1971_2594 | 191 |
| 794 | 3300046660 | Ga0495625_0042362 | Ga0495625_0042362_758_1372 | 191 |
| 795 | 3300046660 | Ga0495625_0049574 | Ga0495625_0049574_975_1550 | 191 |
| 796 | 3300046660 | Ga0495625_0064046 | Ga0495625_0064046_302_877 | 191 |
| 797 | 3300046660 | Ga0495625_0101986 | Ga0495625_0101986_1210_1785 | 191 |
| 798 | 3300046660 | Ga0495625_0171286 | Ga0495625_0171286_594_1169 | 191 |
| 799 | 3300046663 | Ga0495635_0001910 | Ga0495635_0001910_3943_4518 | 191 |
| 800 | 3300046664 | Ga0495659_0000303 | Ga0495659_0000303_9357_9932 | 191 |
| 801 | 3300046664 | Ga0495659_0003514 | Ga0495659_0003514_1935_2549 | 191 |
| 802 | 3300046664 | Ga0495659_0004826 | Ga0495659_0004826_43_618 | 191 |
| 803 | 3300046664 | Ga0495659_0022706 | Ga0495659_0022706_24_638 | 191 |
| 804 | 3300046664 | Ga0495659_0045182 | Ga0495659_0045182_241_816 | 191 |
| 805 | 3300046665 | Ga0495661_0005237 | Ga0495661_0005237_3290_3865 | 191 |
| 806 | 3300046665 | Ga0495661_0006410 | Ga0495661_0006410_2687_3310 | 191 |
| 807 | 3300046665 | Ga0495661_0021670 | Ga0495661_0021670_196_771 | 191 |
| 808 | 3300046665 | Ga0495661_0088665 | Ga0495661_0088665_1070_1645 | 191 |
| 809 | 3300046665 | Ga0495661_0121184 | Ga0495661_0121184_82_657 | 191 |
| 810 | 3300046674 | Ga0495588_0029489 | Ga0495588_0029489_23_598 | 191 |
| 811 | 3300046674 | Ga0495588_0036337 | Ga0495588_0036337_1230_1826 | 191 |
| 812 | 3300046678 | Ga0495599_0118418 | Ga0495599_0118418_806_1381 | 191 |
| 813 | 3300046679 | Ga0495623_0001609 | Ga0495623_0001609_9580_10155 | 191 |
| 814 | 3300046680 | Ga0495646_0017027 | Ga0495646_0017027_3753_4328 | 191 |
| 815 | 3300046680 | Ga0495646_0032005 | Ga0495646_0032005_1637_2212 | 191 |
| 816 | 3300046684 | Ga0495669_0018466 | Ga0495669_0018466_557_1132 | 191 |
| 817 | 3300046684 | Ga0495669_0158834 | Ga0495669_0158834_69_644 | 191 |
| 818 | 3300046689 | Ga0495613_0007193 | Ga0495613_0007193_2749_3324 | 191 |
| 819 | 3300046689 | Ga0495613_0291850 | Ga0495613_0291850_356_931 | 191 |
| 820 | 3300046690 | Ga0495624_0002859 | Ga0495624_0002859_2780_3355 | 191 |
| 821 | 3300046691 | Ga0495670_0001099 | Ga0495670_0001099_2767_3342 | 191 |
| 822 | 3300046691 | Ga0495670_0001137 | Ga0495670_0001137_9553_10149 | 191 |
| 823 | 3300046691 | Ga0495670_0001253 | Ga0495670_0001253_2277_2891 | 191 |
| 824 | 3300046691 | Ga0495670_0011321 | Ga0495670_0011321_2913_3488 | 191 |
| 825 | 3300046691 | Ga0495670_0023333 | Ga0495670_0023333_2406_2981 | 191 |
| 826 | 3300046691 | Ga0495670_0032752 | Ga0495670_0032752_1432_2007 | 191 |
| 827 | 3300046691 | Ga0495670_0271796 | Ga0495670_0271796_83_658 | 191 |
| 828 | 3300046692 | Ga0495671_0001442 | Ga0495671_0001442_9546_10160 | 191 |
| 829 | 3300046692 | Ga0495671_0002093 | Ga0495671_0002093_9509_10084 | 191 |
| 830 | 3300046692 | Ga0495671_0002148 | Ga0495671_0002148_9302_9877 | 191 |
| 831 | 3300046692 | Ga0495671_0002252 | Ga0495671_0002252_9548_10123 | 191 |
| 832 | 3300046692 | Ga0495671_0002985 | Ga0495671_0002985_7626_8201 | 191 |
| 833 | 3300046692 | Ga0495671_0003677 | Ga0495671_0003677_1515_2090 | 191 |
| 834 | 3300046692 | Ga0495671_0115133 | Ga0495671_0115133_281_856 | 191 |
| 835 | 3300046692 | Ga0495671_0226476 | Ga0495671_0226476_16_612 | 191 |
| 836 | 3300046694 | Ga0495649_0000164 | Ga0495649_0000164_9528_10142 | 191 |
| 837 | 3300046694 | Ga0495649_0002274 | Ga0495649_0002274_3491_4066 | 191 |
| 838 | 3300046694 | Ga0495649_0002501 | Ga0495649_0002501_2743_3318 | 191 |
| 839 | 3300046694 | Ga0495649_0008154 | Ga0495649_0008154_2703_3317 | 191 |
| 840 | 3300046694 | Ga0495649_0008266 | Ga0495649_0008266_3623_4246 | 191 |
| 841 | 3300046694 | Ga0495649_0027230 | Ga0495649_0027230_2304_2879 | 191 |
| 842 | 3300046694 | Ga0495649_0050150 | Ga0495649_0050150_737_1312 | 191 |
| 843 | 3300046694 | Ga0495649_0074500 | Ga0495649_0074500_1011_1586 | 191 |
| 844 | 3300046694 | Ga0495649_0086526 | Ga0495649_0086526_268_843 | 191 |
| 845 | 3300046694 | Ga0495649_0088525 | Ga0495649_0088525_424_999 | 191 |
| 846 | 3300046694 | Ga0495649_0088528 | Ga0495649_0088528_653_1228 | 191 |
| 847 | 3300046694 | Ga0495649_0218441 | Ga0495649_0218441_113_706 | 191 |
| 848 | 3300046794 | Ga0495589_0000388 | Ga0495589_0000388_29626_30240 | 191 |
| 849 | 3300046794 | Ga0495589_0001589 | Ga0495589_0001589_2751_3326 | 191 |
| 850 | 3300046794 | Ga0495589_0002221 | Ga0495589_0002221_9571_10146 | 191 |
| 851 | 3300046794 | Ga0495589_0002244 | Ga0495589_0002244_954_1529 | 191 |
| 852 | 3300046794 | Ga0495589_0002403 | Ga0495589_0002403_4726_5301 | 191 |
| 853 | 3300046794 | Ga0495589_0013539 | Ga0495589_0013539_2514_3089 | 191 |
| 854 | 3300046794 | Ga0495589_0032964 | Ga0495589_0032964_423_998 | 191 |
| 855 | 3300046809 | Ga0495600_0022154 | Ga0495600_0022154_2757_3332 | 191 |
| 856 | 3300046810 | Ga0495660_0001783 | Ga0495660_0001783_9191_9766 | 191 |
| 857 | 3300046810 | Ga0495660_0002108 | Ga0495660_0002108_9544_10119 | 191 |
| 858 | 3300046810 | Ga0495660_0002180 | Ga0495660_0002180_2147_2722 | 191 |
| 859 | 3300046810 | Ga0495660_0002294 | Ga0495660_0002294_2166_2741 | 191 |
| 860 | 3300046810 | Ga0495660_0002326 | Ga0495660_0002326_1818_2393 | 191 |
| 861 | 3300046810 | Ga0495660_0002371 | Ga0495660_0002371_1927_2502 | 191 |
| 862 | 3300046810 | Ga0495660_0004585 | Ga0495660_0004585_2126_2701 | 191 |
| 863 | 3300046810 | Ga0495660_0009714 | Ga0495660_0009714_2359_2934 | 191 |
| 864 | 3300046810 | Ga0495660_0012261 | Ga0495660_0012261_2922_3497 | 191 |
| 865 | 3300046810 | Ga0495660_0015137 | Ga0495660_0015137_1280_1855 | 191 |
| 866 | 3300046810 | Ga0495660_0015738 | Ga0495660_0015738_3434_4030 | 191 |
| 867 | 3300046810 | Ga0495660_0024261 | Ga0495660_0024261_1980_2603 | 191 |
| 868 | 3300046810 | Ga0495660_0033494 | Ga0495660_0033494_669_1292 | 191 |
| 869 | 3300046810 | Ga0495660_0038403 | Ga0495660_0038403_1967_2581 | 191 |
| 870 | 3300046810 | Ga0495660_0061248 | Ga0495660_0061248_138_713 | 191 |
| 871 | 3300046810 | Ga0495660_0074623 | Ga0495660_0074623_217_792 | 191 |
| 872 | 3300047315 | Ga0495581_0001624 | Ga0495581_0001624_2377_2952 | 191 |
| 873 | 3300047317 | Ga0495604_0012242 | Ga0495604_0012242_5741_6316 | 191 |
| 874 | 3300047317 | Ga0495604_0015937 | Ga0495604_0015937_1316_1891 | 191 |
| 875 | 3300047318 | Ga0495636_0002752 | Ga0495636_0002752_3227_3841 | 191 |
| 876 | 3300047318 | Ga0495636_0063579 | Ga0495636_0063579_459_1034 | 191 |
| 877 | 3300047318 | Ga0495636_0194538 | Ga0495636_0194538_259_873 | 191 |
| 878 | 3300047319 | Ga0495674_0010090 | Ga0495674_0010090_2700_3275 | 191 |
| 879 | 3300047320 | Ga0495672_0002092 | Ga0495672_0002092_8575_9189 | 191 |
| 880 | 3300047320 | Ga0495672_0003691 | Ga0495672_0003691_2781_3356 | 191 |
| 881 | 3300047320 | Ga0495672_0003740 | Ga0495672_0003740_2620_3195 | 191 |
| 882 | 3300047320 | Ga0495672_0004120 | Ga0495672_0004120_2159_2764 | 191 |
| 883 | 3300047320 | Ga0495672_0006514 | Ga0495672_0006514_8006_8581 | 191 |
| 884 | 3300047320 | Ga0495672_0007461 | Ga0495672_0007461_6074_6649 | 191 |
| 885 | 3300047320 | Ga0495672_0025057 | Ga0495672_0025057_1447_2022 | 191 |
| 886 | 3300047320 | Ga0495672_0027369 | Ga0495672_0027369_1591_2214 | 191 |
| 887 | 3300047320 | Ga0495672_0037126 | Ga0495672_0037126_1294_1869 | 191 |
| 888 | 3300047321 | Ga0495676_0004392 | Ga0495676_0004392_2744_3319 | 191 |
| 889 | 3300047321 | Ga0495676_0004452 | Ga0495676_0004452_2715_3290 | 191 |
| 890 | 3300047322 | Ga0495680_0012927 | Ga0495680_0012927_5221_5796 | 191 |
| 891 | 3300047322 | Ga0495680_0020278 | Ga0495680_0020278_2802_3377 | 191 |
| 892 | 3300047322 | Ga0495680_0026675 | Ga0495680_0026675_3112_3687 | 191 |
| 893 | 3300047323 | Ga0495683_0000730 | Ga0495683_0000730_13688_14311 | 191 |
| 894 | 3300047323 | Ga0495683_0001672 | Ga0495683_0001672_3883_4458 | 191 |
| 895 | 3300047323 | Ga0495683_0002276 | Ga0495683_0002276_2011_2586 | 191 |
| 896 | 3300047323 | Ga0495683_0002987 | Ga0495683_0002987_82_657 | 191 |
| 897 | 3300047323 | Ga0495683_0008455 | Ga0495683_0008455_2487_3062 | 191 |
| 898 | 3300047323 | Ga0495683_0009474 | Ga0495683_0009474_2530_3144 | 191 |
| 899 | 3300047323 | Ga0495683_0015110 | Ga0495683_0015110_1141_1716 | 191 |
| 900 | 3300047323 | Ga0495683_0108192 | Ga0495683_0108192_420_995 | 191 |
| 901 | 3300047323 | Ga0495683_0122419 | Ga0495683_0122419_442_1038 | 191 |
| 902 | 3300047443 | Ga0495687_005151 | Ga0495687_005151_2241_2816 | 191 |
| 903 | 3300047443 | Ga0495687_005862 | Ga0495687_005862_3893_4507 | 191 |
| 904 | 3300047443 | Ga0495687_011281 | Ga0495687_011281_2243_2818 | 191 |
| 905 | 3300047443 | Ga0495687_046477 | Ga0495687_046477_189_764 | 191 |
| 906 | 3300047444 | Ga0495675_0084194 | Ga0495675_0084194_420_995 | 191 |
| 907 | 3300047445 | Ga0495677_0000637 | Ga0495677_0000637_9554_10129 | 191 |
| 908 | 3300047445 | Ga0495677_0041190 | Ga0495677_0041190_829_1443 | 191 |
| 909 | 3300047446 | Ga0495679_001495 | Ga0495679_001495_9916_10491 | 191 |
| 910 | 3300047446 | Ga0495679_001573 | Ga0495679_001573_9560_10135 | 191 |
| 911 | 3300047446 | Ga0495679_004622 | Ga0495679_004622_3854_4429 | 191 |
| 912 | 3300047447 | Ga0495685_003422 | Ga0495685_003422_2938_3552 | 191 |
| 913 | 3300047469 | Ga0495673_0001034 | Ga0495673_0001034_14449_15024 | 191 |
| 914 | 3300047469 | Ga0495673_0002425 | Ga0495673_0002425_2755_3330 | 191 |
| 915 | 3300047469 | Ga0495673_0006993 | Ga0495673_0006993_4028_4642 | 191 |
| 916 | 3300047469 | Ga0495673_0007956 | Ga0495673_0007956_1248_1823 | 191 |
| 917 | 3300047469 | Ga0495673_0011490 | Ga0495673_0011490_1302_1877 | 191 |
| 918 | 3300047469 | Ga0495673_0029492 | Ga0495673_0029492_44_619 | 191 |
| 919 | 3300047469 | Ga0495673_0035386 | Ga0495673_0035386_29_604 | 191 |
| 920 | 3300047469 | Ga0495673_0039796 | Ga0495673_0039796_1284_1859 | 191 |
| 921 | 3300047469 | Ga0495673_0070352 | Ga0495673_0070352_625_1200 | 191 |
| 922 | 3300047470 | Ga0495681_0000806 | Ga0495681_0000806_13725_14300 | 191 |
| 923 | 3300047470 | Ga0495681_0002142 | Ga0495681_0002142_9756_10331 | 191 |
| 924 | 3300047470 | Ga0495681_0002256 | Ga0495681_0002256_9588_10163 | 191 |
| 925 | 3300047470 | Ga0495681_0002454 | Ga0495681_0002454_3119_3694 | 191 |
| 926 | 3300047470 | Ga0495681_0003233 | Ga0495681_0003233_1159_1734 | 191 |
| 927 | 3300047470 | Ga0495681_0006531 | Ga0495681_0006531_3641_4255 | 191 |
| 928 | 3300047470 | Ga0495681_0006833 | Ga0495681_0006833_1293_1916 | 191 |
| 929 | 3300047470 | Ga0495681_0008447 | Ga0495681_0008447_1027_1602 | 191 |
| 930 | 3300047470 | Ga0495681_0009980 | Ga0495681_0009980_2928_3551 | 191 |
| 931 | 3300047470 | Ga0495681_0021924 | Ga0495681_0021924_1795_2370 | 191 |
| 932 | 3300047470 | Ga0495681_0232709 | Ga0495681_0232709_108_683 | 191 |
| 933 | 3300047472 | Ga0495686_0002408 | Ga0495686_0002408_7381_8004 | 191 |
| 934 | 3300047472 | Ga0495686_0003772 | Ga0495686_0003772_9566_10141 | 191 |
| 935 | 3300047472 | Ga0495686_0003919 | Ga0495686_0003919_2458_3033 | 191 |
| 936 | 3300047472 | Ga0495686_0104074 | Ga0495686_0104074_421_996 | 191 |
| 937 | 3300047472 | Ga0495686_0245932 | Ga0495686_0245932_104_679 | 191 |
| 938 | 3300047673 | Ga0495593_0019133 | Ga0495593_0019133_3248_3823 | 191 |
| 939 | 3300047673 | Ga0495593_0021101 | Ga0495593_0021101_324_899 | 191 |
| 940 | 3300048088 | Ga0495602_0005869 | Ga0495602_0005869_2754_3329 | 191 |
| 941 | 3300048088 | Ga0495602_0077931 | Ga0495602_0077931_1254_1829 | 191 |
| 942 | 3300048091 | Ga0495626_0002272 | Ga0495626_0002272_9592_10167 | 191 |
| 943 | 3300048091 | Ga0495626_0002380 | Ga0495626_0002380_2722_3297 | 191 |
| 944 | 3300048091 | Ga0495626_0002569 | Ga0495626_0002569_9528_10142 | 191 |
| 945 | 3300048091 | Ga0495626_0002714 | Ga0495626_0002714_9300_9875 | 191 |
| 946 | 3300048091 | Ga0495626_0002991 | Ga0495626_0002991_1146_1721 | 191 |
| 947 | 3300048091 | Ga0495626_0006133 | Ga0495626_0006133_5507_6082 | 191 |
| 948 | 3300048091 | Ga0495626_0008711 | Ga0495626_0008711_1005_1580 | 191 |
| 949 | 3300048091 | Ga0495626_0148753 | Ga0495626_0148753_232_807 | 191 |
| 950 | 3300048904 | Ga0496101_0499093 | Ga0496101_0499093_47_622 | 191 |
| 951 | 3300048905 | Ga0496102_0000604 | Ga0496102_0000604_27302_27877 | 191 |
| 952 | 3300048906 | Ga0496103_0002176 | Ga0496103_0002176_2321_2896 | 191 |
| 953 | 3300048906 | Ga0496103_0333104 | Ga0496103_0333104_79_654 | 191 |
| 954 | 3300048909 | Ga0496106_0007313 | Ga0496106_0007313_5974_6549 | 191 |
| 955 | 3300048909 | Ga0496106_0522325 | Ga0496106_0522325_49_624 | 191 |
| 956 | 3300048910 | Ga0496107_0046072 | Ga0496107_0046072_2434_3009 | 191 |
| 957 | 3300048914 | Ga0496111_0092207 | Ga0496111_0092207_1080_1655 | 191 |
| 958 | 3300048915 | Ga0496112_0086937 | Ga0496112_0086937_1686_2285 | 191 |
| 959 | 3300048916 | Ga0496113_0725254 | Ga0496113_0725254_26_718 | 191 |
| 960 | 3300048917 | Ga0496114_0440471 | Ga0496114_0440471_453_1028 | 191 |
| 961 | 3300048918 | Ga0496115_0409177 | Ga0496115_0409177_85_660 | 191 |
| 962 | 3300048919 | Ga0496116_0000286 | Ga0496116_0000286_9476_10168 | 191 |
| 963 | 3300048919 | Ga0496116_0000730 | Ga0496116_0000730_31809_32384 | 191 |
| 964 | 3300048919 | Ga0496116_0004436 | Ga0496116_0004436_9576_10151 | 191 |
| 965 | 3300048919 | Ga0496116_0004518 | Ga0496116_0004518_9893_10468 | 191 |
| 966 | 3300048919 | Ga0496116_0004704 | Ga0496116_0004704_9573_10148 | 191 |
| 967 | 3300048920 | Ga0496117_0000773 | Ga0496117_0000773_40235_40927 | 191 |
| 968 | 3300048920 | Ga0496117_0006000 | Ga0496117_0006000_9577_10152 | 191 |
| 969 | 3300048920 | Ga0496117_0019564 | Ga0496117_0019564_3168_3743 | 191 |
| 970 | 3300048920 | Ga0496117_0043804 | Ga0496117_0043804_598_1173 | 191 |
| 971 | 3300048920 | Ga0496117_0055149 | Ga0496117_0055149_181_756 | 191 |
| 972 | 3300048920 | Ga0496117_0058433 | Ga0496117_0058433_2002_2625 | 191 |
| 973 | 3300048920 | Ga0496117_0193059 | Ga0496117_0193059_183_758 | 191 |
| 974 | 3300048921 | Ga0496118_0003842 | Ga0496118_0003842_9662_10237 | 191 |
| 975 | 3300048921 | Ga0496118_0006159 | Ga0496118_0006159_9570_10145 | 191 |
| 976 | 3300048921 | Ga0496118_0007853 | Ga0496118_0007853_9577_10152 | 191 |
| 977 | 3300048921 | Ga0496118_0021304 | Ga0496118_0021304_4744_5319 | 191 |
| 978 | 3300048921 | Ga0496118_0123185 | Ga0496118_0123185_256_948 | 191 |
| 979 | 3300048921 | Ga0496118_0124459 | Ga0496118_0124459_649_1224 | 191 |
| 980 | 3300048922 | Ga0496119_0206963 | Ga0496119_0206963_42_617 | 191 |
| 981 | 3300048923 | Ga0496120_0012545 | Ga0496120_0012545_4565_5140 | 191 |
| 982 | 3300048924 | Ga0496121_0000404 | Ga0496121_0000404_9464_10156 | 191 |
| 983 | 3300048924 | Ga0496121_0007241 | Ga0496121_0007241_9564_10139 | 191 |
| 984 | 3300048924 | Ga0496121_0014324 | Ga0496121_0014324_5402_5977 | 191 |
| 985 | 3300048924 | Ga0496121_0071379 | Ga0496121_0071379_1533_2108 | 191 |
| 986 | 3300048924 | Ga0496121_0099767 | Ga0496121_0099767_459_1034 | 191 |
| 987 | 3300048924 | Ga0496121_0122479 | Ga0496121_0122479_266_862 | 191 |
| 988 | 3300048925 | Ga0496122_0005979 | Ga0496122_0005979_4062_4754 | 191 |
| 989 | 3300048925 | Ga0496122_0006393 | Ga0496122_0006393_3386_3961 | 191 |
| 990 | 3300048925 | Ga0496122_0010516 | Ga0496122_0010516_7267_7842 | 191 |
| 991 | 3300048926 | Ga0496123_0000908 | Ga0496123_0000908_9492_10184 | 191 |
| 992 | 3300048926 | Ga0496123_0005686 | Ga0496123_0005686_5591_6166 | 191 |
| 993 | 3300048926 | Ga0496123_0027389 | Ga0496123_0027389_2441_3016 | 191 |
| 994 | 3300048926 | Ga0496123_0050483 | Ga0496123_0050483_1828_2403 | 191 |
| 995 | 3300048927 | Ga0496124_0020696 | Ga0496124_0020696_4684_5259 | 191 |
| 996 | 3300048927 | Ga0496124_0033789 | Ga0496124_0033789_1845_2420 | 191 |
| 997 | 3300048927 | Ga0496124_0041243 | Ga0496124_0041243_3156_3731 | 191 |
| 998 | 3300048927 | Ga0496124_0045904 | Ga0496124_0045904_2843_3418 | 191 |
| 999 | 3300048927 | Ga0496124_0062162 | Ga0496124_0062162_1268_1843 | 191 |
| 1000 | 3300048927 | Ga0496124_0287774 | Ga0496124_0287774_211_786 | 191 |
| 1001 | 3300048928 | Ga0496125_0014923 | Ga0496125_0014923_2208_2831 | 191 |
| 1002 | 3300048928 | Ga0496125_0033046 | Ga0496125_0033046_1783_2358 | 191 |
| 1003 | 3300048928 | Ga0496125_0034532 | Ga0496125_0034532_758_1354 | 191 |
| 1004 | 3300048929 | Ga0496126_0273102 | Ga0496126_0273102_239_814 | 191 |
| 1005 | 3300048929 | Ga0496126_0670010 | Ga0496126_0670010_190_765 | 191 |
| 1006 | 3300049459 | Ga0495678_002293 | Ga0495678_002293_2758_3333 | 191 |
| 1007 | 3300049459 | Ga0495678_002324 | Ga0495678_002324_2748_3323 | 191 |
| 1008 | 3300049459 | Ga0495678_002486 | Ga0495678_002486_2293_2868 | 191 |
| 1009 | 3300049459 | Ga0495678_002506 | Ga0495678_002506_2224_2838 | 191 |
| 1010 | 3300049459 | Ga0495678_002601 | Ga0495678_002601_9415_9990 | 191 |
| 1011 | 3300049459 | Ga0495678_002835 | Ga0495678_002835_1477_2052 | 191 |
| 1012 | 3300049459 | Ga0495678_004648 | Ga0495678_004648_2278_2892 | 191 |
| 1013 | 3300049459 | Ga0495678_027181 | Ga0495678_027181_550_1125 | 191 |
| 1014 | 3300049459 | Ga0495678_037460 | Ga0495678_037460_189_764 | 191 |
| 1015 | 3300049459 | Ga0495678_039972 | Ga0495678_039972_26_601 | 191 |
| 1016 | 3300049459 | Ga0495678_096941 | Ga0495678_096941_235_858 | 191 |
| 1017 | 3300049459 | Ga0495678_110234 | Ga0495678_110234_291_866 | 191 |
| 1018 | 3300049460 | Ga0495682_0001251 | Ga0495682_0001251_4157_4732 | 191 |
| 1019 | 3300049460 | Ga0495682_0002016 | Ga0495682_0002016_2747_3322 | 191 |
| 1020 | 3300049460 | Ga0495682_0003654 | Ga0495682_0003654_995_1609 | 191 |
| 1021 | 3300049460 | Ga0495682_0005470 | Ga0495682_0005470_2606_3181 | 191 |
| 1022 | 3300049460 | Ga0495682_0011752 | Ga0495682_0011752_1944_2558 | 191 |
| 1023 | 3300049460 | Ga0495682_0106812 | Ga0495682_0106812_191_766 | 191 |
| 1024 | 3300049662 | Ga0501222_000201 | Ga0501222_000201_8100_8675 | 191 |
| 1025 | 3300050489 | nmdc:mga03683_7439_c1 | nmdc:mga03683_7439_c1_402_977 | 191 |
| 1026 | 3300050491 | nmdc:mga00v17_113143_c1 | nmdc:mga00v17_113143_c1_265_840 | 191 |
| 1027 | 3300050491 | nmdc:mga00v17_69459_c1 | nmdc:mga00v17_69459_c1_1041_1616 | 191 |
| 1028 | 3300050514 | nmdc:mga08x19_280063_c1 | nmdc:mga08x19_280063_c1_443_1066 | 191 |
| 1029 | 3300050514 | nmdc:mga08x19_317394_c1 | nmdc:mga08x19_317394_c1_192_767 | 191 |
| 1030 | 3300053111 | Ga0500572_000540 | Ga0500572_000540_9562_10137 | 191 |
| 1031 | 3300053126 | Ga0500621_004535 | Ga0500621_004535_1053_1628 | 191 |
| 1032 | 3300053145 | Ga0500586_007980 | Ga0500586_007980_1212_1787 | 191 |
| 1033 | iso_pu_bacteria | 2599185160 | 2599354694 | 191 |
| 1034 | iso_pu_bacteria | 2599185161 | 2599361496 | 191 |
| 1035 | iso_pu_bacteria | 2599185162 | 2599367818 | 191 |
| 1036 | iso_pu_bacteria | 2599185163 | 2599374608 | 191 |
| 1037 | iso_pu_bacteria | 2599185164 | 2599379801 | 191 |
| 1038 | iso_pu_bacteria | 2599185165 | 2599386247 | 191 |
| 1039 | iso_pu_bacteria | 2599185166 | 2599393466 | 191 |
| 1040 | iso_pu_bacteria | 2599185168 | 2599405233 | 191 |
| 1041 | iso_pu_bacteria | 2599185181 | 2599461528 | 191 |
| 1042 | iso_pu_bacteria | 2599185182 | 2599467449 | 191 |
| 1043 | iso_pu_bacteria | 2599185186 | 2599491378 | 191 |
| 1044 | iso_pu_bacteria | 2599185356 | 2600214146 | 191 |
| 1045 | iso_pu_bacteria | 2600255313 | 2601775149 | 191 |
| 1046 | iso_pu_bacteria | 2667528171 | 2671097275 | 191 |
| 1047 | iso_pu_bacteria | 2818991464 | 2819702374 | 191 |
| 1048 | iso_pu_bacteria | 2935353572 | 2935353575 | 191 |
| 1049 | iso_pu_bacteria | 637000220 | 637318086 | 191 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4xjy-assembly2.cif.gz_C | periplasmic repressor protein yfir | 0.9536 | 41 | 182 |
| 4zhy-assembly1.cif.gz_A | crystal structure of a bacterial signalling complex | 0.9521 | 41 | 186 |
| 4yna-assembly2.cif.gz_D | oxidized yfir | 0.9511 | 39 | 180 |
| 4yn9-assembly1.cif.gz_B | yfir mutant-c110s | 0.9421 | 39 | 184 |
| 4yna-assembly2.cif.gz_D | oxidized yfir | 0.926 | 39 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P64548_29_167_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8594 | 46 | 184 | 3.40.50.2300 |
| af_P64548_29_167_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.848 | 46 | 184 | 3.40.50.2300 |
| af_Q03144_12_224_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.6761 | 67 | 140 | 3.40.50.880 |
| 4pg7A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.667 | 64 | 139 | 3.40.50.720 |
| 4rs3A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.6649 | 67 | 152 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W4XNL2-F1-model_v4 | deleted | 0.9698 | 39 | 190 |
|
| AF-A0A7U9Q3J3-F1-model_v4 | deleted | 0.9677 | 33 | 190 |
|
| AF-A0A024EB96-F1-model_v4 | YfiR family protein | 0.9648 | 33 | 190 |
|
| AF-A0A423E6Y0-F1-model_v4 | deleted | 0.9637 | 33 | 190 |
|
| AF-U6ZVP7-F1-model_v4 | deleted | 0.9621 | 33 | 190 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar