F488993

General Info

Members Datasets Scaffolds Average Seq Length
1048 791 485 317

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1008514|Ga0055536_10085144
Length 346
Sequence MELPLTRHLLKAEIHCHIEGATPPALAAIQAEIYGIDTGKVLRDGAYVWSDFSEFIVCYDAVASLFKTAGDYALLTETYLLELAAANTIYSEIIVSPDHGDRIGLGADAYLAGICDGIHAAREKTGIEARIIVTGERHFGPDRVVSAAEXAARAKXPLVTGFNMAGEERMGRVADYARAFDIARDAGLGLTIHAGEVCGAFSVSDALDLVKPSRIGHGVRAIEDPALVERLAELGIVLEVCPGSNIALNVFPDFDSHPLKRLKAAGVRVCINSDDPPFFHTSLAREYDIASVIMGMPDEEIDAMTRTAIEAAFVDEATRARLIARLDAQSIQPSRSETGDEAASRA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
25 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
26 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
27 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
28 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
29 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516143018 Ensifer sp. BR816 Isolate Nodule
40 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
41 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
42 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
43 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
44 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
45 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
46 2519899620 Rhizobium sp. Pop5 Isolate Nodule
47 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
48 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
49 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
50 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
51 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
52 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
53 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
54 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
55 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
56 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
57 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
58 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
59 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
60 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
61 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
62 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
63 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
64 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
65 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
66 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
67 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
68 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
69 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
70 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
71 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
72 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
73 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
74 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
75 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
76 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
77 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
78 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
79 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
80 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
81 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
82 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
83 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
84 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
85 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
86 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
87 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
88 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
89 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
90 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
91 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
92 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
93 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
94 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
95 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
96 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
97 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
98 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
99 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
100 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
101 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
102 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
103 2643221557 Ensifer sp. Root558 Isolate Unclassified
104 2643221558 Rhizobium sp. Root149 Isolate Unclassified
105 2643221568 Rhizobium sp. Root564 Isolate Unclassified
106 2643221582 Rhizobium sp. Root651 Isolate Unclassified
107 2643221599 Rhizobium sp. Root708 Isolate Unclassified
108 2643221607 Rhizobium sp. Root73 Isolate Unclassified
109 2643221610 Ensifer sp. Root74 Isolate Unclassified
110 2643221618 Ensifer sp. Root231 Isolate Unclassified
111 2643221626 Ensifer sp. Root31 Isolate Unclassified
112 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
113 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
114 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
115 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
116 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
117 2643221655 Ensifer sp. Root1252 Isolate Unclassified
118 2643221659 Ensifer sp. Root127 Isolate Unclassified
119 2643221668 Ensifer sp. Root423 Isolate Unclassified
120 2643221675 Ensifer sp. Root1298 Isolate Unclassified
121 2643221680 Ensifer sp. Root1312 Isolate Unclassified
122 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
123 2643221688 Rhizobium sp. Root482 Isolate Unclassified
124 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
125 2643221693 Rhizobium sp. Root491 Isolate Unclassified
126 2643221698 Ensifer sp. Root142 Isolate Unclassified
127 2643221712 Ensifer sp. Root258 Isolate Unclassified
128 2643221718 Rhizobium sp. Root268 Isolate Unclassified
129 2643221719 Rhizobium sp. Root274 Isolate Unclassified
130 2643221723 Ensifer sp. Root278 Isolate Unclassified
131 2643221726 Ensifer sp. Root954 Isolate Unclassified
132 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
133 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
134 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
135 2718217882 Rhizobium sp. N741 Isolate Nodule
136 2718217927 Rhizobium sp. N324 Isolate Nodule
137 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
138 2718218009 Rhizobium sp. N561 Isolate Nodule
139 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
140 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
141 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
142 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
143 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
144 2718218363 Rhizobium sp. N113 Isolate Nodule
145 2718218365 Rhizobium sp. N731 Isolate Nodule
146 2718218366 Rhizobium sp. N621 Isolate Nodule
147 2718218423 Rhizobium sp. N941 Isolate Nodule
148 2721755514 Rhizobium sp. N6212 Isolate Nodule
149 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
150 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
151 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
152 2721755809 Rhizobium sp. N541 Isolate Nodule
153 2721755810 Rhizobium sp. N871 Isolate Nodule
154 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
155 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
156 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
157 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
158 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
159 2728369365 Rhizobium sp. N1341 Isolate Nodule
160 2728369397 Rhizobium sp. N1314 Isolate Nodule
161 2738541293 Rhizobium sp. GV031 Isolate Unclassified
162 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
163 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
164 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
165 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
166 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
167 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
168 2791355256 Rhizobium sp. M10 Isolate Nodule
169 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
170 2791355260 Rhizobium sp. L9 Isolate Nodule
171 2791355261 Rhizobium sp. J15 Isolate Nodule
172 2791355262 Rhizobium sp. M1 Isolate Nodule
173 2791355263 Rhizobium chutanense C5 Isolate Nodule
174 2791355264 Rhizobium sp. S9 Isolate Nodule
175 2791355265 Rhizobium sp. H4 Isolate Nodule
176 2791355266 Rhizobium sp. L43 Isolate Nodule
177 2791355267 Rhizobium sp. L18 Isolate Nodule
178 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
179 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
180 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
181 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
182 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
183 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
184 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
185 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
186 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
187 2802429633 Rhizobium anhuiense J3 Isolate Nodule
188 2802429634 Rhizobium anhuiense S10 Isolate Nodule
189 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
190 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
191 2802429637 Rhizobium anhuiense C15 Isolate Nodule
192 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
193 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
194 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
195 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
196 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
197 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
198 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
199 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
200 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
201 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
202 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
203 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
204 2838048938 Rhizobium pisi 27/80 Isolate Nodule
205 2838061910 Rhizobium phaseoli L15 Isolate Nodule
206 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
207 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
208 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
209 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
210 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
211 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
212 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
213 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
214 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
215 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
216 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
217 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
218 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
219 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
220 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
221 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
222 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
223 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
224 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
225 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
226 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
227 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
228 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
229 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
230 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
231 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
232 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
233 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
234 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
235 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
236 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
237 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
238 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
239 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
240 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
241 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
242 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
243 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
244 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
245 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
246 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
247 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
248 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
249 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
250 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
251 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
252 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
253 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
254 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
255 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
256 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
257 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
258 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
259 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
260 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
261 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
262 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
263 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
264 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
265 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
266 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
267 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
268 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
269 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
270 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
271 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
272 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
273 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
274 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
275 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
276 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
277 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
278 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
279 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
280 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
281 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
282 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
283 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
284 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
285 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
286 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
287 2844163670 Ensifer sp. 1H6 Isolate Unclassified
288 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
289 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
290 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
291 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
292 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
293 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
294 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
295 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
296 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
297 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
298 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
299 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
300 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
301 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
302 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
303 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
304 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
305 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
306 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
307 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
308 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
309 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
310 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
311 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
312 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
313 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
314 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
315 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
316 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
317 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
318 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
319 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
320 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
321 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
322 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
323 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
324 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
325 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
326 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
327 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
328 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
329 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
330 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
331 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
332 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
333 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
334 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
335 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
336 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
337 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
338 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
339 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
340 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
341 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
342 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
343 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
344 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
345 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
346 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
347 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
348 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
349 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
350 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
351 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
352 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
353 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
354 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
355 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
356 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
357 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
358 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
359 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
360 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
361 2933599457 Rhizobium phaseoli M3 Isolate Nodule
362 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
363 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
364 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
365 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
366 2936381700 Rhizobium chutanense C16 Isolate Unclassified
367 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
368 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
369 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
370 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
371 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
372 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
373 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
374 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
375 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
376 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
377 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
378 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
379 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
380 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
381 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
382 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
383 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
384 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
385 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
386 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
387 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
388 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
389 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
390 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
391 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
392 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
393 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
394 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
395 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
396 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
397 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
398 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
399 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
400 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
401 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
402 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
403 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
404 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
405 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
406 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
407 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
408 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
409 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
410 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
411 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
412 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
413 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
414 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
415 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
416 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
417 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
418 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
419 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
420 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
421 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
422 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
423 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
424 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
425 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
426 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
427 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
428 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
429 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
430 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
431 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
432 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
433 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
434 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
435 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
436 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
437 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
438 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
439 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
440 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
441 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
442 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
443 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
444 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
445 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
446 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
447 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
448 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
449 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
450 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
451 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
452 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
453 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
454 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
455 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
456 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
457 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
458 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
459 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
460 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
461 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
462 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
463 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
464 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
465 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
466 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
467 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
468 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
469 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
470 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
471 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
472 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
473 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
474 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
475 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
476 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
477 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
478 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
479 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
480 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
481 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
482 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
483 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
484 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
485 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
486 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
487 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
488 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
489 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
490 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
491 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
492 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
493 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
494 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
495 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
496 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
497 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
498 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
499 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
500 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
501 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
502 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
503 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
504 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
505 2996887358 Rhizobium sp. R711 Isolate Nodule
506 2996893221 Rhizobium sp. R635 Isolate Nodule
507 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
508 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
509 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
510 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
511 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
512 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
513 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
514 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
515 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
516 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
517 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
518 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
519 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
520 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
521 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
522 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
523 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
524 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
525 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
526 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
527 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
528 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
529 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
530 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
531 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
532 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
533 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
534 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
535 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
536 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
537 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
538 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
539 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
540 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
541 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
542 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
543 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
544 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
545 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
546 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
547 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
548 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
549 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
550 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
551 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
552 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
553 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
554 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
555 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
556 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
557 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
558 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
559 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
560 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
561 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
562 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
563 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
564 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
565 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
566 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
567 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
568 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
569 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
570 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
571 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
572 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
573 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
574 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
575 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
576 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
577 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
578 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
579 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
580 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
581 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
582 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
583 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
584 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
585 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
586 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
587 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
588 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
589 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
590 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
591 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
592 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
593 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
594 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
595 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
596 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
597 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
598 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
599 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
600 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
601 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
602 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
603 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
604 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
605 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
614 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
615 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
616 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
617 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
619 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
620 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
621 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
622 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
623 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
624 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
625 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
626 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
627 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
628 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
629 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
630 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
631 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
632 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
633 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
634 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
635 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
636 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
637 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
638 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
639 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
640 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
641 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
642 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
643 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
644 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
645 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
646 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
647 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
648 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
649 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
650 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
651 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
652 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
653 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
654 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
655 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
656 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
657 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
658 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
659 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
660 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
661 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
662 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
663 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
664 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
665 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
666 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
667 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
668 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
669 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
670 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
671 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
672 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
673 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
674 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
675 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
676 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
677 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
678 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
679 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
680 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
681 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
682 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
683 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
684 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
685 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
686 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
687 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
688 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
689 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
690 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
691 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
692 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
693 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
694 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
695 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
696 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
697 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
698 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
699 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
700 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
701 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
702 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
703 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
704 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
705 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
706 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
707 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
708 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
709 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
710 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
711 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
712 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
713 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
714 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
715 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
716 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
717 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
718 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
719 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
720 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
721 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
722 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
723 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
724 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
725 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
726 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
727 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
728 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
729 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
730 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
731 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
732 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
733 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
734 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
735 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
736 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
737 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
738 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
739 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
740 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
741 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
742 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
743 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
744 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
745 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
746 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
747 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
748 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
749 8005258706 Rhizobium sp. R693 Isolate Nodule
750 8005275841 Rhizobium sp. N4311 Isolate Nodule
751 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
752 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
753 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
754 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
755 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
756 8005321885 Rhizobium sp. R72 Isolate Nodule
757 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
758 8005382845 Rhizobium sp. R634 Isolate Nodule
759 8005395548 Rhizobium sp. R339 Isolate Nodule
760 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
761 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
762 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
763 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
764 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
765 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
766 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
767 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
768 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
769 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
770 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
771 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
772 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
773 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
774 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
775 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
776 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
777 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
778 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
779 8018176218 Rhizobium sp. N122 Isolate Nodule
780 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
781 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
782 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
783 8024501048 Rhizobium sp. H4 Isolate Nodule
784 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
785 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
786 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
787 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
788 8056382006 Rhizobium croatiense 13T Isolate Nodule
789 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
790 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
791 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.09
Metatranscriptomes 0.19
Isolates 53.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 18.61
Nodule 41.03
Rhizoplane 1.43
Rhizosphere 18.99
Stem 0
Stem Tuber 0
Unclassified 19.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000110 3300002704 Bacteria 43893
2 JGI25156J39149_1000192 3300002705 Bacteria 44040
3 JGI25162J39368_1000302 3300002737 Bacteria 45304
4 JGI25162J39368_1001906 3300002737 Bacteria 9562
5 JGI25154J39366_1000196 3300002738 Bacteria 44040
6 JGI25158J39367_1001051 3300002739 Bacteria 5027
7 JGI25158J39367_1009750 3300002739 Bacteria 1310
8 JGI25157J39369_1000228 3300002741 Bacteria 44040
9 JGI25152J39213_1000869 3300002773 Bacteria 14910
10 JGI25152J39213_1002441 3300002773 Bacteria 7070
11 JGI25152J39213_1002981 3300002773 Bacteria 6012
12 JGI25150J39212_1000266 3300002774 Bacteria 27840
13 JGI25150J39212_1006913 3300002774 Bacteria 2308
14 JGI25159J45721_1000023 3300002987 Bacteria 116643
15 JGI25159J45721_1000516 3300002987 Bacteria 17666
16 JGI25159J45721_1004235 3300002987 Bacteria 4831
17 JGI25151J46595_10000355 3300003187 Bacteria 48795
18 JGI25151J46595_10000660 3300003187 Bacteria 29371
19 JGI25151J46595_10008348 3300003187 Bacteria 4989
20 JGI25151J46595_10061657 3300003187 Bacteria 1192
21 JGI25165J46597_1000390 3300003214 Bacteria 46779
22 JGI25165J46597_1001110 3300003214 Bacteria 17044
23 JGI25165J46597_1001741 3300003214 Bacteria 9593
24 JGI25165J46597_1006106 3300003214 Bacteria 2183
25 JGI25153J46596_10003933 3300003215 Bacteria 8143
26 JGI25153J46596_10007137 3300003215 Bacteria 5543
27 JGI25153J46596_10007533 3300003215 Bacteria 5333
28 rootH1_10006497 3300003316 Bacteria 1763
29 rootH2_10025655 3300003320 Bacteria 6336
30 rootL2_10018866 3300003322 Bacteria 9681
31 rootH1_10003510 3300003323 Bacteria 2612
32 rootH1_10036427 3300003323 Bacteria 1893
33 JGI25160J50197_1000044 3300003354 Bacteria 145379
34 JGI25160J50197_1000061 3300003354 Bacteria 116643
35 JGI25160J50197_1014649 3300003354 Bacteria 2612
36 JGI25161J50226_1000028 3300003374 Bacteria 145379
37 JGI25161J50226_1000078 3300003374 Bacteria 83416
38 JGI25161J50226_1000200 3300003374 Bacteria 39159
39 Ga0055539_1008016 3300003752 Bacteria 1328
40 Ga0055526_1002887 3300003771 Bacteria 11326
41 Ga0055526_1011840 3300003771 Bacteria 3873
42 Ga0055524_1000734 3300003775 Bacteria 22502
43 Ga0055524_1002242 3300003775 Bacteria 10122
44 Ga0055524_1003047 3300003775 Bacteria 8294
45 Ga0055524_1005209 3300003775 Bacteria 5847
46 Ga0055524_1022400 3300003775 Bacteria 2065
47 Ga0055536_1006750 3300003781 Bacteria 5259
48 Ga0055536_1008514 3300003781 Bacteria 4397
49 Ga0055528_1000113 3300003790 Bacteria 65323
50 Ga0055528_1001190 3300003790 Bacteria 16795
51 Ga0055528_1005448 3300003790 Bacteria 5930
52 Ga0055528_1011317 3300003790 Bacteria 3555
53 Ga0055528_1016169 3300003790 Bacteria 2654
54 Ga0055528_1023758 3300003790 Bacteria 1858
55 Ga0055530_10008543 3300003791 Bacteria 4084
56 Ga0055540_1001653 3300003792 Bacteria 12938
57 Ga0055540_1007093 3300003792 Bacteria 4301
58 Ga0055540_1020253 3300003792 Bacteria 1765
59 Ga0055531_10007819 3300003794 Bacteria 5756
60 Ga0055531_10008418 3300003794 Bacteria 5441
61 Ga0055543_1000054 3300004625 Bacteria 104176
62 Ga0055543_1000069 3300004625 Bacteria 94040
63 Ga0055543_1000741 3300004625 Bacteria 16504
64 Ga0055543_1002126 3300004625 Bacteria 6861
65 Ga0065165_1000047 3300005262 Bacteria 197811
66 Ga0065165_1000318 3300005262 Bacteria 78352
67 Ga0065165_1007561 3300005262 Bacteria 5303
68 Ga0065165_1008846 3300005262 Bacteria 4625
69 Ga0070670_100000105 3300005331 Bacteria 77938
70 Ga0070668_100255425 3300005347 Bacteria 1456
71 Ga0070669_100028879 3300005353 Bacteria 3995
72 Ga0070667_100115026 3300005367 Bacteria 2336
73 Ga0070667_100321385 3300005367 Bacteria 1396
74 Ga0070665_100025729 3300005548 Bacteria 5928
75 Ga0070665_100033790 3300005548 Bacteria 5145
76 Ga0070665_100065060 3300005548 Bacteria 3658
77 Ga0068854_100080902 3300005578 Bacteria 2398
78 Ga0068852_100009243 3300005616 Bacteria 7301
79 Ga0075365_10007972 3300006038 Bacteria 5974
80 Ga0075365_10019454 3300006038 Bacteria 4192
81 Ga0075365_10040474 3300006038 Bacteria 3039
82 Ga0075368_10016307 3300006042 Bacteria 2769
83 Ga0075363_100010624 3300006048 Bacteria 4382
84 Ga0075364_10000011 3300006051 Bacteria 62606
85 Ga0075364_10059133 3300006051 Bacteria 2512
86 Ga0075362_10001958 3300006177 Bacteria 6764
87 Ga0075362_10027871 3300006177 Bacteria 2421
88 Ga0075367_10011561 3300006178 Bacteria 4677
89 Ga0075369_10001934 3300006186 Bacteria 7277
90 Ga0075369_10010007 3300006186 Bacteria 3703
91 Ga0075369_10029580 3300006186 Bacteria 2302
92 Ga0075369_10051280 3300006186 Bacteria 1786
93 Ga0075369_10088993 3300006186 Bacteria 1376
94 Ga0075366_10005204 3300006195 Bacteria 7040
95 Ga0075366_10018991 3300006195 Bacteria 3973
96 Ga0075370_10000842 3300006353 Bacteria 12429
97 Ga0075370_10017277 3300006353 Bacteria 3897
98 Ga0079104_1000082 3300006946 Bacteria 137722
99 Ga0099826_10017417 3300006948 Bacteria 5425
100 Ga0099826_10026045 3300006948 Bacteria 4321
101 Ga0105251_10082448 3300009011 Bacteria 1485
102 Ga0105244_10068059 3300009036 Bacteria 1780
103 Ga0105244_10104799 3300009036 Bacteria 1380
104 Ga0105240_10001468 3300009093 Bacteria 40305
105 Ga0105248_10121100 3300009177 Bacteria 2951
106 Ga0105237_10004445 3300009545 Bacteria 16237
107 Ga0123341_1000642 3300009765 Bacteria 22722
108 Ga0123342_1010090 3300009766 Bacteria 10966
109 Ga0123342_1021337 3300009766 Bacteria 4563
110 Ga0105239_10109198 3300010375 Bacteria 3065
111 Ga0105246_10159689 3300011119 Bacteria 1716
112 Ga0157373_10015517 3300013100 Bacteria 5570
113 Ga0157371_10000004 3300013102 Bacteria 512593
114 Ga0157371_10176676 3300013102 Bacteria 1527
115 Ga0157370_10001047 3300013104 Bacteria 34825
116 Ga0157370_10001796 3300013104 Bacteria 26445
117 Ga0157370_10128074 3300013104 Bacteria 2369
118 Ga0157369_10138306 3300013105 Bacteria 2578
119 Ga0157369_10298694 3300013105 Bacteria 1675
120 Ga0171463_1001 3300013249 Bacteria 1406070
121 Ga0182008_10031273 3300014497 Bacteria 2680
122 Ga0182007_10002297 3300015262 Bacteria 9621
123 Ga0182005_1025945 3300015265 Bacteria 1599
124 Ga0183363_1185 3300015690 Bacteria 13404
125 Ga0163161_10112287 3300017792 Bacteria 2039
126 Ga0214544_1005567 3300021320 Bacteria 24246
127 Ga0214542_1004334 3300021321 Bacteria 28262
128 Ga0214543_1004000 3300021327 Bacteria 28246
129 Ga0214543_1008948 3300021327 Bacteria 15988
130 Ga0228711_1000006 3300022739 Bacteria 202437
131 Ga0228710_1000004 3300022740 Bacteria 250560
132 Ga0209435_100087 3300025206 Bacteria 44093
133 Ga0209436_100022 3300025208 Bacteria 96695
134 Ga0209436_100213 3300025208 Bacteria 26862
135 Ga0209672_102344 3300025228 Bacteria 4779
136 Ga0209563_108902 3300025230 Bacteria 1554
137 Ga0209437_100050 3300025233 Bacteria 394010
138 Ga0209437_100205 3300025233 Bacteria 115669
139 Ga0207425_1000052 3300025245 Bacteria 162123
140 Ga0207425_1001736 3300025245 Bacteria 8600
141 Ga0207425_1002984 3300025245 Bacteria 5645
142 Ga0209646_1000285 3300025246 Bacteria 44093
143 Ga0209646_1011028 3300025246 Bacteria 1405
144 Ga0209026_1000347 3300025250 Bacteria 44093
145 Ga0209677_100223 3300025253 Bacteria 40538
146 Ga0209759_1000482 3300025256 Bacteria 44093
147 Ga0209129_1000066 3300025258 Bacteria 226820
148 Ga0209129_1000141 3300025258 Bacteria 119150
149 Ga0209129_1001039 3300025258 Bacteria 16421
150 Ga0209129_1001099 3300025258 Bacteria 15766
151 Ga0209129_1001848 3300025258 Bacteria 11206
152 Ga0209129_1004007 3300025258 Bacteria 6042
153 Ga0209233_1000037 3300025261 Bacteria 554620
154 Ga0209233_1000187 3300025261 Bacteria 133091
155 Ga0209233_1000232 3300025261 Bacteria 96361
156 Ga0209673_1000024 3300025273 Bacteria 409632
157 Ga0209673_1000911 3300025273 Bacteria 37766
158 Ga0209673_1002137 3300025273 Bacteria 14721
159 Ga0209673_1002144 3300025273 Bacteria 14664
160 Ga0209673_1002283 3300025273 Bacteria 13700
161 Ga0209673_1003397 3300025273 Bacteria 9438
162 Ga0209673_1008268 3300025273 Bacteria 4649
163 Ga0209130_1000002 3300025284 Bacteria 722648
164 Ga0209130_1000005 3300025284 Bacteria 599620
165 Ga0209130_1000093 3300025284 Bacteria 145707
166 Ga0209676_1003289 3300025292 Bacteria 10132
167 Ga0209676_1008080 3300025292 Bacteria 4778
168 Ga0209025_1000144 3300025294 Bacteria 181446
169 Ga0209025_1000274 3300025294 Bacteria 119322
170 Ga0209025_1000275 3300025294 Bacteria 119220
171 Ga0209025_1000377 3300025294 Bacteria 92728
172 Ga0209025_1000553 3300025294 Bacteria 69760
173 Ga0209025_1000832 3300025294 Bacteria 49004
174 Ga0209025_1004510 3300025294 Bacteria 12026
175 Ga0209025_1006199 3300025294 Bacteria 9388
176 Ga0209025_1011140 3300025294 Bacteria 5983
177 Ga0209564_1000262 3300025295 Bacteria 112256
178 Ga0209564_1000486 3300025295 Bacteria 66011
179 Ga0209564_1000590 3300025295 Bacteria 57280
180 Ga0209564_1009772 3300025295 Bacteria 4510
181 Ga0209564_1010276 3300025295 Bacteria 4333
182 Ga0209564_1031040 3300025295 Bacteria 1642
183 Ga0209758_1000229 3300025297 Bacteria 119657
184 Ga0209758_1000383 3300025297 Bacteria 76487
185 Ga0209758_1000466 3300025297 Bacteria 66920
186 Ga0209758_1000971 3300025297 Bacteria 38600
187 Ga0209758_1001494 3300025297 Bacteria 27240
188 Ga0209758_1003684 3300025297 Bacteria 13618
189 Ga0209758_1034241 3300025297 Bacteria 2024
190 Ga0209758_1037017 3300025297 Bacteria 1893
191 Ga0209050_1005028 3300025298 Bacteria 8579
192 Ga0209256_1000715 3300025299 Bacteria 44055
193 Ga0209256_1000741 3300025299 Bacteria 42804
194 Ga0209256_1000868 3300025299 Bacteria 37527
195 Ga0209256_1003327 3300025299 Bacteria 11402
196 Ga0209256_1006818 3300025299 Bacteria 5889
197 Ga0209256_1007044 3300025299 Bacteria 5695
198 Ga0209256_1007143 3300025299 Bacteria 5625
199 Ga0209256_1016181 3300025299 Bacteria 2560
200 Ga0207426_1000012 3300025302 Bacteria 730942
201 Ga0207426_1000013 3300025302 Bacteria 721897
202 Ga0207426_1000015 3300025302 Bacteria 599316
203 Ga0207426_1000142 3300025302 Bacteria 194023
204 Ga0207426_1002277 3300025302 Bacteria 12665
205 Ga0209051_1000170 3300025303 Bacteria 119026
206 Ga0209051_1000768 3300025303 Bacteria 34059
207 Ga0209051_1002082 3300025303 Bacteria 15092
208 Ga0209051_1007516 3300025303 Bacteria 5940
209 Ga0209051_1017231 3300025303 Bacteria 3234
210 Ga0209051_1031443 3300025303 Bacteria 2042
211 Ga0209257_1001590 3300025304 Bacteria 26075
212 Ga0209257_1006763 3300025304 Bacteria 7225
213 Ga0209257_1007148 3300025304 Bacteria 6862
214 Ga0209257_1009658 3300025304 Bacteria 5100
215 Ga0207695_10000427 3300025913 Bacteria 93089
216 Ga0207671_10002841 3300025914 Bacteria 18002
217 Ga0207681_10185119 3300025923 Bacteria 1589
218 Ga0207650_10000302 3300025925 Bacteria 48702
219 Ga0207668_10051998 3300025972 Bacteria 2833
220 Ga0207640_10056804 3300025981 Bacteria 2572
221 Ga0207658_10083919 3300025986 Bacteria 2450
222 Ga0207678_10125098 3300026067 Bacteria 2193
223 Ga0209281_1000043 3300027111 Bacteria 341543
224 Ga0209281_1000102 3300027111 Bacteria 221665
225 Ga0209281_1000563 3300027111 Bacteria 44757
226 Ga0209371_1000009 3300027312 Bacteria 963030
227 Ga0209371_1000569 3300027312 Bacteria 33436
228 Ga0209371_1000597 3300027312 Bacteria 32346
229 Ga0209371_1002100 3300027312 Bacteria 11818
230 Ga0209282_1000013 3300027666 Bacteria 215053
231 Ga0209282_1019359 3300027666 Bacteria 4321
232 Ga0209282_1028987 3300027666 Bacteria 3423
233 Ga0209813_10003197 3300027866 Bacteria 3818
234 Ga0268266_10023891 3300028379 Bacteria 5202
235 Ga0268266_10031975 3300028379 Bacteria 4471
236 Ga0268266_10080689 3300028379 Bacteria 2835
237 Ga0307515_10000029 3300028794 Bacteria 365410
238 Ga0307515_10011406 3300028794 Bacteria 16865
239 Ga0307515_10066981 3300028794 Bacteria 4962
240 Ga0307515_10176303 3300028794 Bacteria 2107
241 Ga0268256_1000010 3300030500 Bacteria 963034
242 Ga0268256_1003765 3300030500 Bacteria 6646
243 Ga0268256_1004108 3300030500 Bacteria 6211
244 Ga0316181_1026626 3300030744 Bacteria 2110
245 Ga0307513_10000259 3300031456 Bacteria 76155
246 Ga0307513_10028778 3300031456 Bacteria 6346
247 Ga0307405_10001661 3300031731 Bacteria 9477
248 Ga0307410_10149355 3300031852 Bacteria 1738
249 Ga0307406_10007052 3300031901 Bacteria 6223
250 Ga0307412_10007214 3300031911 Bacteria 6306
251 Ga0315914_1000004 3300031967 Bacteria 288534
252 Ga0307409_100052793 3300031995 Bacteria 3119
253 Ga0307411_10051253 3300032005 Bacteria 2692
254 Ga0315913_1000055 3300033430 Bacteria 58182
255 Ga0315915_1000003 3300033464 Bacteria 407996
256 Ga0439436_0004700 3300041404 Bacteria 4190
257 Ga0439466_0022251 3300041411 Bacteria 2239
258 Ga0439465_0007622 3300041413 Bacteria 3434
259 Ga0451833_0456755 3300041491 Bacteria 1498
260 Ga0451835_1253214 3300041492 Bacteria 1740
261 Ga0451837_1046261 3300041494 Bacteria 1329
262 Ga0451841_0687643 3300041498 Bacteria 1807
263 Ga0451846_52794 3300041502 Bacteria 1783
264 Ga0451847_0188426 3300041503 Bacteria 2750
265 Ga0451855_0185000 3300041511 Bacteria 1183
266 Ga0451853_3392256 3300041512 Bacteria 2490
267 Ga0439449_0005847 3300042007 Bacteria 4704
268 Ga0439449_0048031 3300042007 Bacteria 1580
269 Ga0450920_003073 3300042122 Bacteria 2879
270 Ga0450900_007577 3300042136 Bacteria 1340
271 Ga0450906_005256 3300042145 Bacteria 2675
272 Ga0450907_016977 3300042146 Bacteria 1214
273 Ga0450910_003476 3300042147 Bacteria 2092
274 Ga0450918_001915 3300042531 Bacteria 4015
275 Ga0466970_0167965 3300044765 Bacteria 1215
276 Ga0466958_0198311 3300045836 Bacteria 1277
277 Ga0495592_0031923 3300046454 Bacteria 3978
278 Ga0495590_0035188 3300046457 Bacteria 1749
279 Ga0495629_0018425 3300046459 Bacteria 4998
280 Ga0495638_0000566 3300046460 Bacteria 41838
281 Ga0495650_0042907 3300046471 Bacteria 1923
282 Ga0495605_0002376 3300046474 Bacteria 11684
283 Ga0495664_0182327 3300046477 Bacteria 1273
284 Ga0495585_0012817 3300046492 Bacteria 4931
285 Ga0495585_0022306 3300046492 Bacteria 3634
286 Ga0495596_0048569 3300046500 Bacteria 1664
287 Ga0495607_0078801 3300046501 Bacteria 1817
288 Ga0495607_0124258 3300046501 Bacteria 1351
289 Ga0495583_0003929 3300046506 Bacteria 10998
290 Ga0495606_0005067 3300046507 Bacteria 12819
291 Ga0495606_0019688 3300046507 Bacteria 5008
292 Ga0495606_0026688 3300046507 Bacteria 4112
293 Ga0495606_0029657 3300046507 Bacteria 3836
294 Ga0495606_0118313 3300046507 Bacteria 1589
295 Ga0495610_0002136 3300046512 Bacteria 16832
296 Ga0495610_0050802 3300046512 Bacteria 2022
297 Ga0495610_0098729 3300046512 Bacteria 1311
298 Ga0495616_0067571 3300046513 Bacteria 1737
299 Ga0495616_0083124 3300046513 Bacteria 1528
300 Ga0495620_0060368 3300046515 Bacteria 1581
301 Ga0495631_0003763 3300046518 Bacteria 8252
302 Ga0495631_0019236 3300046518 Bacteria 3204
303 Ga0495632_0003799 3300046519 Bacteria 10538
304 Ga0495632_0034060 3300046519 Bacteria 2609
305 Ga0495632_0073112 3300046519 Bacteria 1644
306 Ga0495632_0114669 3300046519 Bacteria 1263
307 Ga0495643_0020419 3300046522 Bacteria 3817
308 Ga0495654_0000314 3300046530 Bacteria 42570
309 Ga0495654_0088198 3300046530 Bacteria 1443
310 Ga0495587_0173957 3300046536 Bacteria 1222
311 Ga0495597_0021051 3300046542 Bacteria 3033
312 Ga0495633_0010640 3300046558 Bacteria 5013
313 Ga0495633_0034902 3300046558 Bacteria 2417
314 Ga0495633_0105620 3300046558 Bacteria 1306
315 Ga0495656_0031901 3300046615 Bacteria 2140
316 Ga0495625_0021354 3300046660 Bacteria 4987
317 Ga0495625_0042441 3300046660 Bacteria 3305
318 Ga0495661_0058054 3300046665 Bacteria 2308
319 Ga0495588_0004481 3300046674 Bacteria 6172
320 Ga0495657_0017857 3300046675 Bacteria 5145
321 Ga0495671_0022472 3300046692 Bacteria 3305
322 Ga0495649_0088662 3300046694 Bacteria 1650
323 Ga0495660_0025205 3300046810 Bacteria 3379
324 Ga0495636_0016035 3300047318 Bacteria 2990
325 Ga0495672_0104297 3300047320 Bacteria 1532
326 Ga0495683_0057414 3300047323 Bacteria 1935
327 Ga0495683_0103844 3300047323 Bacteria 1364
328 Ga0495687_010351 3300047443 Bacteria 5121
329 Ga0495687_017057 3300047443 Bacteria 3636
330 Ga0495673_0046454 3300047469 Bacteria 1924
331 Ga0495681_0024243 3300047470 Bacteria 3201
332 Ga0495681_0081024 3300047470 Bacteria 1449
333 Ga0495686_0002334 3300047472 Bacteria 18121
334 Ga0495686_0005569 3300047472 Bacteria 9905
335 Ga0495686_0033205 3300047472 Bacteria 3334
336 Ga0495686_0036817 3300047472 Bacteria 3139
337 Ga0496102_0021992 3300048905 Bacteria 5648
338 Ga0496102_0044273 3300048905 Bacteria 4039
339 Ga0496104_0342776 3300048907 Bacteria 1407
340 Ga0496105_0378608 3300048908 Bacteria 1126
341 Ga0496106_0006761 3300048909 Bacteria 8490
342 Ga0496106_0196431 3300048909 Bacteria 1605
343 Ga0496110_0238870 3300048913 Bacteria 1653
344 Ga0496116_0000240 3300048919 Bacteria 100232
345 Ga0496116_0008310 3300048919 Bacteria 9020
346 Ga0496116_0017595 3300048919 Bacteria 5539
347 Ga0496116_0019568 3300048919 Bacteria 5180
348 Ga0496116_0042611 3300048919 Bacteria 3100
349 Ga0496116_0049587 3300048919 Bacteria 2805
350 Ga0496116_0054889 3300048919 Bacteria 2621
351 Ga0496116_0168251 3300048919 Bacteria 1191
352 Ga0496116_0191452 3300048919 Bacteria 1082
353 Ga0496117_0000002 3300048920 Bacteria 2483758
354 Ga0496117_0002038 3300048920 Bacteria 26746
355 Ga0496117_0005456 3300048920 Bacteria 13341
356 Ga0496117_0007245 3300048920 Bacteria 10910
357 Ga0496117_0008192 3300048920 Bacteria 9972
358 Ga0496117_0018045 3300048920 Bacteria 5868
359 Ga0496117_0065998 3300048920 Bacteria 2457
360 Ga0496118_0001167 3300048921 Bacteria 40506
361 Ga0496118_0008715 3300048921 Bacteria 10421
362 Ga0496118_0011007 3300048921 Bacteria 8884
363 Ga0496118_0015080 3300048921 Bacteria 7181
364 Ga0496118_0015751 3300048921 Bacteria 6978
365 Ga0496118_0023117 3300048921 Bacteria 5411
366 Ga0496118_0121722 3300048921 Bacteria 1699
367 Ga0496118_0131941 3300048921 Bacteria 1602
368 Ga0496119_0019600 3300048922 Bacteria 4970
369 Ga0496119_0031344 3300048922 Bacteria 3568
370 Ga0496119_0119781 3300048922 Bacteria 1449
371 Ga0496120_0002729 3300048923 Bacteria 17241
372 Ga0496120_0007537 3300048923 Bacteria 8077
373 Ga0496120_0021625 3300048923 Bacteria 4062
374 Ga0496120_0146899 3300048923 Bacteria 1190
375 Ga0496121_0000001 3300048924 Bacteria 1830318
376 Ga0496121_0000426 3300048924 Bacteria 82870
377 Ga0496121_0009474 3300048924 Bacteria 11185
378 Ga0496121_0009970 3300048924 Bacteria 10805
379 Ga0496121_0014274 3300048924 Bacteria 8446
380 Ga0496121_0025871 3300048924 Bacteria 5553
381 Ga0496121_0030224 3300048924 Bacteria 4979
382 Ga0496121_0040587 3300048924 Bacteria 4080
383 Ga0496121_0055947 3300048924 Bacteria 3281
384 Ga0496122_0000001 3300048925 Bacteria 1827766
385 Ga0496122_0000018 3300048925 Bacteria 426350
386 Ga0496122_0000321 3300048925 Bacteria 105353
387 Ga0496122_0016064 3300048925 Bacteria 7114
388 Ga0496122_0022181 3300048925 Bacteria 5654
389 Ga0496122_0023001 3300048925 Bacteria 5515
390 Ga0496122_0023695 3300048925 Bacteria 5397
391 Ga0496122_0023765 3300048925 Bacteria 5387
392 Ga0496122_0031718 3300048925 Bacteria 4388
393 Ga0496122_0064461 3300048925 Bacteria 2665
394 Ga0496122_0100646 3300048925 Bacteria 1933
395 Ga0496122_0101454 3300048925 Bacteria 1922
396 Ga0496122_0156214 3300048925 Bacteria 1399
397 Ga0496123_0000001 3300048926 Bacteria 1831497
398 Ga0496123_0000015 3300048926 Bacteria 426088
399 Ga0496123_0000454 3300048926 Bacteria 72735
400 Ga0496123_0004823 3300048926 Bacteria 13917
401 Ga0496123_0019563 3300048926 Bacteria 5333
402 Ga0496123_0025495 3300048926 Bacteria 4456
403 Ga0496123_0061554 3300048926 Bacteria 2410
404 Ga0496123_0065637 3300048926 Bacteria 2305
405 Ga0496123_0066989 3300048926 Bacteria 2270
406 Ga0496123_0069013 3300048926 Bacteria 2222
407 Ga0496123_0101625 3300048926 Bacteria 1671
408 Ga0496123_0136015 3300048926 Bacteria 1352
409 Ga0496124_0000178 3300048927 Bacteria 126118
410 Ga0496124_0006480 3300048927 Bacteria 12741
411 Ga0496124_0013026 3300048927 Bacteria 8149
412 Ga0496124_0023459 3300048927 Bacteria 5631
413 Ga0496124_0033192 3300048927 Bacteria 4543
414 Ga0496124_0058458 3300048927 Bacteria 3242
415 Ga0496124_0140246 3300048927 Bacteria 1909
416 Ga0496124_0163807 3300048927 Bacteria 1730
417 Ga0496124_0191355 3300048927 Bacteria 1565
418 Ga0496124_0197820 3300048927 Bacteria 1531
419 Ga0496125_0000001 3300048928 Bacteria 1766138
420 Ga0496125_0000628 3300048928 Bacteria 59302
421 Ga0496125_0002093 3300048928 Bacteria 26849
422 Ga0496125_0006658 3300048928 Bacteria 12436
423 Ga0496125_0045441 3300048928 Bacteria 3695
424 Ga0496125_0161085 3300048928 Bacteria 1524
425 Ga0496126_0000322 3300048929 Bacteria 102330
426 Ga0496126_0005535 3300048929 Bacteria 14379
427 Ga0496126_0247322 3300048929 Bacteria 1487
428 Ga0495678_019861 3300049459 Bacteria 2987
429 Ga0495678_022832 3300049459 Bacteria 2730
430 Ga0495678_045372 3300049459 Bacteria 1734
431 Ga0495682_0028987 3300049460 Bacteria 2050
432 Ga0501032_0108682 3300049569 Bacteria 1836
433 Ga0501033_0000260 3300049570 Bacteria 50590
434 Ga0501033_0057659 3300049570 Bacteria 2869
435 Ga0501034_0260892 3300049571 Bacteria 1675
436 Ga0501038_0023801 3300049574 Bacteria 5471
437 Ga0501038_0090395 3300049574 Bacteria 2566
438 Ga0501043_0194452 3300049579 Bacteria 1576
439 Ga0501047_0321063 3300049581 Bacteria 1388
440 Ga0501068_0115454 3300049584 Bacteria 1672
441 Ga0501083_0214200 3300049744 Bacteria 1255
442 Ga0501035_0001226 3300049822 Bacteria 26728
443 Ga0501035_0119927 3300049822 Bacteria 2300
444 Ga0501035_0220168 3300049822 Bacteria 1621
445 nmdc:mga03683_5872_c1 3300050489 Bacteria 4174
446 nmdc:mga03n38_7536_c1 3300050490 Bacteria 3856
447 nmdc:mga00v17_611_c1 3300050491 Bacteria 19769
448 nmdc:mga00v17_71_c1 3300050491 Bacteria 60964
449 nmdc:mga0yw44_149_c1 3300050492 Bacteria 21613
450 nmdc:mga0yw44_183167_c1 3300050492 Bacteria 1379
451 nmdc:mga0yw44_23616_c1 3300050492 Bacteria 3467
452 nmdc:mga0yw44_9713_c1 3300050492 Bacteria 4884
453 nmdc:mga0k408_2459_c1 3300050493 Bacteria 9850
454 nmdc:mga06z11_149024_c1 3300050494 Bacteria 1329
455 nmdc:mga07m45_14826_c1 3300050496 Bacteria 4161
456 nmdc:mga0sz30_16287_c1 3300050516 Bacteria 2950
457 nmdc:mga0sz30_2373_c1 3300050516 Bacteria 6718
458 Ga0495601_0142825 3300053077 Bacteria 1562
459 Ga0500610_0090341 3300053079 Bacteria 1591
460 Ga0495655_0025442 3300053083 Bacteria 1385
461 Ga0500578_0265265 3300053086 Bacteria 1029
462 Ga0500560_000446 3300053107 Bacteria 5689
463 Ga0500572_004466 3300053111 Bacteria 3170
464 Ga0500618_000203 3300053125 Bacteria 47421
465 Ga0500618_001422 3300053125 Bacteria 10688
466 Ga0500618_004472 3300053125 Bacteria 4452
467 Ga0500618_004683 3300053125 Bacteria 4303
468 Ga0500658_0000327 3300053134 Bacteria 21066
469 Ga0500561_0000139 3300053137 Bacteria 14052
470 Ga0500568_0001169 3300053139 Bacteria 17543
471 Ga0500568_0038762 3300053139 Bacteria 1927
472 Ga0500573_0000783 3300053140 Bacteria 14283
473 Ga0500573_0006724 3300053140 Bacteria 6239
474 Ga0500590_002075 3300053148 Bacteria 8678
475 Ga0500604_0041821 3300053151 Bacteria 1387
476 Ga0500616_0000437 3300053153 Bacteria 55094
477 Ga0500616_0002500 3300053153 Bacteria 15220
478 Ga0500616_0036949 3300053153 Bacteria 2646
479 Ga0500622_0002842 3300053156 Bacteria 12134
480 Ga0500624_001239 3300053157 Bacteria 4528
481 Ga0500634_0003970 3300053161 Bacteria 6726
482 Ga0500634_0124182 3300053161 Bacteria 1250
483 Ga0500636_0000036 3300053177 Bacteria 71714
484 Ga0500636_0001307 3300053177 Bacteria 13519
485 Ga0587080_013170 3300059503 Bacteria 1262

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048926 Ga0496123_0101625 Ga0496123_0101625_773_1654 261
2 3300013104 Ga0157370_10128074 Ga0157370_101280743 283
3 3300017792 Ga0163161_10112287 Ga0163161_101122872 284
4 3300005548 Ga0070665_100065060 Ga0070665_1000650602 285
5 3300006946 Ga0079104_1000082 Ga0079104_1000082100 285
6 3300025297 Ga0209758_1034241 Ga0209758_10342412 285
7 3300027111 Ga0209281_1000043 Ga0209281_100004397 285
8 3300028379 Ga0268266_10080689 Ga0268266_100806893 285
9 3300046558 Ga0495633_0034902 Ga0495633_0034902_210_1175 285
10 3300048924 Ga0496121_0009970 Ga0496121_0009970_3871_4863 285
11 3300005262 Ga0065165_1007561 Ga0065165_10075611 286
12 3300046530 Ga0495654_0000314 Ga0495654_0000314_13632_14648 287
13 3300048920 Ga0496117_0008192 Ga0496117_0008192_5720_6703 287
14 3300048923 Ga0496120_0007537 Ga0496120_0007537_6099_7082 287
15 3300048924 Ga0496121_0000001 Ga0496121_0000001_329764_330747 287
16 3300048925 Ga0496122_0022181 Ga0496122_0022181_2993_3976 287
17 3300048926 Ga0496123_0061554 Ga0496123_0061554_144_1127 287
18 3300048927 Ga0496124_0058458 Ga0496124_0058458_2089_3072 287
19 3300048928 Ga0496125_0000001 Ga0496125_0000001_441793_442776 287
20 3300053161 Ga0500634_0003970 Ga0500634_0003970_3551_4564 287
21 3300003187 JGI25151J46595_10008348 JGI25151J46595_100083485 290
22 3300025294 Ga0209025_1000832 Ga0209025_100083237 290
23 3300025297 Ga0209758_1037017 Ga0209758_10370171 290
24 iso_pu_bacteria 2995392953 2995395307 290
25 3300046454 Ga0495592_0031923 Ga0495592_0031923_2367_3314 291
26 3300046459 Ga0495629_0018425 Ga0495629_0018425_533_1480 291
27 3300046507 Ga0495606_0005067 Ga0495606_0005067_8870_9838 291
28 3300046675 Ga0495657_0017857 Ga0495657_0017857_1882_2829 291
29 3300048924 Ga0496121_0025871 Ga0496121_0025871_3824_4792 291
30 3300053077 Ga0495601_0142825 Ga0495601_0142825_536_1483 291
31 3300053148 Ga0500590_002075 Ga0500590_002075_2202_3149 291
32 3300025228 Ga0209672_102344 Ga0209672_1023444 292
33 iso_pu_bacteria 2891048133 2891051044 292
34 3300006038 Ga0075365_10040474 Ga0075365_100404743 293
35 3300006178 Ga0075367_10011561 Ga0075367_100115612 293
36 3300009766 Ga0123342_1010090 Ga0123342_10100902 293
37 iso_pu_bacteria 8005658619 8005661521 293
38 3300010375 Ga0105239_10109198 Ga0105239_101091983 294
39 3300025294 Ga0209025_1000377 Ga0209025_100037746 294
40 3300041491 Ga0451833_0456755 Ga0451833_0456755_234_1190 294
41 3300041494 Ga0451837_1046261 Ga0451837_1046261_154_1110 294
42 3300042007 Ga0439449_0048031 Ga0439449_0048031_299_1255 294
43 3300042136 Ga0450900_007577 Ga0450900_007577_321_1286 294
44 3300044765 Ga0466970_0167965 Ga0466970_0167965_76_1032 294
45 3300045836 Ga0466958_0198311 Ga0466958_0198311_114_1070 294
46 3300046457 Ga0495590_0035188 Ga0495590_0035188_538_1494 294
47 3300046477 Ga0495664_0182327 Ga0495664_0182327_226_1182 294
48 3300046507 Ga0495606_0029657 Ga0495606_0029657_2697_3653 294
49 3300046507 Ga0495606_0118313 Ga0495606_0118313_546_1502 294
50 3300046512 Ga0495610_0098729 Ga0495610_0098729_242_1198 294
51 3300046519 Ga0495632_0034060 Ga0495632_0034060_1617_2573 294
52 3300046522 Ga0495643_0020419 Ga0495643_0020419_1286_2242 294
53 3300046536 Ga0495587_0173957 Ga0495587_0173957_75_1031 294
54 3300046542 Ga0495597_0021051 Ga0495597_0021051_2056_3012 294
55 3300046674 Ga0495588_0004481 Ga0495588_0004481_2173_3138 294
56 3300047323 Ga0495683_0103844 Ga0495683_0103844_366_1322 294
57 3300047443 Ga0495687_010351 Ga0495687_010351_222_1178 294
58 3300047470 Ga0495681_0024243 Ga0495681_0024243_2074_3039 294
59 3300047472 Ga0495686_0033205 Ga0495686_0033205_2057_3013 294
60 3300047472 Ga0495686_0036817 Ga0495686_0036817_1672_2670 294
61 3300048905 Ga0496102_0021992 Ga0496102_0021992_53_1009 294
62 3300048909 Ga0496106_0006761 Ga0496106_0006761_7061_8017 294
63 3300048919 Ga0496116_0049587 Ga0496116_0049587_182_1138 294
64 3300048919 Ga0496116_0054889 Ga0496116_0054889_552_1517 294
65 3300048919 Ga0496116_0191452 Ga0496116_0191452_41_1006 294
66 3300048920 Ga0496117_0000002 Ga0496117_0000002_2407170_2408135 294
67 3300048920 Ga0496117_0005456 Ga0496117_0005456_3678_4634 294
68 3300048920 Ga0496117_0065998 Ga0496117_0065998_31_987 294
69 3300048921 Ga0496118_0001167 Ga0496118_0001167_27452_28417 294
70 3300048921 Ga0496118_0015751 Ga0496118_0015751_3678_4634 294
71 3300048921 Ga0496118_0131941 Ga0496118_0131941_54_1019 294
72 3300048922 Ga0496119_0019600 Ga0496119_0019600_868_1824 294
73 3300048922 Ga0496119_0031344 Ga0496119_0031344_1801_2766 294
74 3300048923 Ga0496120_0002729 Ga0496120_0002729_11997_12962 294
75 3300048923 Ga0496120_0021625 Ga0496120_0021625_1674_2630 294
76 3300048923 Ga0496120_0146899 Ga0496120_0146899_119_1075 294
77 3300048924 Ga0496121_0030224 Ga0496121_0030224_346_1302 294
78 3300048924 Ga0496121_0040587 Ga0496121_0040587_26_982 294
79 3300048924 Ga0496121_0055947 Ga0496121_0055947_2103_3059 294
80 3300048925 Ga0496122_0000001 Ga0496122_0000001_1751178_1752143 294
81 3300048925 Ga0496122_0000321 Ga0496122_0000321_54356_55312 294
82 3300048925 Ga0496122_0023001 Ga0496122_0023001_4473_5429 294
83 3300048925 Ga0496122_0156214 Ga0496122_0156214_189_1145 294
84 3300048926 Ga0496123_0000001 Ga0496123_0000001_1754909_1755874 294
85 3300048926 Ga0496123_0000454 Ga0496123_0000454_50037_50993 294
86 3300048926 Ga0496123_0066989 Ga0496123_0066989_162_1118 294
87 3300048926 Ga0496123_0136015 Ga0496123_0136015_181_1137 294
88 3300048927 Ga0496124_0006480 Ga0496124_0006480_2174_3139 294
89 3300048927 Ga0496124_0140246 Ga0496124_0140246_169_1125 294
90 3300048927 Ga0496124_0191355 Ga0496124_0191355_354_1310 294
91 3300048927 Ga0496124_0197820 Ga0496124_0197820_113_1069 294
92 3300048928 Ga0496125_0000628 Ga0496125_0000628_44463_45419 294
93 3300048928 Ga0496125_0006658 Ga0496125_0006658_8970_9935 294
94 3300048928 Ga0496125_0161085 Ga0496125_0161085_411_1367 294
95 3300048929 Ga0496126_0005535 Ga0496126_0005535_4025_4981 294
96 3300049459 Ga0495678_045372 Ga0495678_045372_192_1190 294
97 3300049569 Ga0501032_0108682 Ga0501032_0108682_112_1068 294
98 3300049570 Ga0501033_0057659 Ga0501033_0057659_279_1235 294
99 3300049571 Ga0501034_0260892 Ga0501034_0260892_287_1243 294
100 3300049574 Ga0501038_0023801 Ga0501038_0023801_596_1552 294
101 3300049574 Ga0501038_0090395 Ga0501038_0090395_1247_2203 294
102 3300049579 Ga0501043_0194452 Ga0501043_0194452_427_1383 294
103 3300049822 Ga0501035_0119927 Ga0501035_0119927_1122_2078 294
104 3300050489 nmdc:mga03683_5872_c1 nmdc:mga03683_5872_c1_1579_2535 294
105 3300050490 nmdc:mga03n38_7536_c1 nmdc:mga03n38_7536_c1_2847_3812 294
106 3300050491 nmdc:mga00v17_611_c1 nmdc:mga00v17_611_c1_12990_13955 294
107 3300050492 nmdc:mga0yw44_149_c1 nmdc:mga0yw44_149_c1_3698_4663 294
108 3300050492 nmdc:mga0yw44_23616_c1 nmdc:mga0yw44_23616_c1_691_1647 294
109 3300050493 nmdc:mga0k408_2459_c1 nmdc:mga0k408_2459_c1_8600_9556 294
110 3300050494 nmdc:mga06z11_149024_c1 nmdc:mga06z11_149024_c1_324_1289 294
111 3300050496 nmdc:mga07m45_14826_c1 nmdc:mga07m45_14826_c1_365_1321 294
112 3300050516 nmdc:mga0sz30_16287_c1 nmdc:mga0sz30_16287_c1_379_1335 294
113 3300050516 nmdc:mga0sz30_2373_c1 nmdc:mga0sz30_2373_c1_3713_4678 294
114 3300053083 Ga0495655_0025442 Ga0495655_0025442_184_1140 294
115 3300053086 Ga0500578_0265265 Ga0500578_0265265_23_979 294
116 3300053107 Ga0500560_000446 Ga0500560_000446_1970_2935 294
117 3300053125 Ga0500618_000203 Ga0500618_000203_31177_32175 294
118 3300053134 Ga0500658_0000327 Ga0500658_0000327_338_1294 294
119 3300053137 Ga0500561_0000139 Ga0500561_0000139_11320_12285 294
120 3300053139 Ga0500568_0038762 Ga0500568_0038762_925_1881 294
121 3300053153 Ga0500616_0036949 Ga0500616_0036949_1286_2242 294
122 3300053157 Ga0500624_001239 Ga0500624_001239_2089_3054 294
123 3300053161 Ga0500634_0124182 Ga0500634_0124182_228_1193 294
124 iso_pu_bacteria 2508501122 2509112199 294
125 iso_pu_bacteria 2509276019 2509379518 294
126 iso_pu_bacteria 2509276021 2509388989 294
127 iso_pu_bacteria 2509276033 2509444579 294
128 iso_pu_bacteria 2510065019 2510135674 294
129 iso_pu_bacteria 2510065057 2510307122 294
130 iso_pu_bacteria 2510461069 2510838866 294
131 iso_pu_bacteria 2510461076 2510897147 294
132 iso_pu_bacteria 2510917022 2511136852 294
133 iso_pu_bacteria 2510917026 2511171038 294
134 iso_pu_bacteria 2510917028 2511185318 294
135 iso_pu_bacteria 2510917030 2511200517 294
136 iso_pu_bacteria 2511231052 2511498731 294
137 iso_pu_bacteria 2512047086 2512534868 294
138 iso_pu_bacteria 2512875026 2512973304 294
139 iso_pu_bacteria 2513237084 2513570835 294
140 iso_pu_bacteria 2513237085 2513574950 294
141 iso_pu_bacteria 2513237086 2513587877 294
142 iso_pu_bacteria 2513237088 2513595621 294
143 iso_pu_bacteria 2513237089 2513603659 294
144 iso_pu_bacteria 2513237091 2513619427 294
145 iso_pu_bacteria 2513237093 2513633734 294
146 iso_pu_bacteria 2513237103 2513707581 294
147 iso_pu_bacteria 2513237138 2513865354 294
148 iso_pu_bacteria 2513237140 2513886025 294
149 iso_pu_bacteria 2513237143 2513904363 294
150 iso_pu_bacteria 2513237144 2513911003 294
151 iso_pu_bacteria 2513237146 2513924311 294
152 iso_pu_bacteria 2513237156 2513983367 294
153 iso_pu_bacteria 2513237159 2513996276 294
154 iso_pu_bacteria 2513237160 2514005899 294
155 iso_pu_bacteria 2513237162 2514024110 294
156 iso_pu_bacteria 2515075009 2515114838 294
157 iso_pu_bacteria 2515154107 2515607171 294
158 iso_pu_bacteria 2515154113 2515635805 294
159 iso_pu_bacteria 2515154114 2515641419 294
160 iso_pu_bacteria 2515154116 2515659308 294
161 iso_pu_bacteria 2515154134 2515741177 294
162 iso_pu_bacteria 2516143018 2516204944 294
163 iso_pu_bacteria 2516653046 2516895010 294
164 iso_pu_bacteria 2516653077 2517038456 294
165 iso_pu_bacteria 2516653085 2517078732 294
166 iso_pu_bacteria 2517093000 2517097474 294
167 iso_pu_bacteria 2517287029 2517408930 294
168 iso_pu_bacteria 2517487022 2517571693 294
169 iso_pu_bacteria 2519899620 2520379176 294
170 iso_pu_bacteria 2524023207 2524452578 294
171 iso_pu_bacteria 2524023209 2524461866 294
172 iso_pu_bacteria 2529292951 2530648339 294
173 iso_pu_bacteria 2534681796 2535514569 294
174 iso_pu_bacteria 2537561587 2537877278 294
175 iso_pu_bacteria 2551306084 2551676003 294
176 iso_pu_bacteria 2551306084 2551682886 294
177 iso_pu_bacteria 2551306085 2551689907 294
178 iso_pu_bacteria 2551306086 2551696294 294
179 iso_pu_bacteria 2551306087 2551703486 294
180 iso_pu_bacteria 2551306089 2551709233 294
181 iso_pu_bacteria 2551306090 2551721936 294
182 iso_pu_bacteria 2551306091 2551729191 294
183 iso_pu_bacteria 2551306092 2551734930 294
184 iso_pu_bacteria 2551306093 2551745168 294
185 iso_pu_bacteria 2554235003 2554246174 294
186 iso_pu_bacteria 2558860100 2558865916 294
187 iso_pu_bacteria 2558860100 2558867631 294
188 iso_pu_bacteria 2558860242 2559293397 294
189 iso_pu_bacteria 2582581283 2585164447 294
190 iso_pu_bacteria 2582581294 2585201289 294
191 iso_pu_bacteria 2582581298 2585223264 294
192 iso_pu_bacteria 2582581299 2585230954 294
193 iso_pu_bacteria 2582581304 2585256429 294
194 iso_pu_bacteria 2582581306 2585264745 294
195 iso_pu_bacteria 2582581307 2585273463 294
196 iso_pu_bacteria 2582581308 2585283175 294
197 iso_pu_bacteria 2582581315 2585328196 294
198 iso_pu_bacteria 2582581316 2585330607 294
199 iso_pu_bacteria 2582581865 2585386186 294
200 iso_pu_bacteria 2582581866 2585394798 294
201 iso_pu_bacteria 2582581867 2585399108 294
202 iso_pu_bacteria 2585427526 2585523953 294
203 iso_pu_bacteria 2585427527 2585536023 294
204 iso_pu_bacteria 2585427528 2585542097 294
205 iso_pu_bacteria 2585427529 2585546140 294
206 iso_pu_bacteria 2585427530 2585556649 294
207 iso_pu_bacteria 2585427531 2585564009 294
208 iso_pu_bacteria 2585427590 2585818742 294
209 iso_pu_bacteria 2585427593 2585840693 294
210 iso_pu_bacteria 2585427594 2585843689 294
211 iso_pu_bacteria 2585427608 2585900323 294
212 iso_pu_bacteria 2585427609 2585909283 294
213 iso_pu_bacteria 2585427633 2585998436 294
214 iso_pu_bacteria 2585427634 2586002999 294
215 iso_pu_bacteria 2585428125 2587984615 294
216 iso_pu_bacteria 2599185156 2599332431 294
217 iso_pu_bacteria 2599185170 2599419731 294
218 iso_pu_bacteria 2599185210 2599604281 294
219 iso_pu_bacteria 2599185352 2600196677 294
220 iso_pu_bacteria 2600255279 2601609583 294
221 iso_pu_bacteria 2600255308 2601746358 294
222 iso_pu_bacteria 2615840624 2616293956 294
223 iso_pu_bacteria 2615840626 2616311182 294
224 iso_pu_bacteria 2615840698 2616556084 294
225 iso_pu_bacteria 2617270742 2617380717 294
226 iso_pu_bacteria 2643221557 2643805651 294
227 iso_pu_bacteria 2643221558 2643812524 294
228 iso_pu_bacteria 2643221568 2643857414 294
229 iso_pu_bacteria 2643221582 2643920554 294
230 iso_pu_bacteria 2643221599 2644004412 294
231 iso_pu_bacteria 2643221607 2644051596 294
232 iso_pu_bacteria 2643221610 2644065826 294
233 iso_pu_bacteria 2643221618 2644103924 294
234 iso_pu_bacteria 2643221626 2644144805 294
235 iso_pu_bacteria 2643221634 2644191210 294
236 iso_pu_bacteria 2643221636 2644200094 294
237 iso_pu_bacteria 2643221637 2644207246 294
238 iso_pu_bacteria 2643221643 2644237670 294
239 iso_pu_bacteria 2643221653 2644298216 294
240 iso_pu_bacteria 2643221655 2644306854 294
241 iso_pu_bacteria 2643221659 2644331045 294
242 iso_pu_bacteria 2643221668 2644380131 294
243 iso_pu_bacteria 2643221675 2644417157 294
244 iso_pu_bacteria 2643221680 2644450553 294
245 iso_pu_bacteria 2643221686 2644480465 294
246 iso_pu_bacteria 2643221688 2644495441 294
247 iso_pu_bacteria 2643221689 2644498805 294
248 iso_pu_bacteria 2643221693 2644519637 294
249 iso_pu_bacteria 2643221698 2644541264 294
250 iso_pu_bacteria 2643221712 2644612465 294
251 iso_pu_bacteria 2643221718 2644650894 294
252 iso_pu_bacteria 2643221719 2644656468 294
253 iso_pu_bacteria 2643221723 2644671338 294
254 iso_pu_bacteria 2643221726 2644693022 294
255 iso_pu_bacteria 2657244999 2657682707 294
256 iso_pu_bacteria 2667528174 2671115831 294
257 iso_pu_bacteria 2690316117 2692319692 294
258 iso_pu_bacteria 2718217882 2719183337 294
259 iso_pu_bacteria 2718217927 2719388097 294
260 iso_pu_bacteria 2718217997 2719667720 294
261 iso_pu_bacteria 2718218009 2719734054 294
262 iso_pu_bacteria 2718218199 2720494140 294
263 iso_pu_bacteria 2718218232 2720615603 294
264 iso_pu_bacteria 2718218233 2720622386 294
265 iso_pu_bacteria 2718218235 2720633740 294
266 iso_pu_bacteria 2718218269 2720777440 294
267 iso_pu_bacteria 2718218363 2721149449 294
268 iso_pu_bacteria 2718218365 2721160852 294
269 iso_pu_bacteria 2718218366 2721166286 294
270 iso_pu_bacteria 2718218423 2721401730 294
271 iso_pu_bacteria 2721755514 2722842456 294
272 iso_pu_bacteria 2721755556 2723029037 294
273 iso_pu_bacteria 2721755684 2723562654 294
274 iso_pu_bacteria 2721755685 2723569347 294
275 iso_pu_bacteria 2721755809 2724040544 294
276 iso_pu_bacteria 2721755810 2724046810 294
277 iso_pu_bacteria 2721755819 2724092047 294
278 iso_pu_bacteria 2721755822 2724106612 294
279 iso_pu_bacteria 2721755823 2724112420 294
280 iso_pu_bacteria 2724679232 2725949662 294
281 iso_pu_bacteria 2728369352 2730109973 294
282 iso_pu_bacteria 2728369365 2730166572 294
283 iso_pu_bacteria 2728369397 2730300484 294
284 iso_pu_bacteria 2738541293 2738800764 294
285 iso_pu_bacteria 2738541317 2738946685 294
286 iso_pu_bacteria 2738541333 2739037346 294
287 iso_pu_bacteria 2765235942 2766067156 294
288 iso_pu_bacteria 2775507049 2776915975 294
289 iso_pu_bacteria 2775507266 2778179512 294
290 iso_pu_bacteria 2791355094 2792643404 294
291 iso_pu_bacteria 2791355256 2793298465 294
292 iso_pu_bacteria 2791355259 2793315695 294
293 iso_pu_bacteria 2791355260 2793323478 294
294 iso_pu_bacteria 2791355261 2793327576 294
295 iso_pu_bacteria 2791355262 2793335647 294
296 iso_pu_bacteria 2791355263 2793341041 294
297 iso_pu_bacteria 2791355264 2793350282 294
298 iso_pu_bacteria 2791355265 2793354777 294
299 iso_pu_bacteria 2791355266 2793358526 294
300 iso_pu_bacteria 2791355267 2793368978 294
301 iso_pu_bacteria 2802428858 2802721233 294
302 iso_pu_bacteria 2802428859 2802724546 294
303 iso_pu_bacteria 2802428860 2802729787 294
304 iso_pu_bacteria 2802428861 2802737133 294
305 iso_pu_bacteria 2802428862 2802746854 294
306 iso_pu_bacteria 2802428863 2802751750 294
307 iso_pu_bacteria 2802429268 2804753929 294
308 iso_pu_bacteria 2802429605 2805928902 294
309 iso_pu_bacteria 2802429606 2805934523 294
310 iso_pu_bacteria 2802429633 2806047073 294
311 iso_pu_bacteria 2802429634 2806054928 294
312 iso_pu_bacteria 2802429635 2806061844 294
313 iso_pu_bacteria 2802429636 2806069633 294
314 iso_pu_bacteria 2802429637 2806075996 294
315 iso_pu_bacteria 2808606387 2808986834 294
316 iso_pu_bacteria 2818991272 2819244203 294
317 iso_pu_bacteria 2818991439 2819556906 294
318 iso_pu_bacteria 2818991448 2819608874 294
319 iso_pu_bacteria 2818991453 2819643300 294
320 iso_pu_bacteria 2818991461 2819685827 294
321 iso_pu_bacteria 2821123053 2821123236 294
322 iso_pu_bacteria 2838016132 2838020947 294
323 iso_pu_bacteria 2838022645 2838026850 294
324 iso_pu_bacteria 2838029111 2838033960 294
325 iso_pu_bacteria 2838035591 2838039736 294
326 iso_pu_bacteria 2838042994 2838044851 294
327 iso_pu_bacteria 2838048938 2838052904 294
328 iso_pu_bacteria 2838061910 2838064697 294
329 iso_pu_bacteria 2838068647 2838070526 294
330 iso_pu_bacteria 2838074704 2838074762 294
331 iso_pu_bacteria 2838661181 2838664014 294
332 iso_pu_bacteria 2838668709 2838672526 294
333 iso_pu_bacteria 2838675328 2838677642 294
334 iso_pu_bacteria 2838680041 2838685589 294
335 iso_pu_bacteria 2838686498 2838689835 294
336 iso_pu_bacteria 2838694306 2838695955 294
337 iso_pu_bacteria 2838701080 2838705151 294
338 iso_pu_bacteria 2838707686 2838713354 294
339 iso_pu_bacteria 2838714209 2838716531 294
340 iso_pu_bacteria 2838719591 2838719669 294
341 iso_pu_bacteria 2838724970 2838727282 294
342 iso_pu_bacteria 2838729681 2838731469 294
343 iso_pu_bacteria 2838736955 2838739741 294
344 iso_pu_bacteria 2838742623 2838744410 294
345 iso_pu_bacteria 2841840854 2841844135 294
346 iso_pu_bacteria 2841846520 2841846600 294
347 iso_pu_bacteria 2841851746 2841852950 294
348 iso_pu_bacteria 2841859092 2841860871 294
349 iso_pu_bacteria 2841864319 2841869118 294
350 iso_pu_bacteria 2842077413 2842082588 294
351 iso_pu_bacteria 2842110456 2842112743 294
352 iso_pu_bacteria 2842118031 2842123853 294
353 iso_pu_bacteria 2842124991 2842127371 294
354 iso_pu_bacteria 2842130223 2842132535 294
355 iso_pu_bacteria 2842140634 2842143856 294
356 iso_pu_bacteria 2842146304 2842150145 294
357 iso_pu_bacteria 2842152218 2842152296 294
358 iso_pu_bacteria 2842156927 2842160277 294
359 iso_pu_bacteria 2842163707 2842165745 294
360 iso_pu_bacteria 2842170452 2842172777 294
361 iso_pu_bacteria 2842175837 2842175915 294
362 iso_pu_bacteria 2842180545 2842184057 294
363 iso_pu_bacteria 2842187318 2842189639 294
364 iso_pu_bacteria 2842192696 2842196359 294
365 iso_pu_bacteria 2842198810 2842202433 294
366 iso_pu_bacteria 2842205361 2842208915 294
367 iso_pu_bacteria 2842211629 2842213953 294
368 iso_pu_bacteria 2842217011 2842219421 294
369 iso_pu_bacteria 2842224351 2842224429 294
370 iso_pu_bacteria 2842229732 2842231639 294
371 iso_pu_bacteria 2842237096 2842242908 294
372 iso_pu_bacteria 2842243621 2842245892 294
373 iso_pu_bacteria 2842250916 2842254831 294
374 iso_pu_bacteria 2842257432 2842260270 294
375 iso_pu_bacteria 2842264693 2842267158 294
376 iso_pu_bacteria 2842271015 2842273681 294
377 iso_pu_bacteria 2842278818 2842282395 294
378 iso_pu_bacteria 2842285085 2842290065 294
379 iso_pu_bacteria 2842291075 2842296981 294
380 iso_pu_bacteria 2842298080 2842299932 294
381 iso_pu_bacteria 2842304105 2842308467 294
382 iso_pu_bacteria 2842311132 2842312229 294
383 iso_pu_bacteria 2842317721 2842321823 294
384 iso_pu_bacteria 2842341865 2842344651 294
385 iso_pu_bacteria 2842357229 2842359546 294
386 iso_pu_bacteria 2842363717 2842367774 294
387 iso_pu_bacteria 2842370503 2842376025 294
388 iso_pu_bacteria 2842377471 2842383235 294
389 iso_pu_bacteria 2842384541 2842390368 294
390 iso_pu_bacteria 2842395702 2842397836 294
391 iso_pu_bacteria 2842402390 2842407675 294
392 iso_pu_bacteria 2842409023 2842414306 294
393 iso_pu_bacteria 2842415677 2842420834 294
394 iso_pu_bacteria 2842422224 2842424140 294
395 iso_pu_bacteria 2842428310 2842431146 294
396 iso_pu_bacteria 2842434925 2842437481 294
397 iso_pu_bacteria 2842441272 2842444296 294
398 iso_pu_bacteria 2842447887 2842451277 294
399 iso_pu_bacteria 2842462802 2842465289 294
400 iso_pu_bacteria 2842469257 2842472242 294
401 iso_pu_bacteria 2842475841 2842480706 294
402 iso_pu_bacteria 2842482326 2842487250 294
403 iso_pu_bacteria 2842489311 2842494113 294
404 iso_pu_bacteria 2842495871 2842501242 294
405 iso_pu_bacteria 2842502639 2842507251 294
406 iso_pu_bacteria 2842509118 2842514525 294
407 iso_pu_bacteria 2842515876 2842517656 294
408 iso_pu_bacteria 2842521101 2842521234 294
409 iso_pu_bacteria 2842922631 2842922699 294
410 iso_pu_bacteria 2844163670 2844164874 294
411 iso_pu_bacteria 2844454524 2844456583 294
412 iso_pu_bacteria 2847417321 2847421083 294
413 iso_pu_bacteria 2848992105 2848995921 294
414 iso_pu_bacteria 2850079185 2850079300 294
415 iso_pu_bacteria 2852387548 2852387869 294
416 iso_pu_bacteria 2854896431 2854900853 294
417 iso_pu_bacteria 2854916844 2854918881 294
418 iso_pu_bacteria 2855825444 2855827643 294
419 iso_pu_bacteria 2855839649 2855843019 294
420 iso_pu_bacteria 2855872281 2855877638 294
421 iso_pu_bacteria 2857516855 2857520879 294
422 iso_pu_bacteria 2857531043 2857533812 294
423 iso_pu_bacteria 2858800743 2858801974 294
424 iso_pu_bacteria 2891373044 2891374800 294
425 iso_pu_bacteria 2896384573 2896386098 294
426 iso_pu_bacteria 2899792073 2899794304 294
427 iso_pu_bacteria 2899803654 2899805881 294
428 iso_pu_bacteria 2899845264 2899845684 294
429 iso_pu_bacteria 2913295892 2913298505 294
430 iso_pu_bacteria 2913308742 2913311957 294
431 iso_pu_bacteria 2915980308 2915983230 294
432 iso_pu_bacteria 2915986958 2915991711 294
433 iso_pu_bacteria 2915993759 2915994211 294
434 iso_pu_bacteria 2916000859 2916002908 294
435 iso_pu_bacteria 2916007675 2916009102 294
436 iso_pu_bacteria 2916014648 2916015145 294
437 iso_pu_bacteria 2916021584 2916022385 294
438 iso_pu_bacteria 2916028427 2916032236 294
439 iso_pu_bacteria 2916035215 2916038133 294
440 iso_pu_bacteria 2916041962 2916042341 294
441 iso_pu_bacteria 2916048683 2916050066 294
442 iso_pu_bacteria 2916055098 2916059030 294
443 iso_pu_bacteria 2916061851 2916063541 294
444 iso_pu_bacteria 2916068649 2916071247 294
445 iso_pu_bacteria 2916076590 2916078523 294
446 iso_pu_bacteria 2919100787 2919101857 294
447 iso_pu_bacteria 2919114240 2919116748 294
448 iso_pu_bacteria 2919166419 2919166607 294
449 iso_pu_bacteria 2919171160 2919172473 294
450 iso_pu_bacteria 2919408235 2919408333 294
451 iso_pu_bacteria 2920760137 2920764047 294
452 iso_pu_bacteria 2920822456 2920822701 294
453 iso_pu_bacteria 2921208531 2921209274 294
454 iso_pu_bacteria 2921237296 2921237626 294
455 iso_pu_bacteria 2921244191 2921245065 294
456 iso_pu_bacteria 2921250672 2921256226 294
457 iso_pu_bacteria 2921257292 2921258729 294
458 iso_pu_bacteria 2921263974 2921268208 294
459 iso_pu_bacteria 2921282425 2921285245 294
460 iso_pu_bacteria 2921289301 2921290023 294
461 iso_pu_bacteria 2923556063 2923556173 294
462 iso_pu_bacteria 2924144063 2924147827 294
463 iso_pu_bacteria 2924150972 2924151890 294
464 iso_pu_bacteria 2924158325 2924164766 294
465 iso_pu_bacteria 2924165586 2924166425 294
466 iso_pu_bacteria 2924172951 2924179685 294
467 iso_pu_bacteria 2924179722 2924180419 294
468 iso_pu_bacteria 2924186466 2924186783 294
469 iso_pu_bacteria 2924193448 2924196269 294
470 iso_pu_bacteria 2924200457 2924204015 294
471 iso_pu_bacteria 2924207177 2924210681 294
472 iso_pu_bacteria 2924214083 2924217219 294
473 iso_pu_bacteria 2924221636 2924222713 294
474 iso_pu_bacteria 2924228884 2924232411 294
475 iso_pu_bacteria 2926754445 2926754758 294
476 iso_pu_bacteria 2926760298 2926761926 294
477 iso_pu_bacteria 2929138655 2929138885 294
478 iso_pu_bacteria 2933006813 2933006943 294
479 iso_pu_bacteria 2933011516 2933015467 294
480 iso_pu_bacteria 2933570622 2933574916 294
481 iso_pu_bacteria 2933586486 2933588368 294
482 iso_pu_bacteria 2933594066 2933594146 294
483 iso_pu_bacteria 2933599457 2933601331 294
484 iso_pu_bacteria 2935894831 2935899973 294
485 iso_pu_bacteria 2935901341 2935902330 294
486 iso_pu_bacteria 2936367885 2936369536 294
487 iso_pu_bacteria 2936375103 2936380277 294
488 iso_pu_bacteria 2936381700 2936385266 294
489 iso_pu_bacteria 2936996657 2936998842 294
490 iso_pu_bacteria 2937002841 2937009362 294
491 iso_pu_bacteria 2937009748 2937015992 294
492 iso_pu_bacteria 2937016420 2937019971 294
493 iso_pu_bacteria 2937023124 2937025567 294
494 iso_pu_bacteria 2937029754 2937032491 294
495 iso_pu_bacteria 2937036028 2937039154 294
496 iso_pu_bacteria 2937049772 2937050414 294
497 iso_pu_bacteria 2937056579 2937060718 294
498 iso_pu_bacteria 2937063883 2937065725 294
499 iso_pu_bacteria 2937071275 2937071752 294
500 iso_pu_bacteria 2937078374 2937084025 294
501 iso_pu_bacteria 2937084907 2937087362 294
502 iso_pu_bacteria 2937091812 2937092292 294
503 iso_pu_bacteria 2937098957 2937106336 294
504 iso_pu_bacteria 2937106411 2937106840 294
505 iso_pu_bacteria 2937113482 2937115962 294
506 iso_pu_bacteria 2937119839 2937125430 294
507 iso_pu_bacteria 2937126314 2937129183 294
508 iso_pu_bacteria 2941499720 2941504159 294
509 iso_pu_bacteria 2957375807 2957378119 294
510 iso_pu_bacteria 2957382221 2957388105 294
511 iso_pu_bacteria 2957388812 2957394282 294
512 iso_pu_bacteria 2957395598 2957401613 294
513 iso_pu_bacteria 2957402308 2957404980 294
514 iso_pu_bacteria 2957408893 2957411919 294
515 iso_pu_bacteria 2957415311 2957417159 294
516 iso_pu_bacteria 2957422303 2957423067 294
517 iso_pu_bacteria 2957430029 2957432985 294
518 iso_pu_bacteria 2957437181 2957439262 294
519 iso_pu_bacteria 2957443900 2957446596 294
520 iso_pu_bacteria 2957450854 2957451425 294
521 iso_pu_bacteria 2957457609 2957458239 294
522 iso_pu_bacteria 2957464669 2957467705 294
523 iso_pu_bacteria 2957471148 2957477923 294
524 iso_pu_bacteria 2957478035 2957484107 294
525 iso_pu_bacteria 2957484790 2957486998 294
526 iso_pu_bacteria 2957491536 2957493868 294
527 iso_pu_bacteria 2957498199 2957505446 294
528 iso_pu_bacteria 2957505466 2957506149 294
529 iso_pu_bacteria 2960584000 2960584692 294
530 iso_pu_bacteria 2960591022 2960593066 294
531 iso_pu_bacteria 2960597568 2960601197 294
532 iso_pu_bacteria 2960603979 2960610819 294
533 iso_pu_bacteria 2960610863 2960612254 294
534 iso_pu_bacteria 2960617483 2960620277 294
535 iso_pu_bacteria 2960624210 2960625994 294
536 iso_pu_bacteria 2960631154 2960635475 294
537 iso_pu_bacteria 2960637947 2960638599 294
538 iso_pu_bacteria 2960645483 2960645929 294
539 iso_pu_bacteria 2960652885 2960658723 294
540 iso_pu_bacteria 2960660292 2960663107 294
541 iso_pu_bacteria 2960667422 2960673463 294
542 iso_pu_bacteria 2960674078 2960680595 294
543 iso_pu_bacteria 2960680706 2960683837 294
544 iso_pu_bacteria 2960687367 2960689251 294
545 iso_pu_bacteria 2960693952 2960697070 294
546 iso_pu_bacteria 2964607997 2964612232 294
547 iso_pu_bacteria 2964615318 2964616393 294
548 iso_pu_bacteria 2964621998 2964623721 294
549 iso_pu_bacteria 2964628898 2964632067 294
550 iso_pu_bacteria 2964636051 2964640448 294
551 iso_pu_bacteria 2964643177 2964649499 294
552 iso_pu_bacteria 2964649959 2964655902 294
553 iso_pu_bacteria 2964656573 2964657885 294
554 iso_pu_bacteria 2964663802 2964667448 294
555 iso_pu_bacteria 2964670856 2964674232 294
556 iso_pu_bacteria 2964678106 2964678831 294
557 iso_pu_bacteria 2964685014 2964687839 294
558 iso_pu_bacteria 2964691889 2964692229 294
559 iso_pu_bacteria 2964698721 2964702338 294
560 iso_pu_bacteria 2964705432 2964708164 294
561 iso_pu_bacteria 2964712639 2964717444 294
562 iso_pu_bacteria 2964719344 2964720006 294
563 iso_pu_bacteria 2967664464 2967666234 294
564 iso_pu_bacteria 2967671571 2967672096 294
565 iso_pu_bacteria 2967678726 2967679148 294
566 iso_pu_bacteria 2967686174 2967688351 294
567 iso_pu_bacteria 2967693043 2967695738 294
568 iso_pu_bacteria 2967699805 2967701539 294
569 iso_pu_bacteria 2967706974 2967711282 294
570 iso_pu_bacteria 2967714385 2967720659 294
571 iso_pu_bacteria 2967721400 2967728531 294
572 iso_pu_bacteria 2967728569 2967733916 294
573 iso_pu_bacteria 2967735183 2967741589 294
574 iso_pu_bacteria 2967742019 2967748888 294
575 iso_pu_bacteria 2967748971 2967755074 294
576 iso_pu_bacteria 2967755722 2967756419 294
577 iso_pu_bacteria 2967762386 2967765349 294
578 iso_pu_bacteria 2967769361 2967773049 294
579 iso_pu_bacteria 2967775926 2967777385 294
580 iso_pu_bacteria 2970019648 2970020108 294
581 iso_pu_bacteria 2970026789 2970028842 294
582 iso_pu_bacteria 2970033650 2970036216 294
583 iso_pu_bacteria 2970040964 2970047517 294
584 iso_pu_bacteria 2970047711 2970054268 294
585 iso_pu_bacteria 2970054988 2970061481 294
586 iso_pu_bacteria 2970061556 2970062233 294
587 iso_pu_bacteria 2970068827 2970074344 294
588 iso_pu_bacteria 2970076120 2970080261 294
589 iso_pu_bacteria 2970082768 2970087624 294
590 iso_pu_bacteria 2970095765 2970097873 294
591 iso_pu_bacteria 2970102677 2970104360 294
592 iso_pu_bacteria 2970109326 2970111777 294
593 iso_pu_bacteria 2970116247 2970121965 294
594 iso_pu_bacteria 2970122695 2970122879 294
595 iso_pu_bacteria 2970129317 2970132286 294
596 iso_pu_bacteria 2970136068 2970137761 294
597 iso_pu_bacteria 2970143518 2970145404 294
598 iso_pu_bacteria 2970149975 2970156637 294
599 iso_pu_bacteria 2970156795 2970157745 294
600 iso_pu_bacteria 2970164137 2970170263 294
601 iso_pu_bacteria 2970170962 2970174573 294
602 iso_pu_bacteria 2970177841 2970184357 294
603 iso_pu_bacteria 2970184632 2970185253 294
604 iso_pu_bacteria 2970191845 2970198816 294
605 iso_pu_bacteria 2977516862 2977522241 294
606 iso_pu_bacteria 2977523885 2977525666 294
607 iso_pu_bacteria 2977530762 2977530799 294
608 iso_pu_bacteria 2977537788 2977540709 294
609 iso_pu_bacteria 2977544691 2977546826 294
610 iso_pu_bacteria 2977551784 2977558239 294
611 iso_pu_bacteria 2977558990 2977560986 294
612 iso_pu_bacteria 2977565890 2977568771 294
613 iso_pu_bacteria 2977572785 2977579281 294
614 iso_pu_bacteria 2977579622 2977582577 294
615 iso_pu_bacteria 2978969890 2978972996 294
616 iso_pu_bacteria 2979089926 2979092807 294
617 iso_pu_bacteria 2979095461 2979099804 294
618 iso_pu_bacteria 2979100975 2979104779 294
619 iso_pu_bacteria 2984509177 2984513421 294
620 iso_pu_bacteria 2984518228 2984520211 294
621 iso_pu_bacteria 2984537506 2984539507 294
622 iso_pu_bacteria 2984587000 2984591244 294
623 iso_pu_bacteria 2984601300 2984601734 294
624 iso_pu_bacteria 2989349275 2989351974 294
625 iso_pu_bacteria 2989776772 2989776826 294
626 iso_pu_bacteria 2996887358 2996887960 294
627 iso_pu_bacteria 2996893221 2996897604 294
628 iso_pu_bacteria 3003930520 3003931337 294
629 iso_pu_bacteria 3005409236 3005410640 294
630 iso_pu_bacteria 3005416602 3005423292 294
631 iso_pu_bacteria 3005445848 3005450101 294
632 iso_pu_bacteria 3005452660 3005456327 294
633 iso_pu_bacteria 639633055 639646073 294
634 iso_pu_bacteria 648276728 648741790 294
635 iso_pu_bacteria 650716007 650738633 294
636 iso_pu_bacteria 8003570095 8003572179 294
637 iso_pu_bacteria 8003992118 8003995598 294
638 iso_pu_bacteria 8003999396 8004003365 294
639 iso_pu_bacteria 8005246636 8005247891 294
640 iso_pu_bacteria 8005258706 8005261474 294
641 iso_pu_bacteria 8005275841 8005278299 294
642 iso_pu_bacteria 8005282627 8005282667 294
643 iso_pu_bacteria 8005289223 8005291643 294
644 iso_pu_bacteria 8005301065 8005305484 294
645 iso_pu_bacteria 8005307578 8005310260 294
646 iso_pu_bacteria 8005314921 8005315619 294
647 iso_pu_bacteria 8005321885 8005322487 294
648 iso_pu_bacteria 8005376324 8005378093 294
649 iso_pu_bacteria 8005382845 8005384103 294
650 iso_pu_bacteria 8005395548 8005399619 294
651 iso_pu_bacteria 8005430974 8005433788 294
652 iso_pu_bacteria 8005460587 8005465534 294
653 iso_pu_bacteria 8005484373 8005484472 294
654 iso_pu_bacteria 8005497431 8005498117 294
655 iso_pu_bacteria 8005542996 8005543226 294
656 iso_pu_bacteria 8005556819 8005559984 294
657 iso_pu_bacteria 8005563573 8005564521 294
658 iso_pu_bacteria 8005570704 8005571208 294
659 iso_pu_bacteria 8005619151 8005619326 294
660 iso_pu_bacteria 8005626139 8005627891 294
661 iso_pu_bacteria 8005645114 8005647392 294
662 iso_pu_bacteria 8005668836 8005669525 294
663 iso_pu_bacteria 8005682033 8005687452 294
664 iso_pu_bacteria 8005688590 8005692763 294
665 iso_pu_bacteria 8005695170 8005701452 294
666 iso_pu_bacteria 8018127388 8018132542 294
667 iso_pu_bacteria 8018150411 8018153932 294
668 iso_pu_bacteria 8018163183 8018167598 294
669 iso_pu_bacteria 8018176218 8018176611 294
670 iso_pu_bacteria 8023680758 8023681263 294
671 iso_pu_bacteria 8024479707 8024481906 294
672 iso_pu_bacteria 8024486573 8024488586 294
673 iso_pu_bacteria 8024501048 8024506342 294
674 iso_pu_bacteria 8046767195 8046768676 294
675 iso_pu_bacteria 8054460903 8054461008 294
676 iso_pu_bacteria 8054558443 8054558907 294
677 iso_pu_bacteria 8056375014 8056381181 294
678 iso_pu_bacteria 8056382006 8056382674 294
679 iso_pu_bacteria 8056875544 8056878657 294
680 iso_pu_bacteria 8057575449 8057582451 294
681 iso_pu_bacteria 8057874678 8057878692 294
682 3300025230 Ga0209563_108902 Ga0209563_1089021 295
683 3300005331 Ga0070670_100000105 Ga0070670_10000010518 296
684 3300021320 Ga0214544_1005567 Ga0214544_100556714 296
685 3300021321 Ga0214542_1004334 Ga0214542_100433413 296
686 3300021327 Ga0214543_1004000 Ga0214543_100400013 296
687 3300025925 Ga0207650_10000302 Ga0207650_1000030219 296
688 3300047472 Ga0495686_0002334 Ga0495686_0002334_9267_10235 296
689 3300003771 Ga0055526_1002887 Ga0055526_10028876 297
690 3300003775 Ga0055524_1000734 Ga0055524_100073423 297
691 3300003781 Ga0055536_1006750 Ga0055536_10067506 297
692 3300003794 Ga0055531_10008418 Ga0055531_100084182 297
693 3300006038 Ga0075365_10019454 Ga0075365_100194542 297
694 3300025292 Ga0209676_1008080 Ga0209676_10080804 297
695 3300025295 Ga0209564_1000590 Ga0209564_100059045 297
696 3300025299 Ga0209256_1000741 Ga0209256_100074113 297
697 3300025299 Ga0209256_1006818 Ga0209256_10068185 297
698 3300025304 Ga0209257_1009658 Ga0209257_10096586 297
699 3300046471 Ga0495650_0042907 Ga0495650_0042907_199_1167 297
700 3300049570 Ga0501033_0000260 Ga0501033_0000260_9375_10340 297
701 3300049822 Ga0501035_0001226 Ga0501035_0001226_22545_23510 297
702 3300050492 nmdc:mga0yw44_9713_c1 nmdc:mga0yw44_9713_c1_3053_4033 297
703 3300059503 Ga0587080_013170 Ga0587080_013170_207_1175 297
704 3300002704 JGI25155J39150_1000110 JGI25155J39150_100011029 298
705 3300002705 JGI25156J39149_1000192 JGI25156J39149_100019230 298
706 3300002737 JGI25162J39368_1000302 JGI25162J39368_100030216 298
707 3300002737 JGI25162J39368_1001906 JGI25162J39368_10019062 298
708 3300002738 JGI25154J39366_1000196 JGI25154J39366_100019615 298
709 3300002739 JGI25158J39367_1001051 JGI25158J39367_10010512 298
710 3300002739 JGI25158J39367_1009750 JGI25158J39367_10097502 298
711 3300002741 JGI25157J39369_1000228 JGI25157J39369_100022815 298
712 3300002773 JGI25152J39213_1000869 JGI25152J39213_100086910 298
713 3300002773 JGI25152J39213_1002441 JGI25152J39213_10024418 298
714 3300002773 JGI25152J39213_1002981 JGI25152J39213_10029813 298
715 3300002774 JGI25150J39212_1000266 JGI25150J39212_100026610 298
716 3300002774 JGI25150J39212_1006913 JGI25150J39212_10069131 298
717 3300002987 JGI25159J45721_1000023 JGI25159J45721_1000023108 298
718 3300002987 JGI25159J45721_1000516 JGI25159J45721_10005164 298
719 3300002987 JGI25159J45721_1004235 JGI25159J45721_10042355 298
720 3300003187 JGI25151J46595_10000355 JGI25151J46595_100003559 298
721 3300003187 JGI25151J46595_10000660 JGI25151J46595_100006609 298
722 3300003187 JGI25151J46595_10061657 JGI25151J46595_100616572 298
723 3300003214 JGI25165J46597_1000390 JGI25165J46597_10003903 298
724 3300003214 JGI25165J46597_1001110 JGI25165J46597_10011102 298
725 3300003214 JGI25165J46597_1001741 JGI25165J46597_10017412 298
726 3300003214 JGI25165J46597_1006106 JGI25165J46597_10061062 298
727 3300003215 JGI25153J46596_10003933 JGI25153J46596_100039335 298
728 3300003215 JGI25153J46596_10007137 JGI25153J46596_100071373 298
729 3300003215 JGI25153J46596_10007533 JGI25153J46596_100075335 298
730 3300003316 rootH1_10006497 rootH1_100064972 298
731 3300003320 rootH2_10025655 rootH2_100256559 298
732 3300003322 rootL2_10018866 rootL2_100188663 298
733 3300003323 rootH1_10003510 rootH1_100035102 298
734 3300003323 rootH1_10036427 rootH1_100364271 298
735 3300003354 JGI25160J50197_1000044 JGI25160J50197_1000044107 298
736 3300003354 JGI25160J50197_1000061 JGI25160J50197_1000061108 298
737 3300003354 JGI25160J50197_1014649 JGI25160J50197_10146492 298
738 3300003374 JGI25161J50226_1000028 JGI25161J50226_100002832 298
739 3300003374 JGI25161J50226_1000078 JGI25161J50226_100007842 298
740 3300003374 JGI25161J50226_1000200 JGI25161J50226_100020027 298
741 3300003752 Ga0055539_1008016 Ga0055539_10080162 298
742 3300003771 Ga0055526_1011840 Ga0055526_10118403 298
743 3300003775 Ga0055524_1002242 Ga0055524_10022426 298
744 3300003775 Ga0055524_1003047 Ga0055524_10030474 298
745 3300003775 Ga0055524_1005209 Ga0055524_10052092 298
746 3300003775 Ga0055524_1022400 Ga0055524_10224002 298
747 3300003781 Ga0055536_1008514 Ga0055536_10085144 298
748 3300003790 Ga0055528_1000113 Ga0055528_100011353 298
749 3300003790 Ga0055528_1001190 Ga0055528_10011909 298
750 3300003790 Ga0055528_1005448 Ga0055528_10054486 298
751 3300003790 Ga0055528_1011317 Ga0055528_10113174 298
752 3300003790 Ga0055528_1016169 Ga0055528_10161692 298
753 3300003790 Ga0055528_1023758 Ga0055528_10237582 298
754 3300003791 Ga0055530_10008543 Ga0055530_100085433 298
755 3300003792 Ga0055540_1001653 Ga0055540_100165310 298
756 3300003792 Ga0055540_1007093 Ga0055540_10070932 298
757 3300003792 Ga0055540_1020253 Ga0055540_10202532 298
758 3300003794 Ga0055531_10007819 Ga0055531_100078194 298
759 3300004625 Ga0055543_1000054 Ga0055543_100005427 298
760 3300004625 Ga0055543_1000069 Ga0055543_100006988 298
761 3300004625 Ga0055543_1000741 Ga0055543_10007414 298
762 3300004625 Ga0055543_1002126 Ga0055543_10021263 298
763 3300005262 Ga0065165_1000047 Ga0065165_100004713 298
764 3300005262 Ga0065165_1000318 Ga0065165_100031826 298
765 3300005262 Ga0065165_1008846 Ga0065165_10088464 298
766 3300005347 Ga0070668_100255425 Ga0070668_1002554252 298
767 3300005353 Ga0070669_100028879 Ga0070669_1000288794 298
768 3300005367 Ga0070667_100115026 Ga0070667_1001150262 298
769 3300005367 Ga0070667_100321385 Ga0070667_1003213851 298
770 3300005548 Ga0070665_100025729 Ga0070665_1000257294 298
771 3300005548 Ga0070665_100033790 Ga0070665_1000337903 298
772 3300005578 Ga0068854_100080902 Ga0068854_1000809022 298
773 3300005616 Ga0068852_100009243 Ga0068852_1000092434 298
774 3300006038 Ga0075365_10007972 Ga0075365_100079722 298
775 3300006042 Ga0075368_10016307 Ga0075368_100163073 298
776 3300006048 Ga0075363_100010624 Ga0075363_1000106244 298
777 3300006051 Ga0075364_10000011 Ga0075364_1000001114 298
778 3300006051 Ga0075364_10059133 Ga0075364_100591332 298
779 3300006177 Ga0075362_10001958 Ga0075362_100019584 298
780 3300006177 Ga0075362_10027871 Ga0075362_100278712 298
781 3300006186 Ga0075369_10001934 Ga0075369_100019345 298
782 3300006186 Ga0075369_10010007 Ga0075369_100100074 298
783 3300006186 Ga0075369_10029580 Ga0075369_100295802 298
784 3300006186 Ga0075369_10051280 Ga0075369_100512801 298
785 3300006186 Ga0075369_10088993 Ga0075369_100889931 298
786 3300006195 Ga0075366_10005204 Ga0075366_100052043 298
787 3300006195 Ga0075366_10018991 Ga0075366_100189914 298
788 3300006353 Ga0075370_10000842 Ga0075370_100008427 298
789 3300006353 Ga0075370_10017277 Ga0075370_100172772 298
790 3300006948 Ga0099826_10017417 Ga0099826_100174173 298
791 3300006948 Ga0099826_10026045 Ga0099826_100260454 298
792 3300009011 Ga0105251_10082448 Ga0105251_100824481 298
793 3300009036 Ga0105244_10068059 Ga0105244_100680592 298
794 3300009036 Ga0105244_10104799 Ga0105244_101047992 298
795 3300009093 Ga0105240_10001468 Ga0105240_100014687 298
796 3300009177 Ga0105248_10121100 Ga0105248_101211002 298
797 3300009545 Ga0105237_10004445 Ga0105237_1000444515 298
798 3300009765 Ga0123341_1000642 Ga0123341_100064210 298
799 3300009766 Ga0123342_1021337 Ga0123342_10213375 298
800 3300011119 Ga0105246_10159689 Ga0105246_101596892 298
801 3300013100 Ga0157373_10015517 Ga0157373_100155173 298
802 3300013102 Ga0157371_10000004 Ga0157371_1000000474 298
803 3300013102 Ga0157371_10176676 Ga0157371_101766762 298
804 3300013104 Ga0157370_10001047 Ga0157370_1000104710 298
805 3300013104 Ga0157370_10001796 Ga0157370_100017967 298
806 3300013105 Ga0157369_10138306 Ga0157369_101383062 298
807 3300013105 Ga0157369_10298694 Ga0157369_102986942 298
808 3300013249 Ga0171463_1001 Ga0171463_10011388 298
809 3300014497 Ga0182008_10031273 Ga0182008_100312732 298
810 3300015262 Ga0182007_10002297 Ga0182007_100022978 298
811 3300015265 Ga0182005_1025945 Ga0182005_10259451 298
812 3300015690 Ga0183363_1185 Ga0183363_118513 298
813 3300021327 Ga0214543_1008948 Ga0214543_10089488 298
814 3300022739 Ga0228711_1000006 Ga0228711_1000006158 298
815 3300022740 Ga0228710_1000004 Ga0228710_1000004209 298
816 3300025206 Ga0209435_100087 Ga0209435_10008715 298
817 3300025208 Ga0209436_100022 Ga0209436_10002298 298
818 3300025208 Ga0209436_100213 Ga0209436_1002139 298
819 3300025233 Ga0209437_100050 Ga0209437_10005082 298
820 3300025233 Ga0209437_100205 Ga0209437_10020585 298
821 3300025245 Ga0207425_1000052 Ga0207425_1000052134 298
822 3300025245 Ga0207425_1001736 Ga0207425_10017369 298
823 3300025245 Ga0207425_1002984 Ga0207425_10029843 298
824 3300025246 Ga0209646_1000285 Ga0209646_100028515 298
825 3300025246 Ga0209646_1011028 Ga0209646_10110282 298
826 3300025250 Ga0209026_1000347 Ga0209026_100034715 298
827 3300025253 Ga0209677_100223 Ga0209677_1002234 298
828 3300025256 Ga0209759_1000482 Ga0209759_100048215 298
829 3300025258 Ga0209129_1000066 Ga0209129_1000066158 298
830 3300025258 Ga0209129_1000141 Ga0209129_100014164 298
831 3300025258 Ga0209129_1001039 Ga0209129_100103914 298
832 3300025258 Ga0209129_1001099 Ga0209129_100109914 298
833 3300025258 Ga0209129_1001848 Ga0209129_100184811 298
834 3300025258 Ga0209129_1004007 Ga0209129_10040071 298
835 3300025261 Ga0209233_1000037 Ga0209233_1000037124 298
836 3300025261 Ga0209233_1000187 Ga0209233_1000187105 298
837 3300025261 Ga0209233_1000232 Ga0209233_100023262 298
838 3300025273 Ga0209673_1000024 Ga0209673_1000024106 298
839 3300025273 Ga0209673_1000911 Ga0209673_100091129 298
840 3300025273 Ga0209673_1002137 Ga0209673_100213711 298
841 3300025273 Ga0209673_1002144 Ga0209673_10021448 298
842 3300025273 Ga0209673_1002283 Ga0209673_10022835 298
843 3300025273 Ga0209673_1003397 Ga0209673_100339710 298
844 3300025273 Ga0209673_1008268 Ga0209673_10082681 298
845 3300025284 Ga0209130_1000002 Ga0209130_1000002581 298
846 3300025284 Ga0209130_1000005 Ga0209130_1000005586 298
847 3300025284 Ga0209130_1000093 Ga0209130_1000093107 298
848 3300025292 Ga0209676_1003289 Ga0209676_100328911 298
849 3300025294 Ga0209025_1000144 Ga0209025_100014462 298
850 3300025294 Ga0209025_1000274 Ga0209025_100027428 298
851 3300025294 Ga0209025_1000275 Ga0209025_100027561 298
852 3300025294 Ga0209025_1000553 Ga0209025_10005539 298
853 3300025294 Ga0209025_1004510 Ga0209025_100451013 298
854 3300025294 Ga0209025_1006199 Ga0209025_10061992 298
855 3300025294 Ga0209025_1011140 Ga0209025_10111402 298
856 3300025295 Ga0209564_1000262 Ga0209564_100026279 298
857 3300025295 Ga0209564_1000486 Ga0209564_100048611 298
858 3300025295 Ga0209564_1009772 Ga0209564_10097723 298
859 3300025295 Ga0209564_1010276 Ga0209564_10102761 298
860 3300025295 Ga0209564_1031040 Ga0209564_10310401 298
861 3300025297 Ga0209758_1000229 Ga0209758_100022962 298
862 3300025297 Ga0209758_1000383 Ga0209758_100038368 298
863 3300025297 Ga0209758_1000466 Ga0209758_10004665 298
864 3300025297 Ga0209758_1000971 Ga0209758_100097111 298
865 3300025297 Ga0209758_1001494 Ga0209758_10014945 298
866 3300025297 Ga0209758_1003684 Ga0209758_10036845 298
867 3300025298 Ga0209050_1005028 Ga0209050_10050284 298
868 3300025299 Ga0209256_1000715 Ga0209256_10007155 298
869 3300025299 Ga0209256_1000868 Ga0209256_100086821 298
870 3300025299 Ga0209256_1003327 Ga0209256_10033272 298
871 3300025299 Ga0209256_1007044 Ga0209256_10070442 298
872 3300025299 Ga0209256_1007143 Ga0209256_10071435 298
873 3300025299 Ga0209256_1016181 Ga0209256_10161812 298
874 3300025302 Ga0207426_1000012 Ga0207426_1000012610 298
875 3300025302 Ga0207426_1000013 Ga0207426_1000013581 298
876 3300025302 Ga0207426_1000015 Ga0207426_100001513 298
877 3300025302 Ga0207426_1000142 Ga0207426_1000142106 298
878 3300025302 Ga0207426_1002277 Ga0207426_10022775 298
879 3300025303 Ga0209051_1000170 Ga0209051_100017091 298
880 3300025303 Ga0209051_1000768 Ga0209051_100076817 298
881 3300025303 Ga0209051_1002082 Ga0209051_10020829 298
882 3300025303 Ga0209051_1007516 Ga0209051_10075163 298
883 3300025303 Ga0209051_1017231 Ga0209051_10172312 298
884 3300025303 Ga0209051_1031443 Ga0209051_10314432 298
885 3300025304 Ga0209257_1001590 Ga0209257_10015908 298
886 3300025304 Ga0209257_1006763 Ga0209257_10067632 298
887 3300025304 Ga0209257_1007148 Ga0209257_10071488 298
888 3300025913 Ga0207695_10000427 Ga0207695_1000042788 298
889 3300025914 Ga0207671_10002841 Ga0207671_1000284117 298
890 3300025923 Ga0207681_10185119 Ga0207681_101851192 298
891 3300025972 Ga0207668_10051998 Ga0207668_100519983 298
892 3300025981 Ga0207640_10056804 Ga0207640_100568043 298
893 3300025986 Ga0207658_10083919 Ga0207658_100839193 298
894 3300026067 Ga0207678_10125098 Ga0207678_101250982 298
895 3300027111 Ga0209281_1000102 Ga0209281_1000102141 298
896 3300027111 Ga0209281_1000563 Ga0209281_100056334 298
897 3300027312 Ga0209371_1000009 Ga0209371_1000009920 298
898 3300027312 Ga0209371_1000569 Ga0209371_100056912 298
899 3300027312 Ga0209371_1000597 Ga0209371_100059721 298
900 3300027312 Ga0209371_1002100 Ga0209371_100210012 298
901 3300027666 Ga0209282_1000013 Ga0209282_1000013176 298
902 3300027666 Ga0209282_1019359 Ga0209282_10193594 298
903 3300027666 Ga0209282_1028987 Ga0209282_10289872 298
904 3300027866 Ga0209813_10003197 Ga0209813_100031973 298
905 3300028379 Ga0268266_10023891 Ga0268266_100238913 298
906 3300028379 Ga0268266_10031975 Ga0268266_100319755 298
907 3300028794 Ga0307515_10000029 Ga0307515_10000029133 298
908 3300028794 Ga0307515_10011406 Ga0307515_1001140614 298
909 3300028794 Ga0307515_10066981 Ga0307515_100669812 298
910 3300028794 Ga0307515_10176303 Ga0307515_101763032 298
911 3300030500 Ga0268256_1000010 Ga0268256_1000010919 298
912 3300030500 Ga0268256_1003765 Ga0268256_10037652 298
913 3300030500 Ga0268256_1004108 Ga0268256_10041085 298
914 3300030744 Ga0316181_1026626 Ga0316181_10266262 298
915 3300031456 Ga0307513_10000259 Ga0307513_1000025922 298
916 3300031456 Ga0307513_10028778 Ga0307513_100287786 298
917 3300031731 Ga0307405_10001661 Ga0307405_100016618 298
918 3300031852 Ga0307410_10149355 Ga0307410_101493552 298
919 3300031901 Ga0307406_10007052 Ga0307406_100070528 298
920 3300031911 Ga0307412_10007214 Ga0307412_100072142 298
921 3300031967 Ga0315914_1000004 Ga0315914_1000004211 298
922 3300031995 Ga0307409_100052793 Ga0307409_1000527932 298
923 3300032005 Ga0307411_10051253 Ga0307411_100512533 298
924 3300033430 Ga0315913_1000055 Ga0315913_100005538 298
925 3300033464 Ga0315915_1000003 Ga0315915_1000003318 298
926 3300041404 Ga0439436_0004700 Ga0439436_0004700_2634_3602 298
927 3300041411 Ga0439466_0022251 Ga0439466_0022251_101_1069 298
928 3300041413 Ga0439465_0007622 Ga0439465_0007622_594_1562 298
929 3300041492 Ga0451835_1253214 Ga0451835_1253214_641_1609 298
930 3300041498 Ga0451841_0687643 Ga0451841_0687643_197_1165 298
931 3300041502 Ga0451846_52794 Ga0451846_52794_792_1760 298
932 3300041503 Ga0451847_0188426 Ga0451847_0188426_516_1484 298
933 3300041511 Ga0451855_0185000 Ga0451855_0185000_99_1067 298
934 3300041512 Ga0451853_3392256 Ga0451853_3392256_1119_2087 298
935 3300042007 Ga0439449_0005847 Ga0439449_0005847_2990_3964 298
936 3300042122 Ga0450920_003073 Ga0450920_003073_1558_2526 298
937 3300042145 Ga0450906_005256 Ga0450906_005256_928_1896 298
938 3300042146 Ga0450907_016977 Ga0450907_016977_85_1053 298
939 3300042147 Ga0450910_003476 Ga0450910_003476_490_1458 298
940 3300042531 Ga0450918_001915 Ga0450918_001915_2186_3154 298
941 3300046460 Ga0495638_0000566 Ga0495638_0000566_6513_7481 298
942 3300046474 Ga0495605_0002376 Ga0495605_0002376_9239_10207 298
943 3300046492 Ga0495585_0012817 Ga0495585_0012817_154_1122 298
944 3300046492 Ga0495585_0022306 Ga0495585_0022306_2649_3617 298
945 3300046500 Ga0495596_0048569 Ga0495596_0048569_602_1570 298
946 3300046501 Ga0495607_0078801 Ga0495607_0078801_200_1195 298
947 3300046501 Ga0495607_0124258 Ga0495607_0124258_152_1120 298
948 3300046506 Ga0495583_0003929 Ga0495583_0003929_4488_5456 298
949 3300046507 Ga0495606_0019688 Ga0495606_0019688_1013_1981 298
950 3300046507 Ga0495606_0026688 Ga0495606_0026688_1636_2604 298
951 3300046512 Ga0495610_0002136 Ga0495610_0002136_9148_10116 298
952 3300046512 Ga0495610_0050802 Ga0495610_0050802_547_1515 298
953 3300046513 Ga0495616_0067571 Ga0495616_0067571_648_1616 298
954 3300046513 Ga0495616_0083124 Ga0495616_0083124_135_1103 298
955 3300046515 Ga0495620_0060368 Ga0495620_0060368_172_1140 298
956 3300046518 Ga0495631_0003763 Ga0495631_0003763_1677_2645 298
957 3300046518 Ga0495631_0019236 Ga0495631_0019236_180_1148 298
958 3300046519 Ga0495632_0003799 Ga0495632_0003799_6785_7753 298
959 3300046519 Ga0495632_0073112 Ga0495632_0073112_183_1151 298
960 3300046519 Ga0495632_0114669 Ga0495632_0114669_105_1100 298
961 3300046530 Ga0495654_0088198 Ga0495654_0088198_211_1179 298
962 3300046558 Ga0495633_0010640 Ga0495633_0010640_1624_2592 298
963 3300046558 Ga0495633_0105620 Ga0495633_0105620_244_1212 298
964 3300046615 Ga0495656_0031901 Ga0495656_0031901_306_1274 298
965 3300046660 Ga0495625_0021354 Ga0495625_0021354_3007_3975 298
966 3300046660 Ga0495625_0042441 Ga0495625_0042441_2030_2998 298
967 3300046665 Ga0495661_0058054 Ga0495661_0058054_596_1564 298
968 3300046692 Ga0495671_0022472 Ga0495671_0022472_1013_1981 298
969 3300046694 Ga0495649_0088662 Ga0495649_0088662_434_1402 298
970 3300046810 Ga0495660_0025205 Ga0495660_0025205_1534_2502 298
971 3300047318 Ga0495636_0016035 Ga0495636_0016035_1614_2582 298
972 3300047320 Ga0495672_0104297 Ga0495672_0104297_445_1413 298
973 3300047323 Ga0495683_0057414 Ga0495683_0057414_218_1186 298
974 3300047443 Ga0495687_017057 Ga0495687_017057_1562_2530 298
975 3300047469 Ga0495673_0046454 Ga0495673_0046454_240_1208 298
976 3300047470 Ga0495681_0081024 Ga0495681_0081024_69_1037 298
977 3300047472 Ga0495686_0005569 Ga0495686_0005569_5738_6706 298
978 3300048905 Ga0496102_0044273 Ga0496102_0044273_433_1401 298
979 3300048907 Ga0496104_0342776 Ga0496104_0342776_429_1397 298
980 3300048908 Ga0496105_0378608 Ga0496105_0378608_112_1080 298
981 3300048909 Ga0496106_0196431 Ga0496106_0196431_402_1370 298
982 3300048913 Ga0496110_0238870 Ga0496110_0238870_148_1116 298
983 3300048919 Ga0496116_0000240 Ga0496116_0000240_88446_89438 298
984 3300048919 Ga0496116_0008310 Ga0496116_0008310_846_1814 298
985 3300048919 Ga0496116_0017595 Ga0496116_0017595_3567_4535 298
986 3300048919 Ga0496116_0019568 Ga0496116_0019568_761_1729 298
987 3300048919 Ga0496116_0042611 Ga0496116_0042611_89_1057 298
988 3300048919 Ga0496116_0168251 Ga0496116_0168251_20_988 298
989 3300048920 Ga0496117_0002038 Ga0496117_0002038_7985_8953 298
990 3300048920 Ga0496117_0007245 Ga0496117_0007245_3514_4482 298
991 3300048920 Ga0496117_0018045 Ga0496117_0018045_1375_2343 298
992 3300048921 Ga0496118_0008715 Ga0496118_0008715_1153_2121 298
993 3300048921 Ga0496118_0011007 Ga0496118_0011007_806_1774 298
994 3300048921 Ga0496118_0015080 Ga0496118_0015080_2246_3214 298
995 3300048921 Ga0496118_0023117 Ga0496118_0023117_2263_3231 298
996 3300048921 Ga0496118_0121722 Ga0496118_0121722_23_1012 298
997 3300048922 Ga0496119_0119781 Ga0496119_0119781_385_1353 298
998 3300048924 Ga0496121_0000426 Ga0496121_0000426_59286_60308 298
999 3300048924 Ga0496121_0009474 Ga0496121_0009474_3577_4545 298
1000 3300048924 Ga0496121_0014274 Ga0496121_0014274_6641_7609 298
1001 3300048925 Ga0496122_0000018 Ga0496122_0000018_268933_269937 298
1002 3300048925 Ga0496122_0016064 Ga0496122_0016064_2225_3211 298
1003 3300048925 Ga0496122_0023695 Ga0496122_0023695_208_1176 298
1004 3300048925 Ga0496122_0023765 Ga0496122_0023765_4222_5190 298
1005 3300048925 Ga0496122_0031718 Ga0496122_0031718_1405_2373 298
1006 3300048925 Ga0496122_0064461 Ga0496122_0064461_563_1531 298
1007 3300048925 Ga0496122_0100646 Ga0496122_0100646_758_1726 298
1008 3300048925 Ga0496122_0101454 Ga0496122_0101454_611_1627 298
1009 3300048926 Ga0496123_0000015 Ga0496123_0000015_268933_269937 298
1010 3300048926 Ga0496123_0004823 Ga0496123_0004823_7391_8407 298
1011 3300048926 Ga0496123_0019563 Ga0496123_0019563_3514_4482 298
1012 3300048926 Ga0496123_0025495 Ga0496123_0025495_285_1253 298
1013 3300048926 Ga0496123_0065637 Ga0496123_0065637_173_1141 298
1014 3300048926 Ga0496123_0069013 Ga0496123_0069013_403_1371 298
1015 3300048927 Ga0496124_0000178 Ga0496124_0000178_29477_30466 298
1016 3300048927 Ga0496124_0013026 Ga0496124_0013026_3678_4646 298
1017 3300048927 Ga0496124_0023459 Ga0496124_0023459_4438_5406 298
1018 3300048927 Ga0496124_0033192 Ga0496124_0033192_203_1171 298
1019 3300048927 Ga0496124_0163807 Ga0496124_0163807_568_1536 298
1020 3300048928 Ga0496125_0002093 Ga0496125_0002093_19187_20155 298
1021 3300048928 Ga0496125_0045441 Ga0496125_0045441_667_1635 298
1022 3300048929 Ga0496126_0000322 Ga0496126_0000322_90452_91444 298
1023 3300048929 Ga0496126_0247322 Ga0496126_0247322_447_1415 298
1024 3300049459 Ga0495678_019861 Ga0495678_019861_1685_2653 298
1025 3300049459 Ga0495678_022832 Ga0495678_022832_1229_2197 298
1026 3300049460 Ga0495682_0028987 Ga0495682_0028987_700_1668 298
1027 3300049581 Ga0501047_0321063 Ga0501047_0321063_291_1259 298
1028 3300049584 Ga0501068_0115454 Ga0501068_0115454_123_1091 298
1029 3300049744 Ga0501083_0214200 Ga0501083_0214200_80_1048 298
1030 3300049822 Ga0501035_0220168 Ga0501035_0220168_481_1449 298
1031 3300050491 nmdc:mga00v17_71_c1 nmdc:mga00v17_71_c1_50572_51594 298
1032 3300050492 nmdc:mga0yw44_183167_c1 nmdc:mga0yw44_183167_c1_231_1220 298
1033 3300053079 Ga0500610_0090341 Ga0500610_0090341_436_1404 298
1034 3300053111 Ga0500572_004466 Ga0500572_004466_1388_2389 298
1035 3300053125 Ga0500618_001422 Ga0500618_001422_9155_10153 298
1036 3300053125 Ga0500618_004472 Ga0500618_004472_2658_3653 298
1037 3300053125 Ga0500618_004683 Ga0500618_004683_1060_2028 298
1038 3300053139 Ga0500568_0001169 Ga0500568_0001169_9925_10893 298
1039 3300053140 Ga0500573_0000783 Ga0500573_0000783_8528_9496 298
1040 3300053140 Ga0500573_0006724 Ga0500573_0006724_4771_5739 298
1041 3300053151 Ga0500604_0041821 Ga0500604_0041821_289_1257 298
1042 3300053153 Ga0500616_0000437 Ga0500616_0000437_9625_10653 298
1043 3300053153 Ga0500616_0002500 Ga0500616_0002500_902_1870 298
1044 3300053156 Ga0500622_0002842 Ga0500622_0002842_1600_2568 298
1045 3300053177 Ga0500636_0000036 Ga0500636_0000036_22407_23396 298
1046 3300053177 Ga0500636_0001307 Ga0500636_0001307_4735_5736 298
1047 iso_pu_bacteria 2599185236 2599718721 298
1048 iso_pu_bacteria 2600254933 2600376736 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00962

A_deaminase

Adenosine deaminase

10

329

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rys-assembly2.cif.gz_B the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens 0.8996 7 297
1fkx-assembly1.cif.gz_A murine adenosine deaminase (d296a) 0.8929 6 297
3ewc-assembly1.cif.gz_A crystal structure of adenosine deaminase from plasmodial vivax in complex with mt-coformycin 0.892 3 296
2amx-assembly1.cif.gz_A crystal structure of plasmodium yoelii adenosine deaminase (py02076) 0.8889 3 296
3mvt-assembly1.cif.gz_A crystal structure of apo mada at 2.2a resolution 0.8887 6 297
ID Description Score Start End Superfamily
af_Q54KF3_1_358_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9195 3 294 3.20.20.140
3rysB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8996 7 297 3.20.20.140
af_Q54KF3_1_358_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8987 3 294 3.20.20.140
af_Q9P6I7_4_353_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8971 5 297 3.20.20.140
3ewcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.892 3 296 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A3S1RTK7-F1-model_v4 Adenosine deaminase 0.9956 162 297 GO:0019239
AF-A0A545ZAP7-F1-model_v4 deleted 0.9852 1 298
AF-A0A2W4BSP4-F1-model_v4 deleted 0.985 1 298
AF-Q92T48-F1-model_v4 Adenine deaminase (ADE) (EC 3.5.4.2) (Adenine aminohydrolase) (AAH) 0.985 1 296 GO:0000034
GO:0006146
GO:0008270
GO:0009117
GO:0043103
AF-A0A0Q8NMW2-F1-model_v4 Adenine deaminase (ADE) (EC 3.5.4.2) (Adenine aminohydrolase) (AAH) 0.9839 1 298 GO:0000034
GO:0006146
GO:0008270
GO:0009117
GO:0043103

Feature Viewer

pLDDT pTM Quality
94.47 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map