F488905

General Info

Members Datasets Scaffolds Average Seq Length
1044 340 2088 171

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10830975|Ga0114129_108309752
Length 200
Sequence MSTSGRAGFARASVCAAHQLTRIDSDGLNRFGMIHGRFQPFHNGHLEYLRGAAARSDELFVGITNPDPTRVREEPSDPLRHLPESNPFTYSERLLMVAAVAEDEGIRAHVIPFPVNEPELWSAYVPAGVTQYLRLFSDWGETKLDRLREAGYEVVVLDEGTDKEISGNDVRAALRSGGDWESLVPPGVARVIKSLQRVTV

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
113 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
114 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
193 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
194 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
195 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
196 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
197 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
200 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
201 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
209 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
210 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
222 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
223 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
224 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
225 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
226 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
227 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
228 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
231 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
232 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
233 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
237 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
238 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
239 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
240 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
243 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
277 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
278 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
328 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
339 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
340 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 12.16
Rhizosphere 86.02
Stem 0
Stem Tuber 0
Unclassified 22.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10830975 3300009147 Bacteria 1176
2 ARCol0yngRDRAFT_1002586 3300000652 Bacteria 1357
3 JGI24744J21845_10002375 3300002077 Bacteria 3838
4 JGI24742J22300_10004954 3300002244 Bacteria 2186
5 JGI25407J50210_10003405 3300003373 Bacteria 3800
6 JGI25407J50210_10003428 3300003373 Bacteria 3792
7 Ga0070676_10118106 3300005328 Unclassified 1661
8 Ga0070676_10945731 3300005328 Bacteria 644
9 Ga0070683_100116483 3300005329 Bacteria 2523
10 Ga0070683_100501566 3300005329 Archaea 1159
11 Ga0070683_101416551 3300005329 Bacteria 668
12 Ga0070690_100037841 3300005330 Bacteria 3042
13 Ga0070690_100086345 3300005330 Unclassified 2060
14 Ga0068869_100182735 3300005334 Unclassified 1645
15 Ga0070666_10031090 3300005335 Bacteria 3523
16 Ga0070680_100005260 3300005336 Bacteria 9791
17 Ga0070680_100757823 3300005336 Unclassified 836
18 Ga0070682_100012384 3300005337 Bacteria 4890
19 Ga0070682_100028428 3300005337 Bacteria 3362
20 Ga0070682_100121836 3300005337 Unclassified 1752
21 Ga0070682_100366460 3300005337 Bacteria 1079
22 Ga0068868_100007477 3300005338 Bacteria 7780
23 Ga0068868_100033702 3300005338 Bacteria 3949
24 Ga0068868_100196786 3300005338 Bacteria 1678
25 Ga0068868_100332674 3300005338 Bacteria 1297
26 Ga0070660_100017417 3300005339 Bacteria 5237
27 Ga0070660_100103703 3300005339 Bacteria 2256
28 Ga0070660_100251912 3300005339 Unclassified 1440
29 Ga0070689_100180337 3300005340 Unclassified 1715
30 Ga0070691_10020515 3300005341 Bacteria 3053
31 Ga0070691_10048520 3300005341 Bacteria 2021
32 Ga0070691_10173078 3300005341 Bacteria 1120
33 Ga0070687_100002213 3300005343 Bacteria 7207
34 Ga0070687_100491928 3300005343 Bacteria 824
35 Ga0070661_100327454 3300005344 Bacteria 1198
36 Ga0070692_10039170 3300005345 Bacteria 2419
37 Ga0070668_100013775 3300005347 Bacteria 6040
38 Ga0070668_100103386 3300005347 Bacteria 2260
39 Ga0070669_100049662 3300005353 Bacteria 3063
40 Ga0070669_100119235 3300005353 Unclassified 2011
41 Ga0070669_100136816 3300005353 Unclassified 1885
42 Ga0070671_100019046 3300005355 Bacteria 5583
43 Ga0070671_100160733 3300005355 Unclassified 1899
44 Ga0070671_100501361 3300005355 Bacteria 1044
45 Ga0070674_100007121 3300005356 Bacteria 6578
46 Ga0070674_100061048 3300005356 Bacteria 2629
47 Ga0070674_100785521 3300005356 Unclassified 821
48 Ga0070673_100111008 3300005364 Bacteria 2274
49 Ga0070673_100436543 3300005364 Bacteria 1176
50 Ga0070688_100027191 3300005365 Bacteria 3406
51 Ga0070659_100006017 3300005366 Bacteria 8749
52 Ga0070667_100807062 3300005367 Unclassified 871
53 Ga0070703_10016248 3300005406 Bacteria 2135
54 Ga0070703_10046578 3300005406 Bacteria 1371
55 Ga0070703_10274980 3300005406 Unclassified 693
56 Ga0070709_10172234 3300005434 Bacteria 1513
57 Ga0070709_10233108 3300005434 Bacteria 1318
58 Ga0070709_10247637 3300005434 Bacteria 1282
59 Ga0070714_100043410 3300005435 Bacteria 3802
60 Ga0070713_100030152 3300005436 Bacteria 4304
61 Ga0070713_100140964 3300005436 Unclassified 2135
62 Ga0070713_100146039 3300005436 Archaea 2100
63 Ga0070713_100199280 3300005436 Bacteria 1807
64 Ga0070713_100547983 3300005436 Bacteria 1095
65 Ga0070710_10007964 3300005437 Bacteria 5151
66 Ga0070710_10011401 3300005437 Bacteria 4391
67 Ga0070710_10015753 3300005437 Bacteria 3833
68 Ga0070710_10807793 3300005437 Unclassified 670
69 Ga0070701_10143856 3300005438 Bacteria 1367
70 Ga0070701_10407624 3300005438 Bacteria 863
71 Ga0070701_10578796 3300005438 Bacteria 741
72 Ga0070711_100044986 3300005439 Bacteria 2999
73 Ga0070711_100088282 3300005439 Bacteria 2228
74 Ga0070711_100154294 3300005439 Unclassified 1735
75 Ga0070711_100308387 3300005439 Bacteria 1261
76 Ga0070711_100758533 3300005439 Unclassified 820
77 Ga0070705_100006285 3300005440 Bacteria 5821
78 Ga0070705_100017233 3300005440 Bacteria 3768
79 Ga0070705_100023676 3300005440 Bacteria 3302
80 Ga0070705_100065951 3300005440 Bacteria 2169
81 Ga0070705_100152479 3300005440 Unclassified 1535
82 Ga0070705_100243093 3300005440 Archaea 1259
83 Ga0070705_100628299 3300005440 Unclassified 834
84 Ga0070705_101047777 3300005440 Unclassified 665
85 Ga0070705_101370163 3300005440 Unclassified 589
86 Ga0070700_100002719 3300005441 Bacteria 9037
87 Ga0070700_100323038 3300005441 Bacteria 1135
88 Ga0070700_100566038 3300005441 Bacteria 885
89 Ga0070694_100010676 3300005444 Bacteria 5675
90 Ga0070694_100093215 3300005444 Bacteria 2117
91 Ga0070694_100155948 3300005444 Bacteria 1671
92 Ga0070694_100193476 3300005444 Unclassified 1512
93 Ga0070694_100825827 3300005444 Bacteria 761
94 Ga0070708_100010130 3300005445 Bacteria 7628
95 Ga0070708_100033519 3300005445 Bacteria 4462
96 Ga0070708_100065685 3300005445 Bacteria 3254
97 Ga0070708_100228256 3300005445 Bacteria 1747
98 Ga0070708_100234230 3300005445 Bacteria 1723
99 Ga0070708_100335223 3300005445 Bacteria 1425
100 Ga0070708_100409001 3300005445 Unclassified 1279
101 Ga0070708_100629584 3300005445 Unclassified 1011
102 Ga0070708_100698584 3300005445 Unclassified 955
103 Ga0070708_100971799 3300005445 Unclassified 796
104 Ga0070663_100003020 3300005455 Bacteria 9610
105 Ga0070663_100032578 3300005455 Bacteria 3594
106 Ga0070663_101323503 3300005455 Unclassified 636
107 Ga0070678_100004375 3300005456 Bacteria 8000
108 Ga0070678_100116013 3300005456 Bacteria 2103
109 Ga0070678_100526519 3300005456 Unclassified 1046
110 Ga0070662_100034736 3300005457 Bacteria 3556
111 Ga0070662_100426494 3300005457 Bacteria 1098
112 Ga0070662_100633830 3300005457 Bacteria 901
113 Ga0070681_10544258 3300005458 Bacteria 1075
114 Ga0068867_100005708 3300005459 Bacteria 8823
115 Ga0068867_100009137 3300005459 Bacteria 6993
116 Ga0068867_100528928 3300005459 Bacteria 1018
117 Ga0068867_100734118 3300005459 Bacteria 874
118 Ga0070685_10064227 3300005466 Bacteria 2158
119 Ga0070685_10105360 3300005466 Unclassified 1728
120 Ga0070685_10144724 3300005466 Bacteria 1500
121 Ga0070706_100009405 3300005467 Bacteria 9100
122 Ga0070706_100015165 3300005467 Bacteria 7116
123 Ga0070706_100019076 3300005467 Bacteria 6327
124 Ga0070706_100087090 3300005467 Bacteria 2895
125 Ga0070706_100103080 3300005467 Bacteria 2653
126 Ga0070706_100185132 3300005467 Bacteria 1946
127 Ga0070707_100001783 3300005468 Bacteria 20715
128 Ga0070707_100024924 3300005468 Bacteria 5671
129 Ga0070707_100070727 3300005468 Bacteria 3361
130 Ga0070707_100071604 3300005468 Bacteria 3340
131 Ga0070707_100165466 3300005468 Bacteria 2155
132 Ga0070707_100174490 3300005468 Bacteria 2095
133 Ga0070707_100877839 3300005468 Bacteria 861
134 Ga0070698_100003764 3300005471 Bacteria 16676
135 Ga0070698_100011310 3300005471 Bacteria 9475
136 Ga0070698_100016699 3300005471 Bacteria 7745
137 Ga0070698_100304001 3300005471 Unclassified 1526
138 Ga0070698_100425874 3300005471 Bacteria 1262
139 Ga0070698_100485650 3300005471 Bacteria 1172
140 Ga0070698_100567355 3300005471 Bacteria 1075
141 Ga0070698_101115739 3300005471 Unclassified 737
142 Ga0070699_100048536 3300005518 Bacteria 3674
143 Ga0070699_100080796 3300005518 Bacteria 2833
144 Ga0070699_100101562 3300005518 Bacteria 2521
145 Ga0070699_100267627 3300005518 Bacteria 1529
146 Ga0070679_100048241 3300005530 Bacteria 4243
147 Ga0070679_100105399 3300005530 Bacteria 2806
148 Ga0070679_100185002 3300005530 Bacteria 2055
149 Ga0070684_100034381 3300005535 Bacteria 4334
150 Ga0070684_100045720 3300005535 Bacteria 3791
151 Ga0070684_100076939 3300005535 Bacteria 2946
152 Ga0070684_100082189 3300005535 Bacteria 2852
153 Ga0070684_100172646 3300005535 Bacteria 1964
154 Ga0070684_100295315 3300005535 Bacteria 1486
155 Ga0070697_100080962 3300005536 Unclassified 2676
156 Ga0070697_100124922 3300005536 Unclassified 2155
157 Ga0070697_100307182 3300005536 Bacteria 1364
158 Ga0068853_100003873 3300005539 Bacteria 11466
159 Ga0068853_100931623 3300005539 Bacteria 835
160 Ga0070672_100158034 3300005543 Bacteria 1879
161 Ga0070672_100218507 3300005543 Bacteria 1598
162 Ga0070686_100000943 3300005544 Bacteria 16754
163 Ga0070686_100313735 3300005544 Bacteria 1167
164 Ga0070686_100573985 3300005544 Unclassified 885
165 Ga0070695_100012438 3300005545 Bacteria 5107
166 Ga0070695_100135041 3300005545 Unclassified 1704
167 Ga0070695_100196576 3300005545 Bacteria 1438
168 Ga0070695_100348663 3300005545 Bacteria 1108
169 Ga0070696_100007393 3300005546 Bacteria 7340
170 Ga0070696_100012491 3300005546 Bacteria 5699
171 Ga0070696_100160931 3300005546 Bacteria 1654
172 Ga0070696_100359865 3300005546 Unclassified 1129
173 Ga0070696_100411692 3300005546 Bacteria 1060
174 Ga0070693_100031739 3300005547 Bacteria 2899
175 Ga0070693_100045336 3300005547 Bacteria 2492
176 Ga0070693_100336732 3300005547 Bacteria 1029
177 Ga0070665_100105153 3300005548 Bacteria 2825
178 Ga0070704_100019935 3300005549 Bacteria 4315
179 Ga0070704_100046083 3300005549 Bacteria 3038
180 Ga0070704_100054858 3300005549 Bacteria 2822
181 Ga0070704_100099335 3300005549 Bacteria 2189
182 Ga0070704_100182344 3300005549 Bacteria 1680
183 Ga0070704_100325996 3300005549 Unclassified 1288
184 Ga0070704_100383010 3300005549 Bacteria 1195
185 Ga0070704_100702712 3300005549 Bacteria 897
186 Ga0068855_100129831 3300005563 Bacteria 2879
187 Ga0068855_100164430 3300005563 Bacteria 2516
188 Ga0068855_100185558 3300005563 Bacteria 2349
189 Ga0068855_100297477 3300005563 Bacteria 1788
190 Ga0068855_101140718 3300005563 Bacteria 813
191 Ga0070664_100231336 3300005564 Bacteria 1657
192 Ga0068857_100002049 3300005577 Bacteria 16363
193 Ga0068857_100330839 3300005577 Bacteria 1408
194 Ga0068854_100114950 3300005578 Bacteria 2035
195 Ga0068854_100145231 3300005578 Unclassified 1824
196 Ga0068854_100405474 3300005578 Unclassified 1129
197 Ga0068856_100024228 3300005614 Bacteria 5905
198 Ga0068856_100104638 3300005614 Bacteria 2824
199 Ga0068856_100126707 3300005614 Bacteria 2557
200 Ga0068856_100286257 3300005614 Bacteria 1665
201 Ga0068856_101335245 3300005614 Unclassified 732
202 Ga0070702_100018435 3300005615 Bacteria 3622
203 Ga0070702_100021765 3300005615 Bacteria 3380
204 Ga0070702_100048163 3300005615 Bacteria 2425
205 Ga0070702_100484537 3300005615 Unclassified 905
206 Ga0070702_100686655 3300005615 Unclassified 779
207 Ga0068852_101040223 3300005616 Unclassified 838
208 Ga0068852_101279306 3300005616 Bacteria 755
209 Ga0068859_100227040 3300005617 Unclassified 1955
210 Ga0068864_100061528 3300005618 Unclassified 3252
211 Ga0068864_100857961 3300005618 Unclassified 895
212 Ga0068866_10000764 3300005718 Bacteria 14510
213 Ga0068866_10003892 3300005718 Bacteria 6124
214 Ga0068866_10080015 3300005718 Unclassified 1752
215 Ga0068866_10229353 3300005718 Bacteria 1125
216 Ga0068866_10401324 3300005718 Unclassified 884
217 Ga0068861_100007355 3300005719 Bacteria 7544
218 Ga0068861_100036976 3300005719 Bacteria 3628
219 Ga0068861_100261204 3300005719 Unclassified 1482
220 Ga0068861_101212676 3300005719 Bacteria 730
221 Ga0068851_10455192 3300005834 Bacteria 761
222 Ga0068870_10177054 3300005840 Unclassified 1277
223 Ga0068870_10436417 3300005840 Archaea 860
224 Ga0068863_100254394 3300005841 Bacteria 1697
225 Ga0068860_100127996 3300005843 Bacteria 2435
226 Ga0068860_101186207 3300005843 Unclassified 784
227 Ga0068862_100100731 3300005844 Bacteria 2526
228 Ga0068862_100128802 3300005844 Unclassified 2237
229 Ga0068862_100238724 3300005844 Bacteria 1652
230 Ga0068862_100353747 3300005844 Unclassified 1363
231 Ga0081455_10001632 3300005937 Bacteria 27349
232 Ga0081455_10010980 3300005937 Bacteria 9129
233 Ga0081455_10020369 3300005937 Bacteria 6247
234 Ga0081455_10073252 3300005937 Bacteria 2833
235 Ga0081455_10355952 3300005937 Bacteria 1031
236 Ga0081455_10704161 3300005937 Bacteria 643
237 Ga0081538_10001314 3300005981 Bacteria 25660
238 Ga0081538_10003640 3300005981 Bacteria 14490
239 Ga0081538_10004394 3300005981 Bacteria 13016
240 Ga0081538_10009243 3300005981 Bacteria 8256
241 Ga0081538_10083532 3300005981 Bacteria 1687
242 Ga0081538_10134011 3300005981 Unclassified 1158
243 Ga0081540_1001832 3300005983 Bacteria 17820
244 Ga0081540_1003731 3300005983 Bacteria 11937
245 Ga0081540_1010067 3300005983 Bacteria 6437
246 Ga0081540_1067503 3300005983 Bacteria 1671
247 Ga0081539_10001744 3300005985 Bacteria 34702
248 Ga0081539_10020490 3300005985 Bacteria 4466
249 Ga0070717_10079377 3300006028 Bacteria 2752
250 Ga0070717_10090381 3300006028 Bacteria 2584
251 Ga0070717_10132606 3300006028 Unclassified 2144
252 Ga0075365_10079265 3300006038 Bacteria 2222
253 Ga0075365_10153619 3300006038 Bacteria 1602
254 Ga0075364_10141501 3300006051 Bacteria 1618
255 Ga0075432_10014738 3300006058 Bacteria 2663
256 Ga0075432_10094351 3300006058 Unclassified 1099
257 Ga0070715_10005627 3300006163 Bacteria 4194
258 Ga0070715_10388258 3300006163 Unclassified 772
259 Ga0070716_100001535 3300006173 Bacteria 10347
260 Ga0070712_100022142 3300006175 Bacteria 4182
261 Ga0070712_100024834 3300006175 Bacteria 3976
262 Ga0070712_100033859 3300006175 Bacteria 3459
263 Ga0070712_100269885 3300006175 Bacteria 1366
264 Ga0075366_10125474 3300006195 Bacteria 1548
265 Ga0068871_100012207 3300006358 Bacteria 6326
266 Ga0068871_100056236 3300006358 Unclassified 3197
267 Ga0075428_100105525 3300006844 Bacteria 3072
268 Ga0075428_100121597 3300006844 Unclassified 2843
269 Ga0075428_100188863 3300006844 Bacteria 2229
270 Ga0075428_100269957 3300006844 Bacteria 1830
271 Ga0075428_100396935 3300006844 Unclassified 1478
272 Ga0075428_100397842 3300006844 Bacteria 1476
273 Ga0075428_100421592 3300006844 Bacteria 1430
274 Ga0075428_100602193 3300006844 Bacteria 1174
275 Ga0075428_100612341 3300006844 Bacteria 1163
276 Ga0075430_100517428 3300006846 Unclassified 985
277 Ga0075431_100256727 3300006847 Bacteria 1775
278 Ga0075431_100262795 3300006847 Unclassified 1751
279 Ga0075433_10067965 3300006852 Bacteria 3127
280 Ga0075433_10098587 3300006852 Bacteria 2587
281 Ga0075433_10105283 3300006852 Bacteria 2499
282 Ga0075433_10157727 3300006852 Unclassified 2019
283 Ga0075433_10192041 3300006852 Bacteria 1816
284 Ga0075433_10236930 3300006852 Bacteria 1620
285 Ga0075433_10276128 3300006852 Bacteria 1489
286 Ga0075434_100039725 3300006871 Bacteria 4661
287 Ga0075434_100074461 3300006871 Bacteria 3389
288 Ga0075434_100284183 3300006871 Bacteria 1674
289 Ga0075434_100293997 3300006871 Bacteria 1644
290 Ga0075429_100019479 3300006880 Bacteria 5878
291 Ga0075429_100424302 3300006880 Unclassified 1165
292 Ga0075429_100578804 3300006880 Unclassified 984
293 Ga0068865_100123897 3300006881 Bacteria 1926
294 Ga0068865_100160948 3300006881 Bacteria 1712
295 Ga0068865_100230077 3300006881 Bacteria 1454
296 Ga0068865_100326783 3300006881 Bacteria 1235
297 Ga0068865_100848258 3300006881 Unclassified 791
298 Ga0068865_101578123 3300006881 Unclassified 589
299 Ga0075436_100015251 3300006914 Bacteria 5262
300 Ga0075436_100016564 3300006914 Bacteria 5046
301 Ga0075436_100037389 3300006914 Bacteria 3351
302 Ga0075436_100081641 3300006914 Bacteria 2242
303 Ga0097620_100227050 3300006931 Unclassified 1955
304 Ga0075435_100020293 3300007076 Bacteria 5088
305 Ga0075435_100046938 3300007076 Bacteria 3467
306 Ga0075435_100062202 3300007076 Bacteria 3029
307 Ga0075435_100170484 3300007076 Bacteria 1836
308 Ga0075435_100239734 3300007076 Bacteria 1542
309 Ga0105240_10238273 3300009093 Unclassified 2111
310 Ga0105240_11143288 3300009093 Unclassified 827
311 Ga0111539_10040883 3300009094 Bacteria 5579
312 Ga0111539_10048629 3300009094 Bacteria 5062
313 Ga0111539_10080392 3300009094 Bacteria 3834
314 Ga0111539_10133615 3300009094 Bacteria 2905
315 Ga0111539_10525573 3300009094 Unclassified 1378
316 Ga0111539_10922310 3300009094 Unclassified 1016
317 Ga0111539_11812147 3300009094 Unclassified 708
318 Ga0105245_10003939 3300009098 Bacteria 13205
319 Ga0105245_10010008 3300009098 Bacteria 8256
320 Ga0105245_10020822 3300009098 Bacteria 5749
321 Ga0105245_10034776 3300009098 Bacteria 4470
322 Ga0105245_10065952 3300009098 Bacteria 3275
323 Ga0105245_10084989 3300009098 Bacteria 2900
324 Ga0105245_10103124 3300009098 Bacteria 2642
325 Ga0105245_10746629 3300009098 Unclassified 1014
326 Ga0105245_10821808 3300009098 Bacteria 968
327 Ga0105247_10020070 3300009101 Bacteria 4017
328 Ga0114129_10017054 3300009147 Bacteria 10340
329 Ga0114129_10019724 3300009147 Bacteria 9596
330 Ga0114129_10019762 3300009147 Bacteria 9587
331 Ga0114129_10067861 3300009147 Bacteria 4973
332 Ga0114129_10217085 3300009147 Unclassified 2582
333 Ga0114129_10220430 3300009147 Bacteria 2559
334 Ga0114129_10241643 3300009147 Bacteria 2427
335 Ga0114129_10423208 3300009147 Unclassified 1751
336 Ga0114129_10453248 3300009147 Bacteria 1682
337 Ga0114129_10585608 3300009147 Unclassified 1447
338 Ga0114129_10729481 3300009147 Unclassified 1271
339 Ga0114129_10931918 3300009147 Bacteria 1098
340 Ga0114129_11380734 3300009147 Unclassified 870
341 Ga0114129_12316745 3300009147 Bacteria 644
342 Ga0105243_10023342 3300009148 Bacteria 4709
343 Ga0105243_10041832 3300009148 Bacteria 3584
344 Ga0105243_10365523 3300009148 Unclassified 1329
345 Ga0105241_10023963 3300009174 Bacteria 4531
346 Ga0105241_10055898 3300009174 Bacteria 3024
347 Ga0105241_10196612 3300009174 Bacteria 1682
348 Ga0105242_10026948 3300009176 Bacteria 4559
349 Ga0105242_10129654 3300009176 Bacteria 2175
350 Ga0105242_10176304 3300009176 Bacteria 1882
351 Ga0105248_10057042 3300009177 Bacteria 4383
352 Ga0105248_10095769 3300009177 Bacteria 3342
353 Ga0105248_10849707 3300009177 Bacteria 1030
354 Ga0105248_11695454 3300009177 Unclassified 716
355 Ga0105237_10085281 3300009545 Bacteria 3148
356 Ga0105238_10195548 3300009551 Bacteria 1998
357 Ga0105249_10000587 3300009553 Bacteria 33206
358 Ga0105249_10023380 3300009553 Bacteria 5545
359 Ga0105249_10239671 3300009553 Bacteria 1792
360 Ga0105249_10848833 3300009553 Unclassified 979
361 Ga0105249_11825997 3300009553 Unclassified 680
362 Ga0105239_10014910 3300010375 Bacteria 8615
363 Ga0105239_10846751 3300010375 Bacteria 1049
364 Ga0105239_11458945 3300010375 Bacteria 790
365 Ga0105246_10045576 3300011119 Bacteria 2987
366 Ga0105246_10165214 3300011119 Unclassified 1690
367 Ga0105246_10380959 3300011119 Bacteria 1165
368 Ga0105246_10444324 3300011119 Bacteria 1088
369 Ga0105246_10553785 3300011119 Unclassified 986
370 Ga0157343_1007170 3300012488 Bacteria 772
371 Ga0157313_1005592 3300012503 Bacteria 913
372 Ga0157339_1013329 3300012505 Unclassified 784
373 Ga0157373_10029312 3300013100 Bacteria 3964
374 Ga0157371_10028826 3300013102 Bacteria 4019
375 Ga0157374_10007194 3300013296 Bacteria 9479
376 Ga0157378_10032376 3300013297 Bacteria 4620
377 Ga0157378_10137003 3300013297 Bacteria 2270
378 Ga0157378_10494698 3300013297 Bacteria 1220
379 Ga0157378_10769191 3300013297 Unclassified 987
380 Ga0163162_10001280 3300013306 Bacteria 23542
381 Ga0163162_10043643 3300013306 Bacteria 4489
382 Ga0163162_10210045 3300013306 Bacteria 2076
383 Ga0157372_10125068 3300013307 Bacteria 2956
384 Ga0157372_10871570 3300013307 Bacteria 1045
385 Ga0157375_10004811 3300013308 Bacteria 11733
386 Ga0157375_10085557 3300013308 Bacteria 3203
387 Ga0157375_10097978 3300013308 Bacteria 3008
388 Ga0157375_10099811 3300013308 Bacteria 2982
389 Ga0157375_10119671 3300013308 Bacteria 2741
390 Ga0157375_10391205 3300013308 Bacteria 1557
391 Ga0157375_10599702 3300013308 Unclassified 1260
392 Ga0163163_10065375 3300014325 Unclassified 3610
393 Ga0163163_10134661 3300014325 Bacteria 2511
394 Ga0163163_10138821 3300014325 Bacteria 2472
395 Ga0157380_10003890 3300014326 Bacteria 10299
396 Ga0157380_10720006 3300014326 Unclassified 1005
397 Ga0157377_10000519 3300014745 Bacteria 16326
398 Ga0157377_10298941 3300014745 Bacteria 1061
399 Ga0157379_10717625 3300014968 Unclassified 939
400 Ga0157376_10007715 3300014969 Bacteria 7707
401 Ga0157376_10024449 3300014969 Bacteria 4743
402 Ga0163161_10165989 3300017792 Unclassified 1686
403 Ga0207653_10017886 3300025885 Bacteria 2233
404 Ga0207653_10018918 3300025885 Bacteria 2170
405 Ga0207692_10012193 3300025898 Bacteria 3685
406 Ga0207692_10022049 3300025898 Unclassified 2925
407 Ga0207692_10043401 3300025898 Bacteria 2237
408 Ga0207692_10043955 3300025898 Bacteria 2226
409 Ga0207692_10163298 3300025898 Unclassified 1285
410 Ga0207642_10009110 3300025899 Bacteria 3439
411 Ga0207642_10593416 3300025899 Unclassified 689
412 Ga0207710_10110716 3300025900 Unclassified 1304
413 Ga0207710_10163940 3300025900 Bacteria 1084
414 Ga0207688_10006451 3300025901 Bacteria 6389
415 Ga0207688_10030282 3300025901 Bacteria 2984
416 Ga0207680_10018430 3300025903 Bacteria 3710
417 Ga0207647_10496563 3300025904 Unclassified 681
418 Ga0207685_10015572 3300025905 Unclassified 2412
419 Ga0207685_10052420 3300025905 Bacteria 1581
420 Ga0207685_10128678 3300025905 Bacteria 1121
421 Ga0207699_10067830 3300025906 Bacteria 2170
422 Ga0207699_10086095 3300025906 Bacteria 1962
423 Ga0207699_10212009 3300025906 Unclassified 1318
424 Ga0207699_10729369 3300025906 Bacteria 726
425 Ga0207699_10855588 3300025906 Unclassified 670
426 Ga0207643_10187933 3300025908 Unclassified 1253
427 Ga0207684_10008644 3300025910 Bacteria 9045
428 Ga0207684_10031315 3300025910 Bacteria 4525
429 Ga0207684_10040129 3300025910 Bacteria 3968
430 Ga0207684_10181532 3300025910 Bacteria 1815
431 Ga0207684_10208437 3300025910 Unclassified 1686
432 Ga0207684_10240516 3300025910 Unclassified 1562
433 Ga0207654_10051469 3300025911 Bacteria 2371
434 Ga0207707_10112150 3300025912 Bacteria 2384
435 Ga0207695_10160002 3300025913 Unclassified 2184
436 Ga0207671_10691863 3300025914 Unclassified 811
437 Ga0207693_10000126 3300025915 Bacteria 68560
438 Ga0207693_10001293 3300025915 Bacteria 22224
439 Ga0207693_10004168 3300025915 Bacteria 12270
440 Ga0207693_10004553 3300025915 Bacteria 11703
441 Ga0207693_10005548 3300025915 Bacteria 10497
442 Ga0207693_10037912 3300025915 Bacteria 3798
443 Ga0207693_10038347 3300025915 Bacteria 3774
444 Ga0207693_11132472 3300025915 Unclassified 593
445 Ga0207663_10006439 3300025916 Bacteria 6008
446 Ga0207663_10021176 3300025916 Unclassified 3697
447 Ga0207663_10144275 3300025916 Unclassified 1662
448 Ga0207663_10564191 3300025916 Bacteria 891
449 Ga0207660_10110420 3300025917 Bacteria 2069
450 Ga0207660_10151637 3300025917 Bacteria 1781
451 Ga0207662_10004854 3300025918 Bacteria 7109
452 Ga0207662_10221600 3300025918 Bacteria 1232
453 Ga0207662_10785812 3300025918 Unclassified 670
454 Ga0207657_10002174 3300025919 Bacteria 21240
455 Ga0207657_10068766 3300025919 Bacteria 3008
456 Ga0207657_10277141 3300025919 Unclassified 1332
457 Ga0207649_10408558 3300025920 Bacteria 1017
458 Ga0207649_10596891 3300025920 Unclassified 849
459 Ga0207652_10086612 3300025921 Bacteria 2747
460 Ga0207652_10136087 3300025921 Bacteria 2194
461 Ga0207652_10463270 3300025921 Unclassified 1142
462 Ga0207646_10013769 3300025922 Bacteria 7719
463 Ga0207646_10034097 3300025922 Bacteria 4600
464 Ga0207646_10125331 3300025922 Unclassified 2309
465 Ga0207646_10178465 3300025922 Bacteria 1918
466 Ga0207646_10222552 3300025922 Bacteria 1705
467 Ga0207646_10238814 3300025922 Unclassified 1642
468 Ga0207646_10258289 3300025922 Unclassified 1574
469 Ga0207646_11259948 3300025922 Unclassified 647
470 Ga0207681_10126167 3300025923 Bacteria 1885
471 Ga0207681_10506741 3300025923 Unclassified 989
472 Ga0207681_10976950 3300025923 Bacteria 710
473 Ga0207687_10018369 3300025927 Bacteria 4614
474 Ga0207687_10036360 3300025927 Bacteria 3354
475 Ga0207687_10066568 3300025927 Unclassified 2561
476 Ga0207687_10291005 3300025927 Unclassified 1313
477 Ga0207687_10947775 3300025927 Unclassified 737
478 Ga0207700_10000021 3300025928 Bacteria 168335
479 Ga0207700_10051449 3300025928 Bacteria 3074
480 Ga0207700_10058666 3300025928 Archaea 2908
481 Ga0207700_10101232 3300025928 Unclassified 2298
482 Ga0207664_10074216 3300025929 Bacteria 2747
483 Ga0207664_10168815 3300025929 Unclassified 1871
484 Ga0207664_10271946 3300025929 Bacteria 1484
485 Ga0207644_10035018 3300025931 Bacteria 3516
486 Ga0207644_10187861 3300025931 Unclassified 1623
487 Ga0207644_10442472 3300025931 Bacteria 1067
488 Ga0207690_10053964 3300025932 Bacteria 2700
489 Ga0207690_10590008 3300025932 Unclassified 906
490 Ga0207706_10004640 3300025933 Bacteria 12881
491 Ga0207686_10001422 3300025934 Bacteria 13559
492 Ga0207686_10152289 3300025934 Bacteria 1611
493 Ga0207709_10000790 3300025935 Bacteria 24700
494 Ga0207709_10148433 3300025935 Bacteria 1621
495 Ga0207709_10167845 3300025935 Unclassified 1537
496 Ga0207709_10549121 3300025935 Bacteria 908
497 Ga0207670_10319459 3300025936 Bacteria 1221
498 Ga0207669_10002149 3300025937 Bacteria 8352
499 Ga0207669_10014952 3300025937 Bacteria 3903
500 Ga0207704_10017089 3300025938 Bacteria 3750
501 Ga0207704_10207153 3300025938 Bacteria 1440
502 Ga0207704_10262359 3300025938 Bacteria 1303
503 Ga0207704_11373733 3300025938 Unclassified 605
504 Ga0207665_10000494 3300025939 Bacteria 26650
505 Ga0207665_10006449 3300025939 Bacteria 7786
506 Ga0207665_10007677 3300025939 Bacteria 7121
507 Ga0207665_10009746 3300025939 Bacteria 6306
508 Ga0207691_10034963 3300025940 Bacteria 4669
509 Ga0207711_10184486 3300025941 Bacteria 1899
510 Ga0207711_10533544 3300025941 Bacteria 1094
511 Ga0207711_10820568 3300025941 Unclassified 866
512 Ga0207689_10135102 3300025942 Unclassified 2031
513 Ga0207689_10577985 3300025942 Unclassified 944
514 Ga0207689_10754666 3300025942 Bacteria 821
515 Ga0207661_10038335 3300025944 Bacteria 3756
516 Ga0207661_10507392 3300025944 Archaea 1102
517 Ga0207661_11232827 3300025944 Archaea 688
518 Ga0207679_10266565 3300025945 Archaea 1463
519 Ga0207679_10380518 3300025945 Bacteria 1237
520 Ga0207667_10487910 3300025949 Bacteria 1250
521 Ga0207667_10598603 3300025949 Bacteria 1112
522 Ga0207667_11140454 3300025949 Bacteria 761
523 Ga0207667_11145773 3300025949 Bacteria 759
524 Ga0207712_10722678 3300025961 Bacteria 871
525 Ga0207668_10165743 3300025972 Bacteria 1727
526 Ga0207668_10445188 3300025972 Bacteria 1104
527 Ga0207640_10111176 3300025981 Unclassified 1942
528 Ga0207640_10121685 3300025981 Bacteria 1871
529 Ga0207640_10123319 3300025981 Bacteria 1861
530 Ga0207677_10023679 3300026023 Bacteria 3798
531 Ga0207677_10407276 3300026023 Bacteria 1155
532 Ga0207678_10047585 3300026067 Bacteria 3708
533 Ga0207708_10000415 3300026075 Bacteria 33470
534 Ga0207708_10010983 3300026075 Bacteria 6736
535 Ga0207708_10336808 3300026075 Bacteria 1234
536 Ga0207702_10045682 3300026078 Bacteria 3685
537 Ga0207702_10053634 3300026078 Unclassified 3414
538 Ga0207702_10316656 3300026078 Bacteria 1485
539 Ga0207702_10378233 3300026078 Bacteria 1361
540 Ga0207702_10378967 3300026078 Archaea 1360
541 Ga0207702_10407837 3300026078 Bacteria 1312
542 Ga0207702_11345312 3300026078 Unclassified 708
543 Ga0207641_10078544 3300026088 Unclassified 2859
544 Ga0207648_10000705 3300026089 Bacteria 37489
545 Ga0207648_10003750 3300026089 Bacteria 15885
546 Ga0207648_10102646 3300026089 Bacteria 2507
547 Ga0207648_10300502 3300026089 Bacteria 1439
548 Ga0207648_10655238 3300026089 Bacteria 971
549 Ga0207676_10047734 3300026095 Unclassified 3320
550 Ga0207676_10437126 3300026095 Unclassified 1231
551 Ga0207674_10352195 3300026116 Bacteria 1423
552 Ga0207675_100001825 3300026118 Bacteria 21355
553 Ga0207675_100010036 3300026118 Bacteria 8877
554 Ga0207675_100013655 3300026118 Bacteria 7579
555 Ga0207675_100030987 3300026118 Bacteria 4981
556 Ga0207675_100096119 3300026118 Unclassified 2788
557 Ga0207675_100124347 3300026118 Bacteria 2443
558 Ga0207675_101058682 3300026118 Bacteria 830
559 Ga0207683_10003390 3300026121 Bacteria 13894
560 Ga0207683_10023263 3300026121 Bacteria 5327
561 Ga0207683_10392585 3300026121 Bacteria 1276
562 Ga0207683_10570246 3300026121 Unclassified 1047
563 Ga0207698_10073451 3300026142 Bacteria 2724
564 Ga0207698_10321420 3300026142 Bacteria 1449
565 Ga0207428_10012037 3300027907 Bacteria 7613
566 Ga0207428_10012691 3300027907 Bacteria 7387
567 Ga0207428_10013907 3300027907 Bacteria 7010
568 Ga0207428_10112833 3300027907 Bacteria 2090
569 Ga0268266_10006952 3300028379 Bacteria 10284
570 Ga0268265_10038854 3300028380 Bacteria 3504
571 Ga0268265_10078090 3300028380 Unclassified 2603
572 Ga0268265_10112597 3300028380 Bacteria 2225
573 Ga0268265_10220668 3300028380 Bacteria 1659
574 Ga0268264_10322409 3300028381 Bacteria 1461
575 Ga0268264_10565268 3300028381 Bacteria 1117
576 Ga0307406_10126480 3300031901 Unclassified 1787
577 Ga0307406_10798642 3300031901 Unclassified 796
578 Ga0307409_100125511 3300031995 Bacteria 2182
579 Ga0307409_100629392 3300031995 Bacteria 1064
580 Ga0307416_101950520 3300032002 Bacteria 690
581 Ga0307415_100041456 3300032126 Bacteria 3057
582 Ga0307415_100483890 3300032126 Bacteria 1078
583 Ga0307415_100991477 3300032126 Bacteria 780
584 Ga0373948_0073338 3300034817 Unclassified 771
585 Ga0373950_0043100 3300034818 Unclassified 869
586 Ga0373958_0005198 3300034819 Unclassified 1965
587 Ga0373959_0027491 3300034820 Bacteria 1130
588 Ga0373959_0036083 3300034820 Bacteria 1019
589 Ga0373938_0001272 3300034957 Unclassified 4048
590 Ga0373929_0015768 3300035085 Unclassified 1473
591 Ga0373940_0101763 3300035088 Unclassified 873
592 Ga0373949_0001749 3300035090 Bacteria 5996
593 Ga0373949_0006242 3300035090 Bacteria 2631
594 Ga0373951_0001128 3300035091 Bacteria 7102
595 Ga0373952_0055939 3300035092 Unclassified 953
596 Ga0373936_0304412 3300035113 Bacteria 720
597 Ga0373941_0001344 3300035115 Bacteria 5175
598 Ga0373941_0078079 3300035115 Bacteria 1113
599 Ga0373945_0014189 3300035116 Bacteria 2665
600 Ga0373945_0151132 3300035116 Bacteria 941
601 Ga0373960_0018706 3300035121 Bacteria 1811
602 Ga0373960_0061038 3300035121 Bacteria 1144
603 Ga0373960_0225761 3300035121 Unclassified 672
604 Ga0373943_0012734 3300035170 Bacteria 3792
605 Ga0373946_0003206 3300035171 Bacteria 5805
606 Ga0373942_0043410 3300035207 Bacteria 1235
607 Ga0373942_0053154 3300035207 Unclassified 1142
608 Ga0373961_0023497 3300035241 Archaea 1659
609 Ga0373962_0007404 3300035242 Bacteria 2687
610 Ga0373962_0025901 3300035242 Bacteria 1577
611 Ga0373931_0034755 3300035691 Bacteria 2618
612 Ga0373927_0075892 3300035695 Unclassified 2177
613 Ga0373947_0060292 3300035725 Bacteria 2303
614 Ga0373937_0501071 3300036401 Bacteria 1154
615 Ga0373925_0059240 3300037068 Bacteria 2872
616 Ga0395899_0000775 3300037312 Bacteria 31562
617 Ga0395899_0001403 3300037312 Bacteria 20652
618 Ga0395899_0002275 3300037312 Bacteria 15690
619 Ga0395899_0006761 3300037312 Bacteria 8881
620 Ga0395899_0027290 3300037312 Bacteria 4306
621 Ga0395899_0039378 3300037312 Bacteria 3538
622 Ga0395899_0041426 3300037312 Bacteria 3441
623 Ga0395899_0050383 3300037312 Bacteria 3091
624 Ga0395899_0058260 3300037312 Bacteria 2849
625 Ga0395899_0069946 3300037312 Bacteria 2569
626 Ga0395899_0073964 3300037312 Unclassified 2490
627 Ga0395899_0080290 3300037312 Bacteria 2374
628 Ga0395899_0166224 3300037312 Bacteria 1556
629 Ga0395899_0184625 3300037312 Bacteria 1462
630 Ga0395899_0226448 3300037312 Unclassified 1293
631 Ga0395899_0333453 3300037312 Bacteria 1019
632 Ga0395899_0434041 3300037312 Bacteria 863
633 Ga0395899_0462264 3300037312 Archaea 829
634 Ga0395899_0551455 3300037312 Bacteria 741
635 Ga0395900_0001501 3300037418 Bacteria 27705
636 Ga0395900_0002828 3300037418 Bacteria 18940
637 Ga0395900_0003593 3300037418 Bacteria 16669
638 Ga0395900_0004261 3300037418 Bacteria 15184
639 Ga0395900_0006278 3300037418 Bacteria 12400
640 Ga0395900_0012186 3300037418 Bacteria 8788
641 Ga0395900_0021493 3300037418 Bacteria 6599
642 Ga0395900_0023612 3300037418 Bacteria 6291
643 Ga0395900_0039067 3300037418 Bacteria 4891
644 Ga0395900_0050303 3300037418 Bacteria 4293
645 Ga0395900_0050757 3300037418 Bacteria 4272
646 Ga0395900_0090007 3300037418 Bacteria 3154
647 Ga0395900_0150523 3300037418 Bacteria 2377
648 Ga0395900_0220790 3300037418 Bacteria 1910
649 Ga0395900_0238466 3300037418 Bacteria 1825
650 Ga0395900_0239974 3300037418 Bacteria 1819
651 Ga0395900_0255155 3300037418 Archaea 1753
652 Ga0395900_0425495 3300037418 Bacteria 1288
653 Ga0395900_0461227 3300037418 Bacteria 1225
654 Ga0395900_0491270 3300037418 Bacteria 1179
655 Ga0395900_0572930 3300037418 Unclassified 1071
656 Ga0395900_1083058 3300037418 Unclassified 719
657 Ga0395900_1499972 3300037418 Unclassified 586
658 Ga0395898_0001134 3300037466 Bacteria 40919
659 Ga0395898_0002545 3300037466 Bacteria 21392
660 Ga0395898_0002887 3300037466 Bacteria 19601
661 Ga0395898_0003194 3300037466 Bacteria 18454
662 Ga0395898_0003476 3300037466 Bacteria 17597
663 Ga0395898_0005122 3300037466 Bacteria 14200
664 Ga0395898_0005553 3300037466 Bacteria 13601
665 Ga0395898_0013807 3300037466 Bacteria 8303
666 Ga0395898_0015187 3300037466 Bacteria 7905
667 Ga0395898_0015522 3300037466 Bacteria 7810
668 Ga0395898_0019220 3300037466 Bacteria 6955
669 Ga0395898_0022052 3300037466 Bacteria 6451
670 Ga0395898_0043124 3300037466 Bacteria 4446
671 Ga0395898_0060193 3300037466 Bacteria 3691
672 Ga0395898_0061583 3300037466 Bacteria 3645
673 Ga0395898_0073442 3300037466 Bacteria 3304
674 Ga0395898_0089745 3300037466 Bacteria 2958
675 Ga0395898_0125406 3300037466 Bacteria 2460
676 Ga0395898_0217520 3300037466 Bacteria 1822
677 Ga0395898_0280861 3300037466 Bacteria 1588
678 Ga0395898_0458317 3300037466 Unclassified 1214
679 Ga0395898_0484824 3300037466 Bacteria 1176
680 Ga0395898_0625136 3300037466 Bacteria 1019
681 Ga0395898_0678038 3300037466 Unclassified 973
682 Ga0395898_0714038 3300037466 Bacteria 944
683 Ga0395905_0001871 3300037471 Bacteria 24226
684 Ga0395905_0002236 3300037471 Bacteria 21813
685 Ga0395905_0010133 3300037471 Bacteria 9187
686 Ga0395905_0012265 3300037471 Bacteria 8255
687 Ga0395905_0014700 3300037471 Bacteria 7465
688 Ga0395905_0015560 3300037471 Bacteria 7228
689 Ga0395905_0018237 3300037471 Bacteria 6662
690 Ga0395905_0019186 3300037471 Bacteria 6485
691 Ga0395905_0025816 3300037471 Bacteria 5538
692 Ga0395905_0061951 3300037471 Bacteria 3499
693 Ga0395905_0065302 3300037471 Bacteria 3407
694 Ga0395905_0070105 3300037471 Bacteria 3284
695 Ga0395905_0093759 3300037471 Bacteria 2816
696 Ga0395905_0108121 3300037471 Bacteria 2611
697 Ga0395905_0184364 3300037471 Bacteria 1959
698 Ga0395905_0184686 3300037471 Bacteria 1957
699 Ga0395905_0243324 3300037471 Bacteria 1681
700 Ga0395905_0309575 3300037471 Unclassified 1468
701 Ga0395905_0322654 3300037471 Bacteria 1434
702 Ga0395905_0634795 3300037471 Unclassified 970
703 Ga0395905_0711747 3300037471 Bacteria 906
704 Ga0395901_0001042 3300038443 Bacteria 29911
705 Ga0395901_0002958 3300038443 Bacteria 17133
706 Ga0395901_0005040 3300038443 Bacteria 13338
707 Ga0395901_0005491 3300038443 Bacteria 12845
708 Ga0395901_0006426 3300038443 Bacteria 11911
709 Ga0395901_0010190 3300038443 Bacteria 9522
710 Ga0395901_0011115 3300038443 Bacteria 9123
711 Ga0395901_0012512 3300038443 Bacteria 8609
712 Ga0395901_0018217 3300038443 Bacteria 7169
713 Ga0395901_0020672 3300038443 Bacteria 6737
714 Ga0395901_0023419 3300038443 Bacteria 6330
715 Ga0395901_0023693 3300038443 Bacteria 6295
716 Ga0395901_0025239 3300038443 Bacteria 6101
717 Ga0395901_0043201 3300038443 Bacteria 4675
718 Ga0395901_0046348 3300038443 Bacteria 4515
719 Ga0395901_0057024 3300038443 Bacteria 4063
720 Ga0395901_0081651 3300038443 Bacteria 3377
721 Ga0395901_0087758 3300038443 Bacteria 3252
722 Ga0395901_0097658 3300038443 Archaea 3080
723 Ga0395901_0149624 3300038443 Bacteria 2453
724 Ga0395901_0155658 3300038443 Unclassified 2400
725 Ga0395901_0187547 3300038443 Bacteria 2169
726 Ga0395901_0193023 3300038443 Bacteria 2135
727 Ga0395901_0287413 3300038443 Bacteria 1707
728 Ga0395901_0438496 3300038443 Unclassified 1337
729 Ga0395901_0571158 3300038443 Unclassified 1144
730 Ga0395901_0882263 3300038443 Bacteria 877
731 Ga0395901_1568813 3300038443 Unclassified 612
732 Ga0451789_0320105 3300041443 Bacteria 2746
733 Ga0451793_0230547 3300041452 Bacteria 5076
734 Ga0451797_1344230 3300041453 Bacteria 1209
735 Ga0451795_1321968 3300041456 Unclassified 1605
736 Ga0451798_1077237 3300041458 Bacteria 1841
737 Ga0451800_0564701 3300041459 Bacteria 838
738 Ga0451802_0775119 3300041460 Bacteria 2607
739 Ga0451804_0399589 3300041463 Bacteria 2744
740 Ga0451807_0017034 3300041486 Bacteria 1791
741 Ga0451839_0685172 3300041496 Unclassified 1967
742 Ga0451845_0385095 3300041501 Bacteria 1872
743 Ga0451847_0819308 3300041503 Bacteria 2208
744 Ga0451849_1319872 3300041505 Bacteria 740
745 Ga0451853_0526476 3300041512 Archaea 867
746 Ga0451853_1318362 3300041512 Bacteria 2441
747 Ga0451853_1496837 3300041512 Bacteria 1612
748 Ga0451853_1957809 3300041512 Bacteria 985
749 Ga0451853_2523145 3300041512 Bacteria 1125
750 Ga0451853_2580887 3300041512 Bacteria 1492
751 Ga0451853_3083970 3300041512 Bacteria 1093
752 Ga0439448_0046166 3300042005 Bacteria 1419
753 Ga0450915_000171 3300042119 Unclassified 1834
754 Ga0439458_0013062 3300042157 Bacteria 1867
755 Ga0439464_0087647 3300042439 Viruses 935
756 Ga0450893_0050378 3300042532 Bacteria 779
757 Ga0439440_0133181 3300042993 Unclassified 701
758 Ga0466965_0067611 3300044683 Bacteria 1794
759 Ga0466964_0027216 3300044706 Bacteria 2244
760 Ga0466964_0211381 3300044706 Unclassified 937
761 Ga0466968_0045476 3300044735 Bacteria 1863
762 Ga0466968_0062485 3300044735 Bacteria 1608
763 Ga0466968_0062895 3300044735 Bacteria 1604
764 Ga0466968_0423074 3300044735 Unclassified 655
765 Ga0466960_0004277 3300044901 Bacteria 5564
766 Ga0466960_0333241 3300044901 Bacteria 862
767 Ga0451576_0058063 3300045051 Bacteria 4044
768 Ga0451576_1625391 3300045051 Bacteria 670
769 Ga0466967_0004808 3300045976 Bacteria 9205
770 Ga0495603_0000062 3300046455 Bacteria 46880
771 Ga0495603_0042819 3300046455 Unclassified 2705
772 Ga0495603_0350934 3300046455 Archaea 846
773 Ga0495641_0011742 3300046461 Bacteria 4958
774 Ga0495641_0032927 3300046461 Bacteria 2464
775 Ga0495641_0040948 3300046461 Bacteria 2153
776 Ga0495580_0156072 3300046472 Bacteria 1580
777 Ga0495582_0033727 3300046473 Bacteria 2815
778 Ga0495582_0038176 3300046473 Bacteria 2642
779 Ga0495582_0590757 3300046473 Unclassified 642
780 Ga0495605_0062515 3300046474 Bacteria 1779
781 Ga0495605_0075577 3300046474 Bacteria 1584
782 Ga0495639_0027197 3300046475 Unclassified 2531
783 Ga0495639_0027639 3300046475 Bacteria 2512
784 Ga0495639_0158859 3300046475 Archaea 1093
785 Ga0495584_0032729 3300046491 Unclassified 2631
786 Ga0495584_0065400 3300046491 Bacteria 1829
787 Ga0495584_0244774 3300046491 Bacteria 912
788 Ga0495584_0257056 3300046491 Bacteria 888
789 Ga0495585_0341657 3300046492 Unclassified 729
790 Ga0495594_0000447 3300046499 Bacteria 20925
791 Ga0495594_0050418 3300046499 Unclassified 2289
792 Ga0495596_0133762 3300046500 Unclassified 962
793 Ga0495630_0087451 3300046517 Unclassified 2353
794 Ga0495631_0113571 3300046518 Unclassified 1165
795 Ga0495631_0130620 3300046518 Bacteria 1079
796 Ga0495631_0200152 3300046518 Bacteria 854
797 Ga0495637_0158943 3300046520 Archaea 849
798 Ga0495644_0125316 3300046523 Archaea 978
799 Ga0495663_0001805 3300046525 Bacteria 6618
800 Ga0495663_0013804 3300046525 Bacteria 2259
801 Ga0495663_0024696 3300046525 Bacteria 1748
802 Ga0495666_0036927 3300046526 Unclassified 2378
803 Ga0495666_0226618 3300046526 Bacteria 855
804 Ga0495642_0038014 3300046528 Unclassified 1949
805 Ga0495665_0099189 3300046531 Bacteria 1529
806 Ga0495609_0058356 3300046538 Unclassified 1707
807 Ga0495656_0021925 3300046615 Bacteria 2494
808 Ga0495656_0124863 3300046615 Archaea 1219
809 Ga0495611_0063179 3300046648 Unclassified 1685
810 Ga0495659_0049444 3300046664 Bacteria 1527
811 Ga0495659_0054375 3300046664 Unclassified 1465
812 Ga0495659_0185910 3300046664 Bacteria 848
813 Ga0495661_0153580 3300046665 Bacteria 1242
814 Ga0495588_0000632 3300046674 Bacteria 16378
815 Ga0495588_0258791 3300046674 Unclassified 917
816 Ga0495647_0004331 3300046681 Bacteria 4602
817 Ga0495658_0054043 3300046683 Bacteria 2283
818 Ga0495658_0169849 3300046683 Bacteria 1349
819 Ga0495658_0264885 3300046683 Bacteria 1082
820 Ga0495669_0003905 3300046684 Bacteria 6134
821 Ga0495613_0116752 3300046689 Bacteria 1919
822 Ga0495613_0165764 3300046689 Bacteria 1570
823 Ga0495624_0278848 3300046690 Bacteria 1009
824 Ga0495670_0546789 3300046691 Bacteria 630
825 Ga0495671_0077488 3300046692 Bacteria 1630
826 Ga0495589_0088044 3300046794 Bacteria 1508
827 Ga0495581_0002069 3300047315 Bacteria 11286
828 Ga0495581_0113815 3300047315 Bacteria 1573
829 Ga0495676_0000253 3300047321 Bacteria 43107
830 Ga0495676_0075995 3300047321 Bacteria 2566
831 Ga0495683_0037965 3300047323 Unclassified 2440
832 Ga0495683_0135840 3300047323 Bacteria 1156
833 Ga0495677_0063284 3300047445 Unclassified 1374
834 Ga0495677_0095312 3300047445 Bacteria 1124
835 Ga0495685_013727 3300047447 Unclassified 2750
836 Ga0496100_0021816 3300048903 Bacteria 3864
837 Ga0496101_0002526 3300048904 Bacteria 11238
838 Ga0496101_0047027 3300048904 Bacteria 3096
839 Ga0496101_0069307 3300048904 Bacteria 2580
840 Ga0496101_0215659 3300048904 Bacteria 1488
841 Ga0496101_0263142 3300048904 Unclassified 1345
842 Ga0496101_0288473 3300048904 Bacteria 1284
843 Ga0496101_0334627 3300048904 Bacteria 1189
844 Ga0496101_0557067 3300048904 Bacteria 906
845 Ga0496102_0010584 3300048905 Bacteria 7944
846 Ga0496102_0017379 3300048905 Bacteria 6301
847 Ga0496102_0054400 3300048905 Bacteria 3649
848 Ga0496102_0145825 3300048905 Bacteria 2222
849 Ga0496102_0174862 3300048905 Bacteria 2022
850 Ga0496103_0001169 3300048906 Bacteria 18049
851 Ga0496103_0017711 3300048906 Bacteria 4265
852 Ga0496103_0031656 3300048906 Bacteria 3224
853 Ga0496103_0034389 3300048906 Bacteria 3099
854 Ga0496103_0126191 3300048906 Unclassified 1632
855 Ga0496103_0395622 3300048906 Unclassified 888
856 Ga0496104_0002508 3300048907 Bacteria 15797
857 Ga0496104_0003548 3300048907 Bacteria 13455
858 Ga0496104_0007013 3300048907 Bacteria 9936
859 Ga0496104_0094964 3300048907 Bacteria 2853
860 Ga0496104_0125302 3300048907 Bacteria 2467
861 Ga0496104_0448150 3300048907 Bacteria 1202
862 Ga0496104_0834292 3300048907 Unclassified 827
863 Ga0496105_0000042 3300048908 Bacteria 114886
864 Ga0496105_0002088 3300048908 Bacteria 14454
865 Ga0496105_0004474 3300048908 Bacteria 10522
866 Ga0496105_0031817 3300048908 Unclassified 4327
867 Ga0496105_0048021 3300048908 Bacteria 3523
868 Ga0496105_0282175 3300048908 Bacteria 1339
869 Ga0496105_0733278 3300048908 Unclassified 756
870 Ga0496106_0003639 3300048909 Bacteria 11495
871 Ga0496106_0024597 3300048909 Bacteria 4478
872 Ga0496106_0052951 3300048909 Bacteria 3064
873 Ga0496106_0253920 3300048909 Bacteria 1406
874 Ga0496106_0278075 3300048909 Unclassified 1341
875 Ga0496107_0005238 3300048910 Bacteria 8855
876 Ga0496107_0006172 3300048910 Bacteria 8231
877 Ga0496107_0053510 3300048910 Bacteria 2912
878 Ga0496107_0093718 3300048910 Bacteria 2196
879 Ga0496107_0205433 3300048910 Bacteria 1464
880 Ga0496107_0263602 3300048910 Unclassified 1282
881 Ga0496107_0312329 3300048910 Unclassified 1170
882 Ga0496107_0494679 3300048910 Unclassified 907
883 Ga0496107_0560725 3300048910 Bacteria 846
884 Ga0496108_0001658 3300048911 Bacteria 17647
885 Ga0496108_0002105 3300048911 Bacteria 15931
886 Ga0496108_0005226 3300048911 Bacteria 10483
887 Ga0496108_0027073 3300048911 Bacteria 4730
888 Ga0496108_0033984 3300048911 Bacteria 4235
889 Ga0496108_0053108 3300048911 Unclassified 3397
890 Ga0496108_0074457 3300048911 Bacteria 2867
891 Ga0496108_0089930 3300048911 Bacteria 2610
892 Ga0496108_0392728 3300048911 Bacteria 1212
893 Ga0496108_0433756 3300048911 Bacteria 1148
894 Ga0496109_0001502 3300048912 Bacteria 19387
895 Ga0496109_0001909 3300048912 Bacteria 17319
896 Ga0496109_0024719 3300048912 Bacteria 5344
897 Ga0496109_0045446 3300048912 Bacteria 3985
898 Ga0496109_0048017 3300048912 Bacteria 3883
899 Ga0496109_0075569 3300048912 Unclassified 3097
900 Ga0496109_0113098 3300048912 Bacteria 2525
901 Ga0496109_0129471 3300048912 Bacteria 2355
902 Ga0496109_0218296 3300048912 Bacteria 1793
903 Ga0496109_0241444 3300048912 Archaea 1700
904 Ga0496110_0000050 3300048913 Bacteria 59023
905 Ga0496110_0001137 3300048913 Bacteria 18822
906 Ga0496110_0001795 3300048913 Bacteria 15825
907 Ga0496110_0022287 3300048913 Bacteria 5377
908 Ga0496110_0070475 3300048913 Bacteria 3098
909 Ga0496110_0213997 3300048913 Bacteria 1752
910 Ga0496110_0256436 3300048913 Bacteria 1592
911 Ga0496110_0459417 3300048913 Bacteria 1160
912 Ga0496110_0521517 3300048913 Bacteria 1081
913 Ga0496110_1097967 3300048913 Bacteria 704
914 Ga0496111_0000439 3300048914 Bacteria 21067
915 Ga0496111_0007210 3300048914 Bacteria 7270
916 Ga0496111_0011817 3300048914 Bacteria 5894
917 Ga0496111_0039662 3300048914 Bacteria 3378
918 Ga0496111_0071825 3300048914 Bacteria 2519
919 Ga0496111_0073134 3300048914 Archaea 2496
920 Ga0496111_0074143 3300048914 Bacteria 2478
921 Ga0496111_0084761 3300048914 Bacteria 2317
922 Ga0496111_0192018 3300048914 Bacteria 1518
923 Ga0496111_0699600 3300048914 Unclassified 737
924 Ga0496112_0002189 3300048915 Bacteria 15555
925 Ga0496112_0026197 3300048915 Bacteria 5608
926 Ga0496112_0045844 3300048915 Unclassified 4285
927 Ga0496112_0116095 3300048915 Bacteria 2647
928 Ga0496112_0120286 3300048915 Bacteria 2596
929 Ga0496112_0153365 3300048915 Bacteria 2271
930 Ga0496112_0175879 3300048915 Unclassified 2105
931 Ga0496112_0324959 3300048915 Bacteria 1482
932 Ga0496112_0396200 3300048915 Bacteria 1320
933 Ga0496112_0488245 3300048915 Bacteria 1168
934 Ga0496112_0506847 3300048915 Bacteria 1142
935 Ga0496112_1508291 3300048915 Archaea 586
936 Ga0496113_0000348 3300048916 Bacteria 22048
937 Ga0496113_0000517 3300048916 Bacteria 19082
938 Ga0496113_0009673 3300048916 Bacteria 6334
939 Ga0496113_0029294 3300048916 Bacteria 3974
940 Ga0496113_0111443 3300048916 Bacteria 2130
941 Ga0496113_0280551 3300048916 Bacteria 1332
942 Ga0496113_0437640 3300048916 Bacteria 1050
943 Ga0496113_0587988 3300048916 Bacteria 892
944 Ga0496113_0736272 3300048916 Unclassified 786
945 Ga0496114_0006533 3300048917 Bacteria 9188
946 Ga0496114_0040776 3300048917 Bacteria 3845
947 Ga0496114_0049698 3300048917 Bacteria 3490
948 Ga0496114_0103919 3300048917 Bacteria 2429
949 Ga0496114_0146754 3300048917 Archaea 2045
950 Ga0496114_0386149 3300048917 Bacteria 1240
951 Ga0496115_0013945 3300048918 Bacteria 6081
952 Ga0496115_0148931 3300048918 Unclassified 1932
953 Ga0496115_0167086 3300048918 Bacteria 1819
954 Ga0501031_0039879 3300049568 Bacteria 3065
955 Ga0501033_0029867 3300049570 Bacteria 4097
956 Ga0501034_1235817 3300049571 Unclassified 625
957 Ga0501037_0012082 3300049573 Bacteria 6360
958 Ga0501038_0035611 3300049574 Bacteria 4369
959 Ga0501039_0306821 3300049575 Bacteria 1248
960 Ga0501039_1226076 3300049575 Unclassified 580
961 Ga0501040_0344775 3300049576 Bacteria 1067
962 Ga0501040_1131388 3300049576 Unclassified 568
963 Ga0501041_0479501 3300049577 Unclassified 790
964 Ga0501043_0039517 3300049579 Bacteria 3707
965 Ga0501046_0039413 3300049580 Bacteria 3783
966 Ga0501048_0029528 3300049582 Bacteria 3975
967 Ga0501067_0003623 3300049583 Bacteria 8506
968 Ga0501067_0501486 3300049583 Bacteria 679
969 Ga0501068_0001555 3300049584 Bacteria 12194
970 Ga0501069_0009481 3300049585 Bacteria 5138
971 Ga0501069_0127936 3300049585 Unclassified 1453
972 Ga0501070_0025384 3300049586 Bacteria 4971
973 Ga0501071_0130915 3300049587 Bacteria 1863
974 Ga0501073_0023529 3300049589 Bacteria 4423
975 Ga0501074_0136769 3300049590 Bacteria 1752
976 Ga0501075_1176213 3300049591 Unclassified 582
977 Ga0501076_0379388 3300049592 Unclassified 1162
978 Ga0501077_0225333 3300049593 Bacteria 1191
979 Ga0501079_0155730 3300049741 Bacteria 1781
980 Ga0501079_0575980 3300049741 Unclassified 885
981 Ga0501080_0301740 3300049742 Unclassified 1452
982 Ga0501081_0132516 3300049743 Bacteria 1781
983 Ga0501081_0754444 3300049743 Unclassified 731
984 Ga0501044_0199243 3300049823 Bacteria 1961
985 nmdc:mga03683_315896_c1 3300050489 Bacteria 735
986 nmdc:mga0yw44_138644_c1 3300050492 Unclassified 1579
987 nmdc:mga0k408_55235_c3 3300050493 Unclassified 1200
988 nmdc:mga04h51_415833_c1 3300050495 Unclassified 565
989 nmdc:mga05p37_1093043_c1 3300050507 Bacteria 836
990 nmdc:mga05p37_125218_c1 3300050507 Bacteria 3156
991 nmdc:mga05p37_144869_c1 3300050507 Unclassified 2515
992 nmdc:mga05p37_201237_c1 3300050507 Bacteria 2412
993 nmdc:mga05p37_24422_c1 3300050507 Bacteria 7346
994 nmdc:mga05p37_24663_c1 3300050507 Bacteria 7310
995 nmdc:mga05p37_334144_c1 3300050507 Unclassified 1789
996 nmdc:mga05p37_389894_c1 3300050507 Unclassified 1629
997 nmdc:mga05p37_396048_c1 3300050507 Bacteria 1614
998 nmdc:mga05p37_50290_c1 3300050507 Bacteria 5126
999 nmdc:mga05p37_543758_c1 3300050507 Bacteria 1324
1000 nmdc:mga05p37_83026_c1 3300050507 Bacteria 3947
1001 nmdc:mga09592_417436_c1 3300050508 Bacteria 1159
1002 nmdc:mga09592_57738_c1 3300050508 Bacteria 3281
1003 nmdc:mga0qj67_308794_c1 3300050509 Unclassified 1281
1004 nmdc:mga0qj67_97880_c1 3300050509 Bacteria 2363
1005 nmdc:mga06r32_178969_c1 3300050510 Bacteria 2106
1006 nmdc:mga06r32_179427_c1 3300050510 Bacteria 2103
1007 nmdc:mga06r32_239719_c1 3300050510 Bacteria 1801
1008 nmdc:mga08y16_1009019_c1 3300050511 Bacteria 812
1009 nmdc:mga08y16_265682_c1 3300050511 Unclassified 1771
1010 nmdc:mga08y16_312266_c1 3300050511 Unclassified 1619
1011 nmdc:mga08y16_35012_c1 3300050511 Bacteria 5275
1012 nmdc:mga08y16_55059_c1 3300050511 Bacteria 4158
1013 nmdc:mga08y16_670243_c1 3300050511 Bacteria 1040
1014 nmdc:mga0n895_1030864_c1 3300050512 Unclassified 803
1015 nmdc:mga0n895_109943_c1 3300050512 Bacteria 2772
1016 nmdc:mga0n895_231138_c1 3300050512 Bacteria 1877
1017 nmdc:mga0n895_740497_c1 3300050512 Bacteria 977
1018 nmdc:mga0rr50_211727_c1 3300050513 Bacteria 1597
1019 nmdc:mga0rr50_579811_c1 3300050513 Unclassified 956
1020 nmdc:mga0rr50_7492_c1 3300050513 Bacteria 6737
1021 nmdc:mga0rr50_84991_c1 3300050513 Bacteria 2451
1022 nmdc:mga08x19_13594_c1 3300050514 Bacteria 4923
1023 nmdc:mga08x19_14962_c2 3300050514 Bacteria 3315
1024 nmdc:mga08x19_21012_c1 3300050514 Unclassified 4027
1025 nmdc:mga08x19_272937_c1 3300050514 Bacteria 1171
1026 nmdc:mga08x19_592281_c1 3300050514 Bacteria 786
1027 nmdc:mga08x19_6183_c1 3300050514 Bacteria 7081
1028 nmdc:mga08x19_98551_c1 3300050514 Bacteria 1936
1029 nmdc:mga0a205_1081154_c1 3300050515 Archaea 649
1030 nmdc:mga0a205_112662_c1 3300050515 Bacteria 2620
1031 nmdc:mga0a205_1128227_c1 3300050515 Bacteria 632
1032 nmdc:mga0a205_119284_c1 3300050515 Bacteria 2537
1033 nmdc:mga0a205_135354_c1 3300050515 Bacteria 2364
1034 nmdc:mga0a205_188610_c1 3300050515 Unclassified 1954
1035 nmdc:mga0a205_40605_c1 3300050515 Unclassified 4480
1036 nmdc:mga0a205_41461_c1 3300050515 Bacteria 4433
1037 nmdc:mga0a205_6925_c1 3300050515 Bacteria 10250
1038 nmdc:mga0a205_735184_c1 3300050515 Unclassified 836
1039 Ga0501084_0026849 3300054114 Bacteria 4809
1040 Ga0501084_0344986 3300054114 Bacteria 1258
1041 Ga0501084_0686575 3300054114 Unclassified 864
1042 Ga0501082_0040269 3300060353 Bacteria 4030
1043 Ga0501082_0620675 3300060353 Unclassified 946
1044 Ga0530510_0007885 3300061734 Bacteria 7427
1045 Ga0114129_10830975
1046 ARCol0yngRDRAFT_1002586
1047 JGI24744J21845_10002375
1048 JGI24742J22300_10004954
1049 JGI25407J50210_10003405
1050 JGI25407J50210_10003428
1051 Ga0070676_10118106
1052 Ga0070676_10945731
1053 Ga0070683_100116483
1054 Ga0070683_100501566
1055 Ga0070683_101416551
1056 Ga0070690_100037841
1057 Ga0070690_100086345
1058 Ga0068869_100182735
1059 Ga0070666_10031090
1060 Ga0070680_100005260
1061 Ga0070680_100757823
1062 Ga0070682_100012384
1063 Ga0070682_100028428
1064 Ga0070682_100121836
1065 Ga0070682_100366460
1066 Ga0068868_100007477
1067 Ga0068868_100033702
1068 Ga0068868_100196786
1069 Ga0068868_100332674
1070 Ga0070660_100017417
1071 Ga0070660_100103703
1072 Ga0070660_100251912
1073 Ga0070689_100180337
1074 Ga0070691_10020515
1075 Ga0070691_10048520
1076 Ga0070691_10173078
1077 Ga0070687_100002213
1078 Ga0070687_100491928
1079 Ga0070661_100327454
1080 Ga0070692_10039170
1081 Ga0070668_100013775
1082 Ga0070668_100103386
1083 Ga0070669_100049662
1084 Ga0070669_100119235
1085 Ga0070669_100136816
1086 Ga0070671_100019046
1087 Ga0070671_100160733
1088 Ga0070671_100501361
1089 Ga0070674_100007121
1090 Ga0070674_100061048
1091 Ga0070674_100785521
1092 Ga0070673_100111008
1093 Ga0070673_100436543
1094 Ga0070688_100027191
1095 Ga0070659_100006017
1096 Ga0070667_100807062
1097 Ga0070703_10016248
1098 Ga0070703_10046578
1099 Ga0070703_10274980
1100 Ga0070709_10172234
1101 Ga0070709_10233108
1102 Ga0070709_10247637
1103 Ga0070714_100043410
1104 Ga0070713_100030152
1105 Ga0070713_100140964
1106 Ga0070713_100146039
1107 Ga0070713_100199280
1108 Ga0070713_100547983
1109 Ga0070710_10007964
1110 Ga0070710_10011401
1111 Ga0070710_10015753
1112 Ga0070710_10807793
1113 Ga0070701_10143856
1114 Ga0070701_10407624
1115 Ga0070701_10578796
1116 Ga0070711_100044986
1117 Ga0070711_100088282
1118 Ga0070711_100154294
1119 Ga0070711_100308387
1120 Ga0070711_100758533
1121 Ga0070705_100006285
1122 Ga0070705_100017233
1123 Ga0070705_100023676
1124 Ga0070705_100065951
1125 Ga0070705_100152479
1126 Ga0070705_100243093
1127 Ga0070705_100628299
1128 Ga0070705_101047777
1129 Ga0070705_101370163
1130 Ga0070700_100002719
1131 Ga0070700_100323038
1132 Ga0070700_100566038
1133 Ga0070694_100010676
1134 Ga0070694_100093215
1135 Ga0070694_100155948
1136 Ga0070694_100193476
1137 Ga0070694_100825827
1138 Ga0070708_100010130
1139 Ga0070708_100033519
1140 Ga0070708_100065685
1141 Ga0070708_100228256
1142 Ga0070708_100234230
1143 Ga0070708_100335223
1144 Ga0070708_100409001
1145 Ga0070708_100629584
1146 Ga0070708_100698584
1147 Ga0070708_100971799
1148 Ga0070663_100003020
1149 Ga0070663_100032578
1150 Ga0070663_101323503
1151 Ga0070678_100004375
1152 Ga0070678_100116013
1153 Ga0070678_100526519
1154 Ga0070662_100034736
1155 Ga0070662_100426494
1156 Ga0070662_100633830
1157 Ga0070681_10544258
1158 Ga0068867_100005708
1159 Ga0068867_100009137
1160 Ga0068867_100528928
1161 Ga0068867_100734118
1162 Ga0070685_10064227
1163 Ga0070685_10105360
1164 Ga0070685_10144724
1165 Ga0070706_100009405
1166 Ga0070706_100015165
1167 Ga0070706_100019076
1168 Ga0070706_100087090
1169 Ga0070706_100103080
1170 Ga0070706_100185132
1171 Ga0070707_100001783
1172 Ga0070707_100024924
1173 Ga0070707_100070727
1174 Ga0070707_100071604
1175 Ga0070707_100165466
1176 Ga0070707_100174490
1177 Ga0070707_100877839
1178 Ga0070698_100003764
1179 Ga0070698_100011310
1180 Ga0070698_100016699
1181 Ga0070698_100304001
1182 Ga0070698_100425874
1183 Ga0070698_100485650
1184 Ga0070698_100567355
1185 Ga0070698_101115739
1186 Ga0070699_100048536
1187 Ga0070699_100080796
1188 Ga0070699_100101562
1189 Ga0070699_100267627
1190 Ga0070679_100048241
1191 Ga0070679_100105399
1192 Ga0070679_100185002
1193 Ga0070684_100034381
1194 Ga0070684_100045720
1195 Ga0070684_100076939
1196 Ga0070684_100082189
1197 Ga0070684_100172646
1198 Ga0070684_100295315
1199 Ga0070697_100080962
1200 Ga0070697_100124922
1201 Ga0070697_100307182
1202 Ga0068853_100003873
1203 Ga0068853_100931623
1204 Ga0070672_100158034
1205 Ga0070672_100218507
1206 Ga0070686_100000943
1207 Ga0070686_100313735
1208 Ga0070686_100573985
1209 Ga0070695_100012438
1210 Ga0070695_100135041
1211 Ga0070695_100196576
1212 Ga0070695_100348663
1213 Ga0070696_100007393
1214 Ga0070696_100012491
1215 Ga0070696_100160931
1216 Ga0070696_100359865
1217 Ga0070696_100411692
1218 Ga0070693_100031739
1219 Ga0070693_100045336
1220 Ga0070693_100336732
1221 Ga0070665_100105153
1222 Ga0070704_100019935
1223 Ga0070704_100046083
1224 Ga0070704_100054858
1225 Ga0070704_100099335
1226 Ga0070704_100182344
1227 Ga0070704_100325996
1228 Ga0070704_100383010
1229 Ga0070704_100702712
1230 Ga0068855_100129831
1231 Ga0068855_100164430
1232 Ga0068855_100185558
1233 Ga0068855_100297477
1234 Ga0068855_101140718
1235 Ga0070664_100231336
1236 Ga0068857_100002049
1237 Ga0068857_100330839
1238 Ga0068854_100114950
1239 Ga0068854_100145231
1240 Ga0068854_100405474
1241 Ga0068856_100024228
1242 Ga0068856_100104638
1243 Ga0068856_100126707
1244 Ga0068856_100286257
1245 Ga0068856_101335245
1246 Ga0070702_100018435
1247 Ga0070702_100021765
1248 Ga0070702_100048163
1249 Ga0070702_100484537
1250 Ga0070702_100686655
1251 Ga0068852_101040223
1252 Ga0068852_101279306
1253 Ga0068859_100227040
1254 Ga0068864_100061528
1255 Ga0068864_100857961
1256 Ga0068866_10000764
1257 Ga0068866_10003892
1258 Ga0068866_10080015
1259 Ga0068866_10229353
1260 Ga0068866_10401324
1261 Ga0068861_100007355
1262 Ga0068861_100036976
1263 Ga0068861_100261204
1264 Ga0068861_101212676
1265 Ga0068851_10455192
1266 Ga0068870_10177054
1267 Ga0068870_10436417
1268 Ga0068863_100254394
1269 Ga0068860_100127996
1270 Ga0068860_101186207
1271 Ga0068862_100100731
1272 Ga0068862_100128802
1273 Ga0068862_100238724
1274 Ga0068862_100353747
1275 Ga0081455_10001632
1276 Ga0081455_10010980
1277 Ga0081455_10020369
1278 Ga0081455_10073252
1279 Ga0081455_10355952
1280 Ga0081455_10704161
1281 Ga0081538_10001314
1282 Ga0081538_10003640
1283 Ga0081538_10004394
1284 Ga0081538_10009243
1285 Ga0081538_10083532
1286 Ga0081538_10134011
1287 Ga0081540_1001832
1288 Ga0081540_1003731
1289 Ga0081540_1010067
1290 Ga0081540_1067503
1291 Ga0081539_10001744
1292 Ga0081539_10020490
1293 Ga0070717_10079377
1294 Ga0070717_10090381
1295 Ga0070717_10132606
1296 Ga0075365_10079265
1297 Ga0075365_10153619
1298 Ga0075364_10141501
1299 Ga0075432_10014738
1300 Ga0075432_10094351
1301 Ga0070715_10005627
1302 Ga0070715_10388258
1303 Ga0070716_100001535
1304 Ga0070712_100022142
1305 Ga0070712_100024834
1306 Ga0070712_100033859
1307 Ga0070712_100269885
1308 Ga0075366_10125474
1309 Ga0068871_100012207
1310 Ga0068871_100056236
1311 Ga0075428_100105525
1312 Ga0075428_100121597
1313 Ga0075428_100188863
1314 Ga0075428_100269957
1315 Ga0075428_100396935
1316 Ga0075428_100397842
1317 Ga0075428_100421592
1318 Ga0075428_100602193
1319 Ga0075428_100612341
1320 Ga0075430_100517428
1321 Ga0075431_100256727
1322 Ga0075431_100262795
1323 Ga0075433_10067965
1324 Ga0075433_10098587
1325 Ga0075433_10105283
1326 Ga0075433_10157727
1327 Ga0075433_10192041
1328 Ga0075433_10236930
1329 Ga0075433_10276128
1330 Ga0075434_100039725
1331 Ga0075434_100074461
1332 Ga0075434_100284183
1333 Ga0075434_100293997
1334 Ga0075429_100019479
1335 Ga0075429_100424302
1336 Ga0075429_100578804
1337 Ga0068865_100123897
1338 Ga0068865_100160948
1339 Ga0068865_100230077
1340 Ga0068865_100326783
1341 Ga0068865_100848258
1342 Ga0068865_101578123
1343 Ga0075436_100015251
1344 Ga0075436_100016564
1345 Ga0075436_100037389
1346 Ga0075436_100081641
1347 Ga0097620_100227050
1348 Ga0075435_100020293
1349 Ga0075435_100046938
1350 Ga0075435_100062202
1351 Ga0075435_100170484
1352 Ga0075435_100239734
1353 Ga0105240_10238273
1354 Ga0105240_11143288
1355 Ga0111539_10040883
1356 Ga0111539_10048629
1357 Ga0111539_10080392
1358 Ga0111539_10133615
1359 Ga0111539_10525573
1360 Ga0111539_10922310
1361 Ga0111539_11812147
1362 Ga0105245_10003939
1363 Ga0105245_10010008
1364 Ga0105245_10020822
1365 Ga0105245_10034776
1366 Ga0105245_10065952
1367 Ga0105245_10084989
1368 Ga0105245_10103124
1369 Ga0105245_10746629
1370 Ga0105245_10821808
1371 Ga0105247_10020070
1372 Ga0114129_10017054
1373 Ga0114129_10019724
1374 Ga0114129_10019762
1375 Ga0114129_10067861
1376 Ga0114129_10217085
1377 Ga0114129_10220430
1378 Ga0114129_10241643
1379 Ga0114129_10423208
1380 Ga0114129_10453248
1381 Ga0114129_10585608
1382 Ga0114129_10729481
1383 Ga0114129_10931918
1384 Ga0114129_11380734
1385 Ga0114129_12316745
1386 Ga0105243_10023342
1387 Ga0105243_10041832
1388 Ga0105243_10365523
1389 Ga0105241_10023963
1390 Ga0105241_10055898
1391 Ga0105241_10196612
1392 Ga0105242_10026948
1393 Ga0105242_10129654
1394 Ga0105242_10176304
1395 Ga0105248_10057042
1396 Ga0105248_10095769
1397 Ga0105248_10849707
1398 Ga0105248_11695454
1399 Ga0105237_10085281
1400 Ga0105238_10195548
1401 Ga0105249_10000587
1402 Ga0105249_10023380
1403 Ga0105249_10239671
1404 Ga0105249_10848833
1405 Ga0105249_11825997
1406 Ga0105239_10014910
1407 Ga0105239_10846751
1408 Ga0105239_11458945
1409 Ga0105246_10045576
1410 Ga0105246_10165214
1411 Ga0105246_10380959
1412 Ga0105246_10444324
1413 Ga0105246_10553785
1414 Ga0157343_1007170
1415 Ga0157313_1005592
1416 Ga0157339_1013329
1417 Ga0157373_10029312
1418 Ga0157371_10028826
1419 Ga0157374_10007194
1420 Ga0157378_10032376
1421 Ga0157378_10137003
1422 Ga0157378_10494698
1423 Ga0157378_10769191
1424 Ga0163162_10001280
1425 Ga0163162_10043643
1426 Ga0163162_10210045
1427 Ga0157372_10125068
1428 Ga0157372_10871570
1429 Ga0157375_10004811
1430 Ga0157375_10085557
1431 Ga0157375_10097978
1432 Ga0157375_10099811
1433 Ga0157375_10119671
1434 Ga0157375_10391205
1435 Ga0157375_10599702
1436 Ga0163163_10065375
1437 Ga0163163_10134661
1438 Ga0163163_10138821
1439 Ga0157380_10003890
1440 Ga0157380_10720006
1441 Ga0157377_10000519
1442 Ga0157377_10298941
1443 Ga0157379_10717625
1444 Ga0157376_10007715
1445 Ga0157376_10024449
1446 Ga0163161_10165989
1447 Ga0207653_10017886
1448 Ga0207653_10018918
1449 Ga0207692_10012193
1450 Ga0207692_10022049
1451 Ga0207692_10043401
1452 Ga0207692_10043955
1453 Ga0207692_10163298
1454 Ga0207642_10009110
1455 Ga0207642_10593416
1456 Ga0207710_10110716
1457 Ga0207710_10163940
1458 Ga0207688_10006451
1459 Ga0207688_10030282
1460 Ga0207680_10018430
1461 Ga0207647_10496563
1462 Ga0207685_10015572
1463 Ga0207685_10052420
1464 Ga0207685_10128678
1465 Ga0207699_10067830
1466 Ga0207699_10086095
1467 Ga0207699_10212009
1468 Ga0207699_10729369
1469 Ga0207699_10855588
1470 Ga0207643_10187933
1471 Ga0207684_10008644
1472 Ga0207684_10031315
1473 Ga0207684_10040129
1474 Ga0207684_10181532
1475 Ga0207684_10208437
1476 Ga0207684_10240516
1477 Ga0207654_10051469
1478 Ga0207707_10112150
1479 Ga0207695_10160002
1480 Ga0207671_10691863
1481 Ga0207693_10000126
1482 Ga0207693_10001293
1483 Ga0207693_10004168
1484 Ga0207693_10004553
1485 Ga0207693_10005548
1486 Ga0207693_10037912
1487 Ga0207693_10038347
1488 Ga0207693_11132472
1489 Ga0207663_10006439
1490 Ga0207663_10021176
1491 Ga0207663_10144275
1492 Ga0207663_10564191
1493 Ga0207660_10110420
1494 Ga0207660_10151637
1495 Ga0207662_10004854
1496 Ga0207662_10221600
1497 Ga0207662_10785812
1498 Ga0207657_10002174
1499 Ga0207657_10068766
1500 Ga0207657_10277141
1501 Ga0207649_10408558
1502 Ga0207649_10596891
1503 Ga0207652_10086612
1504 Ga0207652_10136087
1505 Ga0207652_10463270
1506 Ga0207646_10013769
1507 Ga0207646_10034097
1508 Ga0207646_10125331
1509 Ga0207646_10178465
1510 Ga0207646_10222552
1511 Ga0207646_10238814
1512 Ga0207646_10258289
1513 Ga0207646_11259948
1514 Ga0207681_10126167
1515 Ga0207681_10506741
1516 Ga0207681_10976950
1517 Ga0207687_10018369
1518 Ga0207687_10036360
1519 Ga0207687_10066568
1520 Ga0207687_10291005
1521 Ga0207687_10947775
1522 Ga0207700_10000021
1523 Ga0207700_10051449
1524 Ga0207700_10058666
1525 Ga0207700_10101232
1526 Ga0207664_10074216
1527 Ga0207664_10168815
1528 Ga0207664_10271946
1529 Ga0207644_10035018
1530 Ga0207644_10187861
1531 Ga0207644_10442472
1532 Ga0207690_10053964
1533 Ga0207690_10590008
1534 Ga0207706_10004640
1535 Ga0207686_10001422
1536 Ga0207686_10152289
1537 Ga0207709_10000790
1538 Ga0207709_10148433
1539 Ga0207709_10167845
1540 Ga0207709_10549121
1541 Ga0207670_10319459
1542 Ga0207669_10002149
1543 Ga0207669_10014952
1544 Ga0207704_10017089
1545 Ga0207704_10207153
1546 Ga0207704_10262359
1547 Ga0207704_11373733
1548 Ga0207665_10000494
1549 Ga0207665_10006449
1550 Ga0207665_10007677
1551 Ga0207665_10009746
1552 Ga0207691_10034963
1553 Ga0207711_10184486
1554 Ga0207711_10533544
1555 Ga0207711_10820568
1556 Ga0207689_10135102
1557 Ga0207689_10577985
1558 Ga0207689_10754666
1559 Ga0207661_10038335
1560 Ga0207661_10507392
1561 Ga0207661_11232827
1562 Ga0207679_10266565
1563 Ga0207679_10380518
1564 Ga0207667_10487910
1565 Ga0207667_10598603
1566 Ga0207667_11140454
1567 Ga0207667_11145773
1568 Ga0207712_10722678
1569 Ga0207668_10165743
1570 Ga0207668_10445188
1571 Ga0207640_10111176
1572 Ga0207640_10121685
1573 Ga0207640_10123319
1574 Ga0207677_10023679
1575 Ga0207677_10407276
1576 Ga0207678_10047585
1577 Ga0207708_10000415
1578 Ga0207708_10010983
1579 Ga0207708_10336808
1580 Ga0207702_10045682
1581 Ga0207702_10053634
1582 Ga0207702_10316656
1583 Ga0207702_10378233
1584 Ga0207702_10378967
1585 Ga0207702_10407837
1586 Ga0207702_11345312
1587 Ga0207641_10078544
1588 Ga0207648_10000705
1589 Ga0207648_10003750
1590 Ga0207648_10102646
1591 Ga0207648_10300502
1592 Ga0207648_10655238
1593 Ga0207676_10047734
1594 Ga0207676_10437126
1595 Ga0207674_10352195
1596 Ga0207675_100001825
1597 Ga0207675_100010036
1598 Ga0207675_100013655
1599 Ga0207675_100030987
1600 Ga0207675_100096119
1601 Ga0207675_100124347
1602 Ga0207675_101058682
1603 Ga0207683_10003390
1604 Ga0207683_10023263
1605 Ga0207683_10392585
1606 Ga0207683_10570246
1607 Ga0207698_10073451
1608 Ga0207698_10321420
1609 Ga0207428_10012037
1610 Ga0207428_10012691
1611 Ga0207428_10013907
1612 Ga0207428_10112833
1613 Ga0268266_10006952
1614 Ga0268265_10038854
1615 Ga0268265_10078090
1616 Ga0268265_10112597
1617 Ga0268265_10220668
1618 Ga0268264_10322409
1619 Ga0268264_10565268
1620 Ga0307406_10126480
1621 Ga0307406_10798642
1622 Ga0307409_100125511
1623 Ga0307409_100629392
1624 Ga0307416_101950520
1625 Ga0307415_100041456
1626 Ga0307415_100483890
1627 Ga0307415_100991477
1628 Ga0373948_0073338
1629 Ga0373950_0043100
1630 Ga0373958_0005198
1631 Ga0373959_0027491
1632 Ga0373959_0036083
1633 Ga0373938_0001272
1634 Ga0373929_0015768
1635 Ga0373940_0101763
1636 Ga0373949_0001749
1637 Ga0373949_0006242
1638 Ga0373951_0001128
1639 Ga0373952_0055939
1640 Ga0373936_0304412
1641 Ga0373941_0001344
1642 Ga0373941_0078079
1643 Ga0373945_0014189
1644 Ga0373945_0151132
1645 Ga0373960_0018706
1646 Ga0373960_0061038
1647 Ga0373960_0225761
1648 Ga0373943_0012734
1649 Ga0373946_0003206
1650 Ga0373942_0043410
1651 Ga0373942_0053154
1652 Ga0373961_0023497
1653 Ga0373962_0007404
1654 Ga0373962_0025901
1655 Ga0373931_0034755
1656 Ga0373927_0075892
1657 Ga0373947_0060292
1658 Ga0373937_0501071
1659 Ga0373925_0059240
1660 Ga0395899_0000775
1661 Ga0395899_0001403
1662 Ga0395899_0002275
1663 Ga0395899_0006761
1664 Ga0395899_0027290
1665 Ga0395899_0039378
1666 Ga0395899_0041426
1667 Ga0395899_0050383
1668 Ga0395899_0058260
1669 Ga0395899_0069946
1670 Ga0395899_0073964
1671 Ga0395899_0080290
1672 Ga0395899_0166224
1673 Ga0395899_0184625
1674 Ga0395899_0226448
1675 Ga0395899_0333453
1676 Ga0395899_0434041
1677 Ga0395899_0462264
1678 Ga0395899_0551455
1679 Ga0395900_0001501
1680 Ga0395900_0002828
1681 Ga0395900_0003593
1682 Ga0395900_0004261
1683 Ga0395900_0006278
1684 Ga0395900_0012186
1685 Ga0395900_0021493
1686 Ga0395900_0023612
1687 Ga0395900_0039067
1688 Ga0395900_0050303
1689 Ga0395900_0050757
1690 Ga0395900_0090007
1691 Ga0395900_0150523
1692 Ga0395900_0220790
1693 Ga0395900_0238466
1694 Ga0395900_0239974
1695 Ga0395900_0255155
1696 Ga0395900_0425495
1697 Ga0395900_0461227
1698 Ga0395900_0491270
1699 Ga0395900_0572930
1700 Ga0395900_1083058
1701 Ga0395900_1499972
1702 Ga0395898_0001134
1703 Ga0395898_0002545
1704 Ga0395898_0002887
1705 Ga0395898_0003194
1706 Ga0395898_0003476
1707 Ga0395898_0005122
1708 Ga0395898_0005553
1709 Ga0395898_0013807
1710 Ga0395898_0015187
1711 Ga0395898_0015522
1712 Ga0395898_0019220
1713 Ga0395898_0022052
1714 Ga0395898_0043124
1715 Ga0395898_0060193
1716 Ga0395898_0061583
1717 Ga0395898_0073442
1718 Ga0395898_0089745
1719 Ga0395898_0125406
1720 Ga0395898_0217520
1721 Ga0395898_0280861
1722 Ga0395898_0458317
1723 Ga0395898_0484824
1724 Ga0395898_0625136
1725 Ga0395898_0678038
1726 Ga0395898_0714038
1727 Ga0395905_0001871
1728 Ga0395905_0002236
1729 Ga0395905_0010133
1730 Ga0395905_0012265
1731 Ga0395905_0014700
1732 Ga0395905_0015560
1733 Ga0395905_0018237
1734 Ga0395905_0019186
1735 Ga0395905_0025816
1736 Ga0395905_0061951
1737 Ga0395905_0065302
1738 Ga0395905_0070105
1739 Ga0395905_0093759
1740 Ga0395905_0108121
1741 Ga0395905_0184364
1742 Ga0395905_0184686
1743 Ga0395905_0243324
1744 Ga0395905_0309575
1745 Ga0395905_0322654
1746 Ga0395905_0634795
1747 Ga0395905_0711747
1748 Ga0395901_0001042
1749 Ga0395901_0002958
1750 Ga0395901_0005040
1751 Ga0395901_0005491
1752 Ga0395901_0006426
1753 Ga0395901_0010190
1754 Ga0395901_0011115
1755 Ga0395901_0012512
1756 Ga0395901_0018217
1757 Ga0395901_0020672
1758 Ga0395901_0023419
1759 Ga0395901_0023693
1760 Ga0395901_0025239
1761 Ga0395901_0043201
1762 Ga0395901_0046348
1763 Ga0395901_0057024
1764 Ga0395901_0081651
1765 Ga0395901_0087758
1766 Ga0395901_0097658
1767 Ga0395901_0149624
1768 Ga0395901_0155658
1769 Ga0395901_0187547
1770 Ga0395901_0193023
1771 Ga0395901_0287413
1772 Ga0395901_0438496
1773 Ga0395901_0571158
1774 Ga0395901_0882263
1775 Ga0395901_1568813
1776 Ga0451789_0320105
1777 Ga0451793_0230547
1778 Ga0451797_1344230
1779 Ga0451795_1321968
1780 Ga0451798_1077237
1781 Ga0451800_0564701
1782 Ga0451802_0775119
1783 Ga0451804_0399589
1784 Ga0451807_0017034
1785 Ga0451839_0685172
1786 Ga0451845_0385095
1787 Ga0451847_0819308
1788 Ga0451849_1319872
1789 Ga0451853_0526476
1790 Ga0451853_1318362
1791 Ga0451853_1496837
1792 Ga0451853_1957809
1793 Ga0451853_2523145
1794 Ga0451853_2580887
1795 Ga0451853_3083970
1796 Ga0439448_0046166
1797 Ga0450915_000171
1798 Ga0439458_0013062
1799 Ga0439464_0087647
1800 Ga0450893_0050378
1801 Ga0439440_0133181
1802 Ga0466965_0067611
1803 Ga0466964_0027216
1804 Ga0466964_0211381
1805 Ga0466968_0045476
1806 Ga0466968_0062485
1807 Ga0466968_0062895
1808 Ga0466968_0423074
1809 Ga0466960_0004277
1810 Ga0466960_0333241
1811 Ga0451576_0058063
1812 Ga0451576_1625391
1813 Ga0466967_0004808
1814 Ga0495603_0000062
1815 Ga0495603_0042819
1816 Ga0495603_0350934
1817 Ga0495641_0011742
1818 Ga0495641_0032927
1819 Ga0495641_0040948
1820 Ga0495580_0156072
1821 Ga0495582_0033727
1822 Ga0495582_0038176
1823 Ga0495582_0590757
1824 Ga0495605_0062515
1825 Ga0495605_0075577
1826 Ga0495639_0027197
1827 Ga0495639_0027639
1828 Ga0495639_0158859
1829 Ga0495584_0032729
1830 Ga0495584_0065400
1831 Ga0495584_0244774
1832 Ga0495584_0257056
1833 Ga0495585_0341657
1834 Ga0495594_0000447
1835 Ga0495594_0050418
1836 Ga0495596_0133762
1837 Ga0495630_0087451
1838 Ga0495631_0113571
1839 Ga0495631_0130620
1840 Ga0495631_0200152
1841 Ga0495637_0158943
1842 Ga0495644_0125316
1843 Ga0495663_0001805
1844 Ga0495663_0013804
1845 Ga0495663_0024696
1846 Ga0495666_0036927
1847 Ga0495666_0226618
1848 Ga0495642_0038014
1849 Ga0495665_0099189
1850 Ga0495609_0058356
1851 Ga0495656_0021925
1852 Ga0495656_0124863
1853 Ga0495611_0063179
1854 Ga0495659_0049444
1855 Ga0495659_0054375
1856 Ga0495659_0185910
1857 Ga0495661_0153580
1858 Ga0495588_0000632
1859 Ga0495588_0258791
1860 Ga0495647_0004331
1861 Ga0495658_0054043
1862 Ga0495658_0169849
1863 Ga0495658_0264885
1864 Ga0495669_0003905
1865 Ga0495613_0116752
1866 Ga0495613_0165764
1867 Ga0495624_0278848
1868 Ga0495670_0546789
1869 Ga0495671_0077488
1870 Ga0495589_0088044
1871 Ga0495581_0002069
1872 Ga0495581_0113815
1873 Ga0495676_0000253
1874 Ga0495676_0075995
1875 Ga0495683_0037965
1876 Ga0495683_0135840
1877 Ga0495677_0063284
1878 Ga0495677_0095312
1879 Ga0495685_013727
1880 Ga0496100_0021816
1881 Ga0496101_0002526
1882 Ga0496101_0047027
1883 Ga0496101_0069307
1884 Ga0496101_0215659
1885 Ga0496101_0263142
1886 Ga0496101_0288473
1887 Ga0496101_0334627
1888 Ga0496101_0557067
1889 Ga0496102_0010584
1890 Ga0496102_0017379
1891 Ga0496102_0054400
1892 Ga0496102_0145825
1893 Ga0496102_0174862
1894 Ga0496103_0001169
1895 Ga0496103_0017711
1896 Ga0496103_0031656
1897 Ga0496103_0034389
1898 Ga0496103_0126191
1899 Ga0496103_0395622
1900 Ga0496104_0002508
1901 Ga0496104_0003548
1902 Ga0496104_0007013
1903 Ga0496104_0094964
1904 Ga0496104_0125302
1905 Ga0496104_0448150
1906 Ga0496104_0834292
1907 Ga0496105_0000042
1908 Ga0496105_0002088
1909 Ga0496105_0004474
1910 Ga0496105_0031817
1911 Ga0496105_0048021
1912 Ga0496105_0282175
1913 Ga0496105_0733278
1914 Ga0496106_0003639
1915 Ga0496106_0024597
1916 Ga0496106_0052951
1917 Ga0496106_0253920
1918 Ga0496106_0278075
1919 Ga0496107_0005238
1920 Ga0496107_0006172
1921 Ga0496107_0053510
1922 Ga0496107_0093718
1923 Ga0496107_0205433
1924 Ga0496107_0263602
1925 Ga0496107_0312329
1926 Ga0496107_0494679
1927 Ga0496107_0560725
1928 Ga0496108_0001658
1929 Ga0496108_0002105
1930 Ga0496108_0005226
1931 Ga0496108_0027073
1932 Ga0496108_0033984
1933 Ga0496108_0053108
1934 Ga0496108_0074457
1935 Ga0496108_0089930
1936 Ga0496108_0392728
1937 Ga0496108_0433756
1938 Ga0496109_0001502
1939 Ga0496109_0001909
1940 Ga0496109_0024719
1941 Ga0496109_0045446
1942 Ga0496109_0048017
1943 Ga0496109_0075569
1944 Ga0496109_0113098
1945 Ga0496109_0129471
1946 Ga0496109_0218296
1947 Ga0496109_0241444
1948 Ga0496110_0000050
1949 Ga0496110_0001137
1950 Ga0496110_0001795
1951 Ga0496110_0022287
1952 Ga0496110_0070475
1953 Ga0496110_0213997
1954 Ga0496110_0256436
1955 Ga0496110_0459417
1956 Ga0496110_0521517
1957 Ga0496110_1097967
1958 Ga0496111_0000439
1959 Ga0496111_0007210
1960 Ga0496111_0011817
1961 Ga0496111_0039662
1962 Ga0496111_0071825
1963 Ga0496111_0073134
1964 Ga0496111_0074143
1965 Ga0496111_0084761
1966 Ga0496111_0192018
1967 Ga0496111_0699600
1968 Ga0496112_0002189
1969 Ga0496112_0026197
1970 Ga0496112_0045844
1971 Ga0496112_0116095
1972 Ga0496112_0120286
1973 Ga0496112_0153365
1974 Ga0496112_0175879
1975 Ga0496112_0324959
1976 Ga0496112_0396200
1977 Ga0496112_0488245
1978 Ga0496112_0506847
1979 Ga0496112_1508291
1980 Ga0496113_0000348
1981 Ga0496113_0000517
1982 Ga0496113_0009673
1983 Ga0496113_0029294
1984 Ga0496113_0111443
1985 Ga0496113_0280551
1986 Ga0496113_0437640
1987 Ga0496113_0587988
1988 Ga0496113_0736272
1989 Ga0496114_0006533
1990 Ga0496114_0040776
1991 Ga0496114_0049698
1992 Ga0496114_0103919
1993 Ga0496114_0146754
1994 Ga0496114_0386149
1995 Ga0496115_0013945
1996 Ga0496115_0148931
1997 Ga0496115_0167086
1998 Ga0501031_0039879
1999 Ga0501033_0029867
2000 Ga0501034_1235817
2001 Ga0501037_0012082
2002 Ga0501038_0035611
2003 Ga0501039_0306821
2004 Ga0501039_1226076
2005 Ga0501040_0344775
2006 Ga0501040_1131388
2007 Ga0501041_0479501
2008 Ga0501043_0039517
2009 Ga0501046_0039413
2010 Ga0501048_0029528
2011 Ga0501067_0003623
2012 Ga0501067_0501486
2013 Ga0501068_0001555
2014 Ga0501069_0009481
2015 Ga0501069_0127936
2016 Ga0501070_0025384
2017 Ga0501071_0130915
2018 Ga0501073_0023529
2019 Ga0501074_0136769
2020 Ga0501075_1176213
2021 Ga0501076_0379388
2022 Ga0501077_0225333
2023 Ga0501079_0155730
2024 Ga0501079_0575980
2025 Ga0501080_0301740
2026 Ga0501081_0132516
2027 Ga0501081_0754444
2028 Ga0501044_0199243
2029 nmdc:mga03683_315896_c1
2030 nmdc:mga0yw44_138644_c1
2031 nmdc:mga0k408_55235_c3
2032 nmdc:mga04h51_415833_c1
2033 nmdc:mga05p37_1093043_c1
2034 nmdc:mga05p37_125218_c1
2035 nmdc:mga05p37_144869_c1
2036 nmdc:mga05p37_201237_c1
2037 nmdc:mga05p37_24422_c1
2038 nmdc:mga05p37_24663_c1
2039 nmdc:mga05p37_334144_c1
2040 nmdc:mga05p37_389894_c1
2041 nmdc:mga05p37_396048_c1
2042 nmdc:mga05p37_50290_c1
2043 nmdc:mga05p37_543758_c1
2044 nmdc:mga05p37_83026_c1
2045 nmdc:mga09592_417436_c1
2046 nmdc:mga09592_57738_c1
2047 nmdc:mga0qj67_308794_c1
2048 nmdc:mga0qj67_97880_c1
2049 nmdc:mga06r32_178969_c1
2050 nmdc:mga06r32_179427_c1
2051 nmdc:mga06r32_239719_c1
2052 nmdc:mga08y16_1009019_c1
2053 nmdc:mga08y16_265682_c1
2054 nmdc:mga08y16_312266_c1
2055 nmdc:mga08y16_35012_c1
2056 nmdc:mga08y16_55059_c1
2057 nmdc:mga08y16_670243_c1
2058 nmdc:mga0n895_1030864_c1
2059 nmdc:mga0n895_109943_c1
2060 nmdc:mga0n895_231138_c1
2061 nmdc:mga0n895_740497_c1
2062 nmdc:mga0rr50_211727_c1
2063 nmdc:mga0rr50_579811_c1
2064 nmdc:mga0rr50_7492_c1
2065 nmdc:mga0rr50_84991_c1
2066 nmdc:mga08x19_13594_c1
2067 nmdc:mga08x19_14962_c2
2068 nmdc:mga08x19_21012_c1
2069 nmdc:mga08x19_272937_c1
2070 nmdc:mga08x19_592281_c1
2071 nmdc:mga08x19_6183_c1
2072 nmdc:mga08x19_98551_c1
2073 nmdc:mga0a205_1081154_c1
2074 nmdc:mga0a205_112662_c1
2075 nmdc:mga0a205_1128227_c1
2076 nmdc:mga0a205_119284_c1
2077 nmdc:mga0a205_135354_c1
2078 nmdc:mga0a205_188610_c1
2079 nmdc:mga0a205_40605_c1
2080 nmdc:mga0a205_41461_c1
2081 nmdc:mga0a205_6925_c1
2082 nmdc:mga0a205_735184_c1
2083 Ga0501084_0026849
2084 Ga0501084_0344986
2085 Ga0501084_0686575
2086 Ga0501082_0040269
2087 Ga0501082_0620675
2088 Ga0530510_0007885

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

33

173

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iug-assembly1.cif.gz_B the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus 0.8706 107 133
3ffr-assembly1.cif.gz_A-2 crystal structure of a phosphoserine aminotransferase serc (chu_0995) from cytophaga hutchinsonii atcc 33406 at 1.75 a resolution 0.8343 105 133
1m8k-assembly1.cif.gz_A crystal structure of methanobacterium thermoautotrophicum nicotinamide mononucleotide adenylyltransferase mutant h19a complexed with nad 0.8169 1 170
4yp7-assembly1.cif.gz_A-2 crystal structure of methanobacterium thermoautotrophicum nmnat in complex with nadp 0.8069 1 170
4yp7-assembly1.cif.gz_C-2 crystal structure of methanobacterium thermoautotrophicum nmnat in complex with nadp 0.8046 1 170
ID Description Score Start End Superfamily
1iugB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8706 107 133 3.40.640.10
af_Q58369_38_263_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8568 105 133 3.40.640.10
3ffrA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8344 105 133 3.40.640.10
af_P9WJL7_104_328_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.8284 100 131 3.40.1190.10
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8047 1 169 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A538DKV5-F1-model_v4 Cytidyltransferase-like domain-containing protein 0.9712 2 170 GO:0009058
GO:0016779
AF-A0A538MDM8-F1-model_v4 Nicotinate-nucleotide adenylyltransferase 0.9685 2 158 GO:0009058
GO:0016779
AF-A0A536E9V3-F1-model_v4 Nicotinate-nucleotide adenylyltransferase 0.9639 1 170 GO:0009058
GO:0016779
AF-A0A538DJF7-F1-model_v4 Cytidyltransferase-like domain-containing protein 0.9634 1 175 GO:0009058
GO:0016779
AF-A0A538MDM8-F1-model_v4 Nicotinate-nucleotide adenylyltransferase 0.9625 2 158 GO:0009058
GO:0016779

Map