F488635
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1032 | 383 | 2064 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300041512|Ga0451853_3287554|Ga0451853_3287554_272_736 |
| Length | 154 |
| Sequence | MVAWSDVERQEPAFAARVRALFDAGRHKTLATLRADGSPRISGIEVELDGGELTFGSMPDARKGADLLRDPRFALHSPSSDPPEDDPSGWTGEAKVAGRAELVGDVEDEEGEPSGQRFRADLDEVVLTRLTDAGDRLLIEVWRPGGPLRRIERD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 101 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 102 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 103 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 104 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 120 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 205 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 206 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 240 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 243 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 244 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 245 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 246 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 247 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 248 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 249 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 250 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 323 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 326 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 349 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 364 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 367 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 370 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 371 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 372 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 373 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 374 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 375 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 377 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 378 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 382 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 383 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.61 |
| Metatranscriptomes | 0.19 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.55 |
| Nodule | 0 |
| Rhizoplane | 6.1 |
| Rhizosphere | 87.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451853_3287554 | 3300041512 | Bacteria | 806 |
| 2 | JGI25406J46586_10002251 | 3300003203 | Bacteria | 9107 |
| 3 | rootH2_10044776 | 3300003320 | Bacteria | 4834 |
| 4 | Ga0070676_10281520 | 3300005328 | Bacteria | 1121 |
| 5 | Ga0070683_100035432 | 3300005329 | Bacteria | 4562 |
| 6 | Ga0070683_100041013 | 3300005329 | Bacteria | 4257 |
| 7 | Ga0070683_100047406 | 3300005329 | Bacteria | 3970 |
| 8 | Ga0070683_100076069 | 3300005329 | Bacteria | 3138 |
| 9 | Ga0070690_100015085 | 3300005330 | Bacteria | 4601 |
| 10 | Ga0070670_100686829 | 3300005331 | Bacteria | 920 |
| 11 | Ga0068869_100010305 | 3300005334 | Bacteria | 6092 |
| 12 | Ga0068869_100138751 | 3300005334 | Bacteria | 1875 |
| 13 | Ga0070666_10037091 | 3300005335 | Bacteria | 3239 |
| 14 | Ga0070666_10912759 | 3300005335 | Bacteria | 650 |
| 15 | Ga0070680_100020244 | 3300005336 | Bacteria | 5280 |
| 16 | Ga0070680_100054111 | 3300005336 | Bacteria | 3276 |
| 17 | Ga0070680_100109572 | 3300005336 | Bacteria | 2298 |
| 18 | Ga0070682_100412768 | 3300005337 | Bacteria | 1024 |
| 19 | Ga0068868_100033269 | 3300005338 | Bacteria | 3973 |
| 20 | Ga0070660_100148806 | 3300005339 | Bacteria | 1882 |
| 21 | Ga0070689_101184903 | 3300005340 | Bacteria | 685 |
| 22 | Ga0070661_100038608 | 3300005344 | Bacteria | 3477 |
| 23 | Ga0070661_101101688 | 3300005344 | Bacteria | 662 |
| 24 | Ga0070692_10280938 | 3300005345 | Bacteria | 1009 |
| 25 | Ga0070668_100009548 | 3300005347 | Bacteria | 7199 |
| 26 | Ga0070668_100691959 | 3300005347 | Bacteria | 899 |
| 27 | Ga0070669_100001706 | 3300005353 | Bacteria | 15898 |
| 28 | Ga0070675_100034088 | 3300005354 | Bacteria | 4130 |
| 29 | Ga0070675_100896648 | 3300005354 | Bacteria | 813 |
| 30 | Ga0070673_100210869 | 3300005364 | Bacteria | 1677 |
| 31 | Ga0070673_100744799 | 3300005364 | Bacteria | 902 |
| 32 | Ga0070688_100116115 | 3300005365 | Bacteria | 1787 |
| 33 | Ga0070667_100000056 | 3300005367 | Bacteria | 150952 |
| 34 | Ga0070709_10062616 | 3300005434 | Bacteria | 2372 |
| 35 | Ga0070709_10181999 | 3300005434 | Bacteria | 1476 |
| 36 | Ga0070714_100000182 | 3300005435 | Bacteria | 50060 |
| 37 | Ga0070714_100004513 | 3300005435 | Bacteria | 10492 |
| 38 | Ga0070714_100026331 | 3300005435 | Bacteria | 4806 |
| 39 | Ga0070714_100098296 | 3300005435 | Bacteria | 2575 |
| 40 | Ga0070714_100189747 | 3300005435 | Bacteria | 1874 |
| 41 | Ga0070714_100981965 | 3300005435 | Bacteria | 821 |
| 42 | Ga0070714_101016269 | 3300005435 | Bacteria | 807 |
| 43 | Ga0070713_100028995 | 3300005436 | Bacteria | 4376 |
| 44 | Ga0070713_100132531 | 3300005436 | Bacteria | 2199 |
| 45 | Ga0070713_100293182 | 3300005436 | Bacteria | 1496 |
| 46 | Ga0070713_100294509 | 3300005436 | Bacteria | 1492 |
| 47 | Ga0070713_100360083 | 3300005436 | Bacteria | 1351 |
| 48 | Ga0070710_10000194 | 3300005437 | Bacteria | 28422 |
| 49 | Ga0070710_10012480 | 3300005437 | Bacteria | 4220 |
| 50 | Ga0070710_10018819 | 3300005437 | Bacteria | 3559 |
| 51 | Ga0070710_10028770 | 3300005437 | Bacteria | 2975 |
| 52 | Ga0070710_10067275 | 3300005437 | Bacteria | 2055 |
| 53 | Ga0070711_100058710 | 3300005439 | Bacteria | 2668 |
| 54 | Ga0070711_100064241 | 3300005439 | Bacteria | 2564 |
| 55 | Ga0070711_100127771 | 3300005439 | Bacteria | 1889 |
| 56 | Ga0070711_100331954 | 3300005439 | Bacteria | 1217 |
| 57 | Ga0070711_101179135 | 3300005439 | Bacteria | 662 |
| 58 | Ga0070705_100031485 | 3300005440 | Bacteria | 2937 |
| 59 | Ga0070705_100258841 | 3300005440 | Bacteria | 1226 |
| 60 | Ga0070700_100012728 | 3300005441 | Bacteria | 4707 |
| 61 | Ga0070708_100055643 | 3300005445 | Bacteria | 3518 |
| 62 | Ga0070708_100277707 | 3300005445 | Bacteria | 1576 |
| 63 | Ga0070663_100019004 | 3300005455 | Bacteria | 4519 |
| 64 | Ga0070663_100127468 | 3300005455 | Bacteria | 1929 |
| 65 | Ga0070681_10066357 | 3300005458 | Bacteria | 3577 |
| 66 | Ga0070681_10464003 | 3300005458 | Bacteria | 1179 |
| 67 | Ga0070681_10687293 | 3300005458 | Bacteria | 939 |
| 68 | Ga0068867_100563175 | 3300005459 | Bacteria | 989 |
| 69 | Ga0070706_100004211 | 3300005467 | Bacteria | 13968 |
| 70 | Ga0070706_100033540 | 3300005467 | Bacteria | 4739 |
| 71 | Ga0070706_100053329 | 3300005467 | Bacteria | 3732 |
| 72 | Ga0070706_100367828 | 3300005467 | Bacteria | 1340 |
| 73 | Ga0070706_100369913 | 3300005467 | Bacteria | 1335 |
| 74 | Ga0070706_100616722 | 3300005467 | Bacteria | 1008 |
| 75 | Ga0070706_100889773 | 3300005467 | Bacteria | 823 |
| 76 | Ga0070707_100048318 | 3300005468 | Bacteria | 4076 |
| 77 | Ga0070707_100054602 | 3300005468 | Bacteria | 3830 |
| 78 | Ga0070707_100114769 | 3300005468 | Bacteria | 2613 |
| 79 | Ga0070707_100150193 | 3300005468 | Bacteria | 2268 |
| 80 | Ga0070707_100174097 | 3300005468 | Bacteria | 2097 |
| 81 | Ga0070707_100190367 | 3300005468 | Bacteria | 2000 |
| 82 | Ga0070698_100018312 | 3300005471 | Bacteria | 7373 |
| 83 | Ga0070698_100023734 | 3300005471 | Bacteria | 6408 |
| 84 | Ga0070698_100031505 | 3300005471 | Bacteria | 5498 |
| 85 | Ga0070698_100036660 | 3300005471 | Bacteria | 5063 |
| 86 | Ga0070698_100583221 | 3300005471 | Bacteria | 1058 |
| 87 | Ga0070699_100048207 | 3300005518 | Bacteria | 3686 |
| 88 | Ga0070699_100061060 | 3300005518 | Bacteria | 3267 |
| 89 | Ga0070699_100082651 | 3300005518 | Bacteria | 2800 |
| 90 | Ga0070679_100089236 | 3300005530 | Bacteria | 3070 |
| 91 | Ga0070679_100199981 | 3300005530 | Bacteria | 1965 |
| 92 | Ga0070679_100240499 | 3300005530 | Bacteria | 1768 |
| 93 | Ga0070679_100240563 | 3300005530 | Bacteria | 1767 |
| 94 | Ga0070684_100005321 | 3300005535 | Bacteria | 9856 |
| 95 | Ga0070684_100108312 | 3300005535 | Bacteria | 2489 |
| 96 | Ga0070684_100254004 | 3300005535 | Bacteria | 1607 |
| 97 | Ga0070684_100347760 | 3300005535 | Bacteria | 1363 |
| 98 | Ga0070697_100000794 | 3300005536 | Bacteria | 23696 |
| 99 | Ga0070697_100144654 | 3300005536 | Bacteria | 2001 |
| 100 | Ga0068853_100542077 | 3300005539 | Bacteria | 1101 |
| 101 | Ga0070686_100028314 | 3300005544 | Bacteria | 3397 |
| 102 | Ga0070686_100321147 | 3300005544 | Bacteria | 1154 |
| 103 | Ga0070696_100144285 | 3300005546 | Bacteria | 1743 |
| 104 | Ga0070696_100344059 | 3300005546 | Bacteria | 1153 |
| 105 | Ga0070693_100012141 | 3300005547 | Bacteria | 4353 |
| 106 | Ga0070693_100069795 | 3300005547 | Bacteria | 2066 |
| 107 | Ga0070665_100004740 | 3300005548 | Bacteria | 14157 |
| 108 | Ga0070665_100109273 | 3300005548 | Bacteria | 2768 |
| 109 | Ga0070665_100344570 | 3300005548 | Bacteria | 1495 |
| 110 | Ga0070665_100505738 | 3300005548 | Bacteria | 1220 |
| 111 | Ga0070704_100962253 | 3300005549 | Bacteria | 771 |
| 112 | Ga0068855_100782203 | 3300005563 | Bacteria | 1015 |
| 113 | Ga0070664_100004475 | 3300005564 | Bacteria | 11224 |
| 114 | Ga0070664_100015128 | 3300005564 | Bacteria | 6301 |
| 115 | Ga0068857_100035620 | 3300005577 | Bacteria | 4408 |
| 116 | Ga0068857_100404863 | 3300005577 | Bacteria | 1270 |
| 117 | Ga0068854_100053220 | 3300005578 | Bacteria | 2906 |
| 118 | Ga0068856_100006191 | 3300005614 | Bacteria | 11740 |
| 119 | Ga0068856_100019497 | 3300005614 | Bacteria | 6583 |
| 120 | Ga0068856_100052502 | 3300005614 | Bacteria | 4020 |
| 121 | Ga0068856_100114445 | 3300005614 | Bacteria | 2697 |
| 122 | Ga0068856_100133998 | 3300005614 | Bacteria | 2483 |
| 123 | Ga0068856_100366477 | 3300005614 | Bacteria | 1459 |
| 124 | Ga0068856_100779796 | 3300005614 | Bacteria | 976 |
| 125 | Ga0068856_101319131 | 3300005614 | Bacteria | 737 |
| 126 | Ga0070702_100900534 | 3300005615 | Bacteria | 692 |
| 127 | Ga0068852_100164368 | 3300005616 | Bacteria | 2075 |
| 128 | Ga0068852_100575110 | 3300005616 | Bacteria | 1129 |
| 129 | Ga0068859_100000751 | 3300005617 | Bacteria | 32654 |
| 130 | Ga0068859_100190714 | 3300005617 | Bacteria | 2134 |
| 131 | Ga0068859_101532807 | 3300005617 | Bacteria | 736 |
| 132 | Ga0068864_100011622 | 3300005618 | Bacteria | 7270 |
| 133 | Ga0068864_100031417 | 3300005618 | Bacteria | 4506 |
| 134 | Ga0068864_100566579 | 3300005618 | Bacteria | 1099 |
| 135 | Ga0068866_10076737 | 3300005718 | Bacteria | 1782 |
| 136 | Ga0068861_102442956 | 3300005719 | Bacteria | 526 |
| 137 | Ga0068870_10279115 | 3300005840 | Bacteria | 1047 |
| 138 | Ga0068863_100004393 | 3300005841 | Bacteria | 13902 |
| 139 | Ga0068863_100032410 | 3300005841 | Bacteria | 4981 |
| 140 | Ga0068863_100299450 | 3300005841 | Bacteria | 1560 |
| 141 | Ga0068863_100352980 | 3300005841 | Bacteria | 1432 |
| 142 | Ga0068858_100021321 | 3300005842 | Bacteria | 6051 |
| 143 | Ga0068858_100060942 | 3300005842 | Bacteria | 3488 |
| 144 | Ga0068858_100199993 | 3300005842 | Bacteria | 1889 |
| 145 | Ga0068858_100302562 | 3300005842 | Bacteria | 1526 |
| 146 | Ga0068860_100000092 | 3300005843 | Bacteria | 150190 |
| 147 | Ga0068860_100275849 | 3300005843 | Bacteria | 1642 |
| 148 | Ga0068860_100345732 | 3300005843 | Bacteria | 1463 |
| 149 | Ga0068862_100000035 | 3300005844 | Bacteria | 174953 |
| 150 | Ga0068862_100048492 | 3300005844 | Bacteria | 3626 |
| 151 | Ga0068862_100124168 | 3300005844 | Bacteria | 2278 |
| 152 | Ga0068862_100658775 | 3300005844 | Bacteria | 1010 |
| 153 | Ga0081455_10413894 | 3300005937 | Bacteria | 932 |
| 154 | Ga0081538_10050703 | 3300005981 | Bacteria | 2502 |
| 155 | Ga0081540_1000074 | 3300005983 | Bacteria | 107172 |
| 156 | Ga0081540_1004072 | 3300005983 | Bacteria | 11315 |
| 157 | Ga0081540_1009405 | 3300005983 | Bacteria | 6736 |
| 158 | Ga0081540_1028309 | 3300005983 | Bacteria | 3150 |
| 159 | Ga0081539_10004391 | 3300005985 | Bacteria | 15650 |
| 160 | Ga0070717_10003455 | 3300006028 | Bacteria | 11310 |
| 161 | Ga0070717_10019004 | 3300006028 | Bacteria | 5380 |
| 162 | Ga0070717_10028650 | 3300006028 | Bacteria | 4459 |
| 163 | Ga0070717_10070012 | 3300006028 | Bacteria | 2922 |
| 164 | Ga0070717_10122673 | 3300006028 | Bacteria | 2228 |
| 165 | Ga0070717_10208492 | 3300006028 | Bacteria | 1714 |
| 166 | Ga0070717_10211108 | 3300006028 | Bacteria | 1704 |
| 167 | Ga0070717_10343895 | 3300006028 | Bacteria | 1332 |
| 168 | Ga0070717_10454421 | 3300006028 | Bacteria | 1155 |
| 169 | Ga0070717_10459885 | 3300006028 | Bacteria | 1148 |
| 170 | Ga0075365_10206015 | 3300006038 | Bacteria | 1378 |
| 171 | Ga0075432_10092972 | 3300006058 | Bacteria | 1106 |
| 172 | Ga0070715_10022934 | 3300006163 | Bacteria | 2439 |
| 173 | Ga0070716_100005004 | 3300006173 | Bacteria | 6387 |
| 174 | Ga0070716_100060376 | 3300006173 | Bacteria | 2189 |
| 175 | Ga0070716_100078950 | 3300006173 | Bacteria | 1958 |
| 176 | Ga0070716_100252055 | 3300006173 | Bacteria | 1203 |
| 177 | Ga0070716_100836213 | 3300006173 | Bacteria | 716 |
| 178 | Ga0070712_100014123 | 3300006175 | Bacteria | 5122 |
| 179 | Ga0070712_100037415 | 3300006175 | Bacteria | 3308 |
| 180 | Ga0070712_100119877 | 3300006175 | Bacteria | 1978 |
| 181 | Ga0070712_100167990 | 3300006175 | Bacteria | 1699 |
| 182 | Ga0070712_100292448 | 3300006175 | Bacteria | 1316 |
| 183 | Ga0070712_100389691 | 3300006175 | Bacteria | 1148 |
| 184 | Ga0075369_10097676 | 3300006186 | Bacteria | 1315 |
| 185 | Ga0097621_100186524 | 3300006237 | Bacteria | 1794 |
| 186 | Ga0097621_100531183 | 3300006237 | Bacteria | 1069 |
| 187 | Ga0068871_100044704 | 3300006358 | Bacteria | 3563 |
| 188 | Ga0068871_101565656 | 3300006358 | Bacteria | 623 |
| 189 | Ga0075428_100000194 | 3300006844 | Bacteria | 57602 |
| 190 | Ga0075428_100006627 | 3300006844 | Bacteria | 12880 |
| 191 | Ga0075428_100015429 | 3300006844 | Bacteria | 8468 |
| 192 | Ga0075428_100668909 | 3300006844 | Bacteria | 1107 |
| 193 | Ga0075428_101353926 | 3300006844 | Bacteria | 748 |
| 194 | Ga0075428_101874741 | 3300006844 | Bacteria | 623 |
| 195 | Ga0075430_100027307 | 3300006846 | Bacteria | 4850 |
| 196 | Ga0075431_100011600 | 3300006847 | Bacteria | 8886 |
| 197 | Ga0075431_100021815 | 3300006847 | Bacteria | 6548 |
| 198 | Ga0075431_100028268 | 3300006847 | Bacteria | 5759 |
| 199 | Ga0075431_100276563 | 3300006847 | Bacteria | 1700 |
| 200 | Ga0075433_10308460 | 3300006852 | Bacteria | 1401 |
| 201 | Ga0075433_10324681 | 3300006852 | Bacteria | 1361 |
| 202 | Ga0075434_100168433 | 3300006871 | Bacteria | 2210 |
| 203 | Ga0075434_100540365 | 3300006871 | Bacteria | 1185 |
| 204 | Ga0075434_101145071 | 3300006871 | Bacteria | 791 |
| 205 | Ga0075429_100019369 | 3300006880 | Bacteria | 5894 |
| 206 | Ga0075429_100020643 | 3300006880 | Bacteria | 5718 |
| 207 | Ga0075429_100227156 | 3300006880 | Bacteria | 1635 |
| 208 | Ga0075429_100731768 | 3300006880 | Bacteria | 866 |
| 209 | Ga0075429_100918263 | 3300006880 | Bacteria | 766 |
| 210 | Ga0075436_100167262 | 3300006914 | Bacteria | 1552 |
| 211 | Ga0075436_100202102 | 3300006914 | Bacteria | 1407 |
| 212 | Ga0075436_100247249 | 3300006914 | Bacteria | 1269 |
| 213 | Ga0097620_100000751 | 3300006931 | Bacteria | 32654 |
| 214 | Ga0097620_100190702 | 3300006931 | Bacteria | 2134 |
| 215 | Ga0097620_101533062 | 3300006931 | Bacteria | 736 |
| 216 | Ga0075435_100166561 | 3300007076 | Bacteria | 1858 |
| 217 | Ga0105251_10026881 | 3300009011 | Bacteria | 2926 |
| 218 | Ga0105250_10077930 | 3300009092 | Bacteria | 1342 |
| 219 | Ga0105240_10221817 | 3300009093 | Bacteria | 2202 |
| 220 | Ga0105240_10886465 | 3300009093 | Bacteria | 961 |
| 221 | Ga0105240_11066999 | 3300009093 | Bacteria | 861 |
| 222 | Ga0111539_10039855 | 3300009094 | Bacteria | 5657 |
| 223 | Ga0111539_10253831 | 3300009094 | Bacteria | 2048 |
| 224 | Ga0111539_10566918 | 3300009094 | Bacteria | 1322 |
| 225 | Ga0105245_10025228 | 3300009098 | Bacteria | 5225 |
| 226 | Ga0105245_10325335 | 3300009098 | Bacteria | 1516 |
| 227 | Ga0105245_10477935 | 3300009098 | Bacteria | 1259 |
| 228 | Ga0105245_11287670 | 3300009098 | Bacteria | 780 |
| 229 | Ga0105245_11909069 | 3300009098 | Bacteria | 647 |
| 230 | Ga0105247_10000062 | 3300009101 | Bacteria | 126437 |
| 231 | Ga0105247_10676091 | 3300009101 | Bacteria | 774 |
| 232 | Ga0114129_10000761 | 3300009147 | Bacteria | 41085 |
| 233 | Ga0114129_10002830 | 3300009147 | Bacteria | 24226 |
| 234 | Ga0114129_10006319 | 3300009147 | Bacteria | 16800 |
| 235 | Ga0114129_10009261 | 3300009147 | Bacteria | 14043 |
| 236 | Ga0114129_11614801 | 3300009147 | Bacteria | 793 |
| 237 | Ga0105243_10981669 | 3300009148 | Bacteria | 846 |
| 238 | Ga0105243_11137021 | 3300009148 | Bacteria | 791 |
| 239 | Ga0105241_10284485 | 3300009174 | Bacteria | 1413 |
| 240 | Ga0105248_10000036 | 3300009177 | Bacteria | 187421 |
| 241 | Ga0105248_10014590 | 3300009177 | Bacteria | 8647 |
| 242 | Ga0105248_10152466 | 3300009177 | Bacteria | 2608 |
| 243 | Ga0105248_10906275 | 3300009177 | Bacteria | 995 |
| 244 | Ga0105248_11629857 | 3300009177 | Bacteria | 731 |
| 245 | Ga0105237_10218602 | 3300009545 | Bacteria | 1906 |
| 246 | Ga0105237_10970434 | 3300009545 | Bacteria | 857 |
| 247 | Ga0105238_10113585 | 3300009551 | Bacteria | 2688 |
| 248 | Ga0105238_10457545 | 3300009551 | Bacteria | 1274 |
| 249 | Ga0105238_11159230 | 3300009551 | Bacteria | 797 |
| 250 | Ga0105249_10000046 | 3300009553 | Bacteria | 176363 |
| 251 | Ga0105249_10435445 | 3300009553 | Bacteria | 1348 |
| 252 | Ga0105249_12324004 | 3300009553 | Bacteria | 609 |
| 253 | Ga0105239_10008580 | 3300010375 | Bacteria | 11594 |
| 254 | Ga0105239_10057120 | 3300010375 | Bacteria | 4281 |
| 255 | Ga0105239_10711625 | 3300010375 | Bacteria | 1148 |
| 256 | Ga0105239_11760833 | 3300010375 | Bacteria | 717 |
| 257 | Ga0105246_10972824 | 3300011119 | Unclassified | 766 |
| 258 | Ga0157340_1018995 | 3300012473 | Bacteria | 565 |
| 259 | Ga0157323_1013469 | 3300012495 | Bacteria | 688 |
| 260 | Ga0157319_1021202 | 3300012497 | Bacteria | 633 |
| 261 | Ga0157326_1025172 | 3300012513 | Bacteria | 758 |
| 262 | Ga0157338_1018292 | 3300012515 | Bacteria | 793 |
| 263 | Ga0157373_10124312 | 3300013100 | Bacteria | 1814 |
| 264 | Ga0157370_10207405 | 3300013104 | Bacteria | 1817 |
| 265 | Ga0157370_10273225 | 3300013104 | Bacteria | 1561 |
| 266 | Ga0157370_10856478 | 3300013104 | Bacteria | 826 |
| 267 | Ga0157369_10238935 | 3300013105 | Bacteria | 1898 |
| 268 | Ga0157369_10310719 | 3300013105 | Bacteria | 1639 |
| 269 | Ga0157369_10647409 | 3300013105 | Bacteria | 1090 |
| 270 | Ga0157374_10003735 | 3300013296 | Bacteria | 12799 |
| 271 | Ga0157374_10225528 | 3300013296 | Bacteria | 1840 |
| 272 | Ga0157374_10347709 | 3300013296 | Bacteria | 1473 |
| 273 | Ga0157378_10343949 | 3300013297 | Bacteria | 1455 |
| 274 | Ga0157378_11566284 | 3300013297 | Bacteria | 704 |
| 275 | Ga0157378_11833816 | 3300013297 | Bacteria | 655 |
| 276 | Ga0163162_10044421 | 3300013306 | Bacteria | 4451 |
| 277 | Ga0163162_10266209 | 3300013306 | Bacteria | 1845 |
| 278 | Ga0163162_11280548 | 3300013306 | Bacteria | 833 |
| 279 | Ga0157372_10064862 | 3300013307 | Bacteria | 4099 |
| 280 | Ga0157372_10303007 | 3300013307 | Bacteria | 1859 |
| 281 | Ga0157372_10735587 | 3300013307 | Bacteria | 1147 |
| 282 | Ga0157372_10826687 | 3300013307 | Bacteria | 1076 |
| 283 | Ga0157372_11767388 | 3300013307 | Bacteria | 711 |
| 284 | Ga0157375_10023328 | 3300013308 | Bacteria | 5709 |
| 285 | Ga0157375_10270363 | 3300013308 | Bacteria | 1862 |
| 286 | Ga0163163_10007593 | 3300014325 | Bacteria | 9578 |
| 287 | Ga0163163_10025596 | 3300014325 | Bacteria | 5625 |
| 288 | Ga0163163_10030509 | 3300014325 | Bacteria | 5195 |
| 289 | Ga0163163_10101973 | 3300014325 | Bacteria | 2893 |
| 290 | Ga0157380_10546548 | 3300014326 | Bacteria | 1135 |
| 291 | Ga0182008_10275755 | 3300014497 | Bacteria | 874 |
| 292 | Ga0157377_10001300 | 3300014745 | Bacteria | 10703 |
| 293 | Ga0157377_10007244 | 3300014745 | Bacteria | 5345 |
| 294 | Ga0157377_11423006 | 3300014745 | Bacteria | 548 |
| 295 | Ga0157379_10048308 | 3300014968 | Bacteria | 3798 |
| 296 | Ga0157379_10058859 | 3300014968 | Bacteria | 3436 |
| 297 | Ga0157379_11033473 | 3300014968 | Bacteria | 784 |
| 298 | Ga0157379_11086513 | 3300014968 | Bacteria | 766 |
| 299 | Ga0157376_10141843 | 3300014969 | Bacteria | 2156 |
| 300 | Ga0213873_10019836 | 3300021358 | Bacteria | 1564 |
| 301 | Ga0213874_10005048 | 3300021377 | Bacteria | 3055 |
| 302 | Ga0213874_10034100 | 3300021377 | Bacteria | 1488 |
| 303 | Ga0213874_10092923 | 3300021377 | Bacteria | 993 |
| 304 | Ga0213876_10031360 | 3300021384 | Bacteria | 2805 |
| 305 | Ga0213875_10009052 | 3300021388 | Bacteria | 5062 |
| 306 | Ga0213875_10023508 | 3300021388 | Unclassified | 2943 |
| 307 | Ga0224712_10327652 | 3300022467 | Bacteria | 720 |
| 308 | Ga0207656_10362269 | 3300025321 | Bacteria | 725 |
| 309 | Ga0207653_10088333 | 3300025885 | Bacteria | 1083 |
| 310 | Ga0207692_10002251 | 3300025898 | Bacteria | 7388 |
| 311 | Ga0207692_10003617 | 3300025898 | Bacteria | 6049 |
| 312 | Ga0207692_10032980 | 3300025898 | Bacteria | 2493 |
| 313 | Ga0207642_10410535 | 3300025899 | Bacteria | 812 |
| 314 | Ga0207710_10000060 | 3300025900 | Bacteria | 168230 |
| 315 | Ga0207688_10008948 | 3300025901 | Bacteria | 5449 |
| 316 | Ga0207680_10806485 | 3300025903 | Bacteria | 673 |
| 317 | Ga0207685_10053189 | 3300025905 | Bacteria | 1572 |
| 318 | Ga0207685_10092741 | 3300025905 | Bacteria | 1275 |
| 319 | Ga0207699_10004195 | 3300025906 | Bacteria | 6900 |
| 320 | Ga0207699_10023655 | 3300025906 | Bacteria | 3346 |
| 321 | Ga0207699_10129033 | 3300025906 | Bacteria | 1646 |
| 322 | Ga0207699_10720143 | 3300025906 | Bacteria | 731 |
| 323 | Ga0207645_10024920 | 3300025907 | Bacteria | 3875 |
| 324 | Ga0207643_10062301 | 3300025908 | Bacteria | 2131 |
| 325 | Ga0207684_10001207 | 3300025910 | Bacteria | 28787 |
| 326 | Ga0207684_10008499 | 3300025910 | Bacteria | 9134 |
| 327 | Ga0207684_10069277 | 3300025910 | Bacteria | 2998 |
| 328 | Ga0207684_10744025 | 3300025910 | Bacteria | 831 |
| 329 | Ga0207684_10919229 | 3300025910 | Bacteria | 735 |
| 330 | Ga0207707_10069031 | 3300025912 | Bacteria | 3080 |
| 331 | Ga0207707_10646568 | 3300025912 | Bacteria | 892 |
| 332 | Ga0207707_10664841 | 3300025912 | Bacteria | 877 |
| 333 | Ga0207707_10819921 | 3300025912 | Bacteria | 774 |
| 334 | Ga0207693_10001613 | 3300025915 | Bacteria | 19936 |
| 335 | Ga0207693_10003654 | 3300025915 | Bacteria | 13129 |
| 336 | Ga0207693_10043378 | 3300025915 | Bacteria | 3539 |
| 337 | Ga0207693_10058233 | 3300025915 | Bacteria | 3027 |
| 338 | Ga0207693_10111500 | 3300025915 | Bacteria | 2146 |
| 339 | Ga0207693_10115753 | 3300025915 | Bacteria | 2105 |
| 340 | Ga0207693_10199423 | 3300025915 | Bacteria | 1574 |
| 341 | Ga0207693_10264120 | 3300025915 | Bacteria | 1349 |
| 342 | Ga0207663_10000578 | 3300025916 | Bacteria | 16160 |
| 343 | Ga0207663_10003121 | 3300025916 | Bacteria | 8043 |
| 344 | Ga0207663_10063875 | 3300025916 | Bacteria | 2347 |
| 345 | Ga0207663_10080300 | 3300025916 | Bacteria | 2132 |
| 346 | Ga0207663_10203990 | 3300025916 | Bacteria | 1428 |
| 347 | Ga0207663_10348397 | 3300025916 | Bacteria | 1121 |
| 348 | Ga0207663_10650060 | 3300025916 | Bacteria | 832 |
| 349 | Ga0207663_10721630 | 3300025916 | Bacteria | 790 |
| 350 | Ga0207660_10044127 | 3300025917 | Bacteria | 3136 |
| 351 | Ga0207660_10514585 | 3300025917 | Bacteria | 972 |
| 352 | Ga0207662_10034942 | 3300025918 | Bacteria | 2935 |
| 353 | Ga0207662_10745263 | 3300025918 | Bacteria | 688 |
| 354 | Ga0207657_10011266 | 3300025919 | Bacteria | 8884 |
| 355 | Ga0207657_10036445 | 3300025919 | Bacteria | 4402 |
| 356 | Ga0207657_10148397 | 3300025919 | Bacteria | 1911 |
| 357 | Ga0207649_10030862 | 3300025920 | Bacteria | 3179 |
| 358 | Ga0207652_10060731 | 3300025921 | Bacteria | 3262 |
| 359 | Ga0207646_10148164 | 3300025922 | Bacteria | 2115 |
| 360 | Ga0207646_10269477 | 3300025922 | Bacteria | 1539 |
| 361 | Ga0207646_10413963 | 3300025922 | Bacteria | 1217 |
| 362 | Ga0207646_10703822 | 3300025922 | Bacteria | 903 |
| 363 | Ga0207681_10001181 | 3300025923 | Bacteria | 16820 |
| 364 | Ga0207694_10529807 | 3300025924 | Bacteria | 988 |
| 365 | Ga0207650_11405162 | 3300025925 | Bacteria | 594 |
| 366 | Ga0207659_10054182 | 3300025926 | Bacteria | 2863 |
| 367 | Ga0207659_10987304 | 3300025926 | Bacteria | 724 |
| 368 | Ga0207687_10062585 | 3300025927 | Bacteria | 2632 |
| 369 | Ga0207687_10216476 | 3300025927 | Bacteria | 1506 |
| 370 | Ga0207687_11167098 | 3300025927 | Bacteria | 662 |
| 371 | Ga0207700_10000302 | 3300025928 | Bacteria | 29289 |
| 372 | Ga0207700_10002752 | 3300025928 | Bacteria | 10132 |
| 373 | Ga0207700_10060346 | 3300025928 | Bacteria | 2872 |
| 374 | Ga0207700_10176775 | 3300025928 | Bacteria | 1784 |
| 375 | Ga0207700_10244608 | 3300025928 | Bacteria | 1530 |
| 376 | Ga0207700_10247290 | 3300025928 | Bacteria | 1522 |
| 377 | Ga0207700_10276329 | 3300025928 | Bacteria | 1443 |
| 378 | Ga0207664_10000185 | 3300025929 | Bacteria | 47364 |
| 379 | Ga0207664_10000458 | 3300025929 | Bacteria | 28967 |
| 380 | Ga0207664_10001157 | 3300025929 | Bacteria | 17555 |
| 381 | Ga0207664_10018558 | 3300025929 | Bacteria | 5125 |
| 382 | Ga0207664_10037183 | 3300025929 | Bacteria | 3765 |
| 383 | Ga0207664_10048803 | 3300025929 | Bacteria | 3331 |
| 384 | Ga0207664_10334340 | 3300025929 | Bacteria | 1338 |
| 385 | Ga0207644_10439692 | 3300025931 | Bacteria | 1070 |
| 386 | Ga0207690_11270197 | 3300025932 | Bacteria | 615 |
| 387 | Ga0207706_10115042 | 3300025933 | Bacteria | 2366 |
| 388 | Ga0207709_10088688 | 3300025935 | Bacteria | 2014 |
| 389 | Ga0207709_10493034 | 3300025935 | Bacteria | 955 |
| 390 | Ga0207670_10169084 | 3300025936 | Bacteria | 1638 |
| 391 | Ga0207669_10209079 | 3300025937 | Bacteria | 1423 |
| 392 | Ga0207665_10000535 | 3300025939 | Bacteria | 25580 |
| 393 | Ga0207665_10201728 | 3300025939 | Bacteria | 1450 |
| 394 | Ga0207691_10034116 | 3300025940 | Bacteria | 4736 |
| 395 | Ga0207711_10000073 | 3300025941 | Bacteria | 107878 |
| 396 | Ga0207711_10927084 | 3300025941 | Bacteria | 809 |
| 397 | Ga0207711_11131948 | 3300025941 | Bacteria | 724 |
| 398 | Ga0207689_10004898 | 3300025942 | Bacteria | 12076 |
| 399 | Ga0207689_10005132 | 3300025942 | Bacteria | 11774 |
| 400 | Ga0207661_10037668 | 3300025944 | Bacteria | 3784 |
| 401 | Ga0207661_10047838 | 3300025944 | Bacteria | 3397 |
| 402 | Ga0207661_10081085 | 3300025944 | Bacteria | 2679 |
| 403 | Ga0207661_10085790 | 3300025944 | Bacteria | 2611 |
| 404 | Ga0207679_10015344 | 3300025945 | Bacteria | 5060 |
| 405 | Ga0207679_10015575 | 3300025945 | Bacteria | 5029 |
| 406 | Ga0207679_10111142 | 3300025945 | Bacteria | 2163 |
| 407 | Ga0207667_10518271 | 3300025949 | Bacteria | 1208 |
| 408 | Ga0207651_11022580 | 3300025960 | Bacteria | 739 |
| 409 | Ga0207712_10000042 | 3300025961 | Bacteria | 176338 |
| 410 | Ga0207668_10005675 | 3300025972 | Bacteria | 7347 |
| 411 | Ga0207668_10143148 | 3300025972 | Bacteria | 1841 |
| 412 | Ga0207668_11037428 | 3300025972 | Bacteria | 734 |
| 413 | Ga0207640_10259991 | 3300025981 | Bacteria | 1352 |
| 414 | Ga0207640_10764204 | 3300025981 | Bacteria | 834 |
| 415 | Ga0207658_10000664 | 3300025986 | Bacteria | 30027 |
| 416 | Ga0207677_10023360 | 3300026023 | Bacteria | 3818 |
| 417 | Ga0207677_10547148 | 3300026023 | Bacteria | 1008 |
| 418 | Ga0207677_11550660 | 3300026023 | Bacteria | 613 |
| 419 | Ga0207703_10038202 | 3300026035 | Bacteria | 3830 |
| 420 | Ga0207703_11375355 | 3300026035 | Bacteria | 679 |
| 421 | Ga0207639_10643434 | 3300026041 | Bacteria | 980 |
| 422 | Ga0207678_10006810 | 3300026067 | Bacteria | 10134 |
| 423 | Ga0207678_10025768 | 3300026067 | Bacteria | 5132 |
| 424 | Ga0207678_10795758 | 3300026067 | Bacteria | 835 |
| 425 | Ga0207708_10007865 | 3300026075 | Bacteria | 7896 |
| 426 | Ga0207708_11517779 | 3300026075 | Bacteria | 589 |
| 427 | Ga0207702_10024708 | 3300026078 | Bacteria | 4985 |
| 428 | Ga0207702_10187839 | 3300026078 | Bacteria | 1907 |
| 429 | Ga0207702_10207616 | 3300026078 | Bacteria | 1819 |
| 430 | Ga0207702_10211202 | 3300026078 | Bacteria | 1804 |
| 431 | Ga0207702_10229708 | 3300026078 | Bacteria | 1733 |
| 432 | Ga0207702_10264195 | 3300026078 | Bacteria | 1621 |
| 433 | Ga0207702_10667958 | 3300026078 | Bacteria | 1023 |
| 434 | Ga0207702_10814188 | 3300026078 | Bacteria | 923 |
| 435 | Ga0207641_10003278 | 3300026088 | Bacteria | 14399 |
| 436 | Ga0207641_10037081 | 3300026088 | Bacteria | 4071 |
| 437 | Ga0207648_11290113 | 3300026089 | Bacteria | 686 |
| 438 | Ga0207676_10020587 | 3300026095 | Bacteria | 4829 |
| 439 | Ga0207676_10756177 | 3300026095 | Bacteria | 945 |
| 440 | Ga0207674_10005156 | 3300026116 | Bacteria | 15573 |
| 441 | Ga0207674_10045837 | 3300026116 | Bacteria | 4494 |
| 442 | Ga0207674_10187918 | 3300026116 | Bacteria | 2016 |
| 443 | Ga0207674_10205320 | 3300026116 | Bacteria | 1920 |
| 444 | Ga0207683_10006835 | 3300026121 | Bacteria | 9768 |
| 445 | Ga0207698_10080542 | 3300026142 | Bacteria | 2624 |
| 446 | Ga0207428_10060676 | 3300027907 | Bacteria | 2996 |
| 447 | Ga0207428_10198715 | 3300027907 | Bacteria | 1509 |
| 448 | Ga0268266_10006088 | 3300028379 | Bacteria | 11113 |
| 449 | Ga0268266_10295353 | 3300028379 | Bacteria | 1510 |
| 450 | Ga0268266_10596403 | 3300028379 | Bacteria | 1061 |
| 451 | Ga0268265_10000051 | 3300028380 | Bacteria | 174968 |
| 452 | Ga0268265_10032577 | 3300028380 | Bacteria | 3779 |
| 453 | Ga0268265_10099372 | 3300028380 | Bacteria | 2346 |
| 454 | Ga0268264_10000108 | 3300028381 | Bacteria | 208791 |
| 455 | Ga0268264_10282649 | 3300028381 | Bacteria | 1555 |
| 456 | Ga0265319_1055609 | 3300028563 | Bacteria | 1294 |
| 457 | Ga0307515_10299937 | 3300028794 | Bacteria | 1293 |
| 458 | Ga0265338_10098706 | 3300028800 | Bacteria | 2388 |
| 459 | Ga0265760_10144421 | 3300031090 | Bacteria | 777 |
| 460 | Ga0307513_10036389 | 3300031456 | Bacteria | 5492 |
| 461 | Ga0307408_100204500 | 3300031548 | Bacteria | 1601 |
| 462 | Ga0307508_10019206 | 3300031616 | Bacteria | 6213 |
| 463 | Ga0307508_10094452 | 3300031616 | Bacteria | 2581 |
| 464 | Ga0307508_10396150 | 3300031616 | Bacteria | 972 |
| 465 | Ga0265314_10053595 | 3300031711 | Bacteria | 2797 |
| 466 | Ga0307516_10101978 | 3300031730 | Bacteria | 2685 |
| 467 | Ga0307413_11865573 | 3300031824 | Bacteria | 539 |
| 468 | Ga0307410_10457271 | 3300031852 | Bacteria | 1043 |
| 469 | Ga0307406_10114633 | 3300031901 | Bacteria | 1862 |
| 470 | Ga0307406_10416420 | 3300031901 | Bacteria | 1069 |
| 471 | Ga0307407_10193721 | 3300031903 | Bacteria | 1357 |
| 472 | Ga0307407_10586700 | 3300031903 | Bacteria | 828 |
| 473 | Ga0307412_10658893 | 3300031911 | Bacteria | 894 |
| 474 | Ga0307412_11018560 | 3300031911 | Bacteria | 732 |
| 475 | Ga0307409_100932336 | 3300031995 | Bacteria | 883 |
| 476 | Ga0307409_102065886 | 3300031995 | Bacteria | 599 |
| 477 | Ga0307411_10127109 | 3300032005 | Bacteria | 1856 |
| 478 | Ga0307411_11529774 | 3300032005 | Bacteria | 614 |
| 479 | Ga0307415_100007467 | 3300032126 | Bacteria | 5983 |
| 480 | Ga0307415_100118427 | 3300032126 | Bacteria | 1980 |
| 481 | Ga0307415_100375892 | 3300032126 | Bacteria | 1205 |
| 482 | Ga0307415_100428782 | 3300032126 | Bacteria | 1137 |
| 483 | Ga0307415_101091715 | 3300032126 | Bacteria | 746 |
| 484 | Ga0307415_101752647 | 3300032126 | Bacteria | 600 |
| 485 | Ga0373950_0024368 | 3300034818 | Bacteria | 1087 |
| 486 | Ga0373950_0083183 | 3300034818 | Bacteria | 671 |
| 487 | Ga0373938_0082079 | 3300034957 | Bacteria | 786 |
| 488 | Ga0373926_0000817 | 3300035083 | Bacteria | 8813 |
| 489 | Ga0373926_0193871 | 3300035083 | Bacteria | 781 |
| 490 | Ga0373928_0017709 | 3300035084 | Bacteria | 1469 |
| 491 | Ga0373934_0011547 | 3300035086 | Bacteria | 3322 |
| 492 | Ga0373934_0060881 | 3300035086 | Bacteria | 1503 |
| 493 | Ga0373934_0080249 | 3300035086 | Bacteria | 1310 |
| 494 | Ga0373934_0336192 | 3300035086 | Bacteria | 628 |
| 495 | Ga0373940_0029043 | 3300035088 | Bacteria | 1463 |
| 496 | Ga0373944_0072876 | 3300035089 | Bacteria | 1122 |
| 497 | Ga0373952_0023545 | 3300035092 | Bacteria | 1317 |
| 498 | Ga0373923_0012776 | 3300035111 | Bacteria | 3115 |
| 499 | Ga0373923_0028536 | 3300035111 | Bacteria | 2232 |
| 500 | Ga0373923_0029354 | 3300035111 | Bacteria | 2205 |
| 501 | Ga0373932_0104021 | 3300035112 | Bacteria | 928 |
| 502 | Ga0373936_0002860 | 3300035113 | Bacteria | 6445 |
| 503 | Ga0373936_0039234 | 3300035113 | Bacteria | 1895 |
| 504 | Ga0373936_0053620 | 3300035113 | Bacteria | 1635 |
| 505 | Ga0373936_0238935 | 3300035113 | Bacteria | 809 |
| 506 | Ga0373939_0007962 | 3300035114 | Bacteria | 2588 |
| 507 | Ga0373941_0001089 | 3300035115 | Bacteria | 5656 |
| 508 | Ga0373941_0008987 | 3300035115 | Bacteria | 2504 |
| 509 | Ga0373941_0190976 | 3300035115 | Bacteria | 774 |
| 510 | Ga0373945_0001271 | 3300035116 | Bacteria | 7662 |
| 511 | Ga0373953_0010439 | 3300035117 | Bacteria | 3232 |
| 512 | Ga0373953_0011667 | 3300035117 | Bacteria | 3091 |
| 513 | Ga0373953_0021422 | 3300035117 | Bacteria | 2425 |
| 514 | Ga0373953_0035696 | 3300035117 | Bacteria | 1955 |
| 515 | Ga0373953_0202221 | 3300035117 | Bacteria | 859 |
| 516 | Ga0373954_0025505 | 3300035118 | Bacteria | 2703 |
| 517 | Ga0373954_0080628 | 3300035118 | Bacteria | 1554 |
| 518 | Ga0373954_0110834 | 3300035118 | Bacteria | 1327 |
| 519 | Ga0373954_0216861 | 3300035118 | Bacteria | 941 |
| 520 | Ga0373956_0007477 | 3300035119 | Bacteria | 4401 |
| 521 | Ga0373956_0012871 | 3300035119 | Bacteria | 3474 |
| 522 | Ga0373956_0227239 | 3300035119 | Bacteria | 886 |
| 523 | Ga0373957_0001345 | 3300035120 | Bacteria | 6593 |
| 524 | Ga0373957_0028626 | 3300035120 | Bacteria | 2031 |
| 525 | Ga0373960_0050479 | 3300035121 | Bacteria | 1233 |
| 526 | Ga0373943_0144442 | 3300035170 | Bacteria | 1284 |
| 527 | Ga0373943_0175691 | 3300035170 | Bacteria | 1174 |
| 528 | Ga0373943_0200078 | 3300035170 | Bacteria | 1105 |
| 529 | Ga0373943_0370988 | 3300035170 | Bacteria | 823 |
| 530 | Ga0373946_0002684 | 3300035171 | Bacteria | 6290 |
| 531 | Ga0373946_0061237 | 3300035171 | Bacteria | 1602 |
| 532 | Ga0373946_0110206 | 3300035171 | Bacteria | 1245 |
| 533 | Ga0373955_0002560 | 3300035172 | Bacteria | 7953 |
| 534 | Ga0373955_0068827 | 3300035172 | Bacteria | 1973 |
| 535 | Ga0373942_0002863 | 3300035207 | Bacteria | 4099 |
| 536 | Ga0373942_0018104 | 3300035207 | Bacteria | 1744 |
| 537 | Ga0373962_0002821 | 3300035242 | Bacteria | 4150 |
| 538 | Ga0373962_0008781 | 3300035242 | Bacteria | 2495 |
| 539 | Ga0373924_0000926 | 3300035410 | Bacteria | 9264 |
| 540 | Ga0373924_0010047 | 3300035410 | Bacteria | 3483 |
| 541 | Ga0373924_0185955 | 3300035410 | Bacteria | 914 |
| 542 | Ga0373931_0005594 | 3300035691 | Bacteria | 5825 |
| 543 | Ga0373931_0379720 | 3300035691 | Bacteria | 890 |
| 544 | Ga0373935_0012683 | 3300035692 | Bacteria | 5071 |
| 545 | Ga0373935_0053537 | 3300035692 | Bacteria | 2567 |
| 546 | Ga0373935_0054348 | 3300035692 | Bacteria | 2549 |
| 547 | Ga0373935_0153991 | 3300035692 | Bacteria | 1562 |
| 548 | Ga0373935_0992445 | 3300035692 | Bacteria | 623 |
| 549 | Ga0373935_1004404 | 3300035692 | Bacteria | 620 |
| 550 | Ga0373927_0342744 | 3300035695 | Bacteria | 985 |
| 551 | Ga0373933_0008678 | 3300035724 | Bacteria | 5542 |
| 552 | Ga0373933_0008877 | 3300035724 | Bacteria | 5481 |
| 553 | Ga0373933_0020080 | 3300035724 | Bacteria | 3783 |
| 554 | Ga0373933_0106519 | 3300035724 | Bacteria | 1744 |
| 555 | Ga0373933_0473865 | 3300035724 | Bacteria | 820 |
| 556 | Ga0373933_0476276 | 3300035724 | Bacteria | 817 |
| 557 | Ga0373947_0004433 | 3300035725 | Bacteria | 8232 |
| 558 | Ga0373947_0138638 | 3300035725 | Bacteria | 1558 |
| 559 | Ga0373947_0591279 | 3300035725 | Bacteria | 756 |
| 560 | Ga0373947_0896275 | 3300035725 | Bacteria | 605 |
| 561 | Ga0373937_0003013 | 3300036401 | Bacteria | 14127 |
| 562 | Ga0373937_0032932 | 3300036401 | Bacteria | 4702 |
| 563 | Ga0373937_0057179 | 3300036401 | Bacteria | 3582 |
| 564 | Ga0373937_0095639 | 3300036401 | Bacteria | 2754 |
| 565 | Ga0373937_0117878 | 3300036401 | Bacteria | 2473 |
| 566 | Ga0373937_0192503 | 3300036401 | Bacteria | 1916 |
| 567 | Ga0373937_0429946 | 3300036401 | Bacteria | 1253 |
| 568 | Ga0373937_0565107 | 3300036401 | Bacteria | 1080 |
| 569 | Ga0373937_1051284 | 3300036401 | Bacteria | 763 |
| 570 | Ga0373925_0000869 | 3300037068 | Bacteria | 27621 |
| 571 | Ga0373925_0005422 | 3300037068 | Bacteria | 9501 |
| 572 | Ga0373925_0029410 | 3300037068 | Bacteria | 4031 |
| 573 | Ga0373925_0067304 | 3300037068 | Bacteria | 2701 |
| 574 | Ga0373925_0145825 | 3300037068 | Bacteria | 1856 |
| 575 | Ga0373925_0182583 | 3300037068 | Bacteria | 1661 |
| 576 | Ga0373925_0204190 | 3300037068 | Bacteria | 1572 |
| 577 | Ga0373925_0232254 | 3300037068 | Bacteria | 1475 |
| 578 | Ga0373925_0432315 | 3300037068 | Bacteria | 1076 |
| 579 | Ga0395900_0007503 | 3300037418 | Bacteria | 11268 |
| 580 | Ga0395900_0461624 | 3300037418 | Bacteria | 1225 |
| 581 | Ga0395898_0001314 | 3300037466 | Bacteria | 36175 |
| 582 | Ga0436364_0151243 | 3300037853 | Bacteria | 4248 |
| 583 | Ga0436364_0266465 | 3300037853 | Bacteria | 31259 |
| 584 | Ga0436364_0329661 | 3300037853 | Bacteria | 1054 |
| 585 | Ga0436364_0640801 | 3300037853 | Bacteria | 10289 |
| 586 | Ga0436364_0807521 | 3300037853 | Bacteria | 882 |
| 587 | Ga0436364_0833426 | 3300037853 | Bacteria | 26251 |
| 588 | Ga0436365_0577455 | 3300039437 | Bacteria | 723 |
| 589 | Ga0436365_1262337 | 3300039437 | Bacteria | 30999 |
| 590 | Ga0436365_1431667 | 3300039437 | Bacteria | 3029 |
| 591 | Ga0436365_1638261 | 3300039437 | Bacteria | 1382 |
| 592 | Ga0436365_1719466 | 3300039437 | Bacteria | 5551 |
| 593 | Ga0436365_1855302 | 3300039437 | Bacteria | 9293 |
| 594 | Ga0436365_1906766 | 3300039437 | Bacteria | 2450 |
| 595 | Ga0436365_1930531 | 3300039437 | Bacteria | 3168 |
| 596 | Ga0436360_0806080 | 3300039438 | Bacteria | 775 |
| 597 | Ga0436363_0026259 | 3300039450 | Bacteria | 986 |
| 598 | Ga0436363_0034926 | 3300039450 | Bacteria | 14835 |
| 599 | Ga0436363_0579082 | 3300039450 | Bacteria | 5923 |
| 600 | Ga0436363_0584233 | 3300039450 | Bacteria | 1144 |
| 601 | Ga0436363_0771498 | 3300039450 | Bacteria | 695 |
| 602 | Ga0436363_1340115 | 3300039450 | Bacteria | 839 |
| 603 | Ga0436363_1661362 | 3300039450 | Bacteria | 11266 |
| 604 | Ga0436363_1663746 | 3300039450 | Bacteria | 7346 |
| 605 | Ga0436363_1692517 | 3300039450 | Bacteria | 1157 |
| 606 | Ga0436362_0035988 | 3300039453 | Bacteria | 2003 |
| 607 | Ga0436362_0331281 | 3300039453 | Bacteria | 1709 |
| 608 | Ga0436362_0499114 | 3300039453 | Bacteria | 1929 |
| 609 | Ga0436362_0947624 | 3300039453 | Bacteria | 564 |
| 610 | Ga0436362_0977146 | 3300039453 | Bacteria | 881 |
| 611 | Ga0436362_0994550 | 3300039453 | Bacteria | 1375 |
| 612 | Ga0439434_0301941 | 3300042435 | Bacteria | 554 |
| 613 | Ga0466969_0017241 | 3300044656 | Bacteria | 3773 |
| 614 | Ga0466969_0056935 | 3300044656 | Bacteria | 1907 |
| 615 | Ga0466965_0570196 | 3300044683 | Bacteria | 641 |
| 616 | Ga0466966_0004546 | 3300044684 | Bacteria | 9143 |
| 617 | Ga0466961_0128500 | 3300044693 | Bacteria | 1588 |
| 618 | Ga0466963_0174871 | 3300044694 | Bacteria | 1498 |
| 619 | Ga0466971_0075886 | 3300044719 | Bacteria | 1529 |
| 620 | Ga0466971_0596415 | 3300044719 | Bacteria | 550 |
| 621 | Ga0466970_0139384 | 3300044765 | Bacteria | 1335 |
| 622 | Ga0466970_0490595 | 3300044765 | Bacteria | 707 |
| 623 | Ga0466957_0021755 | 3300044842 | Bacteria | 3780 |
| 624 | Ga0466959_0023716 | 3300045049 | Bacteria | 4541 |
| 625 | Ga0466959_0108966 | 3300045049 | Bacteria | 1978 |
| 626 | Ga0466967_0123893 | 3300045976 | Bacteria | 2392 |
| 627 | Ga0466967_0310940 | 3300045976 | Bacteria | 1518 |
| 628 | Ga0466967_0581754 | 3300045976 | Bacteria | 1104 |
| 629 | Ga0466967_0670867 | 3300045976 | Bacteria | 1026 |
| 630 | Ga0495592_0042664 | 3300046454 | Bacteria | 3397 |
| 631 | Ga0495592_0044664 | 3300046454 | Bacteria | 3309 |
| 632 | Ga0495592_0159477 | 3300046454 | Bacteria | 1553 |
| 633 | Ga0495603_0013211 | 3300046455 | Bacteria | 4990 |
| 634 | Ga0495603_0454085 | 3300046455 | Bacteria | 734 |
| 635 | Ga0495629_0009154 | 3300046459 | Bacteria | 7251 |
| 636 | Ga0495629_0020093 | 3300046459 | Bacteria | 4769 |
| 637 | Ga0495629_0048612 | 3300046459 | Bacteria | 2974 |
| 638 | Ga0495629_0055937 | 3300046459 | Bacteria | 2759 |
| 639 | Ga0495629_0129266 | 3300046459 | Bacteria | 1760 |
| 640 | Ga0495629_0145171 | 3300046459 | Bacteria | 1650 |
| 641 | Ga0495629_0463336 | 3300046459 | Bacteria | 857 |
| 642 | Ga0495638_0006284 | 3300046460 | Bacteria | 8664 |
| 643 | Ga0495641_0005028 | 3300046461 | Bacteria | 9111 |
| 644 | Ga0495641_0008182 | 3300046461 | Bacteria | 6419 |
| 645 | Ga0495641_0036891 | 3300046461 | Bacteria | 2294 |
| 646 | Ga0495651_0002913 | 3300046462 | Bacteria | 13247 |
| 647 | Ga0495651_0004518 | 3300046462 | Bacteria | 10644 |
| 648 | Ga0495651_0032330 | 3300046462 | Bacteria | 4081 |
| 649 | Ga0495651_0129969 | 3300046462 | Bacteria | 1839 |
| 650 | Ga0495651_0171602 | 3300046462 | Bacteria | 1544 |
| 651 | Ga0495653_0003833 | 3300046463 | Bacteria | 12166 |
| 652 | Ga0495653_0004516 | 3300046463 | Bacteria | 11239 |
| 653 | Ga0495653_0035259 | 3300046463 | Bacteria | 3949 |
| 654 | Ga0495653_0097738 | 3300046463 | Bacteria | 2132 |
| 655 | Ga0495653_0866628 | 3300046463 | Bacteria | 539 |
| 656 | Ga0495580_0010686 | 3300046472 | Bacteria | 7131 |
| 657 | Ga0495580_0011003 | 3300046472 | Bacteria | 7013 |
| 658 | Ga0495580_0292829 | 3300046472 | Bacteria | 1109 |
| 659 | Ga0495582_0001153 | 3300046473 | Bacteria | 14859 |
| 660 | Ga0495582_0004357 | 3300046473 | Bacteria | 7961 |
| 661 | Ga0495582_0025073 | 3300046473 | Bacteria | 3266 |
| 662 | Ga0495582_0045451 | 3300046473 | Bacteria | 2418 |
| 663 | Ga0495639_0000717 | 3300046475 | Bacteria | 15170 |
| 664 | Ga0495639_0007385 | 3300046475 | Bacteria | 4719 |
| 665 | Ga0495639_0052881 | 3300046475 | Bacteria | 1849 |
| 666 | Ga0495662_0000952 | 3300046476 | Bacteria | 14172 |
| 667 | Ga0495662_0002610 | 3300046476 | Bacteria | 9110 |
| 668 | Ga0495662_0044771 | 3300046476 | Bacteria | 2136 |
| 669 | Ga0495662_0304125 | 3300046476 | Bacteria | 784 |
| 670 | Ga0495664_0023134 | 3300046477 | Bacteria | 3604 |
| 671 | Ga0495664_0041406 | 3300046477 | Bacteria | 2725 |
| 672 | Ga0495664_0052301 | 3300046477 | Bacteria | 2426 |
| 673 | Ga0495664_0093135 | 3300046477 | Bacteria | 1813 |
| 674 | Ga0495664_0100715 | 3300046477 | Bacteria | 1740 |
| 675 | Ga0495594_0011242 | 3300046499 | Bacteria | 4649 |
| 676 | Ga0495594_0132848 | 3300046499 | Bacteria | 1410 |
| 677 | Ga0495594_0408598 | 3300046499 | Bacteria | 772 |
| 678 | Ga0495608_0009478 | 3300046511 | Bacteria | 6802 |
| 679 | Ga0495608_0017200 | 3300046511 | Bacteria | 5003 |
| 680 | Ga0495608_0019429 | 3300046511 | Bacteria | 4675 |
| 681 | Ga0495608_0020299 | 3300046511 | Bacteria | 4567 |
| 682 | Ga0495608_0114627 | 3300046511 | Bacteria | 1731 |
| 683 | Ga0495608_0233940 | 3300046511 | Bacteria | 1149 |
| 684 | Ga0495618_0006876 | 3300046514 | Bacteria | 6892 |
| 685 | Ga0495618_0011467 | 3300046514 | Bacteria | 5376 |
| 686 | Ga0495618_0028460 | 3300046514 | Bacteria | 3482 |
| 687 | Ga0495618_0121555 | 3300046514 | Bacteria | 1672 |
| 688 | Ga0495618_0200115 | 3300046514 | Bacteria | 1264 |
| 689 | Ga0495628_0013479 | 3300046516 | Bacteria | 6876 |
| 690 | Ga0495628_0053855 | 3300046516 | Bacteria | 3173 |
| 691 | Ga0495628_0060924 | 3300046516 | Bacteria | 2960 |
| 692 | Ga0495628_0110437 | 3300046516 | Bacteria | 2115 |
| 693 | Ga0495628_0355885 | 3300046516 | Bacteria | 1075 |
| 694 | Ga0495628_0688251 | 3300046516 | Bacteria | 723 |
| 695 | Ga0495630_0018362 | 3300046517 | Bacteria | 5138 |
| 696 | Ga0495630_0128527 | 3300046517 | Bacteria | 1923 |
| 697 | Ga0495630_0292735 | 3300046517 | Bacteria | 1244 |
| 698 | Ga0495630_0804517 | 3300046517 | Bacteria | 717 |
| 699 | Ga0495666_0014871 | 3300046526 | Bacteria | 3873 |
| 700 | Ga0495666_0048760 | 3300046526 | Bacteria | 2039 |
| 701 | Ga0495666_0063739 | 3300046526 | Bacteria | 1759 |
| 702 | Ga0495666_0271447 | 3300046526 | Bacteria | 770 |
| 703 | Ga0495652_0007334 | 3300046529 | Bacteria | 10169 |
| 704 | Ga0495652_0022709 | 3300046529 | Bacteria | 5567 |
| 705 | Ga0495652_0129628 | 3300046529 | Bacteria | 1998 |
| 706 | Ga0495652_0724266 | 3300046529 | Bacteria | 667 |
| 707 | Ga0495665_0014877 | 3300046531 | Bacteria | 4191 |
| 708 | Ga0495665_0021143 | 3300046531 | Bacteria | 3495 |
| 709 | Ga0495665_0089633 | 3300046531 | Bacteria | 1616 |
| 710 | Ga0495640_0015937 | 3300046533 | Bacteria | 5638 |
| 711 | Ga0495640_0020924 | 3300046533 | Bacteria | 4810 |
| 712 | Ga0495640_0057233 | 3300046533 | Bacteria | 2661 |
| 713 | Ga0495640_0155193 | 3300046533 | Bacteria | 1469 |
| 714 | Ga0495640_0220107 | 3300046533 | Bacteria | 1197 |
| 715 | Ga0495640_0646216 | 3300046533 | Bacteria | 637 |
| 716 | Ga0495586_0001181 | 3300046535 | Bacteria | 14662 |
| 717 | Ga0495586_0146868 | 3300046535 | Bacteria | 1326 |
| 718 | Ga0495586_0157565 | 3300046535 | Bacteria | 1279 |
| 719 | Ga0495586_0194785 | 3300046535 | Bacteria | 1148 |
| 720 | Ga0495587_0005606 | 3300046536 | Bacteria | 8190 |
| 721 | Ga0495587_0008893 | 3300046536 | Bacteria | 6444 |
| 722 | Ga0495587_0010585 | 3300046536 | Bacteria | 5863 |
| 723 | Ga0495587_0026615 | 3300046536 | Bacteria | 3526 |
| 724 | Ga0495587_0221683 | 3300046536 | Bacteria | 1066 |
| 725 | Ga0495587_0431638 | 3300046536 | Bacteria | 731 |
| 726 | Ga0495645_0060738 | 3300046543 | Bacteria | 2740 |
| 727 | Ga0495645_0105747 | 3300046543 | Bacteria | 1996 |
| 728 | Ga0495645_0256631 | 3300046543 | Bacteria | 1159 |
| 729 | Ga0495645_0275554 | 3300046543 | Bacteria | 1108 |
| 730 | Ga0495622_0209866 | 3300046557 | Bacteria | 865 |
| 731 | Ga0495667_0000218 | 3300046559 | Bacteria | 37859 |
| 732 | Ga0495667_0001137 | 3300046559 | Bacteria | 17334 |
| 733 | Ga0495667_0024855 | 3300046559 | Bacteria | 4034 |
| 734 | Ga0495667_0031491 | 3300046559 | Bacteria | 3560 |
| 735 | Ga0495667_0185525 | 3300046559 | Bacteria | 1334 |
| 736 | Ga0495667_0311578 | 3300046559 | Bacteria | 996 |
| 737 | Ga0495667_0402124 | 3300046559 | Bacteria | 862 |
| 738 | Ga0495634_0016948 | 3300046642 | Bacteria | 5203 |
| 739 | Ga0495634_0029812 | 3300046642 | Bacteria | 3774 |
| 740 | Ga0495634_0036714 | 3300046642 | Bacteria | 3350 |
| 741 | Ga0495634_0043005 | 3300046642 | Bacteria | 3062 |
| 742 | Ga0495634_0043395 | 3300046642 | Bacteria | 3047 |
| 743 | Ga0495634_0054634 | 3300046642 | Bacteria | 2672 |
| 744 | Ga0495635_0005138 | 3300046663 | Bacteria | 9110 |
| 745 | Ga0495635_0017189 | 3300046663 | Bacteria | 5051 |
| 746 | Ga0495635_0033165 | 3300046663 | Bacteria | 3581 |
| 747 | Ga0495635_0084237 | 3300046663 | Bacteria | 2175 |
| 748 | Ga0495635_0977344 | 3300046663 | Bacteria | 539 |
| 749 | Ga0495588_0034317 | 3300046674 | Bacteria | 2567 |
| 750 | Ga0495588_0237343 | 3300046674 | Bacteria | 962 |
| 751 | Ga0495657_0022907 | 3300046675 | Bacteria | 4470 |
| 752 | Ga0495657_0025066 | 3300046675 | Bacteria | 4238 |
| 753 | Ga0495657_0028011 | 3300046675 | Bacteria | 3966 |
| 754 | Ga0495657_0061493 | 3300046675 | Bacteria | 2483 |
| 755 | Ga0495657_0128347 | 3300046675 | Bacteria | 1590 |
| 756 | Ga0495599_0001452 | 3300046678 | Bacteria | 13594 |
| 757 | Ga0495599_0006158 | 3300046678 | Bacteria | 7225 |
| 758 | Ga0495599_0023670 | 3300046678 | Bacteria | 3840 |
| 759 | Ga0495599_0064712 | 3300046678 | Bacteria | 2284 |
| 760 | Ga0495599_0105616 | 3300046678 | Bacteria | 1754 |
| 761 | Ga0495623_0027330 | 3300046679 | Bacteria | 3670 |
| 762 | Ga0495623_0029849 | 3300046679 | Bacteria | 3508 |
| 763 | Ga0495623_0063149 | 3300046679 | Bacteria | 2319 |
| 764 | Ga0495623_0074488 | 3300046679 | Bacteria | 2109 |
| 765 | Ga0495623_0487829 | 3300046679 | Bacteria | 652 |
| 766 | Ga0495646_0006843 | 3300046680 | Bacteria | 7236 |
| 767 | Ga0495646_0008505 | 3300046680 | Bacteria | 6518 |
| 768 | Ga0495646_0012811 | 3300046680 | Bacteria | 5329 |
| 769 | Ga0495646_0013357 | 3300046680 | Bacteria | 5219 |
| 770 | Ga0495646_0015506 | 3300046680 | Bacteria | 4835 |
| 771 | Ga0495646_0113866 | 3300046680 | Bacteria | 1537 |
| 772 | Ga0495658_0003523 | 3300046683 | Bacteria | 7744 |
| 773 | Ga0495658_0014278 | 3300046683 | Bacteria | 4055 |
| 774 | Ga0495658_0077717 | 3300046683 | Bacteria | 1941 |
| 775 | Ga0495613_0006664 | 3300046689 | Bacteria | 8627 |
| 776 | Ga0495613_0015703 | 3300046689 | Bacteria | 5635 |
| 777 | Ga0495613_0020282 | 3300046689 | Bacteria | 4955 |
| 778 | Ga0495613_0044544 | 3300046689 | Bacteria | 3282 |
| 779 | Ga0495624_0009453 | 3300046690 | Bacteria | 6753 |
| 780 | Ga0495624_0031751 | 3300046690 | Bacteria | 3430 |
| 781 | Ga0495624_0074906 | 3300046690 | Bacteria | 2102 |
| 782 | Ga0495624_0078240 | 3300046690 | Bacteria | 2051 |
| 783 | Ga0495624_0097176 | 3300046690 | Bacteria | 1814 |
| 784 | Ga0495600_0002618 | 3300046809 | Bacteria | 10375 |
| 785 | Ga0495600_0008482 | 3300046809 | Bacteria | 6315 |
| 786 | Ga0495600_0047553 | 3300046809 | Bacteria | 2798 |
| 787 | Ga0495600_0061673 | 3300046809 | Bacteria | 2449 |
| 788 | Ga0495600_0113961 | 3300046809 | Bacteria | 1760 |
| 789 | Ga0495581_0007796 | 3300047315 | Bacteria | 6200 |
| 790 | Ga0495581_0008567 | 3300047315 | Bacteria | 5925 |
| 791 | Ga0495581_0026087 | 3300047315 | Bacteria | 3389 |
| 792 | Ga0495581_0058994 | 3300047315 | Bacteria | 2216 |
| 793 | Ga0495581_0417681 | 3300047315 | Bacteria | 782 |
| 794 | Ga0495604_0010095 | 3300047317 | Bacteria | 7478 |
| 795 | Ga0495604_0021043 | 3300047317 | Bacteria | 5204 |
| 796 | Ga0495604_0067823 | 3300047317 | Bacteria | 2709 |
| 797 | Ga0495604_0081977 | 3300047317 | Bacteria | 2413 |
| 798 | Ga0495604_0227947 | 3300047317 | Bacteria | 1279 |
| 799 | Ga0495604_0499355 | 3300047317 | Bacteria | 789 |
| 800 | Ga0495674_0006623 | 3300047319 | Bacteria | 11099 |
| 801 | Ga0495674_0013603 | 3300047319 | Bacteria | 7644 |
| 802 | Ga0495674_0033255 | 3300047319 | Bacteria | 4672 |
| 803 | Ga0495674_0136743 | 3300047319 | Bacteria | 2061 |
| 804 | Ga0495674_0182784 | 3300047319 | Bacteria | 1745 |
| 805 | Ga0495674_0208431 | 3300047319 | Bacteria | 1620 |
| 806 | Ga0495674_0217254 | 3300047319 | Bacteria | 1581 |
| 807 | Ga0495674_0844055 | 3300047319 | Bacteria | 710 |
| 808 | Ga0495674_1377278 | 3300047319 | Bacteria | 526 |
| 809 | Ga0495676_0002773 | 3300047321 | Bacteria | 15741 |
| 810 | Ga0495676_0110119 | 3300047321 | Bacteria | 2022 |
| 811 | Ga0495676_0162605 | 3300047321 | Bacteria | 1578 |
| 812 | Ga0495676_0168649 | 3300047321 | Bacteria | 1542 |
| 813 | Ga0495676_0272444 | 3300047321 | Bacteria | 1148 |
| 814 | Ga0495680_0002214 | 3300047322 | Bacteria | 20092 |
| 815 | Ga0495680_0011349 | 3300047322 | Bacteria | 7890 |
| 816 | Ga0495680_0044192 | 3300047322 | Bacteria | 3523 |
| 817 | Ga0495680_0060437 | 3300047322 | Bacteria | 2920 |
| 818 | Ga0495680_0092035 | 3300047322 | Bacteria | 2272 |
| 819 | Ga0495680_0160669 | 3300047322 | Bacteria | 1632 |
| 820 | Ga0495680_0900248 | 3300047322 | Bacteria | 571 |
| 821 | Ga0495675_0002221 | 3300047444 | Bacteria | 11586 |
| 822 | Ga0495675_0018074 | 3300047444 | Bacteria | 4470 |
| 823 | Ga0495675_0033476 | 3300047444 | Bacteria | 3280 |
| 824 | Ga0495675_0110673 | 3300047444 | Bacteria | 1714 |
| 825 | Ga0495675_0126688 | 3300047444 | Bacteria | 1589 |
| 826 | Ga0495684_0034949 | 3300047471 | Bacteria | 3856 |
| 827 | Ga0495684_0055134 | 3300047471 | Bacteria | 3031 |
| 828 | Ga0495684_0140106 | 3300047471 | Bacteria | 1813 |
| 829 | Ga0495684_0286610 | 3300047471 | Bacteria | 1186 |
| 830 | Ga0495593_0005814 | 3300047673 | Bacteria | 7272 |
| 831 | Ga0495593_0006554 | 3300047673 | Bacteria | 6813 |
| 832 | Ga0495593_0046344 | 3300047673 | Bacteria | 2317 |
| 833 | Ga0495593_0095802 | 3300047673 | Bacteria | 1525 |
| 834 | Ga0495593_0116900 | 3300047673 | Bacteria | 1358 |
| 835 | Ga0495593_0159071 | 3300047673 | Bacteria | 1141 |
| 836 | Ga0495602_0028307 | 3300048088 | Bacteria | 5365 |
| 837 | Ga0495602_0055418 | 3300048088 | Bacteria | 3491 |
| 838 | Ga0495602_0062328 | 3300048088 | Bacteria | 3235 |
| 839 | Ga0495602_0147576 | 3300048088 | Bacteria | 1853 |
| 840 | Ga0495602_0227713 | 3300048088 | Bacteria | 1402 |
| 841 | Ga0495614_0011826 | 3300048089 | Bacteria | 3837 |
| 842 | Ga0495614_0062817 | 3300048089 | Bacteria | 1596 |
| 843 | Ga0496100_0007581 | 3300048903 | Bacteria | 5999 |
| 844 | Ga0496100_0081472 | 3300048903 | Bacteria | 2187 |
| 845 | Ga0496100_0091970 | 3300048903 | Bacteria | 2072 |
| 846 | Ga0496100_0492993 | 3300048903 | Bacteria | 943 |
| 847 | Ga0496100_0617422 | 3300048903 | Bacteria | 843 |
| 848 | Ga0496101_0020308 | 3300048904 | Bacteria | 4544 |
| 849 | Ga0496101_0226662 | 3300048904 | Bacteria | 1452 |
| 850 | Ga0496101_0568469 | 3300048904 | Bacteria | 896 |
| 851 | Ga0496101_0982334 | 3300048904 | Bacteria | 664 |
| 852 | Ga0496102_0000390 | 3300048905 | Bacteria | 51759 |
| 853 | Ga0496102_0065517 | 3300048905 | Bacteria | 3330 |
| 854 | Ga0496102_0087792 | 3300048905 | Bacteria | 2874 |
| 855 | Ga0496102_0251507 | 3300048905 | Bacteria | 1666 |
| 856 | Ga0496102_0268868 | 3300048905 | Bacteria | 1607 |
| 857 | Ga0496102_0967586 | 3300048905 | Bacteria | 772 |
| 858 | Ga0496102_1073251 | 3300048905 | Bacteria | 725 |
| 859 | Ga0496103_0000663 | 3300048906 | Bacteria | 25925 |
| 860 | Ga0496104_0002444 | 3300048907 | Bacteria | 15993 |
| 861 | Ga0496104_0003718 | 3300048907 | Bacteria | 13171 |
| 862 | Ga0496104_0051365 | 3300048907 | Bacteria | 3891 |
| 863 | Ga0496104_0060388 | 3300048907 | Bacteria | 3591 |
| 864 | Ga0496104_0111303 | 3300048907 | Bacteria | 2625 |
| 865 | Ga0496104_0547111 | 3300048907 | Bacteria | 1068 |
| 866 | Ga0496105_0032283 | 3300048908 | Bacteria | 4296 |
| 867 | Ga0496105_0066449 | 3300048908 | Bacteria | 2977 |
| 868 | Ga0496105_0085352 | 3300048908 | Bacteria | 2608 |
| 869 | Ga0496105_0195515 | 3300048908 | Bacteria | 1652 |
| 870 | Ga0496105_0571372 | 3300048908 | Bacteria | 880 |
| 871 | Ga0496105_0615611 | 3300048908 | Bacteria | 841 |
| 872 | Ga0496106_0211143 | 3300048909 | Bacteria | 1546 |
| 873 | Ga0496107_0013864 | 3300048910 | Bacteria | 5634 |
| 874 | Ga0496107_0066304 | 3300048910 | Bacteria | 2617 |
| 875 | Ga0496107_0247634 | 3300048910 | Bacteria | 1326 |
| 876 | Ga0496108_0009369 | 3300048911 | Bacteria | 7925 |
| 877 | Ga0496108_0013762 | 3300048911 | Bacteria | 6600 |
| 878 | Ga0496108_0016979 | 3300048911 | Bacteria | 5949 |
| 879 | Ga0496108_0523387 | 3300048911 | Bacteria | 1035 |
| 880 | Ga0496108_0679709 | 3300048911 | Bacteria | 893 |
| 881 | Ga0496108_1393968 | 3300048911 | Bacteria | 586 |
| 882 | Ga0496109_0042741 | 3300048912 | Bacteria | 4107 |
| 883 | Ga0496109_0045059 | 3300048912 | Bacteria | 4002 |
| 884 | Ga0496109_0162525 | 3300048912 | Bacteria | 2092 |
| 885 | Ga0496109_0320970 | 3300048912 | Bacteria | 1461 |
| 886 | Ga0496109_0414576 | 3300048912 | Bacteria | 1272 |
| 887 | Ga0496109_1998442 | 3300048912 | Bacteria | 512 |
| 888 | Ga0496110_0004712 | 3300048913 | Bacteria | 10610 |
| 889 | Ga0496110_0079360 | 3300048913 | Bacteria | 2922 |
| 890 | Ga0496110_1263655 | 3300048913 | Bacteria | 647 |
| 891 | Ga0496111_0005891 | 3300048914 | Bacteria | 7903 |
| 892 | Ga0496111_0019700 | 3300048914 | Bacteria | 4691 |
| 893 | Ga0496112_0010834 | 3300048915 | Bacteria | 8296 |
| 894 | Ga0496112_0016811 | 3300048915 | Bacteria | 6862 |
| 895 | Ga0496112_0364629 | 3300048915 | Bacteria | 1386 |
| 896 | Ga0496112_0625337 | 3300048915 | Bacteria | 1007 |
| 897 | Ga0496113_0006891 | 3300048916 | Bacteria | 7251 |
| 898 | Ga0496113_0020833 | 3300048916 | Bacteria | 4617 |
| 899 | Ga0496113_0259004 | 3300048916 | Bacteria | 1389 |
| 900 | Ga0496113_0260332 | 3300048916 | Bacteria | 1386 |
| 901 | Ga0496114_0184265 | 3300048917 | Bacteria | 1824 |
| 902 | Ga0496114_0251216 | 3300048917 | Bacteria | 1556 |
| 903 | Ga0496114_0612542 | 3300048917 | Bacteria | 960 |
| 904 | Ga0496115_0018901 | 3300048918 | Bacteria | 5300 |
| 905 | Ga0496115_0773187 | 3300048918 | Bacteria | 749 |
| 906 | Ga0496116_0031667 | 3300048919 | Bacteria | 3781 |
| 907 | Ga0496117_0000430 | 3300048920 | Bacteria | 70406 |
| 908 | Ga0496118_0000165 | 3300048921 | Bacteria | 119376 |
| 909 | Ga0496119_0039472 | 3300048922 | Bacteria | 3033 |
| 910 | Ga0496120_0013050 | 3300048923 | Bacteria | 5617 |
| 911 | Ga0496121_0001920 | 3300048924 | Bacteria | 33194 |
| 912 | Ga0496124_0015861 | 3300048927 | Bacteria | 7196 |
| 913 | Ga0496125_0085402 | 3300048928 | Bacteria | 2391 |
| 914 | Ga0496125_0162721 | 3300048928 | Bacteria | 1513 |
| 915 | Ga0496126_0000189 | 3300048929 | Bacteria | 138921 |
| 916 | Ga0496126_0000807 | 3300048929 | Bacteria | 56090 |
| 917 | Ga0496126_0685573 | 3300048929 | Bacteria | 798 |
| 918 | Ga0501291_032849 | 3300049514 | Bacteria | 883 |
| 919 | Ga0501031_0011545 | 3300049568 | Bacteria | 5760 |
| 920 | Ga0501032_0176790 | 3300049569 | Bacteria | 1398 |
| 921 | Ga0501034_0643221 | 3300049571 | Bacteria | 963 |
| 922 | Ga0501036_0086241 | 3300049572 | Bacteria | 2654 |
| 923 | Ga0501036_1130209 | 3300049572 | Bacteria | 639 |
| 924 | Ga0501037_0517553 | 3300049573 | Unclassified | 808 |
| 925 | Ga0501038_0014731 | 3300049574 | Bacteria | 7125 |
| 926 | Ga0501038_0148646 | 3300049574 | Unclassified | 1911 |
| 927 | Ga0501039_0022325 | 3300049575 | Bacteria | 4858 |
| 928 | Ga0501039_0079151 | 3300049575 | Bacteria | 2557 |
| 929 | Ga0501039_1105679 | 3300049575 | Bacteria | 614 |
| 930 | Ga0501040_0003265 | 3300049576 | Bacteria | 10477 |
| 931 | Ga0501040_0464418 | 3300049576 | Bacteria | 911 |
| 932 | Ga0501040_0726648 | 3300049576 | Bacteria | 718 |
| 933 | Ga0501041_0007040 | 3300049577 | Bacteria | 6598 |
| 934 | Ga0501041_0055547 | 3300049577 | Bacteria | 2418 |
| 935 | Ga0501042_0064447 | 3300049578 | Bacteria | 2618 |
| 936 | Ga0501042_0252073 | 3300049578 | Bacteria | 1274 |
| 937 | Ga0501043_0858141 | 3300049579 | Bacteria | 653 |
| 938 | Ga0501046_0123336 | 3300049580 | Bacteria | 1970 |
| 939 | Ga0501046_0274056 | 3300049580 | Unclassified | 1237 |
| 940 | Ga0501048_0011513 | 3300049582 | Bacteria | 6597 |
| 941 | Ga0501048_0081414 | 3300049582 | Bacteria | 2284 |
| 942 | Ga0501048_0781719 | 3300049582 | Bacteria | 686 |
| 943 | Ga0501067_0062204 | 3300049583 | Bacteria | 2066 |
| 944 | Ga0501067_0535519 | 3300049583 | Bacteria | 656 |
| 945 | Ga0501068_0076926 | 3300049584 | Bacteria | 2043 |
| 946 | Ga0501068_0376793 | 3300049584 | Bacteria | 913 |
| 947 | Ga0501071_0009821 | 3300049587 | Bacteria | 6388 |
| 948 | Ga0501071_0009897 | 3300049587 | Bacteria | 6368 |
| 949 | Ga0501072_0005756 | 3300049588 | Bacteria | 9435 |
| 950 | Ga0501073_1053398 | 3300049589 | Unclassified | 559 |
| 951 | Ga0501074_0093377 | 3300049590 | Bacteria | 2155 |
| 952 | Ga0501075_0034249 | 3300049591 | Bacteria | 3781 |
| 953 | Ga0501076_0059086 | 3300049592 | Bacteria | 3049 |
| 954 | Ga0501077_0156572 | 3300049593 | Bacteria | 1446 |
| 955 | Ga0501077_0191041 | 3300049593 | Unclassified | 1301 |
| 956 | Ga0501227_141715 | 3300049665 | Bacteria | 660 |
| 957 | Ga0501079_0015246 | 3300049741 | Bacteria | 5863 |
| 958 | Ga0501080_0246220 | 3300049742 | Bacteria | 1630 |
| 959 | Ga0501081_0103887 | 3300049743 | Bacteria | 2011 |
| 960 | Ga0501081_0991966 | 3300049743 | Unclassified | 634 |
| 961 | Ga0501045_0008315 | 3300049824 | Bacteria | 7226 |
| 962 | nmdc:mga0yw44_329965_c1 | 3300050492 | Bacteria | 1025 |
| 963 | nmdc:mga05p37_22291_c1 | 3300050507 | Bacteria | 7681 |
| 964 | nmdc:mga05p37_3141_c1 | 3300050507 | Bacteria | 19212 |
| 965 | nmdc:mga05p37_53972_c1 | 3300050507 | Bacteria | 4945 |
| 966 | nmdc:mga05p37_560681_c1 | 3300050507 | Bacteria | 1298 |
| 967 | nmdc:mga05p37_669685_c1 | 3300050507 | Bacteria | 1159 |
| 968 | nmdc:mga09592_10067_c1 | 3300050508 | Bacteria | 7689 |
| 969 | nmdc:mga09592_42420_c1 | 3300050508 | Bacteria | 3826 |
| 970 | nmdc:mga09592_43580_c1 | 3300050508 | Bacteria | 3776 |
| 971 | nmdc:mga0qj67_270_c3 | 3300050509 | Bacteria | 16426 |
| 972 | nmdc:mga06r32_1017122_c1 | 3300050510 | Bacteria | 781 |
| 973 | nmdc:mga06r32_1154099_c1 | 3300050510 | Bacteria | 722 |
| 974 | nmdc:mga06r32_1230_c1 | 3300050510 | Bacteria | 16737 |
| 975 | nmdc:mga06r32_1331080_c1 | 3300050510 | Bacteria | 661 |
| 976 | nmdc:mga06r32_16231_c1 | 3300050510 | Bacteria | 6783 |
| 977 | nmdc:mga06r32_22052_c1 | 3300050510 | Bacteria | 5884 |
| 978 | nmdc:mga06r32_766_c1 | 3300050510 | Bacteria | 28321 |
| 979 | nmdc:mga08y16_318537_c1 | 3300050511 | Bacteria | 1601 |
| 980 | nmdc:mga08y16_49950_c1 | 3300050511 | Bacteria | 4377 |
| 981 | nmdc:mga08y16_545077_c1 | 3300050511 | Bacteria | 1174 |
| 982 | nmdc:mga0n895_206482_c1 | 3300050512 | Bacteria | 1995 |
| 983 | nmdc:mga0n895_398424_c1 | 3300050512 | Unclassified | 1392 |
| 984 | nmdc:mga0n895_59989_c1 | 3300050512 | Bacteria | 3753 |
| 985 | nmdc:mga0n895_862566_c1 | 3300050512 | Bacteria | 893 |
| 986 | nmdc:mga0rr50_131599_c1 | 3300050513 | Bacteria | 2004 |
| 987 | nmdc:mga0rr50_32272_c1 | 3300050513 | Bacteria | 3730 |
| 988 | nmdc:mga08x19_30863_c1 | 3300050514 | Bacteria | 3368 |
| 989 | nmdc:mga08x19_35945_c1 | 3300050514 | Bacteria | 3136 |
| 990 | nmdc:mga0a205_1122793_c1 | 3300050515 | Bacteria | 634 |
| 991 | nmdc:mga0a205_1313709_c1 | 3300050515 | Bacteria | 571 |
| 992 | nmdc:mga0a205_244774_c1 | 3300050515 | Bacteria | 1674 |
| 993 | nmdc:mga0sz30_2190_c1 | 3300050516 | Bacteria | 6983 |
| 994 | Ga0495601_0049141 | 3300053077 | Bacteria | 2659 |
| 995 | Ga0495601_0049556 | 3300053077 | Bacteria | 2648 |
| 996 | Ga0495601_0107176 | 3300053077 | Bacteria | 1807 |
| 997 | Ga0495601_0263652 | 3300053077 | Bacteria | 1124 |
| 998 | Ga0495612_0024329 | 3300053078 | Bacteria | 2430 |
| 999 | Ga0495612_0028024 | 3300053078 | Bacteria | 2266 |
| 1000 | Ga0495612_0041219 | 3300053078 | Bacteria | 1883 |
| 1001 | Ga0495612_0125020 | 3300053078 | Bacteria | 1108 |
| 1002 | Ga0495612_0393450 | 3300053078 | Bacteria | 629 |
| 1003 | Ga0500635_0312159 | 3300053080 | Bacteria | 621 |
| 1004 | Ga0495595_0000955 | 3300053084 | Bacteria | 11124 |
| 1005 | Ga0495595_0002124 | 3300053084 | Bacteria | 7700 |
| 1006 | Ga0495595_0014552 | 3300053084 | Bacteria | 3341 |
| 1007 | Ga0495595_0031188 | 3300053084 | Bacteria | 2394 |
| 1008 | Ga0495595_0057962 | 3300053084 | Bacteria | 1807 |
| 1009 | Ga0495619_0009889 | 3300053085 | Bacteria | 6010 |
| 1010 | Ga0495619_0027729 | 3300053085 | Bacteria | 3651 |
| 1011 | Ga0495619_0032243 | 3300053085 | Bacteria | 3399 |
| 1012 | Ga0495619_0067109 | 3300053085 | Bacteria | 2394 |
| 1013 | Ga0495619_0846825 | 3300053085 | Bacteria | 617 |
| 1014 | Ga0500556_0014851 | 3300053104 | Bacteria | 2387 |
| 1015 | Ga0500562_000672 | 3300053108 | Bacteria | 8316 |
| 1016 | Ga0500593_215100 | 3300053117 | Bacteria | 681 |
| 1017 | Ga0500559_0004293 | 3300053136 | Bacteria | 6817 |
| 1018 | Ga0500559_0208424 | 3300053136 | Bacteria | 922 |
| 1019 | Ga0500568_0084263 | 3300053139 | Bacteria | 1204 |
| 1020 | Ga0500604_0135691 | 3300053151 | Bacteria | 829 |
| 1021 | Ga0500616_0025567 | 3300053153 | Bacteria | 3274 |
| 1022 | Ga0500630_105840 | 3300053159 | Bacteria | 1273 |
| 1023 | Ga0500637_0454282 | 3300053178 | Bacteria | 649 |
| 1024 | Ga0500645_000014 | 3300053730 | Bacteria | 151349 |
| 1025 | Ga0501084_0081635 | 3300054114 | Bacteria | 2712 |
| 1026 | Ga0501084_0107461 | 3300054114 | Bacteria | 2344 |
| 1027 | Ga0501082_0014332 | 3300060353 | Bacteria | 6821 |
| 1028 | Ga0530510_0016065 | 3300061734 | Bacteria | 5292 |
| 1029 | Ga0530510_0091536 | 3300061734 | Unclassified | 2219 |
| 1030 | Ga0530510_0107690 | 3300061734 | Bacteria | 2040 |
| 1031 | 2558913318 | 2558860112 | Bacteria | 9931328 |
| 1032 | 2902803379 | 2902799365 | Bacteria | 5419524 |
| 1033 | Ga0451853_3287554 | |||
| 1034 | JGI25406J46586_10002251 | |||
| 1035 | rootH2_10044776 | |||
| 1036 | Ga0070676_10281520 | |||
| 1037 | Ga0070683_100035432 | |||
| 1038 | Ga0070683_100041013 | |||
| 1039 | Ga0070683_100047406 | |||
| 1040 | Ga0070683_100076069 | |||
| 1041 | Ga0070690_100015085 | |||
| 1042 | Ga0070670_100686829 | |||
| 1043 | Ga0068869_100010305 | |||
| 1044 | Ga0068869_100138751 | |||
| 1045 | Ga0070666_10037091 | |||
| 1046 | Ga0070666_10912759 | |||
| 1047 | Ga0070680_100020244 | |||
| 1048 | Ga0070680_100054111 | |||
| 1049 | Ga0070680_100109572 | |||
| 1050 | Ga0070682_100412768 | |||
| 1051 | Ga0068868_100033269 | |||
| 1052 | Ga0070660_100148806 | |||
| 1053 | Ga0070689_101184903 | |||
| 1054 | Ga0070661_100038608 | |||
| 1055 | Ga0070661_101101688 | |||
| 1056 | Ga0070692_10280938 | |||
| 1057 | Ga0070668_100009548 | |||
| 1058 | Ga0070668_100691959 | |||
| 1059 | Ga0070669_100001706 | |||
| 1060 | Ga0070675_100034088 | |||
| 1061 | Ga0070675_100896648 | |||
| 1062 | Ga0070673_100210869 | |||
| 1063 | Ga0070673_100744799 | |||
| 1064 | Ga0070688_100116115 | |||
| 1065 | Ga0070667_100000056 | |||
| 1066 | Ga0070709_10062616 | |||
| 1067 | Ga0070709_10181999 | |||
| 1068 | Ga0070714_100000182 | |||
| 1069 | Ga0070714_100004513 | |||
| 1070 | Ga0070714_100026331 | |||
| 1071 | Ga0070714_100098296 | |||
| 1072 | Ga0070714_100189747 | |||
| 1073 | Ga0070714_100981965 | |||
| 1074 | Ga0070714_101016269 | |||
| 1075 | Ga0070713_100028995 | |||
| 1076 | Ga0070713_100132531 | |||
| 1077 | Ga0070713_100293182 | |||
| 1078 | Ga0070713_100294509 | |||
| 1079 | Ga0070713_100360083 | |||
| 1080 | Ga0070710_10000194 | |||
| 1081 | Ga0070710_10012480 | |||
| 1082 | Ga0070710_10018819 | |||
| 1083 | Ga0070710_10028770 | |||
| 1084 | Ga0070710_10067275 | |||
| 1085 | Ga0070711_100058710 | |||
| 1086 | Ga0070711_100064241 | |||
| 1087 | Ga0070711_100127771 | |||
| 1088 | Ga0070711_100331954 | |||
| 1089 | Ga0070711_101179135 | |||
| 1090 | Ga0070705_100031485 | |||
| 1091 | Ga0070705_100258841 | |||
| 1092 | Ga0070700_100012728 | |||
| 1093 | Ga0070708_100055643 | |||
| 1094 | Ga0070708_100277707 | |||
| 1095 | Ga0070663_100019004 | |||
| 1096 | Ga0070663_100127468 | |||
| 1097 | Ga0070681_10066357 | |||
| 1098 | Ga0070681_10464003 | |||
| 1099 | Ga0070681_10687293 | |||
| 1100 | Ga0068867_100563175 | |||
| 1101 | Ga0070706_100004211 | |||
| 1102 | Ga0070706_100033540 | |||
| 1103 | Ga0070706_100053329 | |||
| 1104 | Ga0070706_100367828 | |||
| 1105 | Ga0070706_100369913 | |||
| 1106 | Ga0070706_100616722 | |||
| 1107 | Ga0070706_100889773 | |||
| 1108 | Ga0070707_100048318 | |||
| 1109 | Ga0070707_100054602 | |||
| 1110 | Ga0070707_100114769 | |||
| 1111 | Ga0070707_100150193 | |||
| 1112 | Ga0070707_100174097 | |||
| 1113 | Ga0070707_100190367 | |||
| 1114 | Ga0070698_100018312 | |||
| 1115 | Ga0070698_100023734 | |||
| 1116 | Ga0070698_100031505 | |||
| 1117 | Ga0070698_100036660 | |||
| 1118 | Ga0070698_100583221 | |||
| 1119 | Ga0070699_100048207 | |||
| 1120 | Ga0070699_100061060 | |||
| 1121 | Ga0070699_100082651 | |||
| 1122 | Ga0070679_100089236 | |||
| 1123 | Ga0070679_100199981 | |||
| 1124 | Ga0070679_100240499 | |||
| 1125 | Ga0070679_100240563 | |||
| 1126 | Ga0070684_100005321 | |||
| 1127 | Ga0070684_100108312 | |||
| 1128 | Ga0070684_100254004 | |||
| 1129 | Ga0070684_100347760 | |||
| 1130 | Ga0070697_100000794 | |||
| 1131 | Ga0070697_100144654 | |||
| 1132 | Ga0068853_100542077 | |||
| 1133 | Ga0070686_100028314 | |||
| 1134 | Ga0070686_100321147 | |||
| 1135 | Ga0070696_100144285 | |||
| 1136 | Ga0070696_100344059 | |||
| 1137 | Ga0070693_100012141 | |||
| 1138 | Ga0070693_100069795 | |||
| 1139 | Ga0070665_100004740 | |||
| 1140 | Ga0070665_100109273 | |||
| 1141 | Ga0070665_100344570 | |||
| 1142 | Ga0070665_100505738 | |||
| 1143 | Ga0070704_100962253 | |||
| 1144 | Ga0068855_100782203 | |||
| 1145 | Ga0070664_100004475 | |||
| 1146 | Ga0070664_100015128 | |||
| 1147 | Ga0068857_100035620 | |||
| 1148 | Ga0068857_100404863 | |||
| 1149 | Ga0068854_100053220 | |||
| 1150 | Ga0068856_100006191 | |||
| 1151 | Ga0068856_100019497 | |||
| 1152 | Ga0068856_100052502 | |||
| 1153 | Ga0068856_100114445 | |||
| 1154 | Ga0068856_100133998 | |||
| 1155 | Ga0068856_100366477 | |||
| 1156 | Ga0068856_100779796 | |||
| 1157 | Ga0068856_101319131 | |||
| 1158 | Ga0070702_100900534 | |||
| 1159 | Ga0068852_100164368 | |||
| 1160 | Ga0068852_100575110 | |||
| 1161 | Ga0068859_100000751 | |||
| 1162 | Ga0068859_100190714 | |||
| 1163 | Ga0068859_101532807 | |||
| 1164 | Ga0068864_100011622 | |||
| 1165 | Ga0068864_100031417 | |||
| 1166 | Ga0068864_100566579 | |||
| 1167 | Ga0068866_10076737 | |||
| 1168 | Ga0068861_102442956 | |||
| 1169 | Ga0068870_10279115 | |||
| 1170 | Ga0068863_100004393 | |||
| 1171 | Ga0068863_100032410 | |||
| 1172 | Ga0068863_100299450 | |||
| 1173 | Ga0068863_100352980 | |||
| 1174 | Ga0068858_100021321 | |||
| 1175 | Ga0068858_100060942 | |||
| 1176 | Ga0068858_100199993 | |||
| 1177 | Ga0068858_100302562 | |||
| 1178 | Ga0068860_100000092 | |||
| 1179 | Ga0068860_100275849 | |||
| 1180 | Ga0068860_100345732 | |||
| 1181 | Ga0068862_100000035 | |||
| 1182 | Ga0068862_100048492 | |||
| 1183 | Ga0068862_100124168 | |||
| 1184 | Ga0068862_100658775 | |||
| 1185 | Ga0081455_10413894 | |||
| 1186 | Ga0081538_10050703 | |||
| 1187 | Ga0081540_1000074 | |||
| 1188 | Ga0081540_1004072 | |||
| 1189 | Ga0081540_1009405 | |||
| 1190 | Ga0081540_1028309 | |||
| 1191 | Ga0081539_10004391 | |||
| 1192 | Ga0070717_10003455 | |||
| 1193 | Ga0070717_10019004 | |||
| 1194 | Ga0070717_10028650 | |||
| 1195 | Ga0070717_10070012 | |||
| 1196 | Ga0070717_10122673 | |||
| 1197 | Ga0070717_10208492 | |||
| 1198 | Ga0070717_10211108 | |||
| 1199 | Ga0070717_10343895 | |||
| 1200 | Ga0070717_10454421 | |||
| 1201 | Ga0070717_10459885 | |||
| 1202 | Ga0075365_10206015 | |||
| 1203 | Ga0075432_10092972 | |||
| 1204 | Ga0070715_10022934 | |||
| 1205 | Ga0070716_100005004 | |||
| 1206 | Ga0070716_100060376 | |||
| 1207 | Ga0070716_100078950 | |||
| 1208 | Ga0070716_100252055 | |||
| 1209 | Ga0070716_100836213 | |||
| 1210 | Ga0070712_100014123 | |||
| 1211 | Ga0070712_100037415 | |||
| 1212 | Ga0070712_100119877 | |||
| 1213 | Ga0070712_100167990 | |||
| 1214 | Ga0070712_100292448 | |||
| 1215 | Ga0070712_100389691 | |||
| 1216 | Ga0075369_10097676 | |||
| 1217 | Ga0097621_100186524 | |||
| 1218 | Ga0097621_100531183 | |||
| 1219 | Ga0068871_100044704 | |||
| 1220 | Ga0068871_101565656 | |||
| 1221 | Ga0075428_100000194 | |||
| 1222 | Ga0075428_100006627 | |||
| 1223 | Ga0075428_100015429 | |||
| 1224 | Ga0075428_100668909 | |||
| 1225 | Ga0075428_101353926 | |||
| 1226 | Ga0075428_101874741 | |||
| 1227 | Ga0075430_100027307 | |||
| 1228 | Ga0075431_100011600 | |||
| 1229 | Ga0075431_100021815 | |||
| 1230 | Ga0075431_100028268 | |||
| 1231 | Ga0075431_100276563 | |||
| 1232 | Ga0075433_10308460 | |||
| 1233 | Ga0075433_10324681 | |||
| 1234 | Ga0075434_100168433 | |||
| 1235 | Ga0075434_100540365 | |||
| 1236 | Ga0075434_101145071 | |||
| 1237 | Ga0075429_100019369 | |||
| 1238 | Ga0075429_100020643 | |||
| 1239 | Ga0075429_100227156 | |||
| 1240 | Ga0075429_100731768 | |||
| 1241 | Ga0075429_100918263 | |||
| 1242 | Ga0075436_100167262 | |||
| 1243 | Ga0075436_100202102 | |||
| 1244 | Ga0075436_100247249 | |||
| 1245 | Ga0097620_100000751 | |||
| 1246 | Ga0097620_100190702 | |||
| 1247 | Ga0097620_101533062 | |||
| 1248 | Ga0075435_100166561 | |||
| 1249 | Ga0105251_10026881 | |||
| 1250 | Ga0105250_10077930 | |||
| 1251 | Ga0105240_10221817 | |||
| 1252 | Ga0105240_10886465 | |||
| 1253 | Ga0105240_11066999 | |||
| 1254 | Ga0111539_10039855 | |||
| 1255 | Ga0111539_10253831 | |||
| 1256 | Ga0111539_10566918 | |||
| 1257 | Ga0105245_10025228 | |||
| 1258 | Ga0105245_10325335 | |||
| 1259 | Ga0105245_10477935 | |||
| 1260 | Ga0105245_11287670 | |||
| 1261 | Ga0105245_11909069 | |||
| 1262 | Ga0105247_10000062 | |||
| 1263 | Ga0105247_10676091 | |||
| 1264 | Ga0114129_10000761 | |||
| 1265 | Ga0114129_10002830 | |||
| 1266 | Ga0114129_10006319 | |||
| 1267 | Ga0114129_10009261 | |||
| 1268 | Ga0114129_11614801 | |||
| 1269 | Ga0105243_10981669 | |||
| 1270 | Ga0105243_11137021 | |||
| 1271 | Ga0105241_10284485 | |||
| 1272 | Ga0105248_10000036 | |||
| 1273 | Ga0105248_10014590 | |||
| 1274 | Ga0105248_10152466 | |||
| 1275 | Ga0105248_10906275 | |||
| 1276 | Ga0105248_11629857 | |||
| 1277 | Ga0105237_10218602 | |||
| 1278 | Ga0105237_10970434 | |||
| 1279 | Ga0105238_10113585 | |||
| 1280 | Ga0105238_10457545 | |||
| 1281 | Ga0105238_11159230 | |||
| 1282 | Ga0105249_10000046 | |||
| 1283 | Ga0105249_10435445 | |||
| 1284 | Ga0105249_12324004 | |||
| 1285 | Ga0105239_10008580 | |||
| 1286 | Ga0105239_10057120 | |||
| 1287 | Ga0105239_10711625 | |||
| 1288 | Ga0105239_11760833 | |||
| 1289 | Ga0105246_10972824 | |||
| 1290 | Ga0157340_1018995 | |||
| 1291 | Ga0157323_1013469 | |||
| 1292 | Ga0157319_1021202 | |||
| 1293 | Ga0157326_1025172 | |||
| 1294 | Ga0157338_1018292 | |||
| 1295 | Ga0157373_10124312 | |||
| 1296 | Ga0157370_10207405 | |||
| 1297 | Ga0157370_10273225 | |||
| 1298 | Ga0157370_10856478 | |||
| 1299 | Ga0157369_10238935 | |||
| 1300 | Ga0157369_10310719 | |||
| 1301 | Ga0157369_10647409 | |||
| 1302 | Ga0157374_10003735 | |||
| 1303 | Ga0157374_10225528 | |||
| 1304 | Ga0157374_10347709 | |||
| 1305 | Ga0157378_10343949 | |||
| 1306 | Ga0157378_11566284 | |||
| 1307 | Ga0157378_11833816 | |||
| 1308 | Ga0163162_10044421 | |||
| 1309 | Ga0163162_10266209 | |||
| 1310 | Ga0163162_11280548 | |||
| 1311 | Ga0157372_10064862 | |||
| 1312 | Ga0157372_10303007 | |||
| 1313 | Ga0157372_10735587 | |||
| 1314 | Ga0157372_10826687 | |||
| 1315 | Ga0157372_11767388 | |||
| 1316 | Ga0157375_10023328 | |||
| 1317 | Ga0157375_10270363 | |||
| 1318 | Ga0163163_10007593 | |||
| 1319 | Ga0163163_10025596 | |||
| 1320 | Ga0163163_10030509 | |||
| 1321 | Ga0163163_10101973 | |||
| 1322 | Ga0157380_10546548 | |||
| 1323 | Ga0182008_10275755 | |||
| 1324 | Ga0157377_10001300 | |||
| 1325 | Ga0157377_10007244 | |||
| 1326 | Ga0157377_11423006 | |||
| 1327 | Ga0157379_10048308 | |||
| 1328 | Ga0157379_10058859 | |||
| 1329 | Ga0157379_11033473 | |||
| 1330 | Ga0157379_11086513 | |||
| 1331 | Ga0157376_10141843 | |||
| 1332 | Ga0213873_10019836 | |||
| 1333 | Ga0213874_10005048 | |||
| 1334 | Ga0213874_10034100 | |||
| 1335 | Ga0213874_10092923 | |||
| 1336 | Ga0213876_10031360 | |||
| 1337 | Ga0213875_10009052 | |||
| 1338 | Ga0213875_10023508 | |||
| 1339 | Ga0224712_10327652 | |||
| 1340 | Ga0207656_10362269 | |||
| 1341 | Ga0207653_10088333 | |||
| 1342 | Ga0207692_10002251 | |||
| 1343 | Ga0207692_10003617 | |||
| 1344 | Ga0207692_10032980 | |||
| 1345 | Ga0207642_10410535 | |||
| 1346 | Ga0207710_10000060 | |||
| 1347 | Ga0207688_10008948 | |||
| 1348 | Ga0207680_10806485 | |||
| 1349 | Ga0207685_10053189 | |||
| 1350 | Ga0207685_10092741 | |||
| 1351 | Ga0207699_10004195 | |||
| 1352 | Ga0207699_10023655 | |||
| 1353 | Ga0207699_10129033 | |||
| 1354 | Ga0207699_10720143 | |||
| 1355 | Ga0207645_10024920 | |||
| 1356 | Ga0207643_10062301 | |||
| 1357 | Ga0207684_10001207 | |||
| 1358 | Ga0207684_10008499 | |||
| 1359 | Ga0207684_10069277 | |||
| 1360 | Ga0207684_10744025 | |||
| 1361 | Ga0207684_10919229 | |||
| 1362 | Ga0207707_10069031 | |||
| 1363 | Ga0207707_10646568 | |||
| 1364 | Ga0207707_10664841 | |||
| 1365 | Ga0207707_10819921 | |||
| 1366 | Ga0207693_10001613 | |||
| 1367 | Ga0207693_10003654 | |||
| 1368 | Ga0207693_10043378 | |||
| 1369 | Ga0207693_10058233 | |||
| 1370 | Ga0207693_10111500 | |||
| 1371 | Ga0207693_10115753 | |||
| 1372 | Ga0207693_10199423 | |||
| 1373 | Ga0207693_10264120 | |||
| 1374 | Ga0207663_10000578 | |||
| 1375 | Ga0207663_10003121 | |||
| 1376 | Ga0207663_10063875 | |||
| 1377 | Ga0207663_10080300 | |||
| 1378 | Ga0207663_10203990 | |||
| 1379 | Ga0207663_10348397 | |||
| 1380 | Ga0207663_10650060 | |||
| 1381 | Ga0207663_10721630 | |||
| 1382 | Ga0207660_10044127 | |||
| 1383 | Ga0207660_10514585 | |||
| 1384 | Ga0207662_10034942 | |||
| 1385 | Ga0207662_10745263 | |||
| 1386 | Ga0207657_10011266 | |||
| 1387 | Ga0207657_10036445 | |||
| 1388 | Ga0207657_10148397 | |||
| 1389 | Ga0207649_10030862 | |||
| 1390 | Ga0207652_10060731 | |||
| 1391 | Ga0207646_10148164 | |||
| 1392 | Ga0207646_10269477 | |||
| 1393 | Ga0207646_10413963 | |||
| 1394 | Ga0207646_10703822 | |||
| 1395 | Ga0207681_10001181 | |||
| 1396 | Ga0207694_10529807 | |||
| 1397 | Ga0207650_11405162 | |||
| 1398 | Ga0207659_10054182 | |||
| 1399 | Ga0207659_10987304 | |||
| 1400 | Ga0207687_10062585 | |||
| 1401 | Ga0207687_10216476 | |||
| 1402 | Ga0207687_11167098 | |||
| 1403 | Ga0207700_10000302 | |||
| 1404 | Ga0207700_10002752 | |||
| 1405 | Ga0207700_10060346 | |||
| 1406 | Ga0207700_10176775 | |||
| 1407 | Ga0207700_10244608 | |||
| 1408 | Ga0207700_10247290 | |||
| 1409 | Ga0207700_10276329 | |||
| 1410 | Ga0207664_10000185 | |||
| 1411 | Ga0207664_10000458 | |||
| 1412 | Ga0207664_10001157 | |||
| 1413 | Ga0207664_10018558 | |||
| 1414 | Ga0207664_10037183 | |||
| 1415 | Ga0207664_10048803 | |||
| 1416 | Ga0207664_10334340 | |||
| 1417 | Ga0207644_10439692 | |||
| 1418 | Ga0207690_11270197 | |||
| 1419 | Ga0207706_10115042 | |||
| 1420 | Ga0207709_10088688 | |||
| 1421 | Ga0207709_10493034 | |||
| 1422 | Ga0207670_10169084 | |||
| 1423 | Ga0207669_10209079 | |||
| 1424 | Ga0207665_10000535 | |||
| 1425 | Ga0207665_10201728 | |||
| 1426 | Ga0207691_10034116 | |||
| 1427 | Ga0207711_10000073 | |||
| 1428 | Ga0207711_10927084 | |||
| 1429 | Ga0207711_11131948 | |||
| 1430 | Ga0207689_10004898 | |||
| 1431 | Ga0207689_10005132 | |||
| 1432 | Ga0207661_10037668 | |||
| 1433 | Ga0207661_10047838 | |||
| 1434 | Ga0207661_10081085 | |||
| 1435 | Ga0207661_10085790 | |||
| 1436 | Ga0207679_10015344 | |||
| 1437 | Ga0207679_10015575 | |||
| 1438 | Ga0207679_10111142 | |||
| 1439 | Ga0207667_10518271 | |||
| 1440 | Ga0207651_11022580 | |||
| 1441 | Ga0207712_10000042 | |||
| 1442 | Ga0207668_10005675 | |||
| 1443 | Ga0207668_10143148 | |||
| 1444 | Ga0207668_11037428 | |||
| 1445 | Ga0207640_10259991 | |||
| 1446 | Ga0207640_10764204 | |||
| 1447 | Ga0207658_10000664 | |||
| 1448 | Ga0207677_10023360 | |||
| 1449 | Ga0207677_10547148 | |||
| 1450 | Ga0207677_11550660 | |||
| 1451 | Ga0207703_10038202 | |||
| 1452 | Ga0207703_11375355 | |||
| 1453 | Ga0207639_10643434 | |||
| 1454 | Ga0207678_10006810 | |||
| 1455 | Ga0207678_10025768 | |||
| 1456 | Ga0207678_10795758 | |||
| 1457 | Ga0207708_10007865 | |||
| 1458 | Ga0207708_11517779 | |||
| 1459 | Ga0207702_10024708 | |||
| 1460 | Ga0207702_10187839 | |||
| 1461 | Ga0207702_10207616 | |||
| 1462 | Ga0207702_10211202 | |||
| 1463 | Ga0207702_10229708 | |||
| 1464 | Ga0207702_10264195 | |||
| 1465 | Ga0207702_10667958 | |||
| 1466 | Ga0207702_10814188 | |||
| 1467 | Ga0207641_10003278 | |||
| 1468 | Ga0207641_10037081 | |||
| 1469 | Ga0207648_11290113 | |||
| 1470 | Ga0207676_10020587 | |||
| 1471 | Ga0207676_10756177 | |||
| 1472 | Ga0207674_10005156 | |||
| 1473 | Ga0207674_10045837 | |||
| 1474 | Ga0207674_10187918 | |||
| 1475 | Ga0207674_10205320 | |||
| 1476 | Ga0207683_10006835 | |||
| 1477 | Ga0207698_10080542 | |||
| 1478 | Ga0207428_10060676 | |||
| 1479 | Ga0207428_10198715 | |||
| 1480 | Ga0268266_10006088 | |||
| 1481 | Ga0268266_10295353 | |||
| 1482 | Ga0268266_10596403 | |||
| 1483 | Ga0268265_10000051 | |||
| 1484 | Ga0268265_10032577 | |||
| 1485 | Ga0268265_10099372 | |||
| 1486 | Ga0268264_10000108 | |||
| 1487 | Ga0268264_10282649 | |||
| 1488 | Ga0265319_1055609 | |||
| 1489 | Ga0307515_10299937 | |||
| 1490 | Ga0265338_10098706 | |||
| 1491 | Ga0265760_10144421 | |||
| 1492 | Ga0307513_10036389 | |||
| 1493 | Ga0307408_100204500 | |||
| 1494 | Ga0307508_10019206 | |||
| 1495 | Ga0307508_10094452 | |||
| 1496 | Ga0307508_10396150 | |||
| 1497 | Ga0265314_10053595 | |||
| 1498 | Ga0307516_10101978 | |||
| 1499 | Ga0307413_11865573 | |||
| 1500 | Ga0307410_10457271 | |||
| 1501 | Ga0307406_10114633 | |||
| 1502 | Ga0307406_10416420 | |||
| 1503 | Ga0307407_10193721 | |||
| 1504 | Ga0307407_10586700 | |||
| 1505 | Ga0307412_10658893 | |||
| 1506 | Ga0307412_11018560 | |||
| 1507 | Ga0307409_100932336 | |||
| 1508 | Ga0307409_102065886 | |||
| 1509 | Ga0307411_10127109 | |||
| 1510 | Ga0307411_11529774 | |||
| 1511 | Ga0307415_100007467 | |||
| 1512 | Ga0307415_100118427 | |||
| 1513 | Ga0307415_100375892 | |||
| 1514 | Ga0307415_100428782 | |||
| 1515 | Ga0307415_101091715 | |||
| 1516 | Ga0307415_101752647 | |||
| 1517 | Ga0373950_0024368 | |||
| 1518 | Ga0373950_0083183 | |||
| 1519 | Ga0373938_0082079 | |||
| 1520 | Ga0373926_0000817 | |||
| 1521 | Ga0373926_0193871 | |||
| 1522 | Ga0373928_0017709 | |||
| 1523 | Ga0373934_0011547 | |||
| 1524 | Ga0373934_0060881 | |||
| 1525 | Ga0373934_0080249 | |||
| 1526 | Ga0373934_0336192 | |||
| 1527 | Ga0373940_0029043 | |||
| 1528 | Ga0373944_0072876 | |||
| 1529 | Ga0373952_0023545 | |||
| 1530 | Ga0373923_0012776 | |||
| 1531 | Ga0373923_0028536 | |||
| 1532 | Ga0373923_0029354 | |||
| 1533 | Ga0373932_0104021 | |||
| 1534 | Ga0373936_0002860 | |||
| 1535 | Ga0373936_0039234 | |||
| 1536 | Ga0373936_0053620 | |||
| 1537 | Ga0373936_0238935 | |||
| 1538 | Ga0373939_0007962 | |||
| 1539 | Ga0373941_0001089 | |||
| 1540 | Ga0373941_0008987 | |||
| 1541 | Ga0373941_0190976 | |||
| 1542 | Ga0373945_0001271 | |||
| 1543 | Ga0373953_0010439 | |||
| 1544 | Ga0373953_0011667 | |||
| 1545 | Ga0373953_0021422 | |||
| 1546 | Ga0373953_0035696 | |||
| 1547 | Ga0373953_0202221 | |||
| 1548 | Ga0373954_0025505 | |||
| 1549 | Ga0373954_0080628 | |||
| 1550 | Ga0373954_0110834 | |||
| 1551 | Ga0373954_0216861 | |||
| 1552 | Ga0373956_0007477 | |||
| 1553 | Ga0373956_0012871 | |||
| 1554 | Ga0373956_0227239 | |||
| 1555 | Ga0373957_0001345 | |||
| 1556 | Ga0373957_0028626 | |||
| 1557 | Ga0373960_0050479 | |||
| 1558 | Ga0373943_0144442 | |||
| 1559 | Ga0373943_0175691 | |||
| 1560 | Ga0373943_0200078 | |||
| 1561 | Ga0373943_0370988 | |||
| 1562 | Ga0373946_0002684 | |||
| 1563 | Ga0373946_0061237 | |||
| 1564 | Ga0373946_0110206 | |||
| 1565 | Ga0373955_0002560 | |||
| 1566 | Ga0373955_0068827 | |||
| 1567 | Ga0373942_0002863 | |||
| 1568 | Ga0373942_0018104 | |||
| 1569 | Ga0373962_0002821 | |||
| 1570 | Ga0373962_0008781 | |||
| 1571 | Ga0373924_0000926 | |||
| 1572 | Ga0373924_0010047 | |||
| 1573 | Ga0373924_0185955 | |||
| 1574 | Ga0373931_0005594 | |||
| 1575 | Ga0373931_0379720 | |||
| 1576 | Ga0373935_0012683 | |||
| 1577 | Ga0373935_0053537 | |||
| 1578 | Ga0373935_0054348 | |||
| 1579 | Ga0373935_0153991 | |||
| 1580 | Ga0373935_0992445 | |||
| 1581 | Ga0373935_1004404 | |||
| 1582 | Ga0373927_0342744 | |||
| 1583 | Ga0373933_0008678 | |||
| 1584 | Ga0373933_0008877 | |||
| 1585 | Ga0373933_0020080 | |||
| 1586 | Ga0373933_0106519 | |||
| 1587 | Ga0373933_0473865 | |||
| 1588 | Ga0373933_0476276 | |||
| 1589 | Ga0373947_0004433 | |||
| 1590 | Ga0373947_0138638 | |||
| 1591 | Ga0373947_0591279 | |||
| 1592 | Ga0373947_0896275 | |||
| 1593 | Ga0373937_0003013 | |||
| 1594 | Ga0373937_0032932 | |||
| 1595 | Ga0373937_0057179 | |||
| 1596 | Ga0373937_0095639 | |||
| 1597 | Ga0373937_0117878 | |||
| 1598 | Ga0373937_0192503 | |||
| 1599 | Ga0373937_0429946 | |||
| 1600 | Ga0373937_0565107 | |||
| 1601 | Ga0373937_1051284 | |||
| 1602 | Ga0373925_0000869 | |||
| 1603 | Ga0373925_0005422 | |||
| 1604 | Ga0373925_0029410 | |||
| 1605 | Ga0373925_0067304 | |||
| 1606 | Ga0373925_0145825 | |||
| 1607 | Ga0373925_0182583 | |||
| 1608 | Ga0373925_0204190 | |||
| 1609 | Ga0373925_0232254 | |||
| 1610 | Ga0373925_0432315 | |||
| 1611 | Ga0395900_0007503 | |||
| 1612 | Ga0395900_0461624 | |||
| 1613 | Ga0395898_0001314 | |||
| 1614 | Ga0436364_0151243 | |||
| 1615 | Ga0436364_0266465 | |||
| 1616 | Ga0436364_0329661 | |||
| 1617 | Ga0436364_0640801 | |||
| 1618 | Ga0436364_0807521 | |||
| 1619 | Ga0436364_0833426 | |||
| 1620 | Ga0436365_0577455 | |||
| 1621 | Ga0436365_1262337 | |||
| 1622 | Ga0436365_1431667 | |||
| 1623 | Ga0436365_1638261 | |||
| 1624 | Ga0436365_1719466 | |||
| 1625 | Ga0436365_1855302 | |||
| 1626 | Ga0436365_1906766 | |||
| 1627 | Ga0436365_1930531 | |||
| 1628 | Ga0436360_0806080 | |||
| 1629 | Ga0436363_0026259 | |||
| 1630 | Ga0436363_0034926 | |||
| 1631 | Ga0436363_0579082 | |||
| 1632 | Ga0436363_0584233 | |||
| 1633 | Ga0436363_0771498 | |||
| 1634 | Ga0436363_1340115 | |||
| 1635 | Ga0436363_1661362 | |||
| 1636 | Ga0436363_1663746 | |||
| 1637 | Ga0436363_1692517 | |||
| 1638 | Ga0436362_0035988 | |||
| 1639 | Ga0436362_0331281 | |||
| 1640 | Ga0436362_0499114 | |||
| 1641 | Ga0436362_0947624 | |||
| 1642 | Ga0436362_0977146 | |||
| 1643 | Ga0436362_0994550 | |||
| 1644 | Ga0439434_0301941 | |||
| 1645 | Ga0466969_0017241 | |||
| 1646 | Ga0466969_0056935 | |||
| 1647 | Ga0466965_0570196 | |||
| 1648 | Ga0466966_0004546 | |||
| 1649 | Ga0466961_0128500 | |||
| 1650 | Ga0466963_0174871 | |||
| 1651 | Ga0466971_0075886 | |||
| 1652 | Ga0466971_0596415 | |||
| 1653 | Ga0466970_0139384 | |||
| 1654 | Ga0466970_0490595 | |||
| 1655 | Ga0466957_0021755 | |||
| 1656 | Ga0466959_0023716 | |||
| 1657 | Ga0466959_0108966 | |||
| 1658 | Ga0466967_0123893 | |||
| 1659 | Ga0466967_0310940 | |||
| 1660 | Ga0466967_0581754 | |||
| 1661 | Ga0466967_0670867 | |||
| 1662 | Ga0495592_0042664 | |||
| 1663 | Ga0495592_0044664 | |||
| 1664 | Ga0495592_0159477 | |||
| 1665 | Ga0495603_0013211 | |||
| 1666 | Ga0495603_0454085 | |||
| 1667 | Ga0495629_0009154 | |||
| 1668 | Ga0495629_0020093 | |||
| 1669 | Ga0495629_0048612 | |||
| 1670 | Ga0495629_0055937 | |||
| 1671 | Ga0495629_0129266 | |||
| 1672 | Ga0495629_0145171 | |||
| 1673 | Ga0495629_0463336 | |||
| 1674 | Ga0495638_0006284 | |||
| 1675 | Ga0495641_0005028 | |||
| 1676 | Ga0495641_0008182 | |||
| 1677 | Ga0495641_0036891 | |||
| 1678 | Ga0495651_0002913 | |||
| 1679 | Ga0495651_0004518 | |||
| 1680 | Ga0495651_0032330 | |||
| 1681 | Ga0495651_0129969 | |||
| 1682 | Ga0495651_0171602 | |||
| 1683 | Ga0495653_0003833 | |||
| 1684 | Ga0495653_0004516 | |||
| 1685 | Ga0495653_0035259 | |||
| 1686 | Ga0495653_0097738 | |||
| 1687 | Ga0495653_0866628 | |||
| 1688 | Ga0495580_0010686 | |||
| 1689 | Ga0495580_0011003 | |||
| 1690 | Ga0495580_0292829 | |||
| 1691 | Ga0495582_0001153 | |||
| 1692 | Ga0495582_0004357 | |||
| 1693 | Ga0495582_0025073 | |||
| 1694 | Ga0495582_0045451 | |||
| 1695 | Ga0495639_0000717 | |||
| 1696 | Ga0495639_0007385 | |||
| 1697 | Ga0495639_0052881 | |||
| 1698 | Ga0495662_0000952 | |||
| 1699 | Ga0495662_0002610 | |||
| 1700 | Ga0495662_0044771 | |||
| 1701 | Ga0495662_0304125 | |||
| 1702 | Ga0495664_0023134 | |||
| 1703 | Ga0495664_0041406 | |||
| 1704 | Ga0495664_0052301 | |||
| 1705 | Ga0495664_0093135 | |||
| 1706 | Ga0495664_0100715 | |||
| 1707 | Ga0495594_0011242 | |||
| 1708 | Ga0495594_0132848 | |||
| 1709 | Ga0495594_0408598 | |||
| 1710 | Ga0495608_0009478 | |||
| 1711 | Ga0495608_0017200 | |||
| 1712 | Ga0495608_0019429 | |||
| 1713 | Ga0495608_0020299 | |||
| 1714 | Ga0495608_0114627 | |||
| 1715 | Ga0495608_0233940 | |||
| 1716 | Ga0495618_0006876 | |||
| 1717 | Ga0495618_0011467 | |||
| 1718 | Ga0495618_0028460 | |||
| 1719 | Ga0495618_0121555 | |||
| 1720 | Ga0495618_0200115 | |||
| 1721 | Ga0495628_0013479 | |||
| 1722 | Ga0495628_0053855 | |||
| 1723 | Ga0495628_0060924 | |||
| 1724 | Ga0495628_0110437 | |||
| 1725 | Ga0495628_0355885 | |||
| 1726 | Ga0495628_0688251 | |||
| 1727 | Ga0495630_0018362 | |||
| 1728 | Ga0495630_0128527 | |||
| 1729 | Ga0495630_0292735 | |||
| 1730 | Ga0495630_0804517 | |||
| 1731 | Ga0495666_0014871 | |||
| 1732 | Ga0495666_0048760 | |||
| 1733 | Ga0495666_0063739 | |||
| 1734 | Ga0495666_0271447 | |||
| 1735 | Ga0495652_0007334 | |||
| 1736 | Ga0495652_0022709 | |||
| 1737 | Ga0495652_0129628 | |||
| 1738 | Ga0495652_0724266 | |||
| 1739 | Ga0495665_0014877 | |||
| 1740 | Ga0495665_0021143 | |||
| 1741 | Ga0495665_0089633 | |||
| 1742 | Ga0495640_0015937 | |||
| 1743 | Ga0495640_0020924 | |||
| 1744 | Ga0495640_0057233 | |||
| 1745 | Ga0495640_0155193 | |||
| 1746 | Ga0495640_0220107 | |||
| 1747 | Ga0495640_0646216 | |||
| 1748 | Ga0495586_0001181 | |||
| 1749 | Ga0495586_0146868 | |||
| 1750 | Ga0495586_0157565 | |||
| 1751 | Ga0495586_0194785 | |||
| 1752 | Ga0495587_0005606 | |||
| 1753 | Ga0495587_0008893 | |||
| 1754 | Ga0495587_0010585 | |||
| 1755 | Ga0495587_0026615 | |||
| 1756 | Ga0495587_0221683 | |||
| 1757 | Ga0495587_0431638 | |||
| 1758 | Ga0495645_0060738 | |||
| 1759 | Ga0495645_0105747 | |||
| 1760 | Ga0495645_0256631 | |||
| 1761 | Ga0495645_0275554 | |||
| 1762 | Ga0495622_0209866 | |||
| 1763 | Ga0495667_0000218 | |||
| 1764 | Ga0495667_0001137 | |||
| 1765 | Ga0495667_0024855 | |||
| 1766 | Ga0495667_0031491 | |||
| 1767 | Ga0495667_0185525 | |||
| 1768 | Ga0495667_0311578 | |||
| 1769 | Ga0495667_0402124 | |||
| 1770 | Ga0495634_0016948 | |||
| 1771 | Ga0495634_0029812 | |||
| 1772 | Ga0495634_0036714 | |||
| 1773 | Ga0495634_0043005 | |||
| 1774 | Ga0495634_0043395 | |||
| 1775 | Ga0495634_0054634 | |||
| 1776 | Ga0495635_0005138 | |||
| 1777 | Ga0495635_0017189 | |||
| 1778 | Ga0495635_0033165 | |||
| 1779 | Ga0495635_0084237 | |||
| 1780 | Ga0495635_0977344 | |||
| 1781 | Ga0495588_0034317 | |||
| 1782 | Ga0495588_0237343 | |||
| 1783 | Ga0495657_0022907 | |||
| 1784 | Ga0495657_0025066 | |||
| 1785 | Ga0495657_0028011 | |||
| 1786 | Ga0495657_0061493 | |||
| 1787 | Ga0495657_0128347 | |||
| 1788 | Ga0495599_0001452 | |||
| 1789 | Ga0495599_0006158 | |||
| 1790 | Ga0495599_0023670 | |||
| 1791 | Ga0495599_0064712 | |||
| 1792 | Ga0495599_0105616 | |||
| 1793 | Ga0495623_0027330 | |||
| 1794 | Ga0495623_0029849 | |||
| 1795 | Ga0495623_0063149 | |||
| 1796 | Ga0495623_0074488 | |||
| 1797 | Ga0495623_0487829 | |||
| 1798 | Ga0495646_0006843 | |||
| 1799 | Ga0495646_0008505 | |||
| 1800 | Ga0495646_0012811 | |||
| 1801 | Ga0495646_0013357 | |||
| 1802 | Ga0495646_0015506 | |||
| 1803 | Ga0495646_0113866 | |||
| 1804 | Ga0495658_0003523 | |||
| 1805 | Ga0495658_0014278 | |||
| 1806 | Ga0495658_0077717 | |||
| 1807 | Ga0495613_0006664 | |||
| 1808 | Ga0495613_0015703 | |||
| 1809 | Ga0495613_0020282 | |||
| 1810 | Ga0495613_0044544 | |||
| 1811 | Ga0495624_0009453 | |||
| 1812 | Ga0495624_0031751 | |||
| 1813 | Ga0495624_0074906 | |||
| 1814 | Ga0495624_0078240 | |||
| 1815 | Ga0495624_0097176 | |||
| 1816 | Ga0495600_0002618 | |||
| 1817 | Ga0495600_0008482 | |||
| 1818 | Ga0495600_0047553 | |||
| 1819 | Ga0495600_0061673 | |||
| 1820 | Ga0495600_0113961 | |||
| 1821 | Ga0495581_0007796 | |||
| 1822 | Ga0495581_0008567 | |||
| 1823 | Ga0495581_0026087 | |||
| 1824 | Ga0495581_0058994 | |||
| 1825 | Ga0495581_0417681 | |||
| 1826 | Ga0495604_0010095 | |||
| 1827 | Ga0495604_0021043 | |||
| 1828 | Ga0495604_0067823 | |||
| 1829 | Ga0495604_0081977 | |||
| 1830 | Ga0495604_0227947 | |||
| 1831 | Ga0495604_0499355 | |||
| 1832 | Ga0495674_0006623 | |||
| 1833 | Ga0495674_0013603 | |||
| 1834 | Ga0495674_0033255 | |||
| 1835 | Ga0495674_0136743 | |||
| 1836 | Ga0495674_0182784 | |||
| 1837 | Ga0495674_0208431 | |||
| 1838 | Ga0495674_0217254 | |||
| 1839 | Ga0495674_0844055 | |||
| 1840 | Ga0495674_1377278 | |||
| 1841 | Ga0495676_0002773 | |||
| 1842 | Ga0495676_0110119 | |||
| 1843 | Ga0495676_0162605 | |||
| 1844 | Ga0495676_0168649 | |||
| 1845 | Ga0495676_0272444 | |||
| 1846 | Ga0495680_0002214 | |||
| 1847 | Ga0495680_0011349 | |||
| 1848 | Ga0495680_0044192 | |||
| 1849 | Ga0495680_0060437 | |||
| 1850 | Ga0495680_0092035 | |||
| 1851 | Ga0495680_0160669 | |||
| 1852 | Ga0495680_0900248 | |||
| 1853 | Ga0495675_0002221 | |||
| 1854 | Ga0495675_0018074 | |||
| 1855 | Ga0495675_0033476 | |||
| 1856 | Ga0495675_0110673 | |||
| 1857 | Ga0495675_0126688 | |||
| 1858 | Ga0495684_0034949 | |||
| 1859 | Ga0495684_0055134 | |||
| 1860 | Ga0495684_0140106 | |||
| 1861 | Ga0495684_0286610 | |||
| 1862 | Ga0495593_0005814 | |||
| 1863 | Ga0495593_0006554 | |||
| 1864 | Ga0495593_0046344 | |||
| 1865 | Ga0495593_0095802 | |||
| 1866 | Ga0495593_0116900 | |||
| 1867 | Ga0495593_0159071 | |||
| 1868 | Ga0495602_0028307 | |||
| 1869 | Ga0495602_0055418 | |||
| 1870 | Ga0495602_0062328 | |||
| 1871 | Ga0495602_0147576 | |||
| 1872 | Ga0495602_0227713 | |||
| 1873 | Ga0495614_0011826 | |||
| 1874 | Ga0495614_0062817 | |||
| 1875 | Ga0496100_0007581 | |||
| 1876 | Ga0496100_0081472 | |||
| 1877 | Ga0496100_0091970 | |||
| 1878 | Ga0496100_0492993 | |||
| 1879 | Ga0496100_0617422 | |||
| 1880 | Ga0496101_0020308 | |||
| 1881 | Ga0496101_0226662 | |||
| 1882 | Ga0496101_0568469 | |||
| 1883 | Ga0496101_0982334 | |||
| 1884 | Ga0496102_0000390 | |||
| 1885 | Ga0496102_0065517 | |||
| 1886 | Ga0496102_0087792 | |||
| 1887 | Ga0496102_0251507 | |||
| 1888 | Ga0496102_0268868 | |||
| 1889 | Ga0496102_0967586 | |||
| 1890 | Ga0496102_1073251 | |||
| 1891 | Ga0496103_0000663 | |||
| 1892 | Ga0496104_0002444 | |||
| 1893 | Ga0496104_0003718 | |||
| 1894 | Ga0496104_0051365 | |||
| 1895 | Ga0496104_0060388 | |||
| 1896 | Ga0496104_0111303 | |||
| 1897 | Ga0496104_0547111 | |||
| 1898 | Ga0496105_0032283 | |||
| 1899 | Ga0496105_0066449 | |||
| 1900 | Ga0496105_0085352 | |||
| 1901 | Ga0496105_0195515 | |||
| 1902 | Ga0496105_0571372 | |||
| 1903 | Ga0496105_0615611 | |||
| 1904 | Ga0496106_0211143 | |||
| 1905 | Ga0496107_0013864 | |||
| 1906 | Ga0496107_0066304 | |||
| 1907 | Ga0496107_0247634 | |||
| 1908 | Ga0496108_0009369 | |||
| 1909 | Ga0496108_0013762 | |||
| 1910 | Ga0496108_0016979 | |||
| 1911 | Ga0496108_0523387 | |||
| 1912 | Ga0496108_0679709 | |||
| 1913 | Ga0496108_1393968 | |||
| 1914 | Ga0496109_0042741 | |||
| 1915 | Ga0496109_0045059 | |||
| 1916 | Ga0496109_0162525 | |||
| 1917 | Ga0496109_0320970 | |||
| 1918 | Ga0496109_0414576 | |||
| 1919 | Ga0496109_1998442 | |||
| 1920 | Ga0496110_0004712 | |||
| 1921 | Ga0496110_0079360 | |||
| 1922 | Ga0496110_1263655 | |||
| 1923 | Ga0496111_0005891 | |||
| 1924 | Ga0496111_0019700 | |||
| 1925 | Ga0496112_0010834 | |||
| 1926 | Ga0496112_0016811 | |||
| 1927 | Ga0496112_0364629 | |||
| 1928 | Ga0496112_0625337 | |||
| 1929 | Ga0496113_0006891 | |||
| 1930 | Ga0496113_0020833 | |||
| 1931 | Ga0496113_0259004 | |||
| 1932 | Ga0496113_0260332 | |||
| 1933 | Ga0496114_0184265 | |||
| 1934 | Ga0496114_0251216 | |||
| 1935 | Ga0496114_0612542 | |||
| 1936 | Ga0496115_0018901 | |||
| 1937 | Ga0496115_0773187 | |||
| 1938 | Ga0496116_0031667 | |||
| 1939 | Ga0496117_0000430 | |||
| 1940 | Ga0496118_0000165 | |||
| 1941 | Ga0496119_0039472 | |||
| 1942 | Ga0496120_0013050 | |||
| 1943 | Ga0496121_0001920 | |||
| 1944 | Ga0496124_0015861 | |||
| 1945 | Ga0496125_0085402 | |||
| 1946 | Ga0496125_0162721 | |||
| 1947 | Ga0496126_0000189 | |||
| 1948 | Ga0496126_0000807 | |||
| 1949 | Ga0496126_0685573 | |||
| 1950 | Ga0501291_032849 | |||
| 1951 | Ga0501031_0011545 | |||
| 1952 | Ga0501032_0176790 | |||
| 1953 | Ga0501034_0643221 | |||
| 1954 | Ga0501036_0086241 | |||
| 1955 | Ga0501036_1130209 | |||
| 1956 | Ga0501037_0517553 | |||
| 1957 | Ga0501038_0014731 | |||
| 1958 | Ga0501038_0148646 | |||
| 1959 | Ga0501039_0022325 | |||
| 1960 | Ga0501039_0079151 | |||
| 1961 | Ga0501039_1105679 | |||
| 1962 | Ga0501040_0003265 | |||
| 1963 | Ga0501040_0464418 | |||
| 1964 | Ga0501040_0726648 | |||
| 1965 | Ga0501041_0007040 | |||
| 1966 | Ga0501041_0055547 | |||
| 1967 | Ga0501042_0064447 | |||
| 1968 | Ga0501042_0252073 | |||
| 1969 | Ga0501043_0858141 | |||
| 1970 | Ga0501046_0123336 | |||
| 1971 | Ga0501046_0274056 | |||
| 1972 | Ga0501048_0011513 | |||
| 1973 | Ga0501048_0081414 | |||
| 1974 | Ga0501048_0781719 | |||
| 1975 | Ga0501067_0062204 | |||
| 1976 | Ga0501067_0535519 | |||
| 1977 | Ga0501068_0076926 | |||
| 1978 | Ga0501068_0376793 | |||
| 1979 | Ga0501071_0009821 | |||
| 1980 | Ga0501071_0009897 | |||
| 1981 | Ga0501072_0005756 | |||
| 1982 | Ga0501073_1053398 | |||
| 1983 | Ga0501074_0093377 | |||
| 1984 | Ga0501075_0034249 | |||
| 1985 | Ga0501076_0059086 | |||
| 1986 | Ga0501077_0156572 | |||
| 1987 | Ga0501077_0191041 | |||
| 1988 | Ga0501227_141715 | |||
| 1989 | Ga0501079_0015246 | |||
| 1990 | Ga0501080_0246220 | |||
| 1991 | Ga0501081_0103887 | |||
| 1992 | Ga0501081_0991966 | |||
| 1993 | Ga0501045_0008315 | |||
| 1994 | nmdc:mga0yw44_329965_c1 | |||
| 1995 | nmdc:mga05p37_22291_c1 | |||
| 1996 | nmdc:mga05p37_3141_c1 | |||
| 1997 | nmdc:mga05p37_53972_c1 | |||
| 1998 | nmdc:mga05p37_560681_c1 | |||
| 1999 | nmdc:mga05p37_669685_c1 | |||
| 2000 | nmdc:mga09592_10067_c1 | |||
| 2001 | nmdc:mga09592_42420_c1 | |||
| 2002 | nmdc:mga09592_43580_c1 | |||
| 2003 | nmdc:mga0qj67_270_c3 | |||
| 2004 | nmdc:mga06r32_1017122_c1 | |||
| 2005 | nmdc:mga06r32_1154099_c1 | |||
| 2006 | nmdc:mga06r32_1230_c1 | |||
| 2007 | nmdc:mga06r32_1331080_c1 | |||
| 2008 | nmdc:mga06r32_16231_c1 | |||
| 2009 | nmdc:mga06r32_22052_c1 | |||
| 2010 | nmdc:mga06r32_766_c1 | |||
| 2011 | nmdc:mga08y16_318537_c1 | |||
| 2012 | nmdc:mga08y16_49950_c1 | |||
| 2013 | nmdc:mga08y16_545077_c1 | |||
| 2014 | nmdc:mga0n895_206482_c1 | |||
| 2015 | nmdc:mga0n895_398424_c1 | |||
| 2016 | nmdc:mga0n895_59989_c1 | |||
| 2017 | nmdc:mga0n895_862566_c1 | |||
| 2018 | nmdc:mga0rr50_131599_c1 | |||
| 2019 | nmdc:mga0rr50_32272_c1 | |||
| 2020 | nmdc:mga08x19_30863_c1 | |||
| 2021 | nmdc:mga08x19_35945_c1 | |||
| 2022 | nmdc:mga0a205_1122793_c1 | |||
| 2023 | nmdc:mga0a205_1313709_c1 | |||
| 2024 | nmdc:mga0a205_244774_c1 | |||
| 2025 | nmdc:mga0sz30_2190_c1 | |||
| 2026 | Ga0495601_0049141 | |||
| 2027 | Ga0495601_0049556 | |||
| 2028 | Ga0495601_0107176 | |||
| 2029 | Ga0495601_0263652 | |||
| 2030 | Ga0495612_0024329 | |||
| 2031 | Ga0495612_0028024 | |||
| 2032 | Ga0495612_0041219 | |||
| 2033 | Ga0495612_0125020 | |||
| 2034 | Ga0495612_0393450 | |||
| 2035 | Ga0500635_0312159 | |||
| 2036 | Ga0495595_0000955 | |||
| 2037 | Ga0495595_0002124 | |||
| 2038 | Ga0495595_0014552 | |||
| 2039 | Ga0495595_0031188 | |||
| 2040 | Ga0495595_0057962 | |||
| 2041 | Ga0495619_0009889 | |||
| 2042 | Ga0495619_0027729 | |||
| 2043 | Ga0495619_0032243 | |||
| 2044 | Ga0495619_0067109 | |||
| 2045 | Ga0495619_0846825 | |||
| 2046 | Ga0500556_0014851 | |||
| 2047 | Ga0500562_000672 | |||
| 2048 | Ga0500593_215100 | |||
| 2049 | Ga0500559_0004293 | |||
| 2050 | Ga0500559_0208424 | |||
| 2051 | Ga0500568_0084263 | |||
| 2052 | Ga0500604_0135691 | |||
| 2053 | Ga0500616_0025567 | |||
| 2054 | Ga0500630_105840 | |||
| 2055 | Ga0500637_0454282 | |||
| 2056 | Ga0500645_000014 | |||
| 2057 | Ga0501084_0081635 | |||
| 2058 | Ga0501084_0107461 | |||
| 2059 | Ga0501082_0014332 | |||
| 2060 | Ga0530510_0016065 | |||
| 2061 | Ga0530510_0091536 | |||
| 2062 | Ga0530510_0107690 | |||
| 2063 | 2558913318 | |||
| 2064 | 2902803379 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lyv-assembly1.cif.gz_B-2 | crystal structure of a domain of ribosome-associated factor y from streptococcus pyogenes serotype m6. northeast structural genomics consortium target id dr64a | 0.7826 | 123 | 151 |
| 3db0-assembly1.cif.gz_B | crystal structure of putative pyridoxamine 5'-phosphate oxidase (np_472219.1) from listeria innocua at 2.00 a resolution | 0.7708 | 18 | 124 |
| 2re7-assembly1.cif.gz_A-2 | crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution | 0.7649 | 18 | 122 |
| 1vl7-assembly1.cif.gz_B | crystal structure of a putative heme oxygenase (alr5027) from nostoc sp. pcc 7120 at 1.50 a resolution | 0.755 | 19 | 124 |
| 6vna-assembly1.cif.gz_C | pden_1323 | 0.7541 | 16 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q10FQ7_7_135_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7735 | 123 | 150 | 3.10.180.10 |
| af_Q2FVN7_2_129_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7601 | 12 | 126 | 2.30.110.10 |
| 2q9kA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7585 | 18 | 122 | 2.30.110.10 |
| af_Q8LDU1_64_218_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7581 | 16 | 126 | 2.30.110.10 |
| 1vl7B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.755 | 19 | 124 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1C6SZM8-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase | 0.9832 | 1 | 151 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A7V9NS37-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.9781 | 3 | 151 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A1C6SZM8-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase | 0.9641 | 1 | 151 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A370HZQ1-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase | 0.9597 | 1 | 151 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A7V9NS37-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.9591 | 3 | 151 |
GO:0005829
GO:0016627 GO:0070967 |