F488363
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1020 | 321 | 2040 | 391 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10000432|Ga0070709_1000043219 |
| Length | 477 |
| Sequence | VRDVTGRDTEEGVGKVVGLALSLSPLPIQRGQVRQFSRAYGTGSSFCTLPASELVGYFQSSLRDFPCVLVTSFCLFAQIGALVYNRRLPMDLPAIQSALRQRNIDAWLFYDHHHRDPIAYRVLGLPASLMVTRRWFYLIPADGEPVKLVHKIEAGHLDSLPGQKHQYSGWQELFDKLKSILAKHLDLAMQYSPNNSVFTVSLVDGGTIDLLRGLGKNIVSSADLVAQFESTWSDEQIASHFAARDSIDSIVTEAFKEIGKRVRNGGTKEHEIQQWFMEAFGRENLVTDDPPIVAVNSNAGNPHYEPHASHPVAIHEGDVVLLDVWGKKNTPNAVYYDITWMGFVGGVPSDRMREVFEIVRDARDTGVKTVLDAVSAGRRLAGWEVDRATRGHIKKAGYGDYFIHRTGHSIGTDVHSNGANMDDLEIHDERQILPNSCFSIEPGIYLPEFGVRSEVNVLVRAKSAEVTGKIQREIVTI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 115 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 116 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 177 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 221 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 222 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 225 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 226 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 227 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 228 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 229 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 230 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 231 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 232 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 233 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 234 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 237 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 238 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 239 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 309 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 310 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.51 |
| Metatranscriptomes | 0.39 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.51 |
| Rhizosphere | 94.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070709_10000432 | 3300005434 | Bacteria | 25363 |
| 2 | JGI24752J21851_1004863 | 3300001976 | Bacteria | 1755 |
| 3 | JGI24751J29686_10000897 | 3300002459 | Bacteria | 6802 |
| 4 | Ga0065712_10004139 | 3300005290 | Bacteria | 3364 |
| 5 | Ga0065712_10158652 | 3300005290 | Bacteria | 1318 |
| 6 | Ga0065715_10091689 | 3300005293 | Bacteria | 5616 |
| 7 | Ga0070658_10046918 | 3300005327 | Bacteria | 3496 |
| 8 | Ga0070658_10260746 | 3300005327 | Unclassified | 1472 |
| 9 | Ga0070683_100008827 | 3300005329 | Bacteria | 8576 |
| 10 | Ga0070683_100011670 | 3300005329 | Bacteria | 7608 |
| 11 | Ga0070683_100046216 | 3300005329 | Bacteria | 4021 |
| 12 | Ga0070683_100109881 | 3300005329 | Bacteria | 2600 |
| 13 | Ga0070670_100024685 | 3300005331 | Bacteria | 5170 |
| 14 | Ga0070670_100031846 | 3300005331 | Bacteria | 4541 |
| 15 | Ga0070677_10013649 | 3300005333 | Bacteria | 2846 |
| 16 | Ga0068869_100004860 | 3300005334 | Bacteria | 8397 |
| 17 | Ga0068869_100029145 | 3300005334 | Bacteria | 3864 |
| 18 | Ga0070680_100115449 | 3300005336 | Unclassified | 2237 |
| 19 | Ga0070682_100078877 | 3300005337 | Unclassified | 2125 |
| 20 | Ga0068868_100008270 | 3300005338 | Bacteria | 7450 |
| 21 | Ga0068868_100009121 | 3300005338 | Bacteria | 7122 |
| 22 | Ga0068868_100012948 | 3300005338 | Bacteria | 6102 |
| 23 | Ga0068868_100019125 | 3300005338 | Bacteria | 5130 |
| 24 | Ga0068868_100038646 | 3300005338 | Bacteria | 3705 |
| 25 | Ga0070660_100001606 | 3300005339 | Bacteria | 15529 |
| 26 | Ga0070660_100026499 | 3300005339 | Bacteria | 4316 |
| 27 | Ga0070660_100159785 | 3300005339 | Unclassified | 1815 |
| 28 | Ga0070689_100050268 | 3300005340 | Bacteria | 3220 |
| 29 | Ga0070687_100016278 | 3300005343 | Bacteria | 3387 |
| 30 | Ga0070687_100099232 | 3300005343 | Bacteria | 1627 |
| 31 | Ga0070661_100006213 | 3300005344 | Bacteria | 8237 |
| 32 | Ga0070661_100060104 | 3300005344 | Unclassified | 2788 |
| 33 | Ga0070668_100007447 | 3300005347 | Bacteria | 8122 |
| 34 | Ga0070668_100038070 | 3300005347 | Bacteria | 3674 |
| 35 | Ga0070669_100003780 | 3300005353 | Bacteria | 10935 |
| 36 | Ga0070675_100020211 | 3300005354 | Bacteria | 5313 |
| 37 | Ga0070671_100148002 | 3300005355 | Unclassified | 1983 |
| 38 | Ga0070673_100023574 | 3300005364 | Bacteria | 4498 |
| 39 | Ga0070688_100002957 | 3300005365 | Bacteria | 8661 |
| 40 | Ga0070688_100172668 | 3300005365 | Bacteria | 1493 |
| 41 | Ga0070659_100001742 | 3300005366 | Bacteria | 15639 |
| 42 | Ga0070659_100016657 | 3300005366 | Bacteria | 5520 |
| 43 | Ga0070709_10000508 | 3300005434 | Bacteria | 22982 |
| 44 | Ga0070709_10007729 | 3300005434 | Bacteria | 5903 |
| 45 | Ga0070709_10029627 | 3300005434 | Bacteria | 3276 |
| 46 | Ga0070709_10116272 | 3300005434 | Bacteria | 1805 |
| 47 | Ga0070709_10126818 | 3300005434 | Bacteria | 1737 |
| 48 | Ga0070714_100000027 | 3300005435 | Bacteria | 141750 |
| 49 | Ga0070714_100000184 | 3300005435 | Bacteria | 49943 |
| 50 | Ga0070714_100001883 | 3300005435 | Bacteria | 15309 |
| 51 | Ga0070714_100004724 | 3300005435 | Bacteria | 10307 |
| 52 | Ga0070714_100017233 | 3300005435 | Bacteria | 5849 |
| 53 | Ga0070714_100049322 | 3300005435 | Unclassified | 3583 |
| 54 | Ga0070714_100183635 | 3300005435 | Unclassified | 1904 |
| 55 | Ga0070713_100000134 | 3300005436 | Bacteria | 48639 |
| 56 | Ga0070713_100000441 | 3300005436 | Bacteria | 26508 |
| 57 | Ga0070713_100000879 | 3300005436 | Bacteria | 19266 |
| 58 | Ga0070713_100020017 | 3300005436 | Bacteria | 5122 |
| 59 | Ga0070713_100028094 | 3300005436 | Bacteria | 4439 |
| 60 | Ga0070713_100035469 | 3300005436 | Unclassified | 4015 |
| 61 | Ga0070713_100044369 | 3300005436 | Bacteria | 3639 |
| 62 | Ga0070713_100061634 | 3300005436 | Bacteria | 3139 |
| 63 | Ga0070713_100095893 | 3300005436 | Bacteria | 2560 |
| 64 | Ga0070713_100193824 | 3300005436 | Unclassified | 1832 |
| 65 | Ga0070710_10001549 | 3300005437 | Bacteria | 10861 |
| 66 | Ga0070710_10008124 | 3300005437 | Bacteria | 5102 |
| 67 | Ga0070710_10021015 | 3300005437 | Bacteria | 3396 |
| 68 | Ga0070710_10029050 | 3300005437 | Bacteria | 2963 |
| 69 | Ga0070710_10040104 | 3300005437 | Bacteria | 2580 |
| 70 | Ga0070710_10041452 | 3300005437 | Unclassified | 2542 |
| 71 | Ga0070711_100000271 | 3300005439 | Bacteria | 26787 |
| 72 | Ga0070711_100012239 | 3300005439 | Bacteria | 5355 |
| 73 | Ga0070711_100012311 | 3300005439 | Bacteria | 5337 |
| 74 | Ga0070711_100025957 | 3300005439 | Bacteria | 3836 |
| 75 | Ga0070711_100029928 | 3300005439 | Bacteria | 3599 |
| 76 | Ga0070711_100053924 | 3300005439 | Bacteria | 2773 |
| 77 | Ga0070711_100058074 | 3300005439 | Bacteria | 2681 |
| 78 | Ga0070711_100070019 | 3300005439 | Unclassified | 2469 |
| 79 | Ga0070711_100084480 | 3300005439 | Unclassified | 2271 |
| 80 | Ga0070711_100111319 | 3300005439 | Bacteria | 2010 |
| 81 | Ga0070711_100244993 | 3300005439 | Unclassified | 1403 |
| 82 | Ga0070708_100000459 | 3300005445 | Bacteria | 30632 |
| 83 | Ga0070708_100001910 | 3300005445 | Bacteria | 16037 |
| 84 | Ga0070708_100001941 | 3300005445 | Bacteria | 15960 |
| 85 | Ga0070708_100008503 | 3300005445 | Bacteria | 8246 |
| 86 | Ga0070708_100013871 | 3300005445 | Bacteria | 6618 |
| 87 | Ga0070708_100017136 | 3300005445 | Bacteria | 6033 |
| 88 | Ga0070708_100026105 | 3300005445 | Unclassified | 4997 |
| 89 | Ga0070708_100027364 | 3300005445 | Bacteria | 4892 |
| 90 | Ga0070708_100032166 | 3300005445 | Bacteria | 4547 |
| 91 | Ga0070708_100037870 | 3300005445 | Bacteria | 4210 |
| 92 | Ga0070708_100108325 | 3300005445 | Unclassified | 2551 |
| 93 | Ga0070708_100408057 | 3300005445 | Bacteria | 1281 |
| 94 | Ga0070663_100006254 | 3300005455 | Bacteria | 7140 |
| 95 | Ga0070678_100070011 | 3300005456 | Unclassified | 2621 |
| 96 | Ga0070662_100004877 | 3300005457 | Bacteria | 8511 |
| 97 | Ga0070662_100005317 | 3300005457 | Bacteria | 8223 |
| 98 | Ga0070662_100043573 | 3300005457 | Bacteria | 3212 |
| 99 | Ga0070662_100161054 | 3300005457 | Bacteria | 1755 |
| 100 | Ga0070662_100211842 | 3300005457 | Unclassified | 1542 |
| 101 | Ga0070681_10000242 | 3300005458 | Bacteria | 43180 |
| 102 | Ga0070681_10004600 | 3300005458 | Bacteria | 13176 |
| 103 | Ga0070681_10018211 | 3300005458 | Bacteria | 7022 |
| 104 | Ga0070681_10023295 | 3300005458 | Bacteria | 6227 |
| 105 | Ga0070681_10027456 | 3300005458 | Bacteria | 5723 |
| 106 | Ga0070681_10154975 | 3300005458 | Bacteria | 2216 |
| 107 | Ga0070681_10166720 | 3300005458 | Bacteria | 2125 |
| 108 | Ga0070681_10173076 | 3300005458 | Bacteria | 2080 |
| 109 | Ga0070681_10214782 | 3300005458 | Unclassified | 1840 |
| 110 | Ga0070681_10232388 | 3300005458 | Unclassified | 1758 |
| 111 | Ga0070681_10260341 | 3300005458 | Unclassified | 1647 |
| 112 | Ga0070685_10001931 | 3300005466 | Bacteria | 10760 |
| 113 | Ga0070706_100000278 | 3300005467 | Bacteria | 62365 |
| 114 | Ga0070706_100000514 | 3300005467 | Bacteria | 45375 |
| 115 | Ga0070706_100001354 | 3300005467 | Bacteria | 26044 |
| 116 | Ga0070706_100002109 | 3300005467 | Bacteria | 20248 |
| 117 | Ga0070706_100003323 | 3300005467 | Bacteria | 15875 |
| 118 | Ga0070706_100012428 | 3300005467 | Bacteria | 7889 |
| 119 | Ga0070706_100015679 | 3300005467 | Bacteria | 7000 |
| 120 | Ga0070706_100017419 | 3300005467 | Bacteria | 6630 |
| 121 | Ga0070706_100078384 | 3300005467 | Bacteria | 3059 |
| 122 | Ga0070706_100080578 | 3300005467 | Unclassified | 3015 |
| 123 | Ga0070707_100000162 | 3300005468 | Bacteria | 63928 |
| 124 | Ga0070707_100000662 | 3300005468 | Bacteria | 34318 |
| 125 | Ga0070707_100008218 | 3300005468 | Bacteria | 9680 |
| 126 | Ga0070707_100009330 | 3300005468 | Bacteria | 9107 |
| 127 | Ga0070707_100012541 | 3300005468 | Bacteria | 7916 |
| 128 | Ga0070707_100013183 | 3300005468 | Bacteria | 7728 |
| 129 | Ga0070707_100029144 | 3300005468 | Bacteria | 5255 |
| 130 | Ga0070707_100051085 | 3300005468 | Bacteria | 3963 |
| 131 | Ga0070707_100156588 | 3300005468 | Bacteria | 2219 |
| 132 | Ga0070707_100184797 | 3300005468 | Unclassified | 2032 |
| 133 | Ga0070707_100238809 | 3300005468 | Bacteria | 1769 |
| 134 | Ga0070707_100310089 | 3300005468 | Bacteria | 1534 |
| 135 | Ga0070707_100327402 | 3300005468 | Unclassified | 1489 |
| 136 | Ga0070698_100000133 | 3300005471 | Bacteria | 65381 |
| 137 | Ga0070698_100001945 | 3300005471 | Bacteria | 22939 |
| 138 | Ga0070698_100002043 | 3300005471 | Bacteria | 22426 |
| 139 | Ga0070698_100011544 | 3300005471 | Bacteria | 9370 |
| 140 | Ga0070698_100025166 | 3300005471 | Bacteria | 6202 |
| 141 | Ga0070698_100039029 | 3300005471 | Bacteria | 4890 |
| 142 | Ga0070698_100041613 | 3300005471 | Unclassified | 4717 |
| 143 | Ga0070698_100141600 | 3300005471 | Bacteria | 2356 |
| 144 | Ga0070698_100315601 | 3300005471 | Bacteria | 1494 |
| 145 | Ga0070699_100000441 | 3300005518 | Bacteria | 39851 |
| 146 | Ga0070699_100002709 | 3300005518 | Bacteria | 15794 |
| 147 | Ga0070699_100009252 | 3300005518 | Bacteria | 8537 |
| 148 | Ga0070699_100046551 | 3300005518 | Bacteria | 3753 |
| 149 | Ga0070699_100091033 | 3300005518 | Bacteria | 2667 |
| 150 | Ga0070679_100047020 | 3300005530 | Bacteria | 4302 |
| 151 | Ga0070679_100079417 | 3300005530 | Bacteria | 3270 |
| 152 | Ga0070679_100161616 | 3300005530 | Unclassified | 2214 |
| 153 | Ga0070679_100176140 | 3300005530 | Unclassified | 2111 |
| 154 | Ga0070679_100185428 | 3300005530 | Bacteria | 2051 |
| 155 | Ga0070684_100001890 | 3300005535 | Bacteria | 15344 |
| 156 | Ga0070684_100048290 | 3300005535 | Unclassified | 3692 |
| 157 | Ga0070684_100150375 | 3300005535 | Unclassified | 2109 |
| 158 | Ga0070684_100183381 | 3300005535 | Unclassified | 1903 |
| 159 | Ga0070697_100000049 | 3300005536 | Bacteria | 90362 |
| 160 | Ga0070697_100000158 | 3300005536 | Bacteria | 55228 |
| 161 | Ga0070697_100001854 | 3300005536 | Bacteria | 16151 |
| 162 | Ga0070697_100002751 | 3300005536 | Bacteria | 13543 |
| 163 | Ga0070697_100004513 | 3300005536 | Bacteria | 10700 |
| 164 | Ga0070697_100007545 | 3300005536 | Bacteria | 8469 |
| 165 | Ga0070697_100008726 | 3300005536 | Bacteria | 7915 |
| 166 | Ga0070697_100010636 | 3300005536 | Bacteria | 7179 |
| 167 | Ga0070697_100011265 | 3300005536 | Bacteria | 6988 |
| 168 | Ga0070697_100020538 | 3300005536 | Bacteria | 5226 |
| 169 | Ga0070697_100039836 | 3300005536 | Bacteria | 3800 |
| 170 | Ga0070697_100047034 | 3300005536 | Bacteria | 3499 |
| 171 | Ga0068853_100006695 | 3300005539 | Bacteria | 9179 |
| 172 | Ga0068853_100030598 | 3300005539 | Unclassified | 4548 |
| 173 | Ga0068853_100107639 | 3300005539 | Unclassified | 2472 |
| 174 | Ga0068853_100128952 | 3300005539 | Bacteria | 2262 |
| 175 | Ga0068853_100175047 | 3300005539 | Bacteria | 1943 |
| 176 | Ga0070686_100001751 | 3300005544 | Bacteria | 12151 |
| 177 | Ga0070695_100042489 | 3300005545 | Unclassified | 2886 |
| 178 | Ga0070695_100155403 | 3300005545 | Bacteria | 1600 |
| 179 | Ga0070696_100043518 | 3300005546 | Bacteria | 3107 |
| 180 | Ga0070693_100013310 | 3300005547 | Bacteria | 4188 |
| 181 | Ga0070693_100051240 | 3300005547 | Unclassified | 2363 |
| 182 | Ga0070693_100088047 | 3300005547 | Bacteria | 1866 |
| 183 | Ga0070665_100314111 | 3300005548 | Bacteria | 1571 |
| 184 | Ga0070704_100104740 | 3300005549 | Unclassified | 2140 |
| 185 | Ga0068855_100000722 | 3300005563 | Bacteria | 40559 |
| 186 | Ga0068855_100012781 | 3300005563 | Bacteria | 10127 |
| 187 | Ga0068855_100016183 | 3300005563 | Bacteria | 8967 |
| 188 | Ga0068855_100053103 | 3300005563 | Bacteria | 4769 |
| 189 | Ga0068855_100107023 | 3300005563 | Bacteria | 3213 |
| 190 | Ga0068855_100124918 | 3300005563 | Unclassified | 2942 |
| 191 | Ga0068855_100173193 | 3300005563 | Bacteria | 2443 |
| 192 | Ga0068855_100173553 | 3300005563 | Unclassified | 2440 |
| 193 | Ga0070664_100002060 | 3300005564 | Bacteria | 16060 |
| 194 | Ga0070664_100044027 | 3300005564 | Unclassified | 3768 |
| 195 | Ga0070664_100124316 | 3300005564 | Unclassified | 2262 |
| 196 | Ga0070664_100146293 | 3300005564 | Unclassified | 2084 |
| 197 | Ga0070664_100194278 | 3300005564 | Bacteria | 1809 |
| 198 | Ga0070664_100326989 | 3300005564 | Archaea | 1390 |
| 199 | Ga0068857_100005616 | 3300005577 | Bacteria | 10721 |
| 200 | Ga0068857_100006773 | 3300005577 | Bacteria | 9858 |
| 201 | Ga0068857_100011308 | 3300005577 | Bacteria | 7766 |
| 202 | Ga0068857_100085631 | 3300005577 | Bacteria | 2817 |
| 203 | Ga0068857_100165562 | 3300005577 | Unclassified | 2008 |
| 204 | Ga0068857_100223203 | 3300005577 | Unclassified | 1722 |
| 205 | Ga0068854_100004626 | 3300005578 | Bacteria | 8679 |
| 206 | Ga0068854_100008281 | 3300005578 | Bacteria | 6674 |
| 207 | Ga0068854_100074203 | 3300005578 | Unclassified | 2495 |
| 208 | Ga0068854_100092306 | 3300005578 | Archaea | 2255 |
| 209 | Ga0068856_100000893 | 3300005614 | Bacteria | 31927 |
| 210 | Ga0068856_100001601 | 3300005614 | Bacteria | 23661 |
| 211 | Ga0068856_100010172 | 3300005614 | Bacteria | 9144 |
| 212 | Ga0068856_100010354 | 3300005614 | Bacteria | 9057 |
| 213 | Ga0068856_100015035 | 3300005614 | Bacteria | 7474 |
| 214 | Ga0068856_100036173 | 3300005614 | Unclassified | 4841 |
| 215 | Ga0068856_100047478 | 3300005614 | Unclassified | 4229 |
| 216 | Ga0068856_100052651 | 3300005614 | Unclassified | 4015 |
| 217 | Ga0068856_100064506 | 3300005614 | Bacteria | 3619 |
| 218 | Ga0068856_100131638 | 3300005614 | Bacteria | 2506 |
| 219 | Ga0068856_100175913 | 3300005614 | Unclassified | 2152 |
| 220 | Ga0070702_100145151 | 3300005615 | Unclassified | 1516 |
| 221 | Ga0068852_100023791 | 3300005616 | Bacteria | 4938 |
| 222 | Ga0068852_100039220 | 3300005616 | Bacteria | 3987 |
| 223 | Ga0068852_100146592 | 3300005616 | Unclassified | 2190 |
| 224 | Ga0068852_100369330 | 3300005616 | Bacteria | 1405 |
| 225 | Ga0068852_100382170 | 3300005616 | Unclassified | 1381 |
| 226 | Ga0068859_100001851 | 3300005617 | Bacteria | 21505 |
| 227 | Ga0068859_100015642 | 3300005617 | Bacteria | 7623 |
| 228 | Ga0068859_100398256 | 3300005617 | Unclassified | 1472 |
| 229 | Ga0068864_100007801 | 3300005618 | Bacteria | 8816 |
| 230 | Ga0068864_100060510 | 3300005618 | Bacteria | 3279 |
| 231 | Ga0068861_100143962 | 3300005719 | Unclassified | 1949 |
| 232 | Ga0068861_100177701 | 3300005719 | Unclassified | 1769 |
| 233 | Ga0068851_10003046 | 3300005834 | Bacteria | 7410 |
| 234 | Ga0068863_100012969 | 3300005841 | Bacteria | 8036 |
| 235 | Ga0068863_100027438 | 3300005841 | Bacteria | 5431 |
| 236 | Ga0068863_100133908 | 3300005841 | Bacteria | 2367 |
| 237 | Ga0068863_100314847 | 3300005841 | Unclassified | 1520 |
| 238 | Ga0068858_100001619 | 3300005842 | Bacteria | 22968 |
| 239 | Ga0068858_100025079 | 3300005842 | Bacteria | 5549 |
| 240 | Ga0068858_100031852 | 3300005842 | Bacteria | 4900 |
| 241 | Ga0068858_100041927 | 3300005842 | Unclassified | 4243 |
| 242 | Ga0068858_100048554 | 3300005842 | Unclassified | 3932 |
| 243 | Ga0068858_100123171 | 3300005842 | Unclassified | 2426 |
| 244 | Ga0068860_100005894 | 3300005843 | Bacteria | 12335 |
| 245 | Ga0068860_100018451 | 3300005843 | Bacteria | 6786 |
| 246 | Ga0068860_100073782 | 3300005843 | Bacteria | 3244 |
| 247 | Ga0068862_100032620 | 3300005844 | Bacteria | 4401 |
| 248 | Ga0081455_10061639 | 3300005937 | Bacteria | 3155 |
| 249 | Ga0070717_10001639 | 3300006028 | Bacteria | 15558 |
| 250 | Ga0070717_10001941 | 3300006028 | Bacteria | 14430 |
| 251 | Ga0070717_10002497 | 3300006028 | Bacteria | 12985 |
| 252 | Ga0070717_10005344 | 3300006028 | Bacteria | 9364 |
| 253 | Ga0070717_10008691 | 3300006028 | Bacteria | 7599 |
| 254 | Ga0070717_10011648 | 3300006028 | Bacteria | 6688 |
| 255 | Ga0070717_10032983 | 3300006028 | Bacteria | 4176 |
| 256 | Ga0070717_10033339 | 3300006028 | Bacteria | 4155 |
| 257 | Ga0070717_10043538 | 3300006028 | Bacteria | 3665 |
| 258 | Ga0070717_10071121 | 3300006028 | Unclassified | 2901 |
| 259 | Ga0070717_10076602 | 3300006028 | Unclassified | 2800 |
| 260 | Ga0070717_10076804 | 3300006028 | Bacteria | 2796 |
| 261 | Ga0070717_10081193 | 3300006028 | Bacteria | 2722 |
| 262 | Ga0070717_10099431 | 3300006028 | Bacteria | 2468 |
| 263 | Ga0070717_10151762 | 3300006028 | Bacteria | 2005 |
| 264 | Ga0070717_10162221 | 3300006028 | Bacteria | 1940 |
| 265 | Ga0070717_10264590 | 3300006028 | Bacteria | 1522 |
| 266 | Ga0070715_10003006 | 3300006163 | Bacteria | 5274 |
| 267 | Ga0070715_10006826 | 3300006163 | Bacteria | 3897 |
| 268 | Ga0070715_10012101 | 3300006163 | Unclassified | 3127 |
| 269 | Ga0070715_10013490 | 3300006163 | Bacteria | 3004 |
| 270 | Ga0070716_100003540 | 3300006173 | Bacteria | 7367 |
| 271 | Ga0070716_100022292 | 3300006173 | Unclassified | 3346 |
| 272 | Ga0070716_100034652 | 3300006173 | Unclassified | 2770 |
| 273 | Ga0070716_100065548 | 3300006173 | Bacteria | 2116 |
| 274 | Ga0070716_100090934 | 3300006173 | Unclassified | 1847 |
| 275 | Ga0070712_100000190 | 3300006175 | Bacteria | 34163 |
| 276 | Ga0070712_100000262 | 3300006175 | Bacteria | 29465 |
| 277 | Ga0070712_100000618 | 3300006175 | Bacteria | 20900 |
| 278 | Ga0070712_100002390 | 3300006175 | Bacteria | 11557 |
| 279 | Ga0070712_100011797 | 3300006175 | Bacteria | 5553 |
| 280 | Ga0070712_100015567 | 3300006175 | Bacteria | 4904 |
| 281 | Ga0070712_100147515 | 3300006175 | Bacteria | 1802 |
| 282 | Ga0070712_100315744 | 3300006175 | Bacteria | 1269 |
| 283 | Ga0097621_100000058 | 3300006237 | Bacteria | 58363 |
| 284 | Ga0097621_100014488 | 3300006237 | Bacteria | 5901 |
| 285 | Ga0097621_100206138 | 3300006237 | Bacteria | 1708 |
| 286 | Ga0068871_100000167 | 3300006358 | Bacteria | 43972 |
| 287 | Ga0068871_100000727 | 3300006358 | Bacteria | 22355 |
| 288 | Ga0068871_100001129 | 3300006358 | Bacteria | 17928 |
| 289 | Ga0068871_100016962 | 3300006358 | Bacteria | 5499 |
| 290 | Ga0068871_100077021 | 3300006358 | Bacteria | 2755 |
| 291 | Ga0068871_100085050 | 3300006358 | Bacteria | 2625 |
| 292 | Ga0075428_100134548 | 3300006844 | Bacteria | 2688 |
| 293 | Ga0075428_100193881 | 3300006844 | Bacteria | 2197 |
| 294 | Ga0075430_100014045 | 3300006846 | Bacteria | 6827 |
| 295 | Ga0075430_100080466 | 3300006846 | Bacteria | 2729 |
| 296 | Ga0075431_100017050 | 3300006847 | Bacteria | 7378 |
| 297 | Ga0075433_10000257 | 3300006852 | Bacteria | 30832 |
| 298 | Ga0075433_10014530 | 3300006852 | Bacteria | 6437 |
| 299 | Ga0075433_10127020 | 3300006852 | Bacteria | 2265 |
| 300 | Ga0075433_10243814 | 3300006852 | Unclassified | 1595 |
| 301 | Ga0075434_100000242 | 3300006871 | Bacteria | 38087 |
| 302 | Ga0075434_100001845 | 3300006871 | Bacteria | 18284 |
| 303 | Ga0075434_100033911 | 3300006871 | Bacteria | 5040 |
| 304 | Ga0075434_100138960 | 3300006871 | Bacteria | 2449 |
| 305 | Ga0075434_100207399 | 3300006871 | Bacteria | 1981 |
| 306 | Ga0075429_100008079 | 3300006880 | Bacteria | 9145 |
| 307 | Ga0075429_100090864 | 3300006880 | Bacteria | 2663 |
| 308 | Ga0068865_100027677 | 3300006881 | Unclassified | 3747 |
| 309 | Ga0068865_100068029 | 3300006881 | Bacteria | 2517 |
| 310 | Ga0068865_100106064 | 3300006881 | Archaea | 2065 |
| 311 | Ga0075436_100000404 | 3300006914 | Bacteria | 27840 |
| 312 | Ga0075436_100001900 | 3300006914 | Bacteria | 14350 |
| 313 | Ga0075436_100013914 | 3300006914 | Bacteria | 5510 |
| 314 | Ga0075436_100045105 | 3300006914 | Unclassified | 3041 |
| 315 | Ga0097620_100001850 | 3300006931 | Bacteria | 21505 |
| 316 | Ga0097620_100015642 | 3300006931 | Bacteria | 7623 |
| 317 | Ga0097620_100398241 | 3300006931 | Unclassified | 1472 |
| 318 | Ga0075435_100000202 | 3300007076 | Bacteria | 35945 |
| 319 | Ga0099794_10090505 | 3300007265 | Bacteria | 1518 |
| 320 | Ga0105240_10000325 | 3300009093 | Bacteria | 90079 |
| 321 | Ga0105240_10001005 | 3300009093 | Bacteria | 50335 |
| 322 | Ga0105240_10017855 | 3300009093 | Bacteria | 9546 |
| 323 | Ga0105240_10063714 | 3300009093 | Bacteria | 4584 |
| 324 | Ga0105240_10076445 | 3300009093 | Unclassified | 4128 |
| 325 | Ga0105240_10103666 | 3300009093 | Unclassified | 3455 |
| 326 | Ga0105240_10134963 | 3300009093 | Bacteria | 2956 |
| 327 | Ga0105240_10167481 | 3300009093 | Unclassified | 2605 |
| 328 | Ga0105240_10172186 | 3300009093 | Unclassified | 2563 |
| 329 | Ga0105240_10179636 | 3300009093 | Bacteria | 2498 |
| 330 | Ga0105240_10227366 | 3300009093 | Bacteria | 2170 |
| 331 | Ga0105240_10381162 | 3300009093 | Bacteria | 1593 |
| 332 | Ga0105240_10391296 | 3300009093 | Bacteria | 1568 |
| 333 | Ga0105245_10004451 | 3300009098 | Bacteria | 12389 |
| 334 | Ga0105245_10015530 | 3300009098 | Bacteria | 6640 |
| 335 | Ga0105245_10016248 | 3300009098 | Bacteria | 6488 |
| 336 | Ga0105245_10076932 | 3300009098 | Bacteria | 3041 |
| 337 | Ga0105247_10018578 | 3300009101 | Bacteria | 4171 |
| 338 | Ga0105247_10127642 | 3300009101 | Bacteria | 1654 |
| 339 | Ga0114129_10028780 | 3300009147 | Bacteria | 7872 |
| 340 | Ga0114129_10108973 | 3300009147 | Unclassified | 3823 |
| 341 | Ga0105241_10001007 | 3300009174 | Bacteria | 21393 |
| 342 | Ga0105241_10028094 | 3300009174 | Bacteria | 4189 |
| 343 | Ga0105241_10057414 | 3300009174 | Bacteria | 2986 |
| 344 | Ga0105241_10142388 | 3300009174 | Bacteria | 1954 |
| 345 | Ga0105242_10009165 | 3300009176 | Bacteria | 7598 |
| 346 | Ga0105248_10011618 | 3300009177 | Bacteria | 9700 |
| 347 | Ga0105248_10022438 | 3300009177 | Bacteria | 7000 |
| 348 | Ga0105248_10028192 | 3300009177 | Bacteria | 6253 |
| 349 | Ga0105248_10046865 | 3300009177 | Bacteria | 4847 |
| 350 | Ga0105248_10235426 | 3300009177 | Unclassified | 2061 |
| 351 | Ga0105237_10011001 | 3300009545 | Bacteria | 9604 |
| 352 | Ga0105237_10014737 | 3300009545 | Bacteria | 8160 |
| 353 | Ga0105237_10026897 | 3300009545 | Bacteria | 5879 |
| 354 | Ga0105237_10069355 | 3300009545 | Unclassified | 3521 |
| 355 | Ga0105237_10122178 | 3300009545 | Bacteria | 2598 |
| 356 | Ga0105237_10171513 | 3300009545 | Bacteria | 2169 |
| 357 | Ga0105237_10186769 | 3300009545 | Bacteria | 2073 |
| 358 | Ga0105238_10048523 | 3300009551 | Unclassified | 4278 |
| 359 | Ga0105238_10065612 | 3300009551 | Unclassified | 3632 |
| 360 | Ga0105238_10107866 | 3300009551 | Unclassified | 2765 |
| 361 | Ga0105249_10013908 | 3300009553 | Bacteria | 7114 |
| 362 | Ga0099796_10005480 | 3300010159 | Unclassified | 3172 |
| 363 | Ga0105239_10044409 | 3300010375 | Bacteria | 4872 |
| 364 | Ga0105239_10200638 | 3300010375 | Unclassified | 2235 |
| 365 | Ga0105239_10323484 | 3300010375 | Bacteria | 1739 |
| 366 | Ga0105239_10469151 | 3300010375 | Unclassified | 1429 |
| 367 | Ga0105246_10055304 | 3300011119 | Bacteria | 2738 |
| 368 | Ga0157373_10003057 | 3300013100 | Bacteria | 12628 |
| 369 | Ga0157373_10013678 | 3300013100 | Bacteria | 5950 |
| 370 | Ga0157373_10066725 | 3300013100 | Bacteria | 2545 |
| 371 | Ga0157373_10101656 | 3300013100 | Bacteria | 2022 |
| 372 | Ga0157373_10128502 | 3300013100 | Unclassified | 1782 |
| 373 | Ga0157371_10002264 | 3300013102 | Bacteria | 18550 |
| 374 | Ga0157371_10072161 | 3300013102 | Unclassified | 2445 |
| 375 | Ga0157370_10142808 | 3300013104 | Unclassified | 2230 |
| 376 | Ga0157370_10198346 | 3300013104 | Bacteria | 1862 |
| 377 | Ga0157369_10000592 | 3300013105 | Bacteria | 47171 |
| 378 | Ga0157369_10003003 | 3300013105 | Bacteria | 20180 |
| 379 | Ga0157369_10005867 | 3300013105 | Bacteria | 14265 |
| 380 | Ga0157369_10015743 | 3300013105 | Bacteria | 8521 |
| 381 | Ga0157369_10105538 | 3300013105 | Unclassified | 3000 |
| 382 | Ga0157369_10122337 | 3300013105 | Bacteria | 2760 |
| 383 | Ga0157369_10175553 | 3300013105 | Bacteria | 2256 |
| 384 | Ga0157374_10000181 | 3300013296 | Bacteria | 58388 |
| 385 | Ga0157374_10002512 | 3300013296 | Bacteria | 15478 |
| 386 | Ga0157374_10003490 | 3300013296 | Bacteria | 13213 |
| 387 | Ga0157374_10005598 | 3300013296 | Bacteria | 10581 |
| 388 | Ga0157374_10007938 | 3300013296 | Bacteria | 9064 |
| 389 | Ga0157374_10008005 | 3300013296 | Bacteria | 9037 |
| 390 | Ga0157374_10048161 | 3300013296 | Bacteria | 3955 |
| 391 | Ga0157374_10097761 | 3300013296 | Bacteria | 2810 |
| 392 | Ga0157374_10109973 | 3300013296 | Bacteria | 2650 |
| 393 | Ga0157374_10119686 | 3300013296 | Unclassified | 2540 |
| 394 | Ga0157374_10248561 | 3300013296 | Unclassified | 1750 |
| 395 | Ga0157378_10000351 | 3300013297 | Bacteria | 45196 |
| 396 | Ga0157378_10000680 | 3300013297 | Bacteria | 31989 |
| 397 | Ga0157378_10002074 | 3300013297 | Bacteria | 17939 |
| 398 | Ga0157378_10007912 | 3300013297 | Bacteria | 9274 |
| 399 | Ga0157378_10032836 | 3300013297 | Unclassified | 4588 |
| 400 | Ga0163162_10002555 | 3300013306 | Bacteria | 17229 |
| 401 | Ga0163162_10004210 | 3300013306 | Bacteria | 13826 |
| 402 | Ga0163162_10019239 | 3300013306 | Bacteria | 6695 |
| 403 | Ga0163162_10037123 | 3300013306 | Unclassified | 4860 |
| 404 | Ga0163162_10348938 | 3300013306 | Bacteria | 1613 |
| 405 | Ga0157372_10001790 | 3300013307 | Bacteria | 23336 |
| 406 | Ga0157372_10004337 | 3300013307 | Bacteria | 15162 |
| 407 | Ga0157372_10005053 | 3300013307 | Bacteria | 14015 |
| 408 | Ga0157372_10009344 | 3300013307 | Bacteria | 10434 |
| 409 | Ga0157372_10024941 | 3300013307 | Bacteria | 6499 |
| 410 | Ga0157372_10060773 | 3300013307 | Unclassified | 4228 |
| 411 | Ga0157372_10128283 | 3300013307 | Bacteria | 2917 |
| 412 | Ga0157372_10257754 | 3300013307 | Bacteria | 2025 |
| 413 | Ga0157375_10140664 | 3300013308 | Bacteria | 2540 |
| 414 | Ga0163163_10001815 | 3300014325 | Bacteria | 18011 |
| 415 | Ga0163163_10004099 | 3300014325 | Bacteria | 12433 |
| 416 | Ga0163163_10028700 | 3300014325 | Bacteria | 5347 |
| 417 | Ga0163163_10029712 | 3300014325 | Bacteria | 5260 |
| 418 | Ga0163163_10036969 | 3300014325 | Bacteria | 4747 |
| 419 | Ga0157380_10019901 | 3300014326 | Bacteria | 5008 |
| 420 | Ga0182008_10005863 | 3300014497 | Bacteria | 6941 |
| 421 | Ga0182008_10019030 | 3300014497 | Unclassified | 3550 |
| 422 | Ga0157377_10004842 | 3300014745 | Bacteria | 6260 |
| 423 | Ga0157379_10007009 | 3300014968 | Bacteria | 9742 |
| 424 | Ga0157379_10028378 | 3300014968 | Bacteria | 4978 |
| 425 | Ga0157379_10101371 | 3300014968 | Unclassified | 2584 |
| 426 | Ga0157376_10017528 | 3300014969 | Bacteria | 5466 |
| 427 | Ga0157376_10024032 | 3300014969 | Unclassified | 4779 |
| 428 | Ga0157376_10038962 | 3300014969 | Bacteria | 3871 |
| 429 | Ga0157376_10062314 | 3300014969 | Bacteria | 3138 |
| 430 | Ga0182005_1012321 | 3300015265 | Unclassified | 2417 |
| 431 | Ga0163161_10028230 | 3300017792 | Bacteria | 3984 |
| 432 | Ga0206350_10321460 | 3300020080 | Unclassified | 4100 |
| 433 | Ga0213875_10015997 | 3300021388 | Bacteria | 3643 |
| 434 | Ga0213875_10053330 | 3300021388 | Bacteria | 1893 |
| 435 | Ga0224569_100109 | 3300022732 | Bacteria | 5745 |
| 436 | Ga0224572_1000176 | 3300024225 | Bacteria | 5867 |
| 437 | Ga0224572_1004882 | 3300024225 | Bacteria | 2364 |
| 438 | Ga0228598_1000307 | 3300024227 | Bacteria | 9559 |
| 439 | Ga0228598_1000403 | 3300024227 | Bacteria | 8753 |
| 440 | Ga0228598_1003454 | 3300024227 | Bacteria | 3399 |
| 441 | Ga0207682_10018935 | 3300025893 | Bacteria | 2694 |
| 442 | Ga0207692_10002000 | 3300025898 | Bacteria | 7789 |
| 443 | Ga0207692_10003777 | 3300025898 | Bacteria | 5947 |
| 444 | Ga0207688_10018778 | 3300025901 | Bacteria | 3761 |
| 445 | Ga0207685_10007955 | 3300025905 | Unclassified | 2990 |
| 446 | Ga0207685_10012888 | 3300025905 | Unclassified | 2568 |
| 447 | Ga0207685_10018117 | 3300025905 | Unclassified | 2292 |
| 448 | Ga0207685_10049676 | 3300025905 | Bacteria | 1612 |
| 449 | Ga0207699_10000209 | 3300025906 | Bacteria | 34945 |
| 450 | Ga0207699_10001910 | 3300025906 | Bacteria | 9817 |
| 451 | Ga0207699_10034606 | 3300025906 | Bacteria | 2867 |
| 452 | Ga0207699_10122246 | 3300025906 | Bacteria | 1686 |
| 453 | Ga0207699_10139490 | 3300025906 | Unclassified | 1592 |
| 454 | Ga0207645_10001689 | 3300025907 | Bacteria | 17919 |
| 455 | Ga0207643_10002573 | 3300025908 | Bacteria | 9824 |
| 456 | Ga0207705_10101398 | 3300025909 | Bacteria | 2117 |
| 457 | Ga0207684_10000614 | 3300025910 | Bacteria | 42486 |
| 458 | Ga0207684_10001674 | 3300025910 | Bacteria | 23538 |
| 459 | Ga0207684_10001907 | 3300025910 | Bacteria | 21656 |
| 460 | Ga0207684_10001969 | 3300025910 | Bacteria | 21216 |
| 461 | Ga0207684_10006371 | 3300025910 | Bacteria | 10759 |
| 462 | Ga0207684_10008375 | 3300025910 | Bacteria | 9191 |
| 463 | Ga0207684_10011025 | 3300025910 | Archaea | 7921 |
| 464 | Ga0207684_10014168 | 3300025910 | Unclassified | 6881 |
| 465 | Ga0207684_10020974 | 3300025910 | Bacteria | 5580 |
| 466 | Ga0207684_10035114 | 3300025910 | Bacteria | 4257 |
| 467 | Ga0207654_10022720 | 3300025911 | Bacteria | 3350 |
| 468 | Ga0207654_10042456 | 3300025911 | Bacteria | 2574 |
| 469 | Ga0207707_10001674 | 3300025912 | Bacteria | 20441 |
| 470 | Ga0207707_10003911 | 3300025912 | Bacteria | 13216 |
| 471 | Ga0207707_10036898 | 3300025912 | Bacteria | 4271 |
| 472 | Ga0207707_10102144 | 3300025912 | Unclassified | 2506 |
| 473 | Ga0207707_10122815 | 3300025912 | Bacteria | 2271 |
| 474 | Ga0207707_10127238 | 3300025912 | Unclassified | 2228 |
| 475 | Ga0207707_10150162 | 3300025912 | Bacteria | 2037 |
| 476 | Ga0207695_10004906 | 3300025913 | Bacteria | 18024 |
| 477 | Ga0207695_10022194 | 3300025913 | Bacteria | 7217 |
| 478 | Ga0207695_10047565 | 3300025913 | Unclassified | 4537 |
| 479 | Ga0207695_10066809 | 3300025913 | Bacteria | 3691 |
| 480 | Ga0207695_10166797 | 3300025913 | Unclassified | 2130 |
| 481 | Ga0207695_10198777 | 3300025913 | Bacteria | 1920 |
| 482 | Ga0207695_10307483 | 3300025913 | Bacteria | 1476 |
| 483 | Ga0207671_10007474 | 3300025914 | Bacteria | 9478 |
| 484 | Ga0207671_10028761 | 3300025914 | Unclassified | 4152 |
| 485 | Ga0207671_10070899 | 3300025914 | Bacteria | 2598 |
| 486 | Ga0207671_10124080 | 3300025914 | Unclassified | 1976 |
| 487 | Ga0207671_10184594 | 3300025914 | Bacteria | 1624 |
| 488 | Ga0207693_10000019 | 3300025915 | Bacteria | 138082 |
| 489 | Ga0207693_10000026 | 3300025915 | Bacteria | 122717 |
| 490 | Ga0207693_10000275 | 3300025915 | Bacteria | 47590 |
| 491 | Ga0207693_10000402 | 3300025915 | Bacteria | 39488 |
| 492 | Ga0207693_10007781 | 3300025915 | Bacteria | 8792 |
| 493 | Ga0207693_10008118 | 3300025915 | Bacteria | 8605 |
| 494 | Ga0207693_10018551 | 3300025915 | Bacteria | 5539 |
| 495 | Ga0207693_10042186 | 3300025915 | Bacteria | 3592 |
| 496 | Ga0207693_10049654 | 3300025915 | Bacteria | 3295 |
| 497 | Ga0207663_10003860 | 3300025916 | Bacteria | 7397 |
| 498 | Ga0207663_10018272 | 3300025916 | Bacteria | 3926 |
| 499 | Ga0207663_10058101 | 3300025916 | Bacteria | 2440 |
| 500 | Ga0207663_10077574 | 3300025916 | Bacteria | 2163 |
| 501 | Ga0207663_10077735 | 3300025916 | Unclassified | 2161 |
| 502 | Ga0207663_10126781 | 3300025916 | Bacteria | 1757 |
| 503 | Ga0207660_10055731 | 3300025917 | Bacteria | 2826 |
| 504 | Ga0207660_10063911 | 3300025917 | Unclassified | 2655 |
| 505 | Ga0207662_10012728 | 3300025918 | Bacteria | 4690 |
| 506 | Ga0207657_10002285 | 3300025919 | Bacteria | 20778 |
| 507 | Ga0207657_10002326 | 3300025919 | Bacteria | 20596 |
| 508 | Ga0207657_10003520 | 3300025919 | Bacteria | 16725 |
| 509 | Ga0207649_10000445 | 3300025920 | Bacteria | 29893 |
| 510 | Ga0207652_10025153 | 3300025921 | Bacteria | 4947 |
| 511 | Ga0207652_10217927 | 3300025921 | Bacteria | 1719 |
| 512 | Ga0207646_10000019 | 3300025922 | Bacteria | 282855 |
| 513 | Ga0207646_10000669 | 3300025922 | Bacteria | 44352 |
| 514 | Ga0207646_10002238 | 3300025922 | Bacteria | 23047 |
| 515 | Ga0207646_10002825 | 3300025922 | Bacteria | 20199 |
| 516 | Ga0207646_10005899 | 3300025922 | Bacteria | 12783 |
| 517 | Ga0207646_10008437 | 3300025922 | Bacteria | 10329 |
| 518 | Ga0207646_10044442 | 3300025922 | Bacteria | 3988 |
| 519 | Ga0207646_10045190 | 3300025922 | Bacteria | 3954 |
| 520 | Ga0207646_10065297 | 3300025922 | Bacteria | 3249 |
| 521 | Ga0207646_10071657 | 3300025922 | Unclassified | 3095 |
| 522 | Ga0207646_10162627 | 3300025922 | Bacteria | 2015 |
| 523 | Ga0207646_10234475 | 3300025922 | Bacteria | 1658 |
| 524 | Ga0207694_10019688 | 3300025924 | Bacteria | 5105 |
| 525 | Ga0207694_10059571 | 3300025924 | Bacteria | 2970 |
| 526 | Ga0207694_10096829 | 3300025924 | Unclassified | 2334 |
| 527 | Ga0207694_10221860 | 3300025924 | Unclassified | 1542 |
| 528 | Ga0207650_10000053 | 3300025925 | Bacteria | 164599 |
| 529 | Ga0207650_10067199 | 3300025925 | Bacteria | 2690 |
| 530 | Ga0207659_10040078 | 3300025926 | Bacteria | 3272 |
| 531 | Ga0207687_10007071 | 3300025927 | Bacteria | 7397 |
| 532 | Ga0207687_10016050 | 3300025927 | Unclassified | 4915 |
| 533 | Ga0207687_10020914 | 3300025927 | Bacteria | 4343 |
| 534 | Ga0207687_10097425 | 3300025927 | Bacteria | 2157 |
| 535 | Ga0207700_10000111 | 3300025928 | Bacteria | 48784 |
| 536 | Ga0207700_10000348 | 3300025928 | Bacteria | 27120 |
| 537 | Ga0207700_10010240 | 3300025928 | Bacteria | 5902 |
| 538 | Ga0207700_10016653 | 3300025928 | Bacteria | 4890 |
| 539 | Ga0207700_10041153 | 3300025928 | Bacteria | 3379 |
| 540 | Ga0207700_10057438 | 3300025928 | Unclassified | 2934 |
| 541 | Ga0207700_10090889 | 3300025928 | Bacteria | 2410 |
| 542 | Ga0207700_10100086 | 3300025928 | Bacteria | 2309 |
| 543 | Ga0207700_10228021 | 3300025928 | Unclassified | 1582 |
| 544 | Ga0207664_10000098 | 3300025929 | Bacteria | 80444 |
| 545 | Ga0207664_10000236 | 3300025929 | Bacteria | 41929 |
| 546 | Ga0207664_10006442 | 3300025929 | Bacteria | 8079 |
| 547 | Ga0207664_10152939 | 3300025929 | Unclassified | 1961 |
| 548 | Ga0207664_10168756 | 3300025929 | Unclassified | 1871 |
| 549 | Ga0207664_10182327 | 3300025929 | Unclassified | 1803 |
| 550 | Ga0207644_10019899 | 3300025931 | Bacteria | 4558 |
| 551 | Ga0207644_10044605 | 3300025931 | Archaea | 3151 |
| 552 | Ga0207690_10015345 | 3300025932 | Bacteria | 4641 |
| 553 | Ga0207706_10002255 | 3300025933 | Bacteria | 18825 |
| 554 | Ga0207706_10017718 | 3300025933 | Bacteria | 6416 |
| 555 | Ga0207706_10057458 | 3300025933 | Bacteria | 3428 |
| 556 | Ga0207706_10103675 | 3300025933 | Unclassified | 2502 |
| 557 | Ga0207670_10015855 | 3300025936 | Bacteria | 4512 |
| 558 | Ga0207704_10036846 | 3300025938 | Bacteria | 2818 |
| 559 | Ga0207665_10000358 | 3300025939 | Bacteria | 31676 |
| 560 | Ga0207665_10004365 | 3300025939 | Bacteria | 9394 |
| 561 | Ga0207665_10012284 | 3300025939 | Bacteria | 5623 |
| 562 | Ga0207665_10027306 | 3300025939 | Unclassified | 3772 |
| 563 | Ga0207665_10027941 | 3300025939 | Unclassified | 3726 |
| 564 | Ga0207665_10087926 | 3300025939 | Bacteria | 2149 |
| 565 | Ga0207665_10102034 | 3300025939 | Bacteria | 2004 |
| 566 | Ga0207665_10168366 | 3300025939 | Unclassified | 1581 |
| 567 | Ga0207665_10186763 | 3300025939 | Unclassified | 1504 |
| 568 | Ga0207691_10003568 | 3300025940 | Bacteria | 15137 |
| 569 | Ga0207711_10014801 | 3300025941 | Bacteria | 6481 |
| 570 | Ga0207711_10041085 | 3300025941 | Bacteria | 3937 |
| 571 | Ga0207711_10051892 | 3300025941 | Bacteria | 3514 |
| 572 | Ga0207689_10000542 | 3300025942 | Bacteria | 35861 |
| 573 | Ga0207689_10002682 | 3300025942 | Bacteria | 16456 |
| 574 | Ga0207689_10007004 | 3300025942 | Bacteria | 9912 |
| 575 | Ga0207689_10011534 | 3300025942 | Bacteria | 7570 |
| 576 | Ga0207689_10127005 | 3300025942 | Bacteria | 2098 |
| 577 | Ga0207661_10001208 | 3300025944 | Bacteria | 17288 |
| 578 | Ga0207661_10088275 | 3300025944 | Bacteria | 2577 |
| 579 | Ga0207661_10167122 | 3300025944 | Bacteria | 1912 |
| 580 | Ga0207661_10174741 | 3300025944 | Bacteria | 1872 |
| 581 | Ga0207679_10001783 | 3300025945 | Bacteria | 13399 |
| 582 | Ga0207679_10111452 | 3300025945 | Bacteria | 2160 |
| 583 | Ga0207679_10145463 | 3300025945 | Bacteria | 1922 |
| 584 | Ga0207667_10007869 | 3300025949 | Bacteria | 12730 |
| 585 | Ga0207667_10064866 | 3300025949 | Bacteria | 3811 |
| 586 | Ga0207667_10120976 | 3300025949 | Unclassified | 2698 |
| 587 | Ga0207667_10144355 | 3300025949 | Bacteria | 2450 |
| 588 | Ga0207667_10177880 | 3300025949 | Bacteria | 2185 |
| 589 | Ga0207667_10463604 | 3300025949 | Unclassified | 1287 |
| 590 | Ga0207651_10001496 | 3300025960 | Bacteria | 10642 |
| 591 | Ga0207640_10011254 | 3300025981 | Bacteria | 5060 |
| 592 | Ga0207640_10044413 | 3300025981 | Bacteria | 2847 |
| 593 | Ga0207640_10044827 | 3300025981 | Bacteria | 2836 |
| 594 | Ga0207658_10005363 | 3300025986 | Bacteria | 8806 |
| 595 | Ga0207658_10048547 | 3300025986 | Bacteria | 3113 |
| 596 | Ga0207677_10002399 | 3300026023 | Bacteria | 9824 |
| 597 | Ga0207677_10009986 | 3300026023 | Bacteria | 5357 |
| 598 | Ga0207677_10023183 | 3300026023 | Bacteria | 3828 |
| 599 | Ga0207703_10032180 | 3300026035 | Bacteria | 4150 |
| 600 | Ga0207703_10032365 | 3300026035 | Unclassified | 4139 |
| 601 | Ga0207703_10037964 | 3300026035 | Unclassified | 3840 |
| 602 | Ga0207703_10064606 | 3300026035 | Bacteria | 3004 |
| 603 | Ga0207703_10229424 | 3300026035 | Bacteria | 1664 |
| 604 | Ga0207639_10000640 | 3300026041 | Bacteria | 24154 |
| 605 | Ga0207639_10020974 | 3300026041 | Bacteria | 4686 |
| 606 | Ga0207639_10060639 | 3300026041 | Bacteria | 2919 |
| 607 | Ga0207639_10255054 | 3300026041 | Bacteria | 1531 |
| 608 | Ga0207678_10000840 | 3300026067 | Bacteria | 28166 |
| 609 | Ga0207678_10006402 | 3300026067 | Bacteria | 10457 |
| 610 | Ga0207708_10039749 | 3300026075 | Bacteria | 3585 |
| 611 | Ga0207702_10000962 | 3300026078 | Bacteria | 29642 |
| 612 | Ga0207702_10000989 | 3300026078 | Bacteria | 29131 |
| 613 | Ga0207702_10005687 | 3300026078 | Bacteria | 10873 |
| 614 | Ga0207702_10007050 | 3300026078 | Bacteria | 9615 |
| 615 | Ga0207702_10009982 | 3300026078 | Bacteria | 7961 |
| 616 | Ga0207702_10031974 | 3300026078 | Bacteria | 4389 |
| 617 | Ga0207702_10049632 | 3300026078 | Unclassified | 3541 |
| 618 | Ga0207702_10051111 | 3300026078 | Bacteria | 3492 |
| 619 | Ga0207641_10000104 | 3300026088 | Bacteria | 122307 |
| 620 | Ga0207641_10020452 | 3300026088 | Bacteria | 5435 |
| 621 | Ga0207641_10048986 | 3300026088 | Bacteria | 3569 |
| 622 | Ga0207641_10124490 | 3300026088 | Bacteria | 2306 |
| 623 | Ga0207648_10002557 | 3300026089 | Bacteria | 19506 |
| 624 | Ga0207648_10003472 | 3300026089 | Bacteria | 16526 |
| 625 | Ga0207648_10047789 | 3300026089 | Unclassified | 3749 |
| 626 | Ga0207676_10000491 | 3300026095 | Bacteria | 33225 |
| 627 | Ga0207676_10033521 | 3300026095 | Bacteria | 3881 |
| 628 | Ga0207676_10141069 | 3300026095 | Unclassified | 2063 |
| 629 | Ga0207676_10161916 | 3300026095 | Bacteria | 1939 |
| 630 | Ga0207674_10000867 | 3300026116 | Bacteria | 39599 |
| 631 | Ga0207674_10001318 | 3300026116 | Bacteria | 32302 |
| 632 | Ga0207674_10010008 | 3300026116 | Bacteria | 10793 |
| 633 | Ga0207674_10027636 | 3300026116 | Bacteria | 5998 |
| 634 | Ga0207675_100047635 | 3300026118 | Bacteria | 4001 |
| 635 | Ga0207675_100134021 | 3300026118 | Bacteria | 2349 |
| 636 | Ga0207683_10003204 | 3300026121 | Bacteria | 14276 |
| 637 | Ga0207683_10054308 | 3300026121 | Unclassified | 3513 |
| 638 | Ga0207698_10126136 | 3300026142 | Bacteria | 2177 |
| 639 | Ga0207698_10306128 | 3300026142 | Bacteria | 1482 |
| 640 | Ga0265356_1000478 | 3300028017 | Bacteria | 7213 |
| 641 | Ga0268264_10073344 | 3300028381 | Bacteria | 2905 |
| 642 | Ga0268264_10103983 | 3300028381 | Bacteria | 2474 |
| 643 | Ga0268264_10266229 | 3300028381 | Unclassified | 1599 |
| 644 | Ga0265319_1001935 | 3300028563 | Bacteria | 11733 |
| 645 | Ga0265318_10000470 | 3300028577 | Bacteria | 29937 |
| 646 | Ga0265323_10002678 | 3300028653 | Bacteria | 8045 |
| 647 | Ga0265338_10000833 | 3300028800 | Bacteria | 52026 |
| 648 | Ga0265338_10011557 | 3300028800 | Bacteria | 10178 |
| 649 | Ga0265338_10040971 | 3300028800 | Unclassified | 4340 |
| 650 | Ga0265762_1000119 | 3300030760 | Bacteria | 11713 |
| 651 | Ga0265762_1000777 | 3300030760 | Bacteria | 5699 |
| 652 | Ga0265760_10021498 | 3300031090 | Unclassified | 1868 |
| 653 | Ga0265330_10000124 | 3300031235 | Bacteria | 63181 |
| 654 | Ga0265330_10001029 | 3300031235 | Bacteria | 16863 |
| 655 | Ga0265330_10002039 | 3300031235 | Bacteria | 11206 |
| 656 | Ga0265330_10076568 | 3300031235 | Bacteria | 1444 |
| 657 | Ga0265332_10000212 | 3300031238 | Bacteria | 47356 |
| 658 | Ga0265332_10048198 | 3300031238 | Bacteria | 1833 |
| 659 | Ga0265328_10019321 | 3300031239 | Bacteria | 2619 |
| 660 | Ga0265328_10057548 | 3300031239 | Bacteria | 1427 |
| 661 | Ga0265320_10000458 | 3300031240 | Bacteria | 32020 |
| 662 | Ga0265325_10001657 | 3300031241 | Bacteria | 15491 |
| 663 | Ga0265325_10003282 | 3300031241 | Bacteria | 10635 |
| 664 | Ga0265325_10017529 | 3300031241 | Bacteria | 3979 |
| 665 | Ga0265325_10021709 | 3300031241 | Bacteria | 3521 |
| 666 | Ga0265325_10037343 | 3300031241 | Bacteria | 2568 |
| 667 | Ga0265329_10000608 | 3300031242 | Bacteria | 18454 |
| 668 | Ga0265329_10001963 | 3300031242 | Bacteria | 9652 |
| 669 | Ga0265340_10009453 | 3300031247 | Bacteria | 5231 |
| 670 | Ga0265340_10033192 | 3300031247 | Bacteria | 2571 |
| 671 | Ga0265340_10048740 | 3300031247 | Bacteria | 2059 |
| 672 | Ga0265339_10003136 | 3300031249 | Bacteria | 11639 |
| 673 | Ga0265339_10006988 | 3300031249 | Bacteria | 7337 |
| 674 | Ga0265339_10013445 | 3300031249 | Bacteria | 4959 |
| 675 | Ga0265339_10015031 | 3300031249 | Bacteria | 4652 |
| 676 | Ga0265339_10027092 | 3300031249 | Bacteria | 3277 |
| 677 | Ga0265339_10060133 | 3300031249 | Bacteria | 2048 |
| 678 | Ga0265331_10000626 | 3300031250 | Bacteria | 30727 |
| 679 | Ga0265331_10030706 | 3300031250 | Bacteria | 2674 |
| 680 | Ga0265331_10038598 | 3300031250 | Bacteria | 2334 |
| 681 | Ga0265316_10000007 | 3300031344 | Bacteria | 264584 |
| 682 | Ga0265316_10001212 | 3300031344 | Bacteria | 27775 |
| 683 | Ga0265316_10001409 | 3300031344 | Bacteria | 25869 |
| 684 | Ga0265316_10001455 | 3300031344 | Bacteria | 25408 |
| 685 | Ga0265316_10006292 | 3300031344 | Bacteria | 11368 |
| 686 | Ga0265316_10014345 | 3300031344 | Bacteria | 6978 |
| 687 | Ga0265316_10018684 | 3300031344 | Bacteria | 5953 |
| 688 | Ga0265316_10104097 | 3300031344 | Bacteria | 2154 |
| 689 | Ga0265316_10113100 | 3300031344 | Bacteria | 2055 |
| 690 | Ga0265316_10136540 | 3300031344 | Bacteria | 1844 |
| 691 | Ga0307408_100082813 | 3300031548 | Bacteria | 2402 |
| 692 | Ga0265313_10002578 | 3300031595 | Bacteria | 15447 |
| 693 | Ga0265313_10007574 | 3300031595 | Bacteria | 7380 |
| 694 | Ga0265313_10027981 | 3300031595 | Bacteria | 2940 |
| 695 | Ga0265314_10000005 | 3300031711 | Bacteria | 668532 |
| 696 | Ga0265314_10024310 | 3300031711 | Bacteria | 4595 |
| 697 | Ga0265314_10026888 | 3300031711 | Bacteria | 4317 |
| 698 | Ga0265314_10060022 | 3300031711 | Bacteria | 2598 |
| 699 | Ga0265314_10063551 | 3300031711 | Bacteria | 2503 |
| 700 | Ga0265342_10000005 | 3300031712 | Bacteria | 247745 |
| 701 | Ga0265342_10001134 | 3300031712 | Bacteria | 25443 |
| 702 | Ga0265342_10004629 | 3300031712 | Bacteria | 10723 |
| 703 | Ga0265342_10019414 | 3300031712 | Unclassified | 4381 |
| 704 | Ga0265342_10031316 | 3300031712 | Bacteria | 3290 |
| 705 | Ga0265342_10036519 | 3300031712 | Bacteria | 3001 |
| 706 | Ga0307410_10030830 | 3300031852 | Bacteria | 3432 |
| 707 | Ga0307409_100012125 | 3300031995 | Bacteria | 5476 |
| 708 | Ga0307409_100024575 | 3300031995 | Unclassified | 4205 |
| 709 | Ga0307416_100108397 | 3300032002 | Bacteria | 2440 |
| 710 | Ga0307416_100140771 | 3300032002 | Bacteria | 2192 |
| 711 | Ga0307411_10030856 | 3300032005 | Unclassified | 3290 |
| 712 | Ga0307411_10092114 | 3300032005 | Bacteria | 2119 |
| 713 | Ga0307415_100012606 | 3300032126 | Unclassified | 4895 |
| 714 | Ga0316212_1001343 | 3300033547 | Bacteria | 3334 |
| 715 | Ga0373926_0004972 | 3300035083 | Bacteria | 4368 |
| 716 | Ga0373926_0010368 | 3300035083 | Bacteria | 3123 |
| 717 | Ga0373926_0015292 | 3300035083 | Bacteria | 2615 |
| 718 | Ga0373923_0022376 | 3300035111 | Bacteria | 2478 |
| 719 | Ga0373923_0059778 | 3300035111 | Bacteria | 1616 |
| 720 | Ga0373923_0106516 | 3300035111 | Bacteria | 1241 |
| 721 | Ga0373936_0000926 | 3300035113 | Bacteria | 10468 |
| 722 | Ga0373936_0011529 | 3300035113 | Bacteria | 3348 |
| 723 | Ga0373936_0081728 | 3300035113 | Bacteria | 1345 |
| 724 | Ga0373945_0001045 | 3300035116 | Bacteria | 8295 |
| 725 | Ga0373945_0007285 | 3300035116 | Unclassified | 3582 |
| 726 | Ga0373953_0031745 | 3300035117 | Unclassified | 2056 |
| 727 | Ga0373954_0001164 | 3300035118 | Bacteria | 10590 |
| 728 | Ga0373954_0001795 | 3300035118 | Bacteria | 8838 |
| 729 | Ga0373954_0021171 | 3300035118 | Bacteria | 2943 |
| 730 | Ga0373954_0066734 | 3300035118 | Bacteria | 1704 |
| 731 | Ga0373956_0008228 | 3300035119 | Unclassified | 4221 |
| 732 | Ga0373956_0020933 | 3300035119 | Bacteria | 2788 |
| 733 | Ga0373957_0038484 | 3300035120 | Bacteria | 1791 |
| 734 | Ga0373943_0000008 | 3300035170 | Bacteria | 69214 |
| 735 | Ga0373943_0001310 | 3300035170 | Bacteria | 11180 |
| 736 | Ga0373943_0001571 | 3300035170 | Bacteria | 10341 |
| 737 | Ga0373943_0012801 | 3300035170 | Bacteria | 3782 |
| 738 | Ga0373943_0094993 | 3300035170 | Unclassified | 1550 |
| 739 | Ga0373943_0112791 | 3300035170 | Unclassified | 1436 |
| 740 | Ga0373946_0001764 | 3300035171 | Bacteria | 7534 |
| 741 | Ga0373946_0005469 | 3300035171 | Bacteria | 4582 |
| 742 | Ga0373946_0008093 | 3300035171 | Bacteria | 3859 |
| 743 | Ga0373946_0015286 | 3300035171 | Bacteria | 2907 |
| 744 | Ga0373955_0004246 | 3300035172 | Bacteria | 6328 |
| 745 | Ga0373955_0033059 | 3300035172 | Bacteria | 2721 |
| 746 | Ga0373924_0037381 | 3300035410 | Bacteria | 1976 |
| 747 | Ga0373935_0001333 | 3300035692 | Bacteria | 13657 |
| 748 | Ga0373935_0003639 | 3300035692 | Bacteria | 8988 |
| 749 | Ga0373935_0009893 | 3300035692 | Bacteria | 5714 |
| 750 | Ga0373935_0011396 | 3300035692 | Bacteria | 5338 |
| 751 | Ga0373935_0012288 | 3300035692 | Bacteria | 5151 |
| 752 | Ga0373935_0024750 | 3300035692 | Bacteria | 3697 |
| 753 | Ga0373935_0060369 | 3300035692 | Unclassified | 2425 |
| 754 | Ga0373935_0231910 | 3300035692 | Unclassified | 1286 |
| 755 | Ga0373927_0000102 | 3300035695 | Bacteria | 64428 |
| 756 | Ga0373927_0000282 | 3300035695 | Bacteria | 40021 |
| 757 | Ga0373927_0004903 | 3300035695 | Bacteria | 9295 |
| 758 | Ga0373927_0010628 | 3300035695 | Bacteria | 6132 |
| 759 | Ga0373927_0016685 | 3300035695 | Bacteria | 4844 |
| 760 | Ga0373927_0019643 | 3300035695 | Bacteria | 4430 |
| 761 | Ga0373927_0020788 | 3300035695 | Bacteria | 4302 |
| 762 | Ga0373933_0006743 | 3300035724 | Bacteria | 6260 |
| 763 | Ga0373933_0029242 | 3300035724 | Bacteria | 3185 |
| 764 | Ga0373933_0117310 | 3300035724 | Bacteria | 1664 |
| 765 | Ga0373947_0000085 | 3300035725 | Bacteria | 46581 |
| 766 | Ga0373947_0003324 | 3300035725 | Bacteria | 9529 |
| 767 | Ga0373947_0003884 | 3300035725 | Bacteria | 8790 |
| 768 | Ga0373947_0006708 | 3300035725 | Bacteria | 6678 |
| 769 | Ga0373947_0116762 | 3300035725 | Unclassified | 1692 |
| 770 | Ga0373937_0001894 | 3300036401 | Bacteria | 17556 |
| 771 | Ga0373937_0002447 | 3300036401 | Bacteria | 15426 |
| 772 | Ga0373937_0005085 | 3300036401 | Bacteria | 11200 |
| 773 | Ga0373937_0011706 | 3300036401 | Unclassified | 7694 |
| 774 | Ga0373937_0038559 | 3300036401 | Bacteria | 4354 |
| 775 | Ga0373937_0083614 | 3300036401 | Bacteria | 2953 |
| 776 | Ga0373937_0220607 | 3300036401 | Unclassified | 1785 |
| 777 | Ga0373937_0580937 | 3300036401 | Bacteria | 1064 |
| 778 | Ga0373925_0001250 | 3300037068 | Bacteria | 22415 |
| 779 | Ga0373925_0001997 | 3300037068 | Bacteria | 16904 |
| 780 | Ga0373925_0004385 | 3300037068 | Bacteria | 10664 |
| 781 | Ga0373925_0005430 | 3300037068 | Bacteria | 9495 |
| 782 | Ga0373925_0006324 | 3300037068 | Bacteria | 8724 |
| 783 | Ga0373925_0008172 | 3300037068 | Bacteria | 7620 |
| 784 | Ga0373925_0009582 | 3300037068 | Bacteria | 7057 |
| 785 | Ga0373925_0022106 | 3300037068 | Bacteria | 4636 |
| 786 | Ga0373925_0027423 | 3300037068 | Unclassified | 4169 |
| 787 | Ga0373925_0195655 | 3300037068 | Bacteria | 1606 |
| 788 | Ga0373925_0198205 | 3300037068 | Unclassified | 1596 |
| 789 | Ga0395900_0389009 | 3300037418 | Bacteria | 1361 |
| 790 | Ga0395898_0018272 | 3300037466 | Bacteria | 7150 |
| 791 | Ga0395905_0052302 | 3300037471 | Unclassified | 3824 |
| 792 | Ga0395905_0222452 | 3300037471 | Bacteria | 1767 |
| 793 | Ga0436364_0111624 | 3300037853 | Bacteria | 13280 |
| 794 | Ga0436364_0800841 | 3300037853 | Bacteria | 5919 |
| 795 | Ga0436364_1031116 | 3300037853 | Bacteria | 1846 |
| 796 | Ga0400483_037104 | 3300039062 | Bacteria | 4226 |
| 797 | Ga0436365_1001330 | 3300039437 | Unclassified | 1960 |
| 798 | Ga0436360_0296885 | 3300039438 | Bacteria | 2019 |
| 799 | Ga0436361_0511551 | 3300039447 | Bacteria | 2053 |
| 800 | Ga0436363_1035544 | 3300039450 | Unclassified | 2669 |
| 801 | Ga0436363_1571670 | 3300039450 | Bacteria | 6055 |
| 802 | Ga0436362_0552319 | 3300039453 | Unclassified | 3813 |
| 803 | Ga0451577_0000523 | 3300042876 | Bacteria | 63915 |
| 804 | Ga0451577_0137874 | 3300042876 | Unclassified | 2191 |
| 805 | Ga0466969_0041440 | 3300044656 | Unclassified | 2303 |
| 806 | Ga0453683_0001517 | 3300044673 | Bacteria | 19821 |
| 807 | Ga0453683_0003698 | 3300044673 | Bacteria | 11190 |
| 808 | Ga0453683_0075830 | 3300044673 | Bacteria | 2105 |
| 809 | Ga0466966_0006612 | 3300044684 | Bacteria | 7672 |
| 810 | Ga0466963_0007856 | 3300044694 | Bacteria | 6385 |
| 811 | Ga0466963_0039646 | 3300044694 | Bacteria | 3085 |
| 812 | Ga0466963_0165055 | 3300044694 | Bacteria | 1543 |
| 813 | Ga0466964_0057564 | 3300044706 | Bacteria | 1609 |
| 814 | Ga0453684_0000951 | 3300044712 | Bacteria | 95417 |
| 815 | Ga0453684_0007605 | 3300044712 | Bacteria | 19858 |
| 816 | Ga0453684_0290717 | 3300044712 | Bacteria | 1861 |
| 817 | Ga0466957_0005729 | 3300044842 | Bacteria | 6985 |
| 818 | Ga0466957_0042258 | 3300044842 | Unclassified | 2757 |
| 819 | Ga0466957_0131339 | 3300044842 | Bacteria | 1605 |
| 820 | Ga0466959_0030420 | 3300045049 | Bacteria | 3998 |
| 821 | Ga0466959_0133235 | 3300045049 | Bacteria | 1760 |
| 822 | Ga0466959_0210256 | 3300045049 | Bacteria | 1352 |
| 823 | Ga0451576_0010527 | 3300045051 | Bacteria | 10600 |
| 824 | Ga0451576_0034449 | 3300045051 | Bacteria | 5378 |
| 825 | Ga0451576_0080028 | 3300045051 | Unclassified | 3400 |
| 826 | Ga0451576_0273611 | 3300045051 | Unclassified | 1766 |
| 827 | Ga0466958_0016272 | 3300045836 | Bacteria | 4280 |
| 828 | Ga0466967_0036308 | 3300045976 | Unclassified | 4205 |
| 829 | Ga0466967_0106794 | 3300045976 | Unclassified | 2567 |
| 830 | Ga0466967_0172547 | 3300045976 | Bacteria | 2035 |
| 831 | Ga0466967_0330482 | 3300045976 | Unclassified | 1472 |
| 832 | Ga0466967_0372808 | 3300045976 | Bacteria | 1384 |
| 833 | Ga0495592_0052904 | 3300046454 | Unclassified | 3013 |
| 834 | Ga0495592_0088598 | 3300046454 | Unclassified | 2224 |
| 835 | Ga0495603_0067613 | 3300046455 | Unclassified | 2103 |
| 836 | Ga0495629_0018762 | 3300046459 | Bacteria | 4945 |
| 837 | Ga0495651_0001954 | 3300046462 | Bacteria | 15929 |
| 838 | Ga0495651_0012679 | 3300046462 | Bacteria | 6505 |
| 839 | Ga0495651_0016421 | 3300046462 | Bacteria | 5733 |
| 840 | Ga0495651_0029697 | 3300046462 | Unclassified | 4263 |
| 841 | Ga0495651_0151062 | 3300046462 | Bacteria | 1674 |
| 842 | Ga0495653_0025083 | 3300046463 | Bacteria | 4797 |
| 843 | Ga0495580_0000345 | 3300046472 | Bacteria | 37884 |
| 844 | Ga0495580_0000603 | 3300046472 | Bacteria | 30353 |
| 845 | Ga0495580_0001544 | 3300046472 | Bacteria | 20251 |
| 846 | Ga0495580_0002140 | 3300046472 | Bacteria | 17326 |
| 847 | Ga0495580_0011670 | 3300046472 | Bacteria | 6792 |
| 848 | Ga0495580_0011687 | 3300046472 | Bacteria | 6786 |
| 849 | Ga0495580_0016391 | 3300046472 | Bacteria | 5561 |
| 850 | Ga0495580_0034691 | 3300046472 | Bacteria | 3631 |
| 851 | Ga0495580_0043314 | 3300046472 | Bacteria | 3204 |
| 852 | Ga0495580_0053894 | 3300046472 | Bacteria | 2837 |
| 853 | Ga0495580_0063084 | 3300046472 | Bacteria | 2599 |
| 854 | Ga0495580_0076385 | 3300046472 | Bacteria | 2336 |
| 855 | Ga0495580_0081695 | 3300046472 | Unclassified | 2252 |
| 856 | Ga0495580_0095575 | 3300046472 | Unclassified | 2067 |
| 857 | Ga0495580_0124499 | 3300046472 | Bacteria | 1789 |
| 858 | Ga0495582_0000622 | 3300046473 | Bacteria | 19514 |
| 859 | Ga0495582_0001976 | 3300046473 | Bacteria | 11502 |
| 860 | Ga0495664_0016600 | 3300046477 | Bacteria | 4197 |
| 861 | Ga0495664_0039253 | 3300046477 | Bacteria | 2797 |
| 862 | Ga0495664_0098607 | 3300046477 | Unclassified | 1759 |
| 863 | Ga0495594_0058971 | 3300046499 | Unclassified | 2122 |
| 864 | Ga0495608_0005808 | 3300046511 | Bacteria | 8794 |
| 865 | Ga0495608_0026115 | 3300046511 | Bacteria | 3984 |
| 866 | Ga0495608_0031296 | 3300046511 | Bacteria | 3598 |
| 867 | Ga0495618_0051470 | 3300046514 | Bacteria | 2602 |
| 868 | Ga0495628_0007555 | 3300046516 | Bacteria | 9401 |
| 869 | Ga0495628_0026495 | 3300046516 | Bacteria | 4726 |
| 870 | Ga0495628_0034642 | 3300046516 | Unclassified | 4060 |
| 871 | Ga0495630_0003848 | 3300046517 | Bacteria | 10478 |
| 872 | Ga0495630_0081791 | 3300046517 | Unclassified | 2437 |
| 873 | Ga0495630_0189669 | 3300046517 | Bacteria | 1568 |
| 874 | Ga0495630_0264763 | 3300046517 | Bacteria | 1313 |
| 875 | Ga0495666_0035186 | 3300046526 | Bacteria | 2442 |
| 876 | Ga0495652_0004346 | 3300046529 | Bacteria | 13573 |
| 877 | Ga0495652_0039044 | 3300046529 | Bacteria | 4107 |
| 878 | Ga0495665_0001833 | 3300046531 | Bacteria | 11475 |
| 879 | Ga0495665_0001960 | 3300046531 | Bacteria | 11110 |
| 880 | Ga0495665_0072920 | 3300046531 | Bacteria | 1808 |
| 881 | Ga0495665_0078394 | 3300046531 | Bacteria | 1738 |
| 882 | Ga0495586_0075562 | 3300046535 | Unclassified | 1844 |
| 883 | Ga0495587_0000442 | 3300046536 | Bacteria | 29092 |
| 884 | Ga0495587_0004541 | 3300046536 | Bacteria | 9120 |
| 885 | Ga0495587_0010761 | 3300046536 | Bacteria | 5809 |
| 886 | Ga0495587_0053780 | 3300046536 | Bacteria | 2373 |
| 887 | Ga0495667_0007526 | 3300046559 | Bacteria | 7388 |
| 888 | Ga0495667_0044689 | 3300046559 | Bacteria | 2933 |
| 889 | Ga0495635_0016351 | 3300046663 | Bacteria | 5180 |
| 890 | Ga0495635_0033122 | 3300046663 | Unclassified | 3584 |
| 891 | Ga0495635_0153091 | 3300046663 | Bacteria | 1570 |
| 892 | Ga0495659_0008336 | 3300046664 | Bacteria | 3299 |
| 893 | Ga0495657_0013658 | 3300046675 | Bacteria | 5983 |
| 894 | Ga0495657_0074612 | 3300046675 | Bacteria | 2207 |
| 895 | Ga0495599_0008189 | 3300046678 | Bacteria | 6352 |
| 896 | Ga0495599_0108798 | 3300046678 | Unclassified | 1727 |
| 897 | Ga0495623_0001371 | 3300046679 | Bacteria | 16530 |
| 898 | Ga0495646_0011292 | 3300046680 | Bacteria | 5671 |
| 899 | Ga0495658_0007843 | 3300046683 | Bacteria | 5287 |
| 900 | Ga0495669_0035913 | 3300046684 | Unclassified | 2189 |
| 901 | Ga0495669_0043013 | 3300046684 | Unclassified | 2010 |
| 902 | Ga0495600_0005598 | 3300046809 | Bacteria | 7584 |
| 903 | Ga0495600_0021037 | 3300046809 | Bacteria | 4175 |
| 904 | Ga0495604_0000979 | 3300047317 | Bacteria | 23812 |
| 905 | Ga0495604_0045188 | 3300047317 | Bacteria | 3438 |
| 906 | Ga0495604_0055899 | 3300047317 | Unclassified | 3040 |
| 907 | Ga0495604_0059116 | 3300047317 | Unclassified | 2940 |
| 908 | Ga0495674_0001505 | 3300047319 | Bacteria | 22860 |
| 909 | Ga0495674_0004208 | 3300047319 | Bacteria | 13861 |
| 910 | Ga0495674_0031174 | 3300047319 | Bacteria | 4845 |
| 911 | Ga0495674_0062055 | 3300047319 | Bacteria | 3255 |
| 912 | Ga0495674_0167501 | 3300047319 | Unclassified | 1835 |
| 913 | Ga0495676_0140941 | 3300047321 | Bacteria | 1728 |
| 914 | Ga0495680_0000547 | 3300047322 | Bacteria | 42327 |
| 915 | Ga0495675_0000027 | 3300047444 | Bacteria | 106917 |
| 916 | Ga0495675_0014852 | 3300047444 | Bacteria | 4924 |
| 917 | Ga0495675_0023510 | 3300047444 | Bacteria | 3927 |
| 918 | Ga0495675_0155111 | 3300047444 | Bacteria | 1413 |
| 919 | Ga0495684_0029877 | 3300047471 | Unclassified | 4183 |
| 920 | Ga0495684_0060295 | 3300047471 | Unclassified | 2889 |
| 921 | Ga0495684_0124963 | 3300047471 | Bacteria | 1936 |
| 922 | Ga0495593_0022382 | 3300047673 | Bacteria | 3521 |
| 923 | Ga0495602_0002605 | 3300048088 | Bacteria | 18426 |
| 924 | Ga0495602_0008897 | 3300048088 | Bacteria | 10471 |
| 925 | Ga0495602_0104366 | 3300048088 | Bacteria | 2319 |
| 926 | Ga0495614_0087577 | 3300048089 | Bacteria | 1352 |
| 927 | Ga0496100_0062003 | 3300048903 | Bacteria | 2466 |
| 928 | Ga0496100_0123429 | 3300048903 | Unclassified | 1815 |
| 929 | Ga0496102_0000786 | 3300048905 | Bacteria | 30824 |
| 930 | Ga0496102_0030087 | 3300048905 | Bacteria | 4860 |
| 931 | Ga0496102_0062839 | 3300048905 | Bacteria | 3400 |
| 932 | Ga0496102_0142404 | 3300048905 | Unclassified | 2248 |
| 933 | Ga0496102_0363525 | 3300048905 | Unclassified | 1362 |
| 934 | Ga0496104_0201121 | 3300048907 | Unclassified | 1904 |
| 935 | Ga0496104_0232464 | 3300048907 | Bacteria | 1755 |
| 936 | Ga0496104_0440221 | 3300048907 | Unclassified | 1215 |
| 937 | Ga0496105_0000399 | 3300048908 | Bacteria | 28536 |
| 938 | Ga0496105_0008491 | 3300048908 | Bacteria | 7980 |
| 939 | Ga0496105_0041633 | 3300048908 | Unclassified | 3786 |
| 940 | Ga0496106_0152843 | 3300048909 | Bacteria | 1821 |
| 941 | Ga0496108_0000629 | 3300048911 | Bacteria | 27529 |
| 942 | Ga0496109_0000270 | 3300048912 | Bacteria | 49971 |
| 943 | Ga0496109_0078788 | 3300048912 | Unclassified | 3034 |
| 944 | Ga0496109_0173966 | 3300048912 | Unclassified | 2021 |
| 945 | Ga0496109_0321638 | 3300048912 | Unclassified | 1460 |
| 946 | Ga0496110_0002501 | 3300048913 | Bacteria | 13796 |
| 947 | Ga0496110_0080645 | 3300048913 | Unclassified | 2900 |
| 948 | Ga0496112_0000121 | 3300048915 | Bacteria | 48786 |
| 949 | Ga0496112_0001114 | 3300048915 | Bacteria | 19958 |
| 950 | Ga0496112_0003512 | 3300048915 | Bacteria | 12990 |
| 951 | Ga0496112_0005362 | 3300048915 | Bacteria | 11080 |
| 952 | Ga0496112_0006571 | 3300048915 | Bacteria | 10232 |
| 953 | Ga0496112_0027881 | 3300048915 | Bacteria | 5448 |
| 954 | Ga0496112_0031725 | 3300048915 | Bacteria | 5126 |
| 955 | Ga0496112_0039232 | 3300048915 | Unclassified | 4627 |
| 956 | Ga0496112_0061570 | 3300048915 | Unclassified | 3700 |
| 957 | Ga0496112_0116729 | 3300048915 | Unclassified | 2639 |
| 958 | Ga0496112_0120908 | 3300048915 | Unclassified | 2588 |
| 959 | Ga0496112_0172253 | 3300048915 | Bacteria | 2130 |
| 960 | Ga0496112_0190516 | 3300048915 | Bacteria | 2013 |
| 961 | Ga0496112_0258193 | 3300048915 | Bacteria | 1692 |
| 962 | Ga0496112_0313136 | 3300048915 | Bacteria | 1515 |
| 963 | Ga0496113_0002775 | 3300048916 | Bacteria | 10302 |
| 964 | Ga0496113_0072803 | 3300048916 | Unclassified | 2616 |
| 965 | Ga0496113_0075589 | 3300048916 | Unclassified | 2571 |
| 966 | Ga0496113_0114865 | 3300048916 | Unclassified | 2099 |
| 967 | Ga0496114_0138203 | 3300048917 | Unclassified | 2108 |
| 968 | Ga0496115_0039011 | 3300048918 | Unclassified | 3771 |
| 969 | Ga0496115_0100120 | 3300048918 | Bacteria | 2376 |
| 970 | Ga0496115_0113427 | 3300048918 | Bacteria | 2227 |
| 971 | Ga0496115_0148247 | 3300048918 | Bacteria | 1937 |
| 972 | Ga0496115_0278163 | 3300048918 | Bacteria | 1374 |
| 973 | Ga0501032_0005704 | 3300049569 | Bacteria | 9216 |
| 974 | Ga0501033_0037420 | 3300049570 | Unclassified | 3632 |
| 975 | Ga0501034_0130187 | 3300049571 | Unclassified | 2500 |
| 976 | Ga0501034_0215273 | 3300049571 | Bacteria | 1875 |
| 977 | Ga0501036_0114081 | 3300049572 | Bacteria | 2283 |
| 978 | Ga0501037_0009000 | 3300049573 | Bacteria | 7313 |
| 979 | Ga0501038_0251947 | 3300049574 | Bacteria | 1398 |
| 980 | Ga0501040_0049459 | 3300049576 | Unclassified | 2874 |
| 981 | Ga0501043_0009517 | 3300049579 | Bacteria | 7617 |
| 982 | Ga0501047_0017578 | 3300049581 | Bacteria | 6851 |
| 983 | Ga0501048_0006576 | 3300049582 | Bacteria | 8835 |
| 984 | Ga0501068_0001225 | 3300049584 | Bacteria | 13613 |
| 985 | Ga0501070_0010893 | 3300049586 | Bacteria | 7680 |
| 986 | Ga0501072_0001261 | 3300049588 | Bacteria | 18900 |
| 987 | Ga0501073_0002323 | 3300049589 | Bacteria | 14223 |
| 988 | Ga0501074_0012760 | 3300049590 | Bacteria | 6108 |
| 989 | Ga0501076_0071055 | 3300049592 | Unclassified | 2784 |
| 990 | Ga0501077_0012602 | 3300049593 | Bacteria | 5295 |
| 991 | Ga0501257_016927 | 3300049686 | Unclassified | 1694 |
| 992 | Ga0501080_0000017 | 3300049742 | Bacteria | 96079 |
| 993 | Ga0501268_003670 | 3300049765 | Unclassified | 2116 |
| 994 | Ga0501270_006070 | 3300049767 | Unclassified | 1433 |
| 995 | Ga0501035_0029617 | 3300049822 | Unclassified | 4992 |
| 996 | Ga0501044_0010324 | 3300049823 | Bacteria | 10141 |
| 997 | Ga0501044_0025922 | 3300049823 | Bacteria | 6213 |
| 998 | nmdc:mga05p37_339084_c1 | 3300050507 | Unclassified | 1773 |
| 999 | nmdc:mga09592_87263_c1 | 3300050508 | Bacteria | 2663 |
| 1000 | nmdc:mga0n895_1177_c1 | 3300050512 | Bacteria | 19184 |
| 1001 | nmdc:mga0n895_184695_c1 | 3300050512 | Bacteria | 2116 |
| 1002 | nmdc:mga0n895_299932_c1 | 3300050512 | Bacteria | 1629 |
| 1003 | nmdc:mga0n895_62884_c1 | 3300050512 | Unclassified | 3670 |
| 1004 | nmdc:mga0n895_92004_c1 | 3300050512 | Unclassified | 3036 |
| 1005 | nmdc:mga0rr50_18350_c1 | 3300050513 | Unclassified | 4698 |
| 1006 | nmdc:mga08x19_131676_c1 | 3300050514 | Unclassified | 1683 |
| 1007 | nmdc:mga08x19_134_c1 | 3300050514 | Bacteria | 65861 |
| 1008 | nmdc:mga08x19_20953_c1 | 3300050514 | Unclassified | 4031 |
| 1009 | nmdc:mga08x19_2332_c1 | 3300050514 | Bacteria | 11518 |
| 1010 | nmdc:mga08x19_26514_c1 | 3300050514 | Bacteria | 3616 |
| 1011 | nmdc:mga08x19_5825_c2 | 3300050514 | Bacteria | 5821 |
| 1012 | nmdc:mga08x19_6467_c1 | 3300050514 | Bacteria | 6937 |
| 1013 | nmdc:mga08x19_7445_c1 | 3300050514 | Bacteria | 6501 |
| 1014 | nmdc:mga0a205_109175_c1 | 3300050515 | Bacteria | 2665 |
| 1015 | nmdc:mga0a205_8182_c1 | 3300050515 | Bacteria | 9500 |
| 1016 | Ga0495601_0001642 | 3300053077 | Bacteria | 12336 |
| 1017 | Ga0495601_0015532 | 3300053077 | Bacteria | 4602 |
| 1018 | Ga0495612_0002730 | 3300053078 | Bacteria | 7305 |
| 1019 | Ga0495619_0003442 | 3300053085 | Bacteria | 10210 |
| 1020 | 2673165357 | 2671180531 | Bacteria | 9045424 |
| 1021 | Ga0070709_10000432 | |||
| 1022 | JGI24752J21851_1004863 | |||
| 1023 | JGI24751J29686_10000897 | |||
| 1024 | Ga0065712_10004139 | |||
| 1025 | Ga0065712_10158652 | |||
| 1026 | Ga0065715_10091689 | |||
| 1027 | Ga0070658_10046918 | |||
| 1028 | Ga0070658_10260746 | |||
| 1029 | Ga0070683_100008827 | |||
| 1030 | Ga0070683_100011670 | |||
| 1031 | Ga0070683_100046216 | |||
| 1032 | Ga0070683_100109881 | |||
| 1033 | Ga0070670_100024685 | |||
| 1034 | Ga0070670_100031846 | |||
| 1035 | Ga0070677_10013649 | |||
| 1036 | Ga0068869_100004860 | |||
| 1037 | Ga0068869_100029145 | |||
| 1038 | Ga0070680_100115449 | |||
| 1039 | Ga0070682_100078877 | |||
| 1040 | Ga0068868_100008270 | |||
| 1041 | Ga0068868_100009121 | |||
| 1042 | Ga0068868_100012948 | |||
| 1043 | Ga0068868_100019125 | |||
| 1044 | Ga0068868_100038646 | |||
| 1045 | Ga0070660_100001606 | |||
| 1046 | Ga0070660_100026499 | |||
| 1047 | Ga0070660_100159785 | |||
| 1048 | Ga0070689_100050268 | |||
| 1049 | Ga0070687_100016278 | |||
| 1050 | Ga0070687_100099232 | |||
| 1051 | Ga0070661_100006213 | |||
| 1052 | Ga0070661_100060104 | |||
| 1053 | Ga0070668_100007447 | |||
| 1054 | Ga0070668_100038070 | |||
| 1055 | Ga0070669_100003780 | |||
| 1056 | Ga0070675_100020211 | |||
| 1057 | Ga0070671_100148002 | |||
| 1058 | Ga0070673_100023574 | |||
| 1059 | Ga0070688_100002957 | |||
| 1060 | Ga0070688_100172668 | |||
| 1061 | Ga0070659_100001742 | |||
| 1062 | Ga0070659_100016657 | |||
| 1063 | Ga0070709_10000508 | |||
| 1064 | Ga0070709_10007729 | |||
| 1065 | Ga0070709_10029627 | |||
| 1066 | Ga0070709_10116272 | |||
| 1067 | Ga0070709_10126818 | |||
| 1068 | Ga0070714_100000027 | |||
| 1069 | Ga0070714_100000184 | |||
| 1070 | Ga0070714_100001883 | |||
| 1071 | Ga0070714_100004724 | |||
| 1072 | Ga0070714_100017233 | |||
| 1073 | Ga0070714_100049322 | |||
| 1074 | Ga0070714_100183635 | |||
| 1075 | Ga0070713_100000134 | |||
| 1076 | Ga0070713_100000441 | |||
| 1077 | Ga0070713_100000879 | |||
| 1078 | Ga0070713_100020017 | |||
| 1079 | Ga0070713_100028094 | |||
| 1080 | Ga0070713_100035469 | |||
| 1081 | Ga0070713_100044369 | |||
| 1082 | Ga0070713_100061634 | |||
| 1083 | Ga0070713_100095893 | |||
| 1084 | Ga0070713_100193824 | |||
| 1085 | Ga0070710_10001549 | |||
| 1086 | Ga0070710_10008124 | |||
| 1087 | Ga0070710_10021015 | |||
| 1088 | Ga0070710_10029050 | |||
| 1089 | Ga0070710_10040104 | |||
| 1090 | Ga0070710_10041452 | |||
| 1091 | Ga0070711_100000271 | |||
| 1092 | Ga0070711_100012239 | |||
| 1093 | Ga0070711_100012311 | |||
| 1094 | Ga0070711_100025957 | |||
| 1095 | Ga0070711_100029928 | |||
| 1096 | Ga0070711_100053924 | |||
| 1097 | Ga0070711_100058074 | |||
| 1098 | Ga0070711_100070019 | |||
| 1099 | Ga0070711_100084480 | |||
| 1100 | Ga0070711_100111319 | |||
| 1101 | Ga0070711_100244993 | |||
| 1102 | Ga0070708_100000459 | |||
| 1103 | Ga0070708_100001910 | |||
| 1104 | Ga0070708_100001941 | |||
| 1105 | Ga0070708_100008503 | |||
| 1106 | Ga0070708_100013871 | |||
| 1107 | Ga0070708_100017136 | |||
| 1108 | Ga0070708_100026105 | |||
| 1109 | Ga0070708_100027364 | |||
| 1110 | Ga0070708_100032166 | |||
| 1111 | Ga0070708_100037870 | |||
| 1112 | Ga0070708_100108325 | |||
| 1113 | Ga0070708_100408057 | |||
| 1114 | Ga0070663_100006254 | |||
| 1115 | Ga0070678_100070011 | |||
| 1116 | Ga0070662_100004877 | |||
| 1117 | Ga0070662_100005317 | |||
| 1118 | Ga0070662_100043573 | |||
| 1119 | Ga0070662_100161054 | |||
| 1120 | Ga0070662_100211842 | |||
| 1121 | Ga0070681_10000242 | |||
| 1122 | Ga0070681_10004600 | |||
| 1123 | Ga0070681_10018211 | |||
| 1124 | Ga0070681_10023295 | |||
| 1125 | Ga0070681_10027456 | |||
| 1126 | Ga0070681_10154975 | |||
| 1127 | Ga0070681_10166720 | |||
| 1128 | Ga0070681_10173076 | |||
| 1129 | Ga0070681_10214782 | |||
| 1130 | Ga0070681_10232388 | |||
| 1131 | Ga0070681_10260341 | |||
| 1132 | Ga0070685_10001931 | |||
| 1133 | Ga0070706_100000278 | |||
| 1134 | Ga0070706_100000514 | |||
| 1135 | Ga0070706_100001354 | |||
| 1136 | Ga0070706_100002109 | |||
| 1137 | Ga0070706_100003323 | |||
| 1138 | Ga0070706_100012428 | |||
| 1139 | Ga0070706_100015679 | |||
| 1140 | Ga0070706_100017419 | |||
| 1141 | Ga0070706_100078384 | |||
| 1142 | Ga0070706_100080578 | |||
| 1143 | Ga0070707_100000162 | |||
| 1144 | Ga0070707_100000662 | |||
| 1145 | Ga0070707_100008218 | |||
| 1146 | Ga0070707_100009330 | |||
| 1147 | Ga0070707_100012541 | |||
| 1148 | Ga0070707_100013183 | |||
| 1149 | Ga0070707_100029144 | |||
| 1150 | Ga0070707_100051085 | |||
| 1151 | Ga0070707_100156588 | |||
| 1152 | Ga0070707_100184797 | |||
| 1153 | Ga0070707_100238809 | |||
| 1154 | Ga0070707_100310089 | |||
| 1155 | Ga0070707_100327402 | |||
| 1156 | Ga0070698_100000133 | |||
| 1157 | Ga0070698_100001945 | |||
| 1158 | Ga0070698_100002043 | |||
| 1159 | Ga0070698_100011544 | |||
| 1160 | Ga0070698_100025166 | |||
| 1161 | Ga0070698_100039029 | |||
| 1162 | Ga0070698_100041613 | |||
| 1163 | Ga0070698_100141600 | |||
| 1164 | Ga0070698_100315601 | |||
| 1165 | Ga0070699_100000441 | |||
| 1166 | Ga0070699_100002709 | |||
| 1167 | Ga0070699_100009252 | |||
| 1168 | Ga0070699_100046551 | |||
| 1169 | Ga0070699_100091033 | |||
| 1170 | Ga0070679_100047020 | |||
| 1171 | Ga0070679_100079417 | |||
| 1172 | Ga0070679_100161616 | |||
| 1173 | Ga0070679_100176140 | |||
| 1174 | Ga0070679_100185428 | |||
| 1175 | Ga0070684_100001890 | |||
| 1176 | Ga0070684_100048290 | |||
| 1177 | Ga0070684_100150375 | |||
| 1178 | Ga0070684_100183381 | |||
| 1179 | Ga0070697_100000049 | |||
| 1180 | Ga0070697_100000158 | |||
| 1181 | Ga0070697_100001854 | |||
| 1182 | Ga0070697_100002751 | |||
| 1183 | Ga0070697_100004513 | |||
| 1184 | Ga0070697_100007545 | |||
| 1185 | Ga0070697_100008726 | |||
| 1186 | Ga0070697_100010636 | |||
| 1187 | Ga0070697_100011265 | |||
| 1188 | Ga0070697_100020538 | |||
| 1189 | Ga0070697_100039836 | |||
| 1190 | Ga0070697_100047034 | |||
| 1191 | Ga0068853_100006695 | |||
| 1192 | Ga0068853_100030598 | |||
| 1193 | Ga0068853_100107639 | |||
| 1194 | Ga0068853_100128952 | |||
| 1195 | Ga0068853_100175047 | |||
| 1196 | Ga0070686_100001751 | |||
| 1197 | Ga0070695_100042489 | |||
| 1198 | Ga0070695_100155403 | |||
| 1199 | Ga0070696_100043518 | |||
| 1200 | Ga0070693_100013310 | |||
| 1201 | Ga0070693_100051240 | |||
| 1202 | Ga0070693_100088047 | |||
| 1203 | Ga0070665_100314111 | |||
| 1204 | Ga0070704_100104740 | |||
| 1205 | Ga0068855_100000722 | |||
| 1206 | Ga0068855_100012781 | |||
| 1207 | Ga0068855_100016183 | |||
| 1208 | Ga0068855_100053103 | |||
| 1209 | Ga0068855_100107023 | |||
| 1210 | Ga0068855_100124918 | |||
| 1211 | Ga0068855_100173193 | |||
| 1212 | Ga0068855_100173553 | |||
| 1213 | Ga0070664_100002060 | |||
| 1214 | Ga0070664_100044027 | |||
| 1215 | Ga0070664_100124316 | |||
| 1216 | Ga0070664_100146293 | |||
| 1217 | Ga0070664_100194278 | |||
| 1218 | Ga0070664_100326989 | |||
| 1219 | Ga0068857_100005616 | |||
| 1220 | Ga0068857_100006773 | |||
| 1221 | Ga0068857_100011308 | |||
| 1222 | Ga0068857_100085631 | |||
| 1223 | Ga0068857_100165562 | |||
| 1224 | Ga0068857_100223203 | |||
| 1225 | Ga0068854_100004626 | |||
| 1226 | Ga0068854_100008281 | |||
| 1227 | Ga0068854_100074203 | |||
| 1228 | Ga0068854_100092306 | |||
| 1229 | Ga0068856_100000893 | |||
| 1230 | Ga0068856_100001601 | |||
| 1231 | Ga0068856_100010172 | |||
| 1232 | Ga0068856_100010354 | |||
| 1233 | Ga0068856_100015035 | |||
| 1234 | Ga0068856_100036173 | |||
| 1235 | Ga0068856_100047478 | |||
| 1236 | Ga0068856_100052651 | |||
| 1237 | Ga0068856_100064506 | |||
| 1238 | Ga0068856_100131638 | |||
| 1239 | Ga0068856_100175913 | |||
| 1240 | Ga0070702_100145151 | |||
| 1241 | Ga0068852_100023791 | |||
| 1242 | Ga0068852_100039220 | |||
| 1243 | Ga0068852_100146592 | |||
| 1244 | Ga0068852_100369330 | |||
| 1245 | Ga0068852_100382170 | |||
| 1246 | Ga0068859_100001851 | |||
| 1247 | Ga0068859_100015642 | |||
| 1248 | Ga0068859_100398256 | |||
| 1249 | Ga0068864_100007801 | |||
| 1250 | Ga0068864_100060510 | |||
| 1251 | Ga0068861_100143962 | |||
| 1252 | Ga0068861_100177701 | |||
| 1253 | Ga0068851_10003046 | |||
| 1254 | Ga0068863_100012969 | |||
| 1255 | Ga0068863_100027438 | |||
| 1256 | Ga0068863_100133908 | |||
| 1257 | Ga0068863_100314847 | |||
| 1258 | Ga0068858_100001619 | |||
| 1259 | Ga0068858_100025079 | |||
| 1260 | Ga0068858_100031852 | |||
| 1261 | Ga0068858_100041927 | |||
| 1262 | Ga0068858_100048554 | |||
| 1263 | Ga0068858_100123171 | |||
| 1264 | Ga0068860_100005894 | |||
| 1265 | Ga0068860_100018451 | |||
| 1266 | Ga0068860_100073782 | |||
| 1267 | Ga0068862_100032620 | |||
| 1268 | Ga0081455_10061639 | |||
| 1269 | Ga0070717_10001639 | |||
| 1270 | Ga0070717_10001941 | |||
| 1271 | Ga0070717_10002497 | |||
| 1272 | Ga0070717_10005344 | |||
| 1273 | Ga0070717_10008691 | |||
| 1274 | Ga0070717_10011648 | |||
| 1275 | Ga0070717_10032983 | |||
| 1276 | Ga0070717_10033339 | |||
| 1277 | Ga0070717_10043538 | |||
| 1278 | Ga0070717_10071121 | |||
| 1279 | Ga0070717_10076602 | |||
| 1280 | Ga0070717_10076804 | |||
| 1281 | Ga0070717_10081193 | |||
| 1282 | Ga0070717_10099431 | |||
| 1283 | Ga0070717_10151762 | |||
| 1284 | Ga0070717_10162221 | |||
| 1285 | Ga0070717_10264590 | |||
| 1286 | Ga0070715_10003006 | |||
| 1287 | Ga0070715_10006826 | |||
| 1288 | Ga0070715_10012101 | |||
| 1289 | Ga0070715_10013490 | |||
| 1290 | Ga0070716_100003540 | |||
| 1291 | Ga0070716_100022292 | |||
| 1292 | Ga0070716_100034652 | |||
| 1293 | Ga0070716_100065548 | |||
| 1294 | Ga0070716_100090934 | |||
| 1295 | Ga0070712_100000190 | |||
| 1296 | Ga0070712_100000262 | |||
| 1297 | Ga0070712_100000618 | |||
| 1298 | Ga0070712_100002390 | |||
| 1299 | Ga0070712_100011797 | |||
| 1300 | Ga0070712_100015567 | |||
| 1301 | Ga0070712_100147515 | |||
| 1302 | Ga0070712_100315744 | |||
| 1303 | Ga0097621_100000058 | |||
| 1304 | Ga0097621_100014488 | |||
| 1305 | Ga0097621_100206138 | |||
| 1306 | Ga0068871_100000167 | |||
| 1307 | Ga0068871_100000727 | |||
| 1308 | Ga0068871_100001129 | |||
| 1309 | Ga0068871_100016962 | |||
| 1310 | Ga0068871_100077021 | |||
| 1311 | Ga0068871_100085050 | |||
| 1312 | Ga0075428_100134548 | |||
| 1313 | Ga0075428_100193881 | |||
| 1314 | Ga0075430_100014045 | |||
| 1315 | Ga0075430_100080466 | |||
| 1316 | Ga0075431_100017050 | |||
| 1317 | Ga0075433_10000257 | |||
| 1318 | Ga0075433_10014530 | |||
| 1319 | Ga0075433_10127020 | |||
| 1320 | Ga0075433_10243814 | |||
| 1321 | Ga0075434_100000242 | |||
| 1322 | Ga0075434_100001845 | |||
| 1323 | Ga0075434_100033911 | |||
| 1324 | Ga0075434_100138960 | |||
| 1325 | Ga0075434_100207399 | |||
| 1326 | Ga0075429_100008079 | |||
| 1327 | Ga0075429_100090864 | |||
| 1328 | Ga0068865_100027677 | |||
| 1329 | Ga0068865_100068029 | |||
| 1330 | Ga0068865_100106064 | |||
| 1331 | Ga0075436_100000404 | |||
| 1332 | Ga0075436_100001900 | |||
| 1333 | Ga0075436_100013914 | |||
| 1334 | Ga0075436_100045105 | |||
| 1335 | Ga0097620_100001850 | |||
| 1336 | Ga0097620_100015642 | |||
| 1337 | Ga0097620_100398241 | |||
| 1338 | Ga0075435_100000202 | |||
| 1339 | Ga0099794_10090505 | |||
| 1340 | Ga0105240_10000325 | |||
| 1341 | Ga0105240_10001005 | |||
| 1342 | Ga0105240_10017855 | |||
| 1343 | Ga0105240_10063714 | |||
| 1344 | Ga0105240_10076445 | |||
| 1345 | Ga0105240_10103666 | |||
| 1346 | Ga0105240_10134963 | |||
| 1347 | Ga0105240_10167481 | |||
| 1348 | Ga0105240_10172186 | |||
| 1349 | Ga0105240_10179636 | |||
| 1350 | Ga0105240_10227366 | |||
| 1351 | Ga0105240_10381162 | |||
| 1352 | Ga0105240_10391296 | |||
| 1353 | Ga0105245_10004451 | |||
| 1354 | Ga0105245_10015530 | |||
| 1355 | Ga0105245_10016248 | |||
| 1356 | Ga0105245_10076932 | |||
| 1357 | Ga0105247_10018578 | |||
| 1358 | Ga0105247_10127642 | |||
| 1359 | Ga0114129_10028780 | |||
| 1360 | Ga0114129_10108973 | |||
| 1361 | Ga0105241_10001007 | |||
| 1362 | Ga0105241_10028094 | |||
| 1363 | Ga0105241_10057414 | |||
| 1364 | Ga0105241_10142388 | |||
| 1365 | Ga0105242_10009165 | |||
| 1366 | Ga0105248_10011618 | |||
| 1367 | Ga0105248_10022438 | |||
| 1368 | Ga0105248_10028192 | |||
| 1369 | Ga0105248_10046865 | |||
| 1370 | Ga0105248_10235426 | |||
| 1371 | Ga0105237_10011001 | |||
| 1372 | Ga0105237_10014737 | |||
| 1373 | Ga0105237_10026897 | |||
| 1374 | Ga0105237_10069355 | |||
| 1375 | Ga0105237_10122178 | |||
| 1376 | Ga0105237_10171513 | |||
| 1377 | Ga0105237_10186769 | |||
| 1378 | Ga0105238_10048523 | |||
| 1379 | Ga0105238_10065612 | |||
| 1380 | Ga0105238_10107866 | |||
| 1381 | Ga0105249_10013908 | |||
| 1382 | Ga0099796_10005480 | |||
| 1383 | Ga0105239_10044409 | |||
| 1384 | Ga0105239_10200638 | |||
| 1385 | Ga0105239_10323484 | |||
| 1386 | Ga0105239_10469151 | |||
| 1387 | Ga0105246_10055304 | |||
| 1388 | Ga0157373_10003057 | |||
| 1389 | Ga0157373_10013678 | |||
| 1390 | Ga0157373_10066725 | |||
| 1391 | Ga0157373_10101656 | |||
| 1392 | Ga0157373_10128502 | |||
| 1393 | Ga0157371_10002264 | |||
| 1394 | Ga0157371_10072161 | |||
| 1395 | Ga0157370_10142808 | |||
| 1396 | Ga0157370_10198346 | |||
| 1397 | Ga0157369_10000592 | |||
| 1398 | Ga0157369_10003003 | |||
| 1399 | Ga0157369_10005867 | |||
| 1400 | Ga0157369_10015743 | |||
| 1401 | Ga0157369_10105538 | |||
| 1402 | Ga0157369_10122337 | |||
| 1403 | Ga0157369_10175553 | |||
| 1404 | Ga0157374_10000181 | |||
| 1405 | Ga0157374_10002512 | |||
| 1406 | Ga0157374_10003490 | |||
| 1407 | Ga0157374_10005598 | |||
| 1408 | Ga0157374_10007938 | |||
| 1409 | Ga0157374_10008005 | |||
| 1410 | Ga0157374_10048161 | |||
| 1411 | Ga0157374_10097761 | |||
| 1412 | Ga0157374_10109973 | |||
| 1413 | Ga0157374_10119686 | |||
| 1414 | Ga0157374_10248561 | |||
| 1415 | Ga0157378_10000351 | |||
| 1416 | Ga0157378_10000680 | |||
| 1417 | Ga0157378_10002074 | |||
| 1418 | Ga0157378_10007912 | |||
| 1419 | Ga0157378_10032836 | |||
| 1420 | Ga0163162_10002555 | |||
| 1421 | Ga0163162_10004210 | |||
| 1422 | Ga0163162_10019239 | |||
| 1423 | Ga0163162_10037123 | |||
| 1424 | Ga0163162_10348938 | |||
| 1425 | Ga0157372_10001790 | |||
| 1426 | Ga0157372_10004337 | |||
| 1427 | Ga0157372_10005053 | |||
| 1428 | Ga0157372_10009344 | |||
| 1429 | Ga0157372_10024941 | |||
| 1430 | Ga0157372_10060773 | |||
| 1431 | Ga0157372_10128283 | |||
| 1432 | Ga0157372_10257754 | |||
| 1433 | Ga0157375_10140664 | |||
| 1434 | Ga0163163_10001815 | |||
| 1435 | Ga0163163_10004099 | |||
| 1436 | Ga0163163_10028700 | |||
| 1437 | Ga0163163_10029712 | |||
| 1438 | Ga0163163_10036969 | |||
| 1439 | Ga0157380_10019901 | |||
| 1440 | Ga0182008_10005863 | |||
| 1441 | Ga0182008_10019030 | |||
| 1442 | Ga0157377_10004842 | |||
| 1443 | Ga0157379_10007009 | |||
| 1444 | Ga0157379_10028378 | |||
| 1445 | Ga0157379_10101371 | |||
| 1446 | Ga0157376_10017528 | |||
| 1447 | Ga0157376_10024032 | |||
| 1448 | Ga0157376_10038962 | |||
| 1449 | Ga0157376_10062314 | |||
| 1450 | Ga0182005_1012321 | |||
| 1451 | Ga0163161_10028230 | |||
| 1452 | Ga0206350_10321460 | |||
| 1453 | Ga0213875_10015997 | |||
| 1454 | Ga0213875_10053330 | |||
| 1455 | Ga0224569_100109 | |||
| 1456 | Ga0224572_1000176 | |||
| 1457 | Ga0224572_1004882 | |||
| 1458 | Ga0228598_1000307 | |||
| 1459 | Ga0228598_1000403 | |||
| 1460 | Ga0228598_1003454 | |||
| 1461 | Ga0207682_10018935 | |||
| 1462 | Ga0207692_10002000 | |||
| 1463 | Ga0207692_10003777 | |||
| 1464 | Ga0207688_10018778 | |||
| 1465 | Ga0207685_10007955 | |||
| 1466 | Ga0207685_10012888 | |||
| 1467 | Ga0207685_10018117 | |||
| 1468 | Ga0207685_10049676 | |||
| 1469 | Ga0207699_10000209 | |||
| 1470 | Ga0207699_10001910 | |||
| 1471 | Ga0207699_10034606 | |||
| 1472 | Ga0207699_10122246 | |||
| 1473 | Ga0207699_10139490 | |||
| 1474 | Ga0207645_10001689 | |||
| 1475 | Ga0207643_10002573 | |||
| 1476 | Ga0207705_10101398 | |||
| 1477 | Ga0207684_10000614 | |||
| 1478 | Ga0207684_10001674 | |||
| 1479 | Ga0207684_10001907 | |||
| 1480 | Ga0207684_10001969 | |||
| 1481 | Ga0207684_10006371 | |||
| 1482 | Ga0207684_10008375 | |||
| 1483 | Ga0207684_10011025 | |||
| 1484 | Ga0207684_10014168 | |||
| 1485 | Ga0207684_10020974 | |||
| 1486 | Ga0207684_10035114 | |||
| 1487 | Ga0207654_10022720 | |||
| 1488 | Ga0207654_10042456 | |||
| 1489 | Ga0207707_10001674 | |||
| 1490 | Ga0207707_10003911 | |||
| 1491 | Ga0207707_10036898 | |||
| 1492 | Ga0207707_10102144 | |||
| 1493 | Ga0207707_10122815 | |||
| 1494 | Ga0207707_10127238 | |||
| 1495 | Ga0207707_10150162 | |||
| 1496 | Ga0207695_10004906 | |||
| 1497 | Ga0207695_10022194 | |||
| 1498 | Ga0207695_10047565 | |||
| 1499 | Ga0207695_10066809 | |||
| 1500 | Ga0207695_10166797 | |||
| 1501 | Ga0207695_10198777 | |||
| 1502 | Ga0207695_10307483 | |||
| 1503 | Ga0207671_10007474 | |||
| 1504 | Ga0207671_10028761 | |||
| 1505 | Ga0207671_10070899 | |||
| 1506 | Ga0207671_10124080 | |||
| 1507 | Ga0207671_10184594 | |||
| 1508 | Ga0207693_10000019 | |||
| 1509 | Ga0207693_10000026 | |||
| 1510 | Ga0207693_10000275 | |||
| 1511 | Ga0207693_10000402 | |||
| 1512 | Ga0207693_10007781 | |||
| 1513 | Ga0207693_10008118 | |||
| 1514 | Ga0207693_10018551 | |||
| 1515 | Ga0207693_10042186 | |||
| 1516 | Ga0207693_10049654 | |||
| 1517 | Ga0207663_10003860 | |||
| 1518 | Ga0207663_10018272 | |||
| 1519 | Ga0207663_10058101 | |||
| 1520 | Ga0207663_10077574 | |||
| 1521 | Ga0207663_10077735 | |||
| 1522 | Ga0207663_10126781 | |||
| 1523 | Ga0207660_10055731 | |||
| 1524 | Ga0207660_10063911 | |||
| 1525 | Ga0207662_10012728 | |||
| 1526 | Ga0207657_10002285 | |||
| 1527 | Ga0207657_10002326 | |||
| 1528 | Ga0207657_10003520 | |||
| 1529 | Ga0207649_10000445 | |||
| 1530 | Ga0207652_10025153 | |||
| 1531 | Ga0207652_10217927 | |||
| 1532 | Ga0207646_10000019 | |||
| 1533 | Ga0207646_10000669 | |||
| 1534 | Ga0207646_10002238 | |||
| 1535 | Ga0207646_10002825 | |||
| 1536 | Ga0207646_10005899 | |||
| 1537 | Ga0207646_10008437 | |||
| 1538 | Ga0207646_10044442 | |||
| 1539 | Ga0207646_10045190 | |||
| 1540 | Ga0207646_10065297 | |||
| 1541 | Ga0207646_10071657 | |||
| 1542 | Ga0207646_10162627 | |||
| 1543 | Ga0207646_10234475 | |||
| 1544 | Ga0207694_10019688 | |||
| 1545 | Ga0207694_10059571 | |||
| 1546 | Ga0207694_10096829 | |||
| 1547 | Ga0207694_10221860 | |||
| 1548 | Ga0207650_10000053 | |||
| 1549 | Ga0207650_10067199 | |||
| 1550 | Ga0207659_10040078 | |||
| 1551 | Ga0207687_10007071 | |||
| 1552 | Ga0207687_10016050 | |||
| 1553 | Ga0207687_10020914 | |||
| 1554 | Ga0207687_10097425 | |||
| 1555 | Ga0207700_10000111 | |||
| 1556 | Ga0207700_10000348 | |||
| 1557 | Ga0207700_10010240 | |||
| 1558 | Ga0207700_10016653 | |||
| 1559 | Ga0207700_10041153 | |||
| 1560 | Ga0207700_10057438 | |||
| 1561 | Ga0207700_10090889 | |||
| 1562 | Ga0207700_10100086 | |||
| 1563 | Ga0207700_10228021 | |||
| 1564 | Ga0207664_10000098 | |||
| 1565 | Ga0207664_10000236 | |||
| 1566 | Ga0207664_10006442 | |||
| 1567 | Ga0207664_10152939 | |||
| 1568 | Ga0207664_10168756 | |||
| 1569 | Ga0207664_10182327 | |||
| 1570 | Ga0207644_10019899 | |||
| 1571 | Ga0207644_10044605 | |||
| 1572 | Ga0207690_10015345 | |||
| 1573 | Ga0207706_10002255 | |||
| 1574 | Ga0207706_10017718 | |||
| 1575 | Ga0207706_10057458 | |||
| 1576 | Ga0207706_10103675 | |||
| 1577 | Ga0207670_10015855 | |||
| 1578 | Ga0207704_10036846 | |||
| 1579 | Ga0207665_10000358 | |||
| 1580 | Ga0207665_10004365 | |||
| 1581 | Ga0207665_10012284 | |||
| 1582 | Ga0207665_10027306 | |||
| 1583 | Ga0207665_10027941 | |||
| 1584 | Ga0207665_10087926 | |||
| 1585 | Ga0207665_10102034 | |||
| 1586 | Ga0207665_10168366 | |||
| 1587 | Ga0207665_10186763 | |||
| 1588 | Ga0207691_10003568 | |||
| 1589 | Ga0207711_10014801 | |||
| 1590 | Ga0207711_10041085 | |||
| 1591 | Ga0207711_10051892 | |||
| 1592 | Ga0207689_10000542 | |||
| 1593 | Ga0207689_10002682 | |||
| 1594 | Ga0207689_10007004 | |||
| 1595 | Ga0207689_10011534 | |||
| 1596 | Ga0207689_10127005 | |||
| 1597 | Ga0207661_10001208 | |||
| 1598 | Ga0207661_10088275 | |||
| 1599 | Ga0207661_10167122 | |||
| 1600 | Ga0207661_10174741 | |||
| 1601 | Ga0207679_10001783 | |||
| 1602 | Ga0207679_10111452 | |||
| 1603 | Ga0207679_10145463 | |||
| 1604 | Ga0207667_10007869 | |||
| 1605 | Ga0207667_10064866 | |||
| 1606 | Ga0207667_10120976 | |||
| 1607 | Ga0207667_10144355 | |||
| 1608 | Ga0207667_10177880 | |||
| 1609 | Ga0207667_10463604 | |||
| 1610 | Ga0207651_10001496 | |||
| 1611 | Ga0207640_10011254 | |||
| 1612 | Ga0207640_10044413 | |||
| 1613 | Ga0207640_10044827 | |||
| 1614 | Ga0207658_10005363 | |||
| 1615 | Ga0207658_10048547 | |||
| 1616 | Ga0207677_10002399 | |||
| 1617 | Ga0207677_10009986 | |||
| 1618 | Ga0207677_10023183 | |||
| 1619 | Ga0207703_10032180 | |||
| 1620 | Ga0207703_10032365 | |||
| 1621 | Ga0207703_10037964 | |||
| 1622 | Ga0207703_10064606 | |||
| 1623 | Ga0207703_10229424 | |||
| 1624 | Ga0207639_10000640 | |||
| 1625 | Ga0207639_10020974 | |||
| 1626 | Ga0207639_10060639 | |||
| 1627 | Ga0207639_10255054 | |||
| 1628 | Ga0207678_10000840 | |||
| 1629 | Ga0207678_10006402 | |||
| 1630 | Ga0207708_10039749 | |||
| 1631 | Ga0207702_10000962 | |||
| 1632 | Ga0207702_10000989 | |||
| 1633 | Ga0207702_10005687 | |||
| 1634 | Ga0207702_10007050 | |||
| 1635 | Ga0207702_10009982 | |||
| 1636 | Ga0207702_10031974 | |||
| 1637 | Ga0207702_10049632 | |||
| 1638 | Ga0207702_10051111 | |||
| 1639 | Ga0207641_10000104 | |||
| 1640 | Ga0207641_10020452 | |||
| 1641 | Ga0207641_10048986 | |||
| 1642 | Ga0207641_10124490 | |||
| 1643 | Ga0207648_10002557 | |||
| 1644 | Ga0207648_10003472 | |||
| 1645 | Ga0207648_10047789 | |||
| 1646 | Ga0207676_10000491 | |||
| 1647 | Ga0207676_10033521 | |||
| 1648 | Ga0207676_10141069 | |||
| 1649 | Ga0207676_10161916 | |||
| 1650 | Ga0207674_10000867 | |||
| 1651 | Ga0207674_10001318 | |||
| 1652 | Ga0207674_10010008 | |||
| 1653 | Ga0207674_10027636 | |||
| 1654 | Ga0207675_100047635 | |||
| 1655 | Ga0207675_100134021 | |||
| 1656 | Ga0207683_10003204 | |||
| 1657 | Ga0207683_10054308 | |||
| 1658 | Ga0207698_10126136 | |||
| 1659 | Ga0207698_10306128 | |||
| 1660 | Ga0265356_1000478 | |||
| 1661 | Ga0268264_10073344 | |||
| 1662 | Ga0268264_10103983 | |||
| 1663 | Ga0268264_10266229 | |||
| 1664 | Ga0265319_1001935 | |||
| 1665 | Ga0265318_10000470 | |||
| 1666 | Ga0265323_10002678 | |||
| 1667 | Ga0265338_10000833 | |||
| 1668 | Ga0265338_10011557 | |||
| 1669 | Ga0265338_10040971 | |||
| 1670 | Ga0265762_1000119 | |||
| 1671 | Ga0265762_1000777 | |||
| 1672 | Ga0265760_10021498 | |||
| 1673 | Ga0265330_10000124 | |||
| 1674 | Ga0265330_10001029 | |||
| 1675 | Ga0265330_10002039 | |||
| 1676 | Ga0265330_10076568 | |||
| 1677 | Ga0265332_10000212 | |||
| 1678 | Ga0265332_10048198 | |||
| 1679 | Ga0265328_10019321 | |||
| 1680 | Ga0265328_10057548 | |||
| 1681 | Ga0265320_10000458 | |||
| 1682 | Ga0265325_10001657 | |||
| 1683 | Ga0265325_10003282 | |||
| 1684 | Ga0265325_10017529 | |||
| 1685 | Ga0265325_10021709 | |||
| 1686 | Ga0265325_10037343 | |||
| 1687 | Ga0265329_10000608 | |||
| 1688 | Ga0265329_10001963 | |||
| 1689 | Ga0265340_10009453 | |||
| 1690 | Ga0265340_10033192 | |||
| 1691 | Ga0265340_10048740 | |||
| 1692 | Ga0265339_10003136 | |||
| 1693 | Ga0265339_10006988 | |||
| 1694 | Ga0265339_10013445 | |||
| 1695 | Ga0265339_10015031 | |||
| 1696 | Ga0265339_10027092 | |||
| 1697 | Ga0265339_10060133 | |||
| 1698 | Ga0265331_10000626 | |||
| 1699 | Ga0265331_10030706 | |||
| 1700 | Ga0265331_10038598 | |||
| 1701 | Ga0265316_10000007 | |||
| 1702 | Ga0265316_10001212 | |||
| 1703 | Ga0265316_10001409 | |||
| 1704 | Ga0265316_10001455 | |||
| 1705 | Ga0265316_10006292 | |||
| 1706 | Ga0265316_10014345 | |||
| 1707 | Ga0265316_10018684 | |||
| 1708 | Ga0265316_10104097 | |||
| 1709 | Ga0265316_10113100 | |||
| 1710 | Ga0265316_10136540 | |||
| 1711 | Ga0307408_100082813 | |||
| 1712 | Ga0265313_10002578 | |||
| 1713 | Ga0265313_10007574 | |||
| 1714 | Ga0265313_10027981 | |||
| 1715 | Ga0265314_10000005 | |||
| 1716 | Ga0265314_10024310 | |||
| 1717 | Ga0265314_10026888 | |||
| 1718 | Ga0265314_10060022 | |||
| 1719 | Ga0265314_10063551 | |||
| 1720 | Ga0265342_10000005 | |||
| 1721 | Ga0265342_10001134 | |||
| 1722 | Ga0265342_10004629 | |||
| 1723 | Ga0265342_10019414 | |||
| 1724 | Ga0265342_10031316 | |||
| 1725 | Ga0265342_10036519 | |||
| 1726 | Ga0307410_10030830 | |||
| 1727 | Ga0307409_100012125 | |||
| 1728 | Ga0307409_100024575 | |||
| 1729 | Ga0307416_100108397 | |||
| 1730 | Ga0307416_100140771 | |||
| 1731 | Ga0307411_10030856 | |||
| 1732 | Ga0307411_10092114 | |||
| 1733 | Ga0307415_100012606 | |||
| 1734 | Ga0316212_1001343 | |||
| 1735 | Ga0373926_0004972 | |||
| 1736 | Ga0373926_0010368 | |||
| 1737 | Ga0373926_0015292 | |||
| 1738 | Ga0373923_0022376 | |||
| 1739 | Ga0373923_0059778 | |||
| 1740 | Ga0373923_0106516 | |||
| 1741 | Ga0373936_0000926 | |||
| 1742 | Ga0373936_0011529 | |||
| 1743 | Ga0373936_0081728 | |||
| 1744 | Ga0373945_0001045 | |||
| 1745 | Ga0373945_0007285 | |||
| 1746 | Ga0373953_0031745 | |||
| 1747 | Ga0373954_0001164 | |||
| 1748 | Ga0373954_0001795 | |||
| 1749 | Ga0373954_0021171 | |||
| 1750 | Ga0373954_0066734 | |||
| 1751 | Ga0373956_0008228 | |||
| 1752 | Ga0373956_0020933 | |||
| 1753 | Ga0373957_0038484 | |||
| 1754 | Ga0373943_0000008 | |||
| 1755 | Ga0373943_0001310 | |||
| 1756 | Ga0373943_0001571 | |||
| 1757 | Ga0373943_0012801 | |||
| 1758 | Ga0373943_0094993 | |||
| 1759 | Ga0373943_0112791 | |||
| 1760 | Ga0373946_0001764 | |||
| 1761 | Ga0373946_0005469 | |||
| 1762 | Ga0373946_0008093 | |||
| 1763 | Ga0373946_0015286 | |||
| 1764 | Ga0373955_0004246 | |||
| 1765 | Ga0373955_0033059 | |||
| 1766 | Ga0373924_0037381 | |||
| 1767 | Ga0373935_0001333 | |||
| 1768 | Ga0373935_0003639 | |||
| 1769 | Ga0373935_0009893 | |||
| 1770 | Ga0373935_0011396 | |||
| 1771 | Ga0373935_0012288 | |||
| 1772 | Ga0373935_0024750 | |||
| 1773 | Ga0373935_0060369 | |||
| 1774 | Ga0373935_0231910 | |||
| 1775 | Ga0373927_0000102 | |||
| 1776 | Ga0373927_0000282 | |||
| 1777 | Ga0373927_0004903 | |||
| 1778 | Ga0373927_0010628 | |||
| 1779 | Ga0373927_0016685 | |||
| 1780 | Ga0373927_0019643 | |||
| 1781 | Ga0373927_0020788 | |||
| 1782 | Ga0373933_0006743 | |||
| 1783 | Ga0373933_0029242 | |||
| 1784 | Ga0373933_0117310 | |||
| 1785 | Ga0373947_0000085 | |||
| 1786 | Ga0373947_0003324 | |||
| 1787 | Ga0373947_0003884 | |||
| 1788 | Ga0373947_0006708 | |||
| 1789 | Ga0373947_0116762 | |||
| 1790 | Ga0373937_0001894 | |||
| 1791 | Ga0373937_0002447 | |||
| 1792 | Ga0373937_0005085 | |||
| 1793 | Ga0373937_0011706 | |||
| 1794 | Ga0373937_0038559 | |||
| 1795 | Ga0373937_0083614 | |||
| 1796 | Ga0373937_0220607 | |||
| 1797 | Ga0373937_0580937 | |||
| 1798 | Ga0373925_0001250 | |||
| 1799 | Ga0373925_0001997 | |||
| 1800 | Ga0373925_0004385 | |||
| 1801 | Ga0373925_0005430 | |||
| 1802 | Ga0373925_0006324 | |||
| 1803 | Ga0373925_0008172 | |||
| 1804 | Ga0373925_0009582 | |||
| 1805 | Ga0373925_0022106 | |||
| 1806 | Ga0373925_0027423 | |||
| 1807 | Ga0373925_0195655 | |||
| 1808 | Ga0373925_0198205 | |||
| 1809 | Ga0395900_0389009 | |||
| 1810 | Ga0395898_0018272 | |||
| 1811 | Ga0395905_0052302 | |||
| 1812 | Ga0395905_0222452 | |||
| 1813 | Ga0436364_0111624 | |||
| 1814 | Ga0436364_0800841 | |||
| 1815 | Ga0436364_1031116 | |||
| 1816 | Ga0400483_037104 | |||
| 1817 | Ga0436365_1001330 | |||
| 1818 | Ga0436360_0296885 | |||
| 1819 | Ga0436361_0511551 | |||
| 1820 | Ga0436363_1035544 | |||
| 1821 | Ga0436363_1571670 | |||
| 1822 | Ga0436362_0552319 | |||
| 1823 | Ga0451577_0000523 | |||
| 1824 | Ga0451577_0137874 | |||
| 1825 | Ga0466969_0041440 | |||
| 1826 | Ga0453683_0001517 | |||
| 1827 | Ga0453683_0003698 | |||
| 1828 | Ga0453683_0075830 | |||
| 1829 | Ga0466966_0006612 | |||
| 1830 | Ga0466963_0007856 | |||
| 1831 | Ga0466963_0039646 | |||
| 1832 | Ga0466963_0165055 | |||
| 1833 | Ga0466964_0057564 | |||
| 1834 | Ga0453684_0000951 | |||
| 1835 | Ga0453684_0007605 | |||
| 1836 | Ga0453684_0290717 | |||
| 1837 | Ga0466957_0005729 | |||
| 1838 | Ga0466957_0042258 | |||
| 1839 | Ga0466957_0131339 | |||
| 1840 | Ga0466959_0030420 | |||
| 1841 | Ga0466959_0133235 | |||
| 1842 | Ga0466959_0210256 | |||
| 1843 | Ga0451576_0010527 | |||
| 1844 | Ga0451576_0034449 | |||
| 1845 | Ga0451576_0080028 | |||
| 1846 | Ga0451576_0273611 | |||
| 1847 | Ga0466958_0016272 | |||
| 1848 | Ga0466967_0036308 | |||
| 1849 | Ga0466967_0106794 | |||
| 1850 | Ga0466967_0172547 | |||
| 1851 | Ga0466967_0330482 | |||
| 1852 | Ga0466967_0372808 | |||
| 1853 | Ga0495592_0052904 | |||
| 1854 | Ga0495592_0088598 | |||
| 1855 | Ga0495603_0067613 | |||
| 1856 | Ga0495629_0018762 | |||
| 1857 | Ga0495651_0001954 | |||
| 1858 | Ga0495651_0012679 | |||
| 1859 | Ga0495651_0016421 | |||
| 1860 | Ga0495651_0029697 | |||
| 1861 | Ga0495651_0151062 | |||
| 1862 | Ga0495653_0025083 | |||
| 1863 | Ga0495580_0000345 | |||
| 1864 | Ga0495580_0000603 | |||
| 1865 | Ga0495580_0001544 | |||
| 1866 | Ga0495580_0002140 | |||
| 1867 | Ga0495580_0011670 | |||
| 1868 | Ga0495580_0011687 | |||
| 1869 | Ga0495580_0016391 | |||
| 1870 | Ga0495580_0034691 | |||
| 1871 | Ga0495580_0043314 | |||
| 1872 | Ga0495580_0053894 | |||
| 1873 | Ga0495580_0063084 | |||
| 1874 | Ga0495580_0076385 | |||
| 1875 | Ga0495580_0081695 | |||
| 1876 | Ga0495580_0095575 | |||
| 1877 | Ga0495580_0124499 | |||
| 1878 | Ga0495582_0000622 | |||
| 1879 | Ga0495582_0001976 | |||
| 1880 | Ga0495664_0016600 | |||
| 1881 | Ga0495664_0039253 | |||
| 1882 | Ga0495664_0098607 | |||
| 1883 | Ga0495594_0058971 | |||
| 1884 | Ga0495608_0005808 | |||
| 1885 | Ga0495608_0026115 | |||
| 1886 | Ga0495608_0031296 | |||
| 1887 | Ga0495618_0051470 | |||
| 1888 | Ga0495628_0007555 | |||
| 1889 | Ga0495628_0026495 | |||
| 1890 | Ga0495628_0034642 | |||
| 1891 | Ga0495630_0003848 | |||
| 1892 | Ga0495630_0081791 | |||
| 1893 | Ga0495630_0189669 | |||
| 1894 | Ga0495630_0264763 | |||
| 1895 | Ga0495666_0035186 | |||
| 1896 | Ga0495652_0004346 | |||
| 1897 | Ga0495652_0039044 | |||
| 1898 | Ga0495665_0001833 | |||
| 1899 | Ga0495665_0001960 | |||
| 1900 | Ga0495665_0072920 | |||
| 1901 | Ga0495665_0078394 | |||
| 1902 | Ga0495586_0075562 | |||
| 1903 | Ga0495587_0000442 | |||
| 1904 | Ga0495587_0004541 | |||
| 1905 | Ga0495587_0010761 | |||
| 1906 | Ga0495587_0053780 | |||
| 1907 | Ga0495667_0007526 | |||
| 1908 | Ga0495667_0044689 | |||
| 1909 | Ga0495635_0016351 | |||
| 1910 | Ga0495635_0033122 | |||
| 1911 | Ga0495635_0153091 | |||
| 1912 | Ga0495659_0008336 | |||
| 1913 | Ga0495657_0013658 | |||
| 1914 | Ga0495657_0074612 | |||
| 1915 | Ga0495599_0008189 | |||
| 1916 | Ga0495599_0108798 | |||
| 1917 | Ga0495623_0001371 | |||
| 1918 | Ga0495646_0011292 | |||
| 1919 | Ga0495658_0007843 | |||
| 1920 | Ga0495669_0035913 | |||
| 1921 | Ga0495669_0043013 | |||
| 1922 | Ga0495600_0005598 | |||
| 1923 | Ga0495600_0021037 | |||
| 1924 | Ga0495604_0000979 | |||
| 1925 | Ga0495604_0045188 | |||
| 1926 | Ga0495604_0055899 | |||
| 1927 | Ga0495604_0059116 | |||
| 1928 | Ga0495674_0001505 | |||
| 1929 | Ga0495674_0004208 | |||
| 1930 | Ga0495674_0031174 | |||
| 1931 | Ga0495674_0062055 | |||
| 1932 | Ga0495674_0167501 | |||
| 1933 | Ga0495676_0140941 | |||
| 1934 | Ga0495680_0000547 | |||
| 1935 | Ga0495675_0000027 | |||
| 1936 | Ga0495675_0014852 | |||
| 1937 | Ga0495675_0023510 | |||
| 1938 | Ga0495675_0155111 | |||
| 1939 | Ga0495684_0029877 | |||
| 1940 | Ga0495684_0060295 | |||
| 1941 | Ga0495684_0124963 | |||
| 1942 | Ga0495593_0022382 | |||
| 1943 | Ga0495602_0002605 | |||
| 1944 | Ga0495602_0008897 | |||
| 1945 | Ga0495602_0104366 | |||
| 1946 | Ga0495614_0087577 | |||
| 1947 | Ga0496100_0062003 | |||
| 1948 | Ga0496100_0123429 | |||
| 1949 | Ga0496102_0000786 | |||
| 1950 | Ga0496102_0030087 | |||
| 1951 | Ga0496102_0062839 | |||
| 1952 | Ga0496102_0142404 | |||
| 1953 | Ga0496102_0363525 | |||
| 1954 | Ga0496104_0201121 | |||
| 1955 | Ga0496104_0232464 | |||
| 1956 | Ga0496104_0440221 | |||
| 1957 | Ga0496105_0000399 | |||
| 1958 | Ga0496105_0008491 | |||
| 1959 | Ga0496105_0041633 | |||
| 1960 | Ga0496106_0152843 | |||
| 1961 | Ga0496108_0000629 | |||
| 1962 | Ga0496109_0000270 | |||
| 1963 | Ga0496109_0078788 | |||
| 1964 | Ga0496109_0173966 | |||
| 1965 | Ga0496109_0321638 | |||
| 1966 | Ga0496110_0002501 | |||
| 1967 | Ga0496110_0080645 | |||
| 1968 | Ga0496112_0000121 | |||
| 1969 | Ga0496112_0001114 | |||
| 1970 | Ga0496112_0003512 | |||
| 1971 | Ga0496112_0005362 | |||
| 1972 | Ga0496112_0006571 | |||
| 1973 | Ga0496112_0027881 | |||
| 1974 | Ga0496112_0031725 | |||
| 1975 | Ga0496112_0039232 | |||
| 1976 | Ga0496112_0061570 | |||
| 1977 | Ga0496112_0116729 | |||
| 1978 | Ga0496112_0120908 | |||
| 1979 | Ga0496112_0172253 | |||
| 1980 | Ga0496112_0190516 | |||
| 1981 | Ga0496112_0258193 | |||
| 1982 | Ga0496112_0313136 | |||
| 1983 | Ga0496113_0002775 | |||
| 1984 | Ga0496113_0072803 | |||
| 1985 | Ga0496113_0075589 | |||
| 1986 | Ga0496113_0114865 | |||
| 1987 | Ga0496114_0138203 | |||
| 1988 | Ga0496115_0039011 | |||
| 1989 | Ga0496115_0100120 | |||
| 1990 | Ga0496115_0113427 | |||
| 1991 | Ga0496115_0148247 | |||
| 1992 | Ga0496115_0278163 | |||
| 1993 | Ga0501032_0005704 | |||
| 1994 | Ga0501033_0037420 | |||
| 1995 | Ga0501034_0130187 | |||
| 1996 | Ga0501034_0215273 | |||
| 1997 | Ga0501036_0114081 | |||
| 1998 | Ga0501037_0009000 | |||
| 1999 | Ga0501038_0251947 | |||
| 2000 | Ga0501040_0049459 | |||
| 2001 | Ga0501043_0009517 | |||
| 2002 | Ga0501047_0017578 | |||
| 2003 | Ga0501048_0006576 | |||
| 2004 | Ga0501068_0001225 | |||
| 2005 | Ga0501070_0010893 | |||
| 2006 | Ga0501072_0001261 | |||
| 2007 | Ga0501073_0002323 | |||
| 2008 | Ga0501074_0012760 | |||
| 2009 | Ga0501076_0071055 | |||
| 2010 | Ga0501077_0012602 | |||
| 2011 | Ga0501257_016927 | |||
| 2012 | Ga0501080_0000017 | |||
| 2013 | Ga0501268_003670 | |||
| 2014 | Ga0501270_006070 | |||
| 2015 | Ga0501035_0029617 | |||
| 2016 | Ga0501044_0010324 | |||
| 2017 | Ga0501044_0025922 | |||
| 2018 | nmdc:mga05p37_339084_c1 | |||
| 2019 | nmdc:mga09592_87263_c1 | |||
| 2020 | nmdc:mga0n895_1177_c1 | |||
| 2021 | nmdc:mga0n895_184695_c1 | |||
| 2022 | nmdc:mga0n895_299932_c1 | |||
| 2023 | nmdc:mga0n895_62884_c1 | |||
| 2024 | nmdc:mga0n895_92004_c1 | |||
| 2025 | nmdc:mga0rr50_18350_c1 | |||
| 2026 | nmdc:mga08x19_131676_c1 | |||
| 2027 | nmdc:mga08x19_134_c1 | |||
| 2028 | nmdc:mga08x19_20953_c1 | |||
| 2029 | nmdc:mga08x19_2332_c1 | |||
| 2030 | nmdc:mga08x19_26514_c1 | |||
| 2031 | nmdc:mga08x19_5825_c2 | |||
| 2032 | nmdc:mga08x19_6467_c1 | |||
| 2033 | nmdc:mga08x19_7445_c1 | |||
| 2034 | nmdc:mga0a205_109175_c1 | |||
| 2035 | nmdc:mga0a205_8182_c1 | |||
| 2036 | Ga0495601_0001642 | |||
| 2037 | Ga0495601_0015532 | |||
| 2038 | Ga0495612_0002730 | |||
| 2039 | Ga0495619_0003442 | |||
| 2040 | 2673165357 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xev-assembly1.cif.gz_A-2 | crystal structure of a novel xaa-pro dipeptidase from deinococcus radiodurans | 0.9288 | 14 | 398 |
| 5xev-assembly1.cif.gz_A-2 | crystal structure of a novel xaa-pro dipeptidase from deinococcus radiodurans | 0.8909 | 14 | 398 |
| 3s6b-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase 1b from plasmodium falciparum, pf10_0150 | 0.8026 | 153 | 396 |
| 4a6v-assembly1.cif.gz_A | x-ray structures of oxazole hydroxamate ecmetap-mn complexes | 0.7901 | 153 | 397 |
| 8p2k-assembly1.cif.gz_MA | ternary complex of translating ribosome, nac and metap1 | 0.778 | 153 | 397 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHS7_144_374_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9117 | 154 | 400 | 3.90.230.10 |
| 2howB02 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9064 | 155 | 401 | 3.90.230.10 |
| 5cdlA02 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9055 | 154 | 397 | 3.90.230.10 |
| 1wy2A02 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9032 | 155 | 399 | 3.90.230.10 |
| 2howB02 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.8987 | 155 | 401 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7V5U3-F1-model_v4 | Peptidase M24 domain-containing protein | 0.9975 | 14 | 401 |
|
| AF-Q1IIU2-F1-model_v4 | Peptidase M24 | 0.9957 | 14 | 401 |
|
| AF-A0A1Q7V5U3-F1-model_v4 | Peptidase M24 domain-containing protein | 0.995 | 14 | 401 |
|
| AF-A0A7C7LAW6-F1-model_v4 | Aminopeptidase P family protein | 0.9936 | 200 | 401 |
GO:0004177
|
| AF-Q1IIU2-F1-model_v4 | Peptidase M24 | 0.9932 | 14 | 401 |
|