F488363

General Info

Members Datasets Scaffolds Average Seq Length
1020 321 2040 391

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10000432|Ga0070709_1000043219
Length 477
Sequence VRDVTGRDTEEGVGKVVGLALSLSPLPIQRGQVRQFSRAYGTGSSFCTLPASELVGYFQSSLRDFPCVLVTSFCLFAQIGALVYNRRLPMDLPAIQSALRQRNIDAWLFYDHHHRDPIAYRVLGLPASLMVTRRWFYLIPADGEPVKLVHKIEAGHLDSLPGQKHQYSGWQELFDKLKSILAKHLDLAMQYSPNNSVFTVSLVDGGTIDLLRGLGKNIVSSADLVAQFESTWSDEQIASHFAARDSIDSIVTEAFKEIGKRVRNGGTKEHEIQQWFMEAFGRENLVTDDPPIVAVNSNAGNPHYEPHASHPVAIHEGDVVLLDVWGKKNTPNAVYYDITWMGFVGGVPSDRMREVFEIVRDARDTGVKTVLDAVSAGRRLAGWEVDRATRGHIKKAGYGDYFIHRTGHSIGTDVHSNGANMDDLEIHDERQILPNSCFSIEPGIYLPEFGVRSEVNVLVRAKSAEVTGKIQREIVTI

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
115 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
116 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
175 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
176 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
188 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
222 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
230 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
231 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
309 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.39
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.51
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 20.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10000432 3300005434 Bacteria 25363
2 JGI24752J21851_1004863 3300001976 Bacteria 1755
3 JGI24751J29686_10000897 3300002459 Bacteria 6802
4 Ga0065712_10004139 3300005290 Bacteria 3364
5 Ga0065712_10158652 3300005290 Bacteria 1318
6 Ga0065715_10091689 3300005293 Bacteria 5616
7 Ga0070658_10046918 3300005327 Bacteria 3496
8 Ga0070658_10260746 3300005327 Unclassified 1472
9 Ga0070683_100008827 3300005329 Bacteria 8576
10 Ga0070683_100011670 3300005329 Bacteria 7608
11 Ga0070683_100046216 3300005329 Bacteria 4021
12 Ga0070683_100109881 3300005329 Bacteria 2600
13 Ga0070670_100024685 3300005331 Bacteria 5170
14 Ga0070670_100031846 3300005331 Bacteria 4541
15 Ga0070677_10013649 3300005333 Bacteria 2846
16 Ga0068869_100004860 3300005334 Bacteria 8397
17 Ga0068869_100029145 3300005334 Bacteria 3864
18 Ga0070680_100115449 3300005336 Unclassified 2237
19 Ga0070682_100078877 3300005337 Unclassified 2125
20 Ga0068868_100008270 3300005338 Bacteria 7450
21 Ga0068868_100009121 3300005338 Bacteria 7122
22 Ga0068868_100012948 3300005338 Bacteria 6102
23 Ga0068868_100019125 3300005338 Bacteria 5130
24 Ga0068868_100038646 3300005338 Bacteria 3705
25 Ga0070660_100001606 3300005339 Bacteria 15529
26 Ga0070660_100026499 3300005339 Bacteria 4316
27 Ga0070660_100159785 3300005339 Unclassified 1815
28 Ga0070689_100050268 3300005340 Bacteria 3220
29 Ga0070687_100016278 3300005343 Bacteria 3387
30 Ga0070687_100099232 3300005343 Bacteria 1627
31 Ga0070661_100006213 3300005344 Bacteria 8237
32 Ga0070661_100060104 3300005344 Unclassified 2788
33 Ga0070668_100007447 3300005347 Bacteria 8122
34 Ga0070668_100038070 3300005347 Bacteria 3674
35 Ga0070669_100003780 3300005353 Bacteria 10935
36 Ga0070675_100020211 3300005354 Bacteria 5313
37 Ga0070671_100148002 3300005355 Unclassified 1983
38 Ga0070673_100023574 3300005364 Bacteria 4498
39 Ga0070688_100002957 3300005365 Bacteria 8661
40 Ga0070688_100172668 3300005365 Bacteria 1493
41 Ga0070659_100001742 3300005366 Bacteria 15639
42 Ga0070659_100016657 3300005366 Bacteria 5520
43 Ga0070709_10000508 3300005434 Bacteria 22982
44 Ga0070709_10007729 3300005434 Bacteria 5903
45 Ga0070709_10029627 3300005434 Bacteria 3276
46 Ga0070709_10116272 3300005434 Bacteria 1805
47 Ga0070709_10126818 3300005434 Bacteria 1737
48 Ga0070714_100000027 3300005435 Bacteria 141750
49 Ga0070714_100000184 3300005435 Bacteria 49943
50 Ga0070714_100001883 3300005435 Bacteria 15309
51 Ga0070714_100004724 3300005435 Bacteria 10307
52 Ga0070714_100017233 3300005435 Bacteria 5849
53 Ga0070714_100049322 3300005435 Unclassified 3583
54 Ga0070714_100183635 3300005435 Unclassified 1904
55 Ga0070713_100000134 3300005436 Bacteria 48639
56 Ga0070713_100000441 3300005436 Bacteria 26508
57 Ga0070713_100000879 3300005436 Bacteria 19266
58 Ga0070713_100020017 3300005436 Bacteria 5122
59 Ga0070713_100028094 3300005436 Bacteria 4439
60 Ga0070713_100035469 3300005436 Unclassified 4015
61 Ga0070713_100044369 3300005436 Bacteria 3639
62 Ga0070713_100061634 3300005436 Bacteria 3139
63 Ga0070713_100095893 3300005436 Bacteria 2560
64 Ga0070713_100193824 3300005436 Unclassified 1832
65 Ga0070710_10001549 3300005437 Bacteria 10861
66 Ga0070710_10008124 3300005437 Bacteria 5102
67 Ga0070710_10021015 3300005437 Bacteria 3396
68 Ga0070710_10029050 3300005437 Bacteria 2963
69 Ga0070710_10040104 3300005437 Bacteria 2580
70 Ga0070710_10041452 3300005437 Unclassified 2542
71 Ga0070711_100000271 3300005439 Bacteria 26787
72 Ga0070711_100012239 3300005439 Bacteria 5355
73 Ga0070711_100012311 3300005439 Bacteria 5337
74 Ga0070711_100025957 3300005439 Bacteria 3836
75 Ga0070711_100029928 3300005439 Bacteria 3599
76 Ga0070711_100053924 3300005439 Bacteria 2773
77 Ga0070711_100058074 3300005439 Bacteria 2681
78 Ga0070711_100070019 3300005439 Unclassified 2469
79 Ga0070711_100084480 3300005439 Unclassified 2271
80 Ga0070711_100111319 3300005439 Bacteria 2010
81 Ga0070711_100244993 3300005439 Unclassified 1403
82 Ga0070708_100000459 3300005445 Bacteria 30632
83 Ga0070708_100001910 3300005445 Bacteria 16037
84 Ga0070708_100001941 3300005445 Bacteria 15960
85 Ga0070708_100008503 3300005445 Bacteria 8246
86 Ga0070708_100013871 3300005445 Bacteria 6618
87 Ga0070708_100017136 3300005445 Bacteria 6033
88 Ga0070708_100026105 3300005445 Unclassified 4997
89 Ga0070708_100027364 3300005445 Bacteria 4892
90 Ga0070708_100032166 3300005445 Bacteria 4547
91 Ga0070708_100037870 3300005445 Bacteria 4210
92 Ga0070708_100108325 3300005445 Unclassified 2551
93 Ga0070708_100408057 3300005445 Bacteria 1281
94 Ga0070663_100006254 3300005455 Bacteria 7140
95 Ga0070678_100070011 3300005456 Unclassified 2621
96 Ga0070662_100004877 3300005457 Bacteria 8511
97 Ga0070662_100005317 3300005457 Bacteria 8223
98 Ga0070662_100043573 3300005457 Bacteria 3212
99 Ga0070662_100161054 3300005457 Bacteria 1755
100 Ga0070662_100211842 3300005457 Unclassified 1542
101 Ga0070681_10000242 3300005458 Bacteria 43180
102 Ga0070681_10004600 3300005458 Bacteria 13176
103 Ga0070681_10018211 3300005458 Bacteria 7022
104 Ga0070681_10023295 3300005458 Bacteria 6227
105 Ga0070681_10027456 3300005458 Bacteria 5723
106 Ga0070681_10154975 3300005458 Bacteria 2216
107 Ga0070681_10166720 3300005458 Bacteria 2125
108 Ga0070681_10173076 3300005458 Bacteria 2080
109 Ga0070681_10214782 3300005458 Unclassified 1840
110 Ga0070681_10232388 3300005458 Unclassified 1758
111 Ga0070681_10260341 3300005458 Unclassified 1647
112 Ga0070685_10001931 3300005466 Bacteria 10760
113 Ga0070706_100000278 3300005467 Bacteria 62365
114 Ga0070706_100000514 3300005467 Bacteria 45375
115 Ga0070706_100001354 3300005467 Bacteria 26044
116 Ga0070706_100002109 3300005467 Bacteria 20248
117 Ga0070706_100003323 3300005467 Bacteria 15875
118 Ga0070706_100012428 3300005467 Bacteria 7889
119 Ga0070706_100015679 3300005467 Bacteria 7000
120 Ga0070706_100017419 3300005467 Bacteria 6630
121 Ga0070706_100078384 3300005467 Bacteria 3059
122 Ga0070706_100080578 3300005467 Unclassified 3015
123 Ga0070707_100000162 3300005468 Bacteria 63928
124 Ga0070707_100000662 3300005468 Bacteria 34318
125 Ga0070707_100008218 3300005468 Bacteria 9680
126 Ga0070707_100009330 3300005468 Bacteria 9107
127 Ga0070707_100012541 3300005468 Bacteria 7916
128 Ga0070707_100013183 3300005468 Bacteria 7728
129 Ga0070707_100029144 3300005468 Bacteria 5255
130 Ga0070707_100051085 3300005468 Bacteria 3963
131 Ga0070707_100156588 3300005468 Bacteria 2219
132 Ga0070707_100184797 3300005468 Unclassified 2032
133 Ga0070707_100238809 3300005468 Bacteria 1769
134 Ga0070707_100310089 3300005468 Bacteria 1534
135 Ga0070707_100327402 3300005468 Unclassified 1489
136 Ga0070698_100000133 3300005471 Bacteria 65381
137 Ga0070698_100001945 3300005471 Bacteria 22939
138 Ga0070698_100002043 3300005471 Bacteria 22426
139 Ga0070698_100011544 3300005471 Bacteria 9370
140 Ga0070698_100025166 3300005471 Bacteria 6202
141 Ga0070698_100039029 3300005471 Bacteria 4890
142 Ga0070698_100041613 3300005471 Unclassified 4717
143 Ga0070698_100141600 3300005471 Bacteria 2356
144 Ga0070698_100315601 3300005471 Bacteria 1494
145 Ga0070699_100000441 3300005518 Bacteria 39851
146 Ga0070699_100002709 3300005518 Bacteria 15794
147 Ga0070699_100009252 3300005518 Bacteria 8537
148 Ga0070699_100046551 3300005518 Bacteria 3753
149 Ga0070699_100091033 3300005518 Bacteria 2667
150 Ga0070679_100047020 3300005530 Bacteria 4302
151 Ga0070679_100079417 3300005530 Bacteria 3270
152 Ga0070679_100161616 3300005530 Unclassified 2214
153 Ga0070679_100176140 3300005530 Unclassified 2111
154 Ga0070679_100185428 3300005530 Bacteria 2051
155 Ga0070684_100001890 3300005535 Bacteria 15344
156 Ga0070684_100048290 3300005535 Unclassified 3692
157 Ga0070684_100150375 3300005535 Unclassified 2109
158 Ga0070684_100183381 3300005535 Unclassified 1903
159 Ga0070697_100000049 3300005536 Bacteria 90362
160 Ga0070697_100000158 3300005536 Bacteria 55228
161 Ga0070697_100001854 3300005536 Bacteria 16151
162 Ga0070697_100002751 3300005536 Bacteria 13543
163 Ga0070697_100004513 3300005536 Bacteria 10700
164 Ga0070697_100007545 3300005536 Bacteria 8469
165 Ga0070697_100008726 3300005536 Bacteria 7915
166 Ga0070697_100010636 3300005536 Bacteria 7179
167 Ga0070697_100011265 3300005536 Bacteria 6988
168 Ga0070697_100020538 3300005536 Bacteria 5226
169 Ga0070697_100039836 3300005536 Bacteria 3800
170 Ga0070697_100047034 3300005536 Bacteria 3499
171 Ga0068853_100006695 3300005539 Bacteria 9179
172 Ga0068853_100030598 3300005539 Unclassified 4548
173 Ga0068853_100107639 3300005539 Unclassified 2472
174 Ga0068853_100128952 3300005539 Bacteria 2262
175 Ga0068853_100175047 3300005539 Bacteria 1943
176 Ga0070686_100001751 3300005544 Bacteria 12151
177 Ga0070695_100042489 3300005545 Unclassified 2886
178 Ga0070695_100155403 3300005545 Bacteria 1600
179 Ga0070696_100043518 3300005546 Bacteria 3107
180 Ga0070693_100013310 3300005547 Bacteria 4188
181 Ga0070693_100051240 3300005547 Unclassified 2363
182 Ga0070693_100088047 3300005547 Bacteria 1866
183 Ga0070665_100314111 3300005548 Bacteria 1571
184 Ga0070704_100104740 3300005549 Unclassified 2140
185 Ga0068855_100000722 3300005563 Bacteria 40559
186 Ga0068855_100012781 3300005563 Bacteria 10127
187 Ga0068855_100016183 3300005563 Bacteria 8967
188 Ga0068855_100053103 3300005563 Bacteria 4769
189 Ga0068855_100107023 3300005563 Bacteria 3213
190 Ga0068855_100124918 3300005563 Unclassified 2942
191 Ga0068855_100173193 3300005563 Bacteria 2443
192 Ga0068855_100173553 3300005563 Unclassified 2440
193 Ga0070664_100002060 3300005564 Bacteria 16060
194 Ga0070664_100044027 3300005564 Unclassified 3768
195 Ga0070664_100124316 3300005564 Unclassified 2262
196 Ga0070664_100146293 3300005564 Unclassified 2084
197 Ga0070664_100194278 3300005564 Bacteria 1809
198 Ga0070664_100326989 3300005564 Archaea 1390
199 Ga0068857_100005616 3300005577 Bacteria 10721
200 Ga0068857_100006773 3300005577 Bacteria 9858
201 Ga0068857_100011308 3300005577 Bacteria 7766
202 Ga0068857_100085631 3300005577 Bacteria 2817
203 Ga0068857_100165562 3300005577 Unclassified 2008
204 Ga0068857_100223203 3300005577 Unclassified 1722
205 Ga0068854_100004626 3300005578 Bacteria 8679
206 Ga0068854_100008281 3300005578 Bacteria 6674
207 Ga0068854_100074203 3300005578 Unclassified 2495
208 Ga0068854_100092306 3300005578 Archaea 2255
209 Ga0068856_100000893 3300005614 Bacteria 31927
210 Ga0068856_100001601 3300005614 Bacteria 23661
211 Ga0068856_100010172 3300005614 Bacteria 9144
212 Ga0068856_100010354 3300005614 Bacteria 9057
213 Ga0068856_100015035 3300005614 Bacteria 7474
214 Ga0068856_100036173 3300005614 Unclassified 4841
215 Ga0068856_100047478 3300005614 Unclassified 4229
216 Ga0068856_100052651 3300005614 Unclassified 4015
217 Ga0068856_100064506 3300005614 Bacteria 3619
218 Ga0068856_100131638 3300005614 Bacteria 2506
219 Ga0068856_100175913 3300005614 Unclassified 2152
220 Ga0070702_100145151 3300005615 Unclassified 1516
221 Ga0068852_100023791 3300005616 Bacteria 4938
222 Ga0068852_100039220 3300005616 Bacteria 3987
223 Ga0068852_100146592 3300005616 Unclassified 2190
224 Ga0068852_100369330 3300005616 Bacteria 1405
225 Ga0068852_100382170 3300005616 Unclassified 1381
226 Ga0068859_100001851 3300005617 Bacteria 21505
227 Ga0068859_100015642 3300005617 Bacteria 7623
228 Ga0068859_100398256 3300005617 Unclassified 1472
229 Ga0068864_100007801 3300005618 Bacteria 8816
230 Ga0068864_100060510 3300005618 Bacteria 3279
231 Ga0068861_100143962 3300005719 Unclassified 1949
232 Ga0068861_100177701 3300005719 Unclassified 1769
233 Ga0068851_10003046 3300005834 Bacteria 7410
234 Ga0068863_100012969 3300005841 Bacteria 8036
235 Ga0068863_100027438 3300005841 Bacteria 5431
236 Ga0068863_100133908 3300005841 Bacteria 2367
237 Ga0068863_100314847 3300005841 Unclassified 1520
238 Ga0068858_100001619 3300005842 Bacteria 22968
239 Ga0068858_100025079 3300005842 Bacteria 5549
240 Ga0068858_100031852 3300005842 Bacteria 4900
241 Ga0068858_100041927 3300005842 Unclassified 4243
242 Ga0068858_100048554 3300005842 Unclassified 3932
243 Ga0068858_100123171 3300005842 Unclassified 2426
244 Ga0068860_100005894 3300005843 Bacteria 12335
245 Ga0068860_100018451 3300005843 Bacteria 6786
246 Ga0068860_100073782 3300005843 Bacteria 3244
247 Ga0068862_100032620 3300005844 Bacteria 4401
248 Ga0081455_10061639 3300005937 Bacteria 3155
249 Ga0070717_10001639 3300006028 Bacteria 15558
250 Ga0070717_10001941 3300006028 Bacteria 14430
251 Ga0070717_10002497 3300006028 Bacteria 12985
252 Ga0070717_10005344 3300006028 Bacteria 9364
253 Ga0070717_10008691 3300006028 Bacteria 7599
254 Ga0070717_10011648 3300006028 Bacteria 6688
255 Ga0070717_10032983 3300006028 Bacteria 4176
256 Ga0070717_10033339 3300006028 Bacteria 4155
257 Ga0070717_10043538 3300006028 Bacteria 3665
258 Ga0070717_10071121 3300006028 Unclassified 2901
259 Ga0070717_10076602 3300006028 Unclassified 2800
260 Ga0070717_10076804 3300006028 Bacteria 2796
261 Ga0070717_10081193 3300006028 Bacteria 2722
262 Ga0070717_10099431 3300006028 Bacteria 2468
263 Ga0070717_10151762 3300006028 Bacteria 2005
264 Ga0070717_10162221 3300006028 Bacteria 1940
265 Ga0070717_10264590 3300006028 Bacteria 1522
266 Ga0070715_10003006 3300006163 Bacteria 5274
267 Ga0070715_10006826 3300006163 Bacteria 3897
268 Ga0070715_10012101 3300006163 Unclassified 3127
269 Ga0070715_10013490 3300006163 Bacteria 3004
270 Ga0070716_100003540 3300006173 Bacteria 7367
271 Ga0070716_100022292 3300006173 Unclassified 3346
272 Ga0070716_100034652 3300006173 Unclassified 2770
273 Ga0070716_100065548 3300006173 Bacteria 2116
274 Ga0070716_100090934 3300006173 Unclassified 1847
275 Ga0070712_100000190 3300006175 Bacteria 34163
276 Ga0070712_100000262 3300006175 Bacteria 29465
277 Ga0070712_100000618 3300006175 Bacteria 20900
278 Ga0070712_100002390 3300006175 Bacteria 11557
279 Ga0070712_100011797 3300006175 Bacteria 5553
280 Ga0070712_100015567 3300006175 Bacteria 4904
281 Ga0070712_100147515 3300006175 Bacteria 1802
282 Ga0070712_100315744 3300006175 Bacteria 1269
283 Ga0097621_100000058 3300006237 Bacteria 58363
284 Ga0097621_100014488 3300006237 Bacteria 5901
285 Ga0097621_100206138 3300006237 Bacteria 1708
286 Ga0068871_100000167 3300006358 Bacteria 43972
287 Ga0068871_100000727 3300006358 Bacteria 22355
288 Ga0068871_100001129 3300006358 Bacteria 17928
289 Ga0068871_100016962 3300006358 Bacteria 5499
290 Ga0068871_100077021 3300006358 Bacteria 2755
291 Ga0068871_100085050 3300006358 Bacteria 2625
292 Ga0075428_100134548 3300006844 Bacteria 2688
293 Ga0075428_100193881 3300006844 Bacteria 2197
294 Ga0075430_100014045 3300006846 Bacteria 6827
295 Ga0075430_100080466 3300006846 Bacteria 2729
296 Ga0075431_100017050 3300006847 Bacteria 7378
297 Ga0075433_10000257 3300006852 Bacteria 30832
298 Ga0075433_10014530 3300006852 Bacteria 6437
299 Ga0075433_10127020 3300006852 Bacteria 2265
300 Ga0075433_10243814 3300006852 Unclassified 1595
301 Ga0075434_100000242 3300006871 Bacteria 38087
302 Ga0075434_100001845 3300006871 Bacteria 18284
303 Ga0075434_100033911 3300006871 Bacteria 5040
304 Ga0075434_100138960 3300006871 Bacteria 2449
305 Ga0075434_100207399 3300006871 Bacteria 1981
306 Ga0075429_100008079 3300006880 Bacteria 9145
307 Ga0075429_100090864 3300006880 Bacteria 2663
308 Ga0068865_100027677 3300006881 Unclassified 3747
309 Ga0068865_100068029 3300006881 Bacteria 2517
310 Ga0068865_100106064 3300006881 Archaea 2065
311 Ga0075436_100000404 3300006914 Bacteria 27840
312 Ga0075436_100001900 3300006914 Bacteria 14350
313 Ga0075436_100013914 3300006914 Bacteria 5510
314 Ga0075436_100045105 3300006914 Unclassified 3041
315 Ga0097620_100001850 3300006931 Bacteria 21505
316 Ga0097620_100015642 3300006931 Bacteria 7623
317 Ga0097620_100398241 3300006931 Unclassified 1472
318 Ga0075435_100000202 3300007076 Bacteria 35945
319 Ga0099794_10090505 3300007265 Bacteria 1518
320 Ga0105240_10000325 3300009093 Bacteria 90079
321 Ga0105240_10001005 3300009093 Bacteria 50335
322 Ga0105240_10017855 3300009093 Bacteria 9546
323 Ga0105240_10063714 3300009093 Bacteria 4584
324 Ga0105240_10076445 3300009093 Unclassified 4128
325 Ga0105240_10103666 3300009093 Unclassified 3455
326 Ga0105240_10134963 3300009093 Bacteria 2956
327 Ga0105240_10167481 3300009093 Unclassified 2605
328 Ga0105240_10172186 3300009093 Unclassified 2563
329 Ga0105240_10179636 3300009093 Bacteria 2498
330 Ga0105240_10227366 3300009093 Bacteria 2170
331 Ga0105240_10381162 3300009093 Bacteria 1593
332 Ga0105240_10391296 3300009093 Bacteria 1568
333 Ga0105245_10004451 3300009098 Bacteria 12389
334 Ga0105245_10015530 3300009098 Bacteria 6640
335 Ga0105245_10016248 3300009098 Bacteria 6488
336 Ga0105245_10076932 3300009098 Bacteria 3041
337 Ga0105247_10018578 3300009101 Bacteria 4171
338 Ga0105247_10127642 3300009101 Bacteria 1654
339 Ga0114129_10028780 3300009147 Bacteria 7872
340 Ga0114129_10108973 3300009147 Unclassified 3823
341 Ga0105241_10001007 3300009174 Bacteria 21393
342 Ga0105241_10028094 3300009174 Bacteria 4189
343 Ga0105241_10057414 3300009174 Bacteria 2986
344 Ga0105241_10142388 3300009174 Bacteria 1954
345 Ga0105242_10009165 3300009176 Bacteria 7598
346 Ga0105248_10011618 3300009177 Bacteria 9700
347 Ga0105248_10022438 3300009177 Bacteria 7000
348 Ga0105248_10028192 3300009177 Bacteria 6253
349 Ga0105248_10046865 3300009177 Bacteria 4847
350 Ga0105248_10235426 3300009177 Unclassified 2061
351 Ga0105237_10011001 3300009545 Bacteria 9604
352 Ga0105237_10014737 3300009545 Bacteria 8160
353 Ga0105237_10026897 3300009545 Bacteria 5879
354 Ga0105237_10069355 3300009545 Unclassified 3521
355 Ga0105237_10122178 3300009545 Bacteria 2598
356 Ga0105237_10171513 3300009545 Bacteria 2169
357 Ga0105237_10186769 3300009545 Bacteria 2073
358 Ga0105238_10048523 3300009551 Unclassified 4278
359 Ga0105238_10065612 3300009551 Unclassified 3632
360 Ga0105238_10107866 3300009551 Unclassified 2765
361 Ga0105249_10013908 3300009553 Bacteria 7114
362 Ga0099796_10005480 3300010159 Unclassified 3172
363 Ga0105239_10044409 3300010375 Bacteria 4872
364 Ga0105239_10200638 3300010375 Unclassified 2235
365 Ga0105239_10323484 3300010375 Bacteria 1739
366 Ga0105239_10469151 3300010375 Unclassified 1429
367 Ga0105246_10055304 3300011119 Bacteria 2738
368 Ga0157373_10003057 3300013100 Bacteria 12628
369 Ga0157373_10013678 3300013100 Bacteria 5950
370 Ga0157373_10066725 3300013100 Bacteria 2545
371 Ga0157373_10101656 3300013100 Bacteria 2022
372 Ga0157373_10128502 3300013100 Unclassified 1782
373 Ga0157371_10002264 3300013102 Bacteria 18550
374 Ga0157371_10072161 3300013102 Unclassified 2445
375 Ga0157370_10142808 3300013104 Unclassified 2230
376 Ga0157370_10198346 3300013104 Bacteria 1862
377 Ga0157369_10000592 3300013105 Bacteria 47171
378 Ga0157369_10003003 3300013105 Bacteria 20180
379 Ga0157369_10005867 3300013105 Bacteria 14265
380 Ga0157369_10015743 3300013105 Bacteria 8521
381 Ga0157369_10105538 3300013105 Unclassified 3000
382 Ga0157369_10122337 3300013105 Bacteria 2760
383 Ga0157369_10175553 3300013105 Bacteria 2256
384 Ga0157374_10000181 3300013296 Bacteria 58388
385 Ga0157374_10002512 3300013296 Bacteria 15478
386 Ga0157374_10003490 3300013296 Bacteria 13213
387 Ga0157374_10005598 3300013296 Bacteria 10581
388 Ga0157374_10007938 3300013296 Bacteria 9064
389 Ga0157374_10008005 3300013296 Bacteria 9037
390 Ga0157374_10048161 3300013296 Bacteria 3955
391 Ga0157374_10097761 3300013296 Bacteria 2810
392 Ga0157374_10109973 3300013296 Bacteria 2650
393 Ga0157374_10119686 3300013296 Unclassified 2540
394 Ga0157374_10248561 3300013296 Unclassified 1750
395 Ga0157378_10000351 3300013297 Bacteria 45196
396 Ga0157378_10000680 3300013297 Bacteria 31989
397 Ga0157378_10002074 3300013297 Bacteria 17939
398 Ga0157378_10007912 3300013297 Bacteria 9274
399 Ga0157378_10032836 3300013297 Unclassified 4588
400 Ga0163162_10002555 3300013306 Bacteria 17229
401 Ga0163162_10004210 3300013306 Bacteria 13826
402 Ga0163162_10019239 3300013306 Bacteria 6695
403 Ga0163162_10037123 3300013306 Unclassified 4860
404 Ga0163162_10348938 3300013306 Bacteria 1613
405 Ga0157372_10001790 3300013307 Bacteria 23336
406 Ga0157372_10004337 3300013307 Bacteria 15162
407 Ga0157372_10005053 3300013307 Bacteria 14015
408 Ga0157372_10009344 3300013307 Bacteria 10434
409 Ga0157372_10024941 3300013307 Bacteria 6499
410 Ga0157372_10060773 3300013307 Unclassified 4228
411 Ga0157372_10128283 3300013307 Bacteria 2917
412 Ga0157372_10257754 3300013307 Bacteria 2025
413 Ga0157375_10140664 3300013308 Bacteria 2540
414 Ga0163163_10001815 3300014325 Bacteria 18011
415 Ga0163163_10004099 3300014325 Bacteria 12433
416 Ga0163163_10028700 3300014325 Bacteria 5347
417 Ga0163163_10029712 3300014325 Bacteria 5260
418 Ga0163163_10036969 3300014325 Bacteria 4747
419 Ga0157380_10019901 3300014326 Bacteria 5008
420 Ga0182008_10005863 3300014497 Bacteria 6941
421 Ga0182008_10019030 3300014497 Unclassified 3550
422 Ga0157377_10004842 3300014745 Bacteria 6260
423 Ga0157379_10007009 3300014968 Bacteria 9742
424 Ga0157379_10028378 3300014968 Bacteria 4978
425 Ga0157379_10101371 3300014968 Unclassified 2584
426 Ga0157376_10017528 3300014969 Bacteria 5466
427 Ga0157376_10024032 3300014969 Unclassified 4779
428 Ga0157376_10038962 3300014969 Bacteria 3871
429 Ga0157376_10062314 3300014969 Bacteria 3138
430 Ga0182005_1012321 3300015265 Unclassified 2417
431 Ga0163161_10028230 3300017792 Bacteria 3984
432 Ga0206350_10321460 3300020080 Unclassified 4100
433 Ga0213875_10015997 3300021388 Bacteria 3643
434 Ga0213875_10053330 3300021388 Bacteria 1893
435 Ga0224569_100109 3300022732 Bacteria 5745
436 Ga0224572_1000176 3300024225 Bacteria 5867
437 Ga0224572_1004882 3300024225 Bacteria 2364
438 Ga0228598_1000307 3300024227 Bacteria 9559
439 Ga0228598_1000403 3300024227 Bacteria 8753
440 Ga0228598_1003454 3300024227 Bacteria 3399
441 Ga0207682_10018935 3300025893 Bacteria 2694
442 Ga0207692_10002000 3300025898 Bacteria 7789
443 Ga0207692_10003777 3300025898 Bacteria 5947
444 Ga0207688_10018778 3300025901 Bacteria 3761
445 Ga0207685_10007955 3300025905 Unclassified 2990
446 Ga0207685_10012888 3300025905 Unclassified 2568
447 Ga0207685_10018117 3300025905 Unclassified 2292
448 Ga0207685_10049676 3300025905 Bacteria 1612
449 Ga0207699_10000209 3300025906 Bacteria 34945
450 Ga0207699_10001910 3300025906 Bacteria 9817
451 Ga0207699_10034606 3300025906 Bacteria 2867
452 Ga0207699_10122246 3300025906 Bacteria 1686
453 Ga0207699_10139490 3300025906 Unclassified 1592
454 Ga0207645_10001689 3300025907 Bacteria 17919
455 Ga0207643_10002573 3300025908 Bacteria 9824
456 Ga0207705_10101398 3300025909 Bacteria 2117
457 Ga0207684_10000614 3300025910 Bacteria 42486
458 Ga0207684_10001674 3300025910 Bacteria 23538
459 Ga0207684_10001907 3300025910 Bacteria 21656
460 Ga0207684_10001969 3300025910 Bacteria 21216
461 Ga0207684_10006371 3300025910 Bacteria 10759
462 Ga0207684_10008375 3300025910 Bacteria 9191
463 Ga0207684_10011025 3300025910 Archaea 7921
464 Ga0207684_10014168 3300025910 Unclassified 6881
465 Ga0207684_10020974 3300025910 Bacteria 5580
466 Ga0207684_10035114 3300025910 Bacteria 4257
467 Ga0207654_10022720 3300025911 Bacteria 3350
468 Ga0207654_10042456 3300025911 Bacteria 2574
469 Ga0207707_10001674 3300025912 Bacteria 20441
470 Ga0207707_10003911 3300025912 Bacteria 13216
471 Ga0207707_10036898 3300025912 Bacteria 4271
472 Ga0207707_10102144 3300025912 Unclassified 2506
473 Ga0207707_10122815 3300025912 Bacteria 2271
474 Ga0207707_10127238 3300025912 Unclassified 2228
475 Ga0207707_10150162 3300025912 Bacteria 2037
476 Ga0207695_10004906 3300025913 Bacteria 18024
477 Ga0207695_10022194 3300025913 Bacteria 7217
478 Ga0207695_10047565 3300025913 Unclassified 4537
479 Ga0207695_10066809 3300025913 Bacteria 3691
480 Ga0207695_10166797 3300025913 Unclassified 2130
481 Ga0207695_10198777 3300025913 Bacteria 1920
482 Ga0207695_10307483 3300025913 Bacteria 1476
483 Ga0207671_10007474 3300025914 Bacteria 9478
484 Ga0207671_10028761 3300025914 Unclassified 4152
485 Ga0207671_10070899 3300025914 Bacteria 2598
486 Ga0207671_10124080 3300025914 Unclassified 1976
487 Ga0207671_10184594 3300025914 Bacteria 1624
488 Ga0207693_10000019 3300025915 Bacteria 138082
489 Ga0207693_10000026 3300025915 Bacteria 122717
490 Ga0207693_10000275 3300025915 Bacteria 47590
491 Ga0207693_10000402 3300025915 Bacteria 39488
492 Ga0207693_10007781 3300025915 Bacteria 8792
493 Ga0207693_10008118 3300025915 Bacteria 8605
494 Ga0207693_10018551 3300025915 Bacteria 5539
495 Ga0207693_10042186 3300025915 Bacteria 3592
496 Ga0207693_10049654 3300025915 Bacteria 3295
497 Ga0207663_10003860 3300025916 Bacteria 7397
498 Ga0207663_10018272 3300025916 Bacteria 3926
499 Ga0207663_10058101 3300025916 Bacteria 2440
500 Ga0207663_10077574 3300025916 Bacteria 2163
501 Ga0207663_10077735 3300025916 Unclassified 2161
502 Ga0207663_10126781 3300025916 Bacteria 1757
503 Ga0207660_10055731 3300025917 Bacteria 2826
504 Ga0207660_10063911 3300025917 Unclassified 2655
505 Ga0207662_10012728 3300025918 Bacteria 4690
506 Ga0207657_10002285 3300025919 Bacteria 20778
507 Ga0207657_10002326 3300025919 Bacteria 20596
508 Ga0207657_10003520 3300025919 Bacteria 16725
509 Ga0207649_10000445 3300025920 Bacteria 29893
510 Ga0207652_10025153 3300025921 Bacteria 4947
511 Ga0207652_10217927 3300025921 Bacteria 1719
512 Ga0207646_10000019 3300025922 Bacteria 282855
513 Ga0207646_10000669 3300025922 Bacteria 44352
514 Ga0207646_10002238 3300025922 Bacteria 23047
515 Ga0207646_10002825 3300025922 Bacteria 20199
516 Ga0207646_10005899 3300025922 Bacteria 12783
517 Ga0207646_10008437 3300025922 Bacteria 10329
518 Ga0207646_10044442 3300025922 Bacteria 3988
519 Ga0207646_10045190 3300025922 Bacteria 3954
520 Ga0207646_10065297 3300025922 Bacteria 3249
521 Ga0207646_10071657 3300025922 Unclassified 3095
522 Ga0207646_10162627 3300025922 Bacteria 2015
523 Ga0207646_10234475 3300025922 Bacteria 1658
524 Ga0207694_10019688 3300025924 Bacteria 5105
525 Ga0207694_10059571 3300025924 Bacteria 2970
526 Ga0207694_10096829 3300025924 Unclassified 2334
527 Ga0207694_10221860 3300025924 Unclassified 1542
528 Ga0207650_10000053 3300025925 Bacteria 164599
529 Ga0207650_10067199 3300025925 Bacteria 2690
530 Ga0207659_10040078 3300025926 Bacteria 3272
531 Ga0207687_10007071 3300025927 Bacteria 7397
532 Ga0207687_10016050 3300025927 Unclassified 4915
533 Ga0207687_10020914 3300025927 Bacteria 4343
534 Ga0207687_10097425 3300025927 Bacteria 2157
535 Ga0207700_10000111 3300025928 Bacteria 48784
536 Ga0207700_10000348 3300025928 Bacteria 27120
537 Ga0207700_10010240 3300025928 Bacteria 5902
538 Ga0207700_10016653 3300025928 Bacteria 4890
539 Ga0207700_10041153 3300025928 Bacteria 3379
540 Ga0207700_10057438 3300025928 Unclassified 2934
541 Ga0207700_10090889 3300025928 Bacteria 2410
542 Ga0207700_10100086 3300025928 Bacteria 2309
543 Ga0207700_10228021 3300025928 Unclassified 1582
544 Ga0207664_10000098 3300025929 Bacteria 80444
545 Ga0207664_10000236 3300025929 Bacteria 41929
546 Ga0207664_10006442 3300025929 Bacteria 8079
547 Ga0207664_10152939 3300025929 Unclassified 1961
548 Ga0207664_10168756 3300025929 Unclassified 1871
549 Ga0207664_10182327 3300025929 Unclassified 1803
550 Ga0207644_10019899 3300025931 Bacteria 4558
551 Ga0207644_10044605 3300025931 Archaea 3151
552 Ga0207690_10015345 3300025932 Bacteria 4641
553 Ga0207706_10002255 3300025933 Bacteria 18825
554 Ga0207706_10017718 3300025933 Bacteria 6416
555 Ga0207706_10057458 3300025933 Bacteria 3428
556 Ga0207706_10103675 3300025933 Unclassified 2502
557 Ga0207670_10015855 3300025936 Bacteria 4512
558 Ga0207704_10036846 3300025938 Bacteria 2818
559 Ga0207665_10000358 3300025939 Bacteria 31676
560 Ga0207665_10004365 3300025939 Bacteria 9394
561 Ga0207665_10012284 3300025939 Bacteria 5623
562 Ga0207665_10027306 3300025939 Unclassified 3772
563 Ga0207665_10027941 3300025939 Unclassified 3726
564 Ga0207665_10087926 3300025939 Bacteria 2149
565 Ga0207665_10102034 3300025939 Bacteria 2004
566 Ga0207665_10168366 3300025939 Unclassified 1581
567 Ga0207665_10186763 3300025939 Unclassified 1504
568 Ga0207691_10003568 3300025940 Bacteria 15137
569 Ga0207711_10014801 3300025941 Bacteria 6481
570 Ga0207711_10041085 3300025941 Bacteria 3937
571 Ga0207711_10051892 3300025941 Bacteria 3514
572 Ga0207689_10000542 3300025942 Bacteria 35861
573 Ga0207689_10002682 3300025942 Bacteria 16456
574 Ga0207689_10007004 3300025942 Bacteria 9912
575 Ga0207689_10011534 3300025942 Bacteria 7570
576 Ga0207689_10127005 3300025942 Bacteria 2098
577 Ga0207661_10001208 3300025944 Bacteria 17288
578 Ga0207661_10088275 3300025944 Bacteria 2577
579 Ga0207661_10167122 3300025944 Bacteria 1912
580 Ga0207661_10174741 3300025944 Bacteria 1872
581 Ga0207679_10001783 3300025945 Bacteria 13399
582 Ga0207679_10111452 3300025945 Bacteria 2160
583 Ga0207679_10145463 3300025945 Bacteria 1922
584 Ga0207667_10007869 3300025949 Bacteria 12730
585 Ga0207667_10064866 3300025949 Bacteria 3811
586 Ga0207667_10120976 3300025949 Unclassified 2698
587 Ga0207667_10144355 3300025949 Bacteria 2450
588 Ga0207667_10177880 3300025949 Bacteria 2185
589 Ga0207667_10463604 3300025949 Unclassified 1287
590 Ga0207651_10001496 3300025960 Bacteria 10642
591 Ga0207640_10011254 3300025981 Bacteria 5060
592 Ga0207640_10044413 3300025981 Bacteria 2847
593 Ga0207640_10044827 3300025981 Bacteria 2836
594 Ga0207658_10005363 3300025986 Bacteria 8806
595 Ga0207658_10048547 3300025986 Bacteria 3113
596 Ga0207677_10002399 3300026023 Bacteria 9824
597 Ga0207677_10009986 3300026023 Bacteria 5357
598 Ga0207677_10023183 3300026023 Bacteria 3828
599 Ga0207703_10032180 3300026035 Bacteria 4150
600 Ga0207703_10032365 3300026035 Unclassified 4139
601 Ga0207703_10037964 3300026035 Unclassified 3840
602 Ga0207703_10064606 3300026035 Bacteria 3004
603 Ga0207703_10229424 3300026035 Bacteria 1664
604 Ga0207639_10000640 3300026041 Bacteria 24154
605 Ga0207639_10020974 3300026041 Bacteria 4686
606 Ga0207639_10060639 3300026041 Bacteria 2919
607 Ga0207639_10255054 3300026041 Bacteria 1531
608 Ga0207678_10000840 3300026067 Bacteria 28166
609 Ga0207678_10006402 3300026067 Bacteria 10457
610 Ga0207708_10039749 3300026075 Bacteria 3585
611 Ga0207702_10000962 3300026078 Bacteria 29642
612 Ga0207702_10000989 3300026078 Bacteria 29131
613 Ga0207702_10005687 3300026078 Bacteria 10873
614 Ga0207702_10007050 3300026078 Bacteria 9615
615 Ga0207702_10009982 3300026078 Bacteria 7961
616 Ga0207702_10031974 3300026078 Bacteria 4389
617 Ga0207702_10049632 3300026078 Unclassified 3541
618 Ga0207702_10051111 3300026078 Bacteria 3492
619 Ga0207641_10000104 3300026088 Bacteria 122307
620 Ga0207641_10020452 3300026088 Bacteria 5435
621 Ga0207641_10048986 3300026088 Bacteria 3569
622 Ga0207641_10124490 3300026088 Bacteria 2306
623 Ga0207648_10002557 3300026089 Bacteria 19506
624 Ga0207648_10003472 3300026089 Bacteria 16526
625 Ga0207648_10047789 3300026089 Unclassified 3749
626 Ga0207676_10000491 3300026095 Bacteria 33225
627 Ga0207676_10033521 3300026095 Bacteria 3881
628 Ga0207676_10141069 3300026095 Unclassified 2063
629 Ga0207676_10161916 3300026095 Bacteria 1939
630 Ga0207674_10000867 3300026116 Bacteria 39599
631 Ga0207674_10001318 3300026116 Bacteria 32302
632 Ga0207674_10010008 3300026116 Bacteria 10793
633 Ga0207674_10027636 3300026116 Bacteria 5998
634 Ga0207675_100047635 3300026118 Bacteria 4001
635 Ga0207675_100134021 3300026118 Bacteria 2349
636 Ga0207683_10003204 3300026121 Bacteria 14276
637 Ga0207683_10054308 3300026121 Unclassified 3513
638 Ga0207698_10126136 3300026142 Bacteria 2177
639 Ga0207698_10306128 3300026142 Bacteria 1482
640 Ga0265356_1000478 3300028017 Bacteria 7213
641 Ga0268264_10073344 3300028381 Bacteria 2905
642 Ga0268264_10103983 3300028381 Bacteria 2474
643 Ga0268264_10266229 3300028381 Unclassified 1599
644 Ga0265319_1001935 3300028563 Bacteria 11733
645 Ga0265318_10000470 3300028577 Bacteria 29937
646 Ga0265323_10002678 3300028653 Bacteria 8045
647 Ga0265338_10000833 3300028800 Bacteria 52026
648 Ga0265338_10011557 3300028800 Bacteria 10178
649 Ga0265338_10040971 3300028800 Unclassified 4340
650 Ga0265762_1000119 3300030760 Bacteria 11713
651 Ga0265762_1000777 3300030760 Bacteria 5699
652 Ga0265760_10021498 3300031090 Unclassified 1868
653 Ga0265330_10000124 3300031235 Bacteria 63181
654 Ga0265330_10001029 3300031235 Bacteria 16863
655 Ga0265330_10002039 3300031235 Bacteria 11206
656 Ga0265330_10076568 3300031235 Bacteria 1444
657 Ga0265332_10000212 3300031238 Bacteria 47356
658 Ga0265332_10048198 3300031238 Bacteria 1833
659 Ga0265328_10019321 3300031239 Bacteria 2619
660 Ga0265328_10057548 3300031239 Bacteria 1427
661 Ga0265320_10000458 3300031240 Bacteria 32020
662 Ga0265325_10001657 3300031241 Bacteria 15491
663 Ga0265325_10003282 3300031241 Bacteria 10635
664 Ga0265325_10017529 3300031241 Bacteria 3979
665 Ga0265325_10021709 3300031241 Bacteria 3521
666 Ga0265325_10037343 3300031241 Bacteria 2568
667 Ga0265329_10000608 3300031242 Bacteria 18454
668 Ga0265329_10001963 3300031242 Bacteria 9652
669 Ga0265340_10009453 3300031247 Bacteria 5231
670 Ga0265340_10033192 3300031247 Bacteria 2571
671 Ga0265340_10048740 3300031247 Bacteria 2059
672 Ga0265339_10003136 3300031249 Bacteria 11639
673 Ga0265339_10006988 3300031249 Bacteria 7337
674 Ga0265339_10013445 3300031249 Bacteria 4959
675 Ga0265339_10015031 3300031249 Bacteria 4652
676 Ga0265339_10027092 3300031249 Bacteria 3277
677 Ga0265339_10060133 3300031249 Bacteria 2048
678 Ga0265331_10000626 3300031250 Bacteria 30727
679 Ga0265331_10030706 3300031250 Bacteria 2674
680 Ga0265331_10038598 3300031250 Bacteria 2334
681 Ga0265316_10000007 3300031344 Bacteria 264584
682 Ga0265316_10001212 3300031344 Bacteria 27775
683 Ga0265316_10001409 3300031344 Bacteria 25869
684 Ga0265316_10001455 3300031344 Bacteria 25408
685 Ga0265316_10006292 3300031344 Bacteria 11368
686 Ga0265316_10014345 3300031344 Bacteria 6978
687 Ga0265316_10018684 3300031344 Bacteria 5953
688 Ga0265316_10104097 3300031344 Bacteria 2154
689 Ga0265316_10113100 3300031344 Bacteria 2055
690 Ga0265316_10136540 3300031344 Bacteria 1844
691 Ga0307408_100082813 3300031548 Bacteria 2402
692 Ga0265313_10002578 3300031595 Bacteria 15447
693 Ga0265313_10007574 3300031595 Bacteria 7380
694 Ga0265313_10027981 3300031595 Bacteria 2940
695 Ga0265314_10000005 3300031711 Bacteria 668532
696 Ga0265314_10024310 3300031711 Bacteria 4595
697 Ga0265314_10026888 3300031711 Bacteria 4317
698 Ga0265314_10060022 3300031711 Bacteria 2598
699 Ga0265314_10063551 3300031711 Bacteria 2503
700 Ga0265342_10000005 3300031712 Bacteria 247745
701 Ga0265342_10001134 3300031712 Bacteria 25443
702 Ga0265342_10004629 3300031712 Bacteria 10723
703 Ga0265342_10019414 3300031712 Unclassified 4381
704 Ga0265342_10031316 3300031712 Bacteria 3290
705 Ga0265342_10036519 3300031712 Bacteria 3001
706 Ga0307410_10030830 3300031852 Bacteria 3432
707 Ga0307409_100012125 3300031995 Bacteria 5476
708 Ga0307409_100024575 3300031995 Unclassified 4205
709 Ga0307416_100108397 3300032002 Bacteria 2440
710 Ga0307416_100140771 3300032002 Bacteria 2192
711 Ga0307411_10030856 3300032005 Unclassified 3290
712 Ga0307411_10092114 3300032005 Bacteria 2119
713 Ga0307415_100012606 3300032126 Unclassified 4895
714 Ga0316212_1001343 3300033547 Bacteria 3334
715 Ga0373926_0004972 3300035083 Bacteria 4368
716 Ga0373926_0010368 3300035083 Bacteria 3123
717 Ga0373926_0015292 3300035083 Bacteria 2615
718 Ga0373923_0022376 3300035111 Bacteria 2478
719 Ga0373923_0059778 3300035111 Bacteria 1616
720 Ga0373923_0106516 3300035111 Bacteria 1241
721 Ga0373936_0000926 3300035113 Bacteria 10468
722 Ga0373936_0011529 3300035113 Bacteria 3348
723 Ga0373936_0081728 3300035113 Bacteria 1345
724 Ga0373945_0001045 3300035116 Bacteria 8295
725 Ga0373945_0007285 3300035116 Unclassified 3582
726 Ga0373953_0031745 3300035117 Unclassified 2056
727 Ga0373954_0001164 3300035118 Bacteria 10590
728 Ga0373954_0001795 3300035118 Bacteria 8838
729 Ga0373954_0021171 3300035118 Bacteria 2943
730 Ga0373954_0066734 3300035118 Bacteria 1704
731 Ga0373956_0008228 3300035119 Unclassified 4221
732 Ga0373956_0020933 3300035119 Bacteria 2788
733 Ga0373957_0038484 3300035120 Bacteria 1791
734 Ga0373943_0000008 3300035170 Bacteria 69214
735 Ga0373943_0001310 3300035170 Bacteria 11180
736 Ga0373943_0001571 3300035170 Bacteria 10341
737 Ga0373943_0012801 3300035170 Bacteria 3782
738 Ga0373943_0094993 3300035170 Unclassified 1550
739 Ga0373943_0112791 3300035170 Unclassified 1436
740 Ga0373946_0001764 3300035171 Bacteria 7534
741 Ga0373946_0005469 3300035171 Bacteria 4582
742 Ga0373946_0008093 3300035171 Bacteria 3859
743 Ga0373946_0015286 3300035171 Bacteria 2907
744 Ga0373955_0004246 3300035172 Bacteria 6328
745 Ga0373955_0033059 3300035172 Bacteria 2721
746 Ga0373924_0037381 3300035410 Bacteria 1976
747 Ga0373935_0001333 3300035692 Bacteria 13657
748 Ga0373935_0003639 3300035692 Bacteria 8988
749 Ga0373935_0009893 3300035692 Bacteria 5714
750 Ga0373935_0011396 3300035692 Bacteria 5338
751 Ga0373935_0012288 3300035692 Bacteria 5151
752 Ga0373935_0024750 3300035692 Bacteria 3697
753 Ga0373935_0060369 3300035692 Unclassified 2425
754 Ga0373935_0231910 3300035692 Unclassified 1286
755 Ga0373927_0000102 3300035695 Bacteria 64428
756 Ga0373927_0000282 3300035695 Bacteria 40021
757 Ga0373927_0004903 3300035695 Bacteria 9295
758 Ga0373927_0010628 3300035695 Bacteria 6132
759 Ga0373927_0016685 3300035695 Bacteria 4844
760 Ga0373927_0019643 3300035695 Bacteria 4430
761 Ga0373927_0020788 3300035695 Bacteria 4302
762 Ga0373933_0006743 3300035724 Bacteria 6260
763 Ga0373933_0029242 3300035724 Bacteria 3185
764 Ga0373933_0117310 3300035724 Bacteria 1664
765 Ga0373947_0000085 3300035725 Bacteria 46581
766 Ga0373947_0003324 3300035725 Bacteria 9529
767 Ga0373947_0003884 3300035725 Bacteria 8790
768 Ga0373947_0006708 3300035725 Bacteria 6678
769 Ga0373947_0116762 3300035725 Unclassified 1692
770 Ga0373937_0001894 3300036401 Bacteria 17556
771 Ga0373937_0002447 3300036401 Bacteria 15426
772 Ga0373937_0005085 3300036401 Bacteria 11200
773 Ga0373937_0011706 3300036401 Unclassified 7694
774 Ga0373937_0038559 3300036401 Bacteria 4354
775 Ga0373937_0083614 3300036401 Bacteria 2953
776 Ga0373937_0220607 3300036401 Unclassified 1785
777 Ga0373937_0580937 3300036401 Bacteria 1064
778 Ga0373925_0001250 3300037068 Bacteria 22415
779 Ga0373925_0001997 3300037068 Bacteria 16904
780 Ga0373925_0004385 3300037068 Bacteria 10664
781 Ga0373925_0005430 3300037068 Bacteria 9495
782 Ga0373925_0006324 3300037068 Bacteria 8724
783 Ga0373925_0008172 3300037068 Bacteria 7620
784 Ga0373925_0009582 3300037068 Bacteria 7057
785 Ga0373925_0022106 3300037068 Bacteria 4636
786 Ga0373925_0027423 3300037068 Unclassified 4169
787 Ga0373925_0195655 3300037068 Bacteria 1606
788 Ga0373925_0198205 3300037068 Unclassified 1596
789 Ga0395900_0389009 3300037418 Bacteria 1361
790 Ga0395898_0018272 3300037466 Bacteria 7150
791 Ga0395905_0052302 3300037471 Unclassified 3824
792 Ga0395905_0222452 3300037471 Bacteria 1767
793 Ga0436364_0111624 3300037853 Bacteria 13280
794 Ga0436364_0800841 3300037853 Bacteria 5919
795 Ga0436364_1031116 3300037853 Bacteria 1846
796 Ga0400483_037104 3300039062 Bacteria 4226
797 Ga0436365_1001330 3300039437 Unclassified 1960
798 Ga0436360_0296885 3300039438 Bacteria 2019
799 Ga0436361_0511551 3300039447 Bacteria 2053
800 Ga0436363_1035544 3300039450 Unclassified 2669
801 Ga0436363_1571670 3300039450 Bacteria 6055
802 Ga0436362_0552319 3300039453 Unclassified 3813
803 Ga0451577_0000523 3300042876 Bacteria 63915
804 Ga0451577_0137874 3300042876 Unclassified 2191
805 Ga0466969_0041440 3300044656 Unclassified 2303
806 Ga0453683_0001517 3300044673 Bacteria 19821
807 Ga0453683_0003698 3300044673 Bacteria 11190
808 Ga0453683_0075830 3300044673 Bacteria 2105
809 Ga0466966_0006612 3300044684 Bacteria 7672
810 Ga0466963_0007856 3300044694 Bacteria 6385
811 Ga0466963_0039646 3300044694 Bacteria 3085
812 Ga0466963_0165055 3300044694 Bacteria 1543
813 Ga0466964_0057564 3300044706 Bacteria 1609
814 Ga0453684_0000951 3300044712 Bacteria 95417
815 Ga0453684_0007605 3300044712 Bacteria 19858
816 Ga0453684_0290717 3300044712 Bacteria 1861
817 Ga0466957_0005729 3300044842 Bacteria 6985
818 Ga0466957_0042258 3300044842 Unclassified 2757
819 Ga0466957_0131339 3300044842 Bacteria 1605
820 Ga0466959_0030420 3300045049 Bacteria 3998
821 Ga0466959_0133235 3300045049 Bacteria 1760
822 Ga0466959_0210256 3300045049 Bacteria 1352
823 Ga0451576_0010527 3300045051 Bacteria 10600
824 Ga0451576_0034449 3300045051 Bacteria 5378
825 Ga0451576_0080028 3300045051 Unclassified 3400
826 Ga0451576_0273611 3300045051 Unclassified 1766
827 Ga0466958_0016272 3300045836 Bacteria 4280
828 Ga0466967_0036308 3300045976 Unclassified 4205
829 Ga0466967_0106794 3300045976 Unclassified 2567
830 Ga0466967_0172547 3300045976 Bacteria 2035
831 Ga0466967_0330482 3300045976 Unclassified 1472
832 Ga0466967_0372808 3300045976 Bacteria 1384
833 Ga0495592_0052904 3300046454 Unclassified 3013
834 Ga0495592_0088598 3300046454 Unclassified 2224
835 Ga0495603_0067613 3300046455 Unclassified 2103
836 Ga0495629_0018762 3300046459 Bacteria 4945
837 Ga0495651_0001954 3300046462 Bacteria 15929
838 Ga0495651_0012679 3300046462 Bacteria 6505
839 Ga0495651_0016421 3300046462 Bacteria 5733
840 Ga0495651_0029697 3300046462 Unclassified 4263
841 Ga0495651_0151062 3300046462 Bacteria 1674
842 Ga0495653_0025083 3300046463 Bacteria 4797
843 Ga0495580_0000345 3300046472 Bacteria 37884
844 Ga0495580_0000603 3300046472 Bacteria 30353
845 Ga0495580_0001544 3300046472 Bacteria 20251
846 Ga0495580_0002140 3300046472 Bacteria 17326
847 Ga0495580_0011670 3300046472 Bacteria 6792
848 Ga0495580_0011687 3300046472 Bacteria 6786
849 Ga0495580_0016391 3300046472 Bacteria 5561
850 Ga0495580_0034691 3300046472 Bacteria 3631
851 Ga0495580_0043314 3300046472 Bacteria 3204
852 Ga0495580_0053894 3300046472 Bacteria 2837
853 Ga0495580_0063084 3300046472 Bacteria 2599
854 Ga0495580_0076385 3300046472 Bacteria 2336
855 Ga0495580_0081695 3300046472 Unclassified 2252
856 Ga0495580_0095575 3300046472 Unclassified 2067
857 Ga0495580_0124499 3300046472 Bacteria 1789
858 Ga0495582_0000622 3300046473 Bacteria 19514
859 Ga0495582_0001976 3300046473 Bacteria 11502
860 Ga0495664_0016600 3300046477 Bacteria 4197
861 Ga0495664_0039253 3300046477 Bacteria 2797
862 Ga0495664_0098607 3300046477 Unclassified 1759
863 Ga0495594_0058971 3300046499 Unclassified 2122
864 Ga0495608_0005808 3300046511 Bacteria 8794
865 Ga0495608_0026115 3300046511 Bacteria 3984
866 Ga0495608_0031296 3300046511 Bacteria 3598
867 Ga0495618_0051470 3300046514 Bacteria 2602
868 Ga0495628_0007555 3300046516 Bacteria 9401
869 Ga0495628_0026495 3300046516 Bacteria 4726
870 Ga0495628_0034642 3300046516 Unclassified 4060
871 Ga0495630_0003848 3300046517 Bacteria 10478
872 Ga0495630_0081791 3300046517 Unclassified 2437
873 Ga0495630_0189669 3300046517 Bacteria 1568
874 Ga0495630_0264763 3300046517 Bacteria 1313
875 Ga0495666_0035186 3300046526 Bacteria 2442
876 Ga0495652_0004346 3300046529 Bacteria 13573
877 Ga0495652_0039044 3300046529 Bacteria 4107
878 Ga0495665_0001833 3300046531 Bacteria 11475
879 Ga0495665_0001960 3300046531 Bacteria 11110
880 Ga0495665_0072920 3300046531 Bacteria 1808
881 Ga0495665_0078394 3300046531 Bacteria 1738
882 Ga0495586_0075562 3300046535 Unclassified 1844
883 Ga0495587_0000442 3300046536 Bacteria 29092
884 Ga0495587_0004541 3300046536 Bacteria 9120
885 Ga0495587_0010761 3300046536 Bacteria 5809
886 Ga0495587_0053780 3300046536 Bacteria 2373
887 Ga0495667_0007526 3300046559 Bacteria 7388
888 Ga0495667_0044689 3300046559 Bacteria 2933
889 Ga0495635_0016351 3300046663 Bacteria 5180
890 Ga0495635_0033122 3300046663 Unclassified 3584
891 Ga0495635_0153091 3300046663 Bacteria 1570
892 Ga0495659_0008336 3300046664 Bacteria 3299
893 Ga0495657_0013658 3300046675 Bacteria 5983
894 Ga0495657_0074612 3300046675 Bacteria 2207
895 Ga0495599_0008189 3300046678 Bacteria 6352
896 Ga0495599_0108798 3300046678 Unclassified 1727
897 Ga0495623_0001371 3300046679 Bacteria 16530
898 Ga0495646_0011292 3300046680 Bacteria 5671
899 Ga0495658_0007843 3300046683 Bacteria 5287
900 Ga0495669_0035913 3300046684 Unclassified 2189
901 Ga0495669_0043013 3300046684 Unclassified 2010
902 Ga0495600_0005598 3300046809 Bacteria 7584
903 Ga0495600_0021037 3300046809 Bacteria 4175
904 Ga0495604_0000979 3300047317 Bacteria 23812
905 Ga0495604_0045188 3300047317 Bacteria 3438
906 Ga0495604_0055899 3300047317 Unclassified 3040
907 Ga0495604_0059116 3300047317 Unclassified 2940
908 Ga0495674_0001505 3300047319 Bacteria 22860
909 Ga0495674_0004208 3300047319 Bacteria 13861
910 Ga0495674_0031174 3300047319 Bacteria 4845
911 Ga0495674_0062055 3300047319 Bacteria 3255
912 Ga0495674_0167501 3300047319 Unclassified 1835
913 Ga0495676_0140941 3300047321 Bacteria 1728
914 Ga0495680_0000547 3300047322 Bacteria 42327
915 Ga0495675_0000027 3300047444 Bacteria 106917
916 Ga0495675_0014852 3300047444 Bacteria 4924
917 Ga0495675_0023510 3300047444 Bacteria 3927
918 Ga0495675_0155111 3300047444 Bacteria 1413
919 Ga0495684_0029877 3300047471 Unclassified 4183
920 Ga0495684_0060295 3300047471 Unclassified 2889
921 Ga0495684_0124963 3300047471 Bacteria 1936
922 Ga0495593_0022382 3300047673 Bacteria 3521
923 Ga0495602_0002605 3300048088 Bacteria 18426
924 Ga0495602_0008897 3300048088 Bacteria 10471
925 Ga0495602_0104366 3300048088 Bacteria 2319
926 Ga0495614_0087577 3300048089 Bacteria 1352
927 Ga0496100_0062003 3300048903 Bacteria 2466
928 Ga0496100_0123429 3300048903 Unclassified 1815
929 Ga0496102_0000786 3300048905 Bacteria 30824
930 Ga0496102_0030087 3300048905 Bacteria 4860
931 Ga0496102_0062839 3300048905 Bacteria 3400
932 Ga0496102_0142404 3300048905 Unclassified 2248
933 Ga0496102_0363525 3300048905 Unclassified 1362
934 Ga0496104_0201121 3300048907 Unclassified 1904
935 Ga0496104_0232464 3300048907 Bacteria 1755
936 Ga0496104_0440221 3300048907 Unclassified 1215
937 Ga0496105_0000399 3300048908 Bacteria 28536
938 Ga0496105_0008491 3300048908 Bacteria 7980
939 Ga0496105_0041633 3300048908 Unclassified 3786
940 Ga0496106_0152843 3300048909 Bacteria 1821
941 Ga0496108_0000629 3300048911 Bacteria 27529
942 Ga0496109_0000270 3300048912 Bacteria 49971
943 Ga0496109_0078788 3300048912 Unclassified 3034
944 Ga0496109_0173966 3300048912 Unclassified 2021
945 Ga0496109_0321638 3300048912 Unclassified 1460
946 Ga0496110_0002501 3300048913 Bacteria 13796
947 Ga0496110_0080645 3300048913 Unclassified 2900
948 Ga0496112_0000121 3300048915 Bacteria 48786
949 Ga0496112_0001114 3300048915 Bacteria 19958
950 Ga0496112_0003512 3300048915 Bacteria 12990
951 Ga0496112_0005362 3300048915 Bacteria 11080
952 Ga0496112_0006571 3300048915 Bacteria 10232
953 Ga0496112_0027881 3300048915 Bacteria 5448
954 Ga0496112_0031725 3300048915 Bacteria 5126
955 Ga0496112_0039232 3300048915 Unclassified 4627
956 Ga0496112_0061570 3300048915 Unclassified 3700
957 Ga0496112_0116729 3300048915 Unclassified 2639
958 Ga0496112_0120908 3300048915 Unclassified 2588
959 Ga0496112_0172253 3300048915 Bacteria 2130
960 Ga0496112_0190516 3300048915 Bacteria 2013
961 Ga0496112_0258193 3300048915 Bacteria 1692
962 Ga0496112_0313136 3300048915 Bacteria 1515
963 Ga0496113_0002775 3300048916 Bacteria 10302
964 Ga0496113_0072803 3300048916 Unclassified 2616
965 Ga0496113_0075589 3300048916 Unclassified 2571
966 Ga0496113_0114865 3300048916 Unclassified 2099
967 Ga0496114_0138203 3300048917 Unclassified 2108
968 Ga0496115_0039011 3300048918 Unclassified 3771
969 Ga0496115_0100120 3300048918 Bacteria 2376
970 Ga0496115_0113427 3300048918 Bacteria 2227
971 Ga0496115_0148247 3300048918 Bacteria 1937
972 Ga0496115_0278163 3300048918 Bacteria 1374
973 Ga0501032_0005704 3300049569 Bacteria 9216
974 Ga0501033_0037420 3300049570 Unclassified 3632
975 Ga0501034_0130187 3300049571 Unclassified 2500
976 Ga0501034_0215273 3300049571 Bacteria 1875
977 Ga0501036_0114081 3300049572 Bacteria 2283
978 Ga0501037_0009000 3300049573 Bacteria 7313
979 Ga0501038_0251947 3300049574 Bacteria 1398
980 Ga0501040_0049459 3300049576 Unclassified 2874
981 Ga0501043_0009517 3300049579 Bacteria 7617
982 Ga0501047_0017578 3300049581 Bacteria 6851
983 Ga0501048_0006576 3300049582 Bacteria 8835
984 Ga0501068_0001225 3300049584 Bacteria 13613
985 Ga0501070_0010893 3300049586 Bacteria 7680
986 Ga0501072_0001261 3300049588 Bacteria 18900
987 Ga0501073_0002323 3300049589 Bacteria 14223
988 Ga0501074_0012760 3300049590 Bacteria 6108
989 Ga0501076_0071055 3300049592 Unclassified 2784
990 Ga0501077_0012602 3300049593 Bacteria 5295
991 Ga0501257_016927 3300049686 Unclassified 1694
992 Ga0501080_0000017 3300049742 Bacteria 96079
993 Ga0501268_003670 3300049765 Unclassified 2116
994 Ga0501270_006070 3300049767 Unclassified 1433
995 Ga0501035_0029617 3300049822 Unclassified 4992
996 Ga0501044_0010324 3300049823 Bacteria 10141
997 Ga0501044_0025922 3300049823 Bacteria 6213
998 nmdc:mga05p37_339084_c1 3300050507 Unclassified 1773
999 nmdc:mga09592_87263_c1 3300050508 Bacteria 2663
1000 nmdc:mga0n895_1177_c1 3300050512 Bacteria 19184
1001 nmdc:mga0n895_184695_c1 3300050512 Bacteria 2116
1002 nmdc:mga0n895_299932_c1 3300050512 Bacteria 1629
1003 nmdc:mga0n895_62884_c1 3300050512 Unclassified 3670
1004 nmdc:mga0n895_92004_c1 3300050512 Unclassified 3036
1005 nmdc:mga0rr50_18350_c1 3300050513 Unclassified 4698
1006 nmdc:mga08x19_131676_c1 3300050514 Unclassified 1683
1007 nmdc:mga08x19_134_c1 3300050514 Bacteria 65861
1008 nmdc:mga08x19_20953_c1 3300050514 Unclassified 4031
1009 nmdc:mga08x19_2332_c1 3300050514 Bacteria 11518
1010 nmdc:mga08x19_26514_c1 3300050514 Bacteria 3616
1011 nmdc:mga08x19_5825_c2 3300050514 Bacteria 5821
1012 nmdc:mga08x19_6467_c1 3300050514 Bacteria 6937
1013 nmdc:mga08x19_7445_c1 3300050514 Bacteria 6501
1014 nmdc:mga0a205_109175_c1 3300050515 Bacteria 2665
1015 nmdc:mga0a205_8182_c1 3300050515 Bacteria 9500
1016 Ga0495601_0001642 3300053077 Bacteria 12336
1017 Ga0495601_0015532 3300053077 Bacteria 4602
1018 Ga0495612_0002730 3300053078 Bacteria 7305
1019 Ga0495619_0003442 3300053085 Bacteria 10210
1020 2673165357 2671180531 Bacteria 9045424
1021 Ga0070709_10000432
1022 JGI24752J21851_1004863
1023 JGI24751J29686_10000897
1024 Ga0065712_10004139
1025 Ga0065712_10158652
1026 Ga0065715_10091689
1027 Ga0070658_10046918
1028 Ga0070658_10260746
1029 Ga0070683_100008827
1030 Ga0070683_100011670
1031 Ga0070683_100046216
1032 Ga0070683_100109881
1033 Ga0070670_100024685
1034 Ga0070670_100031846
1035 Ga0070677_10013649
1036 Ga0068869_100004860
1037 Ga0068869_100029145
1038 Ga0070680_100115449
1039 Ga0070682_100078877
1040 Ga0068868_100008270
1041 Ga0068868_100009121
1042 Ga0068868_100012948
1043 Ga0068868_100019125
1044 Ga0068868_100038646
1045 Ga0070660_100001606
1046 Ga0070660_100026499
1047 Ga0070660_100159785
1048 Ga0070689_100050268
1049 Ga0070687_100016278
1050 Ga0070687_100099232
1051 Ga0070661_100006213
1052 Ga0070661_100060104
1053 Ga0070668_100007447
1054 Ga0070668_100038070
1055 Ga0070669_100003780
1056 Ga0070675_100020211
1057 Ga0070671_100148002
1058 Ga0070673_100023574
1059 Ga0070688_100002957
1060 Ga0070688_100172668
1061 Ga0070659_100001742
1062 Ga0070659_100016657
1063 Ga0070709_10000508
1064 Ga0070709_10007729
1065 Ga0070709_10029627
1066 Ga0070709_10116272
1067 Ga0070709_10126818
1068 Ga0070714_100000027
1069 Ga0070714_100000184
1070 Ga0070714_100001883
1071 Ga0070714_100004724
1072 Ga0070714_100017233
1073 Ga0070714_100049322
1074 Ga0070714_100183635
1075 Ga0070713_100000134
1076 Ga0070713_100000441
1077 Ga0070713_100000879
1078 Ga0070713_100020017
1079 Ga0070713_100028094
1080 Ga0070713_100035469
1081 Ga0070713_100044369
1082 Ga0070713_100061634
1083 Ga0070713_100095893
1084 Ga0070713_100193824
1085 Ga0070710_10001549
1086 Ga0070710_10008124
1087 Ga0070710_10021015
1088 Ga0070710_10029050
1089 Ga0070710_10040104
1090 Ga0070710_10041452
1091 Ga0070711_100000271
1092 Ga0070711_100012239
1093 Ga0070711_100012311
1094 Ga0070711_100025957
1095 Ga0070711_100029928
1096 Ga0070711_100053924
1097 Ga0070711_100058074
1098 Ga0070711_100070019
1099 Ga0070711_100084480
1100 Ga0070711_100111319
1101 Ga0070711_100244993
1102 Ga0070708_100000459
1103 Ga0070708_100001910
1104 Ga0070708_100001941
1105 Ga0070708_100008503
1106 Ga0070708_100013871
1107 Ga0070708_100017136
1108 Ga0070708_100026105
1109 Ga0070708_100027364
1110 Ga0070708_100032166
1111 Ga0070708_100037870
1112 Ga0070708_100108325
1113 Ga0070708_100408057
1114 Ga0070663_100006254
1115 Ga0070678_100070011
1116 Ga0070662_100004877
1117 Ga0070662_100005317
1118 Ga0070662_100043573
1119 Ga0070662_100161054
1120 Ga0070662_100211842
1121 Ga0070681_10000242
1122 Ga0070681_10004600
1123 Ga0070681_10018211
1124 Ga0070681_10023295
1125 Ga0070681_10027456
1126 Ga0070681_10154975
1127 Ga0070681_10166720
1128 Ga0070681_10173076
1129 Ga0070681_10214782
1130 Ga0070681_10232388
1131 Ga0070681_10260341
1132 Ga0070685_10001931
1133 Ga0070706_100000278
1134 Ga0070706_100000514
1135 Ga0070706_100001354
1136 Ga0070706_100002109
1137 Ga0070706_100003323
1138 Ga0070706_100012428
1139 Ga0070706_100015679
1140 Ga0070706_100017419
1141 Ga0070706_100078384
1142 Ga0070706_100080578
1143 Ga0070707_100000162
1144 Ga0070707_100000662
1145 Ga0070707_100008218
1146 Ga0070707_100009330
1147 Ga0070707_100012541
1148 Ga0070707_100013183
1149 Ga0070707_100029144
1150 Ga0070707_100051085
1151 Ga0070707_100156588
1152 Ga0070707_100184797
1153 Ga0070707_100238809
1154 Ga0070707_100310089
1155 Ga0070707_100327402
1156 Ga0070698_100000133
1157 Ga0070698_100001945
1158 Ga0070698_100002043
1159 Ga0070698_100011544
1160 Ga0070698_100025166
1161 Ga0070698_100039029
1162 Ga0070698_100041613
1163 Ga0070698_100141600
1164 Ga0070698_100315601
1165 Ga0070699_100000441
1166 Ga0070699_100002709
1167 Ga0070699_100009252
1168 Ga0070699_100046551
1169 Ga0070699_100091033
1170 Ga0070679_100047020
1171 Ga0070679_100079417
1172 Ga0070679_100161616
1173 Ga0070679_100176140
1174 Ga0070679_100185428
1175 Ga0070684_100001890
1176 Ga0070684_100048290
1177 Ga0070684_100150375
1178 Ga0070684_100183381
1179 Ga0070697_100000049
1180 Ga0070697_100000158
1181 Ga0070697_100001854
1182 Ga0070697_100002751
1183 Ga0070697_100004513
1184 Ga0070697_100007545
1185 Ga0070697_100008726
1186 Ga0070697_100010636
1187 Ga0070697_100011265
1188 Ga0070697_100020538
1189 Ga0070697_100039836
1190 Ga0070697_100047034
1191 Ga0068853_100006695
1192 Ga0068853_100030598
1193 Ga0068853_100107639
1194 Ga0068853_100128952
1195 Ga0068853_100175047
1196 Ga0070686_100001751
1197 Ga0070695_100042489
1198 Ga0070695_100155403
1199 Ga0070696_100043518
1200 Ga0070693_100013310
1201 Ga0070693_100051240
1202 Ga0070693_100088047
1203 Ga0070665_100314111
1204 Ga0070704_100104740
1205 Ga0068855_100000722
1206 Ga0068855_100012781
1207 Ga0068855_100016183
1208 Ga0068855_100053103
1209 Ga0068855_100107023
1210 Ga0068855_100124918
1211 Ga0068855_100173193
1212 Ga0068855_100173553
1213 Ga0070664_100002060
1214 Ga0070664_100044027
1215 Ga0070664_100124316
1216 Ga0070664_100146293
1217 Ga0070664_100194278
1218 Ga0070664_100326989
1219 Ga0068857_100005616
1220 Ga0068857_100006773
1221 Ga0068857_100011308
1222 Ga0068857_100085631
1223 Ga0068857_100165562
1224 Ga0068857_100223203
1225 Ga0068854_100004626
1226 Ga0068854_100008281
1227 Ga0068854_100074203
1228 Ga0068854_100092306
1229 Ga0068856_100000893
1230 Ga0068856_100001601
1231 Ga0068856_100010172
1232 Ga0068856_100010354
1233 Ga0068856_100015035
1234 Ga0068856_100036173
1235 Ga0068856_100047478
1236 Ga0068856_100052651
1237 Ga0068856_100064506
1238 Ga0068856_100131638
1239 Ga0068856_100175913
1240 Ga0070702_100145151
1241 Ga0068852_100023791
1242 Ga0068852_100039220
1243 Ga0068852_100146592
1244 Ga0068852_100369330
1245 Ga0068852_100382170
1246 Ga0068859_100001851
1247 Ga0068859_100015642
1248 Ga0068859_100398256
1249 Ga0068864_100007801
1250 Ga0068864_100060510
1251 Ga0068861_100143962
1252 Ga0068861_100177701
1253 Ga0068851_10003046
1254 Ga0068863_100012969
1255 Ga0068863_100027438
1256 Ga0068863_100133908
1257 Ga0068863_100314847
1258 Ga0068858_100001619
1259 Ga0068858_100025079
1260 Ga0068858_100031852
1261 Ga0068858_100041927
1262 Ga0068858_100048554
1263 Ga0068858_100123171
1264 Ga0068860_100005894
1265 Ga0068860_100018451
1266 Ga0068860_100073782
1267 Ga0068862_100032620
1268 Ga0081455_10061639
1269 Ga0070717_10001639
1270 Ga0070717_10001941
1271 Ga0070717_10002497
1272 Ga0070717_10005344
1273 Ga0070717_10008691
1274 Ga0070717_10011648
1275 Ga0070717_10032983
1276 Ga0070717_10033339
1277 Ga0070717_10043538
1278 Ga0070717_10071121
1279 Ga0070717_10076602
1280 Ga0070717_10076804
1281 Ga0070717_10081193
1282 Ga0070717_10099431
1283 Ga0070717_10151762
1284 Ga0070717_10162221
1285 Ga0070717_10264590
1286 Ga0070715_10003006
1287 Ga0070715_10006826
1288 Ga0070715_10012101
1289 Ga0070715_10013490
1290 Ga0070716_100003540
1291 Ga0070716_100022292
1292 Ga0070716_100034652
1293 Ga0070716_100065548
1294 Ga0070716_100090934
1295 Ga0070712_100000190
1296 Ga0070712_100000262
1297 Ga0070712_100000618
1298 Ga0070712_100002390
1299 Ga0070712_100011797
1300 Ga0070712_100015567
1301 Ga0070712_100147515
1302 Ga0070712_100315744
1303 Ga0097621_100000058
1304 Ga0097621_100014488
1305 Ga0097621_100206138
1306 Ga0068871_100000167
1307 Ga0068871_100000727
1308 Ga0068871_100001129
1309 Ga0068871_100016962
1310 Ga0068871_100077021
1311 Ga0068871_100085050
1312 Ga0075428_100134548
1313 Ga0075428_100193881
1314 Ga0075430_100014045
1315 Ga0075430_100080466
1316 Ga0075431_100017050
1317 Ga0075433_10000257
1318 Ga0075433_10014530
1319 Ga0075433_10127020
1320 Ga0075433_10243814
1321 Ga0075434_100000242
1322 Ga0075434_100001845
1323 Ga0075434_100033911
1324 Ga0075434_100138960
1325 Ga0075434_100207399
1326 Ga0075429_100008079
1327 Ga0075429_100090864
1328 Ga0068865_100027677
1329 Ga0068865_100068029
1330 Ga0068865_100106064
1331 Ga0075436_100000404
1332 Ga0075436_100001900
1333 Ga0075436_100013914
1334 Ga0075436_100045105
1335 Ga0097620_100001850
1336 Ga0097620_100015642
1337 Ga0097620_100398241
1338 Ga0075435_100000202
1339 Ga0099794_10090505
1340 Ga0105240_10000325
1341 Ga0105240_10001005
1342 Ga0105240_10017855
1343 Ga0105240_10063714
1344 Ga0105240_10076445
1345 Ga0105240_10103666
1346 Ga0105240_10134963
1347 Ga0105240_10167481
1348 Ga0105240_10172186
1349 Ga0105240_10179636
1350 Ga0105240_10227366
1351 Ga0105240_10381162
1352 Ga0105240_10391296
1353 Ga0105245_10004451
1354 Ga0105245_10015530
1355 Ga0105245_10016248
1356 Ga0105245_10076932
1357 Ga0105247_10018578
1358 Ga0105247_10127642
1359 Ga0114129_10028780
1360 Ga0114129_10108973
1361 Ga0105241_10001007
1362 Ga0105241_10028094
1363 Ga0105241_10057414
1364 Ga0105241_10142388
1365 Ga0105242_10009165
1366 Ga0105248_10011618
1367 Ga0105248_10022438
1368 Ga0105248_10028192
1369 Ga0105248_10046865
1370 Ga0105248_10235426
1371 Ga0105237_10011001
1372 Ga0105237_10014737
1373 Ga0105237_10026897
1374 Ga0105237_10069355
1375 Ga0105237_10122178
1376 Ga0105237_10171513
1377 Ga0105237_10186769
1378 Ga0105238_10048523
1379 Ga0105238_10065612
1380 Ga0105238_10107866
1381 Ga0105249_10013908
1382 Ga0099796_10005480
1383 Ga0105239_10044409
1384 Ga0105239_10200638
1385 Ga0105239_10323484
1386 Ga0105239_10469151
1387 Ga0105246_10055304
1388 Ga0157373_10003057
1389 Ga0157373_10013678
1390 Ga0157373_10066725
1391 Ga0157373_10101656
1392 Ga0157373_10128502
1393 Ga0157371_10002264
1394 Ga0157371_10072161
1395 Ga0157370_10142808
1396 Ga0157370_10198346
1397 Ga0157369_10000592
1398 Ga0157369_10003003
1399 Ga0157369_10005867
1400 Ga0157369_10015743
1401 Ga0157369_10105538
1402 Ga0157369_10122337
1403 Ga0157369_10175553
1404 Ga0157374_10000181
1405 Ga0157374_10002512
1406 Ga0157374_10003490
1407 Ga0157374_10005598
1408 Ga0157374_10007938
1409 Ga0157374_10008005
1410 Ga0157374_10048161
1411 Ga0157374_10097761
1412 Ga0157374_10109973
1413 Ga0157374_10119686
1414 Ga0157374_10248561
1415 Ga0157378_10000351
1416 Ga0157378_10000680
1417 Ga0157378_10002074
1418 Ga0157378_10007912
1419 Ga0157378_10032836
1420 Ga0163162_10002555
1421 Ga0163162_10004210
1422 Ga0163162_10019239
1423 Ga0163162_10037123
1424 Ga0163162_10348938
1425 Ga0157372_10001790
1426 Ga0157372_10004337
1427 Ga0157372_10005053
1428 Ga0157372_10009344
1429 Ga0157372_10024941
1430 Ga0157372_10060773
1431 Ga0157372_10128283
1432 Ga0157372_10257754
1433 Ga0157375_10140664
1434 Ga0163163_10001815
1435 Ga0163163_10004099
1436 Ga0163163_10028700
1437 Ga0163163_10029712
1438 Ga0163163_10036969
1439 Ga0157380_10019901
1440 Ga0182008_10005863
1441 Ga0182008_10019030
1442 Ga0157377_10004842
1443 Ga0157379_10007009
1444 Ga0157379_10028378
1445 Ga0157379_10101371
1446 Ga0157376_10017528
1447 Ga0157376_10024032
1448 Ga0157376_10038962
1449 Ga0157376_10062314
1450 Ga0182005_1012321
1451 Ga0163161_10028230
1452 Ga0206350_10321460
1453 Ga0213875_10015997
1454 Ga0213875_10053330
1455 Ga0224569_100109
1456 Ga0224572_1000176
1457 Ga0224572_1004882
1458 Ga0228598_1000307
1459 Ga0228598_1000403
1460 Ga0228598_1003454
1461 Ga0207682_10018935
1462 Ga0207692_10002000
1463 Ga0207692_10003777
1464 Ga0207688_10018778
1465 Ga0207685_10007955
1466 Ga0207685_10012888
1467 Ga0207685_10018117
1468 Ga0207685_10049676
1469 Ga0207699_10000209
1470 Ga0207699_10001910
1471 Ga0207699_10034606
1472 Ga0207699_10122246
1473 Ga0207699_10139490
1474 Ga0207645_10001689
1475 Ga0207643_10002573
1476 Ga0207705_10101398
1477 Ga0207684_10000614
1478 Ga0207684_10001674
1479 Ga0207684_10001907
1480 Ga0207684_10001969
1481 Ga0207684_10006371
1482 Ga0207684_10008375
1483 Ga0207684_10011025
1484 Ga0207684_10014168
1485 Ga0207684_10020974
1486 Ga0207684_10035114
1487 Ga0207654_10022720
1488 Ga0207654_10042456
1489 Ga0207707_10001674
1490 Ga0207707_10003911
1491 Ga0207707_10036898
1492 Ga0207707_10102144
1493 Ga0207707_10122815
1494 Ga0207707_10127238
1495 Ga0207707_10150162
1496 Ga0207695_10004906
1497 Ga0207695_10022194
1498 Ga0207695_10047565
1499 Ga0207695_10066809
1500 Ga0207695_10166797
1501 Ga0207695_10198777
1502 Ga0207695_10307483
1503 Ga0207671_10007474
1504 Ga0207671_10028761
1505 Ga0207671_10070899
1506 Ga0207671_10124080
1507 Ga0207671_10184594
1508 Ga0207693_10000019
1509 Ga0207693_10000026
1510 Ga0207693_10000275
1511 Ga0207693_10000402
1512 Ga0207693_10007781
1513 Ga0207693_10008118
1514 Ga0207693_10018551
1515 Ga0207693_10042186
1516 Ga0207693_10049654
1517 Ga0207663_10003860
1518 Ga0207663_10018272
1519 Ga0207663_10058101
1520 Ga0207663_10077574
1521 Ga0207663_10077735
1522 Ga0207663_10126781
1523 Ga0207660_10055731
1524 Ga0207660_10063911
1525 Ga0207662_10012728
1526 Ga0207657_10002285
1527 Ga0207657_10002326
1528 Ga0207657_10003520
1529 Ga0207649_10000445
1530 Ga0207652_10025153
1531 Ga0207652_10217927
1532 Ga0207646_10000019
1533 Ga0207646_10000669
1534 Ga0207646_10002238
1535 Ga0207646_10002825
1536 Ga0207646_10005899
1537 Ga0207646_10008437
1538 Ga0207646_10044442
1539 Ga0207646_10045190
1540 Ga0207646_10065297
1541 Ga0207646_10071657
1542 Ga0207646_10162627
1543 Ga0207646_10234475
1544 Ga0207694_10019688
1545 Ga0207694_10059571
1546 Ga0207694_10096829
1547 Ga0207694_10221860
1548 Ga0207650_10000053
1549 Ga0207650_10067199
1550 Ga0207659_10040078
1551 Ga0207687_10007071
1552 Ga0207687_10016050
1553 Ga0207687_10020914
1554 Ga0207687_10097425
1555 Ga0207700_10000111
1556 Ga0207700_10000348
1557 Ga0207700_10010240
1558 Ga0207700_10016653
1559 Ga0207700_10041153
1560 Ga0207700_10057438
1561 Ga0207700_10090889
1562 Ga0207700_10100086
1563 Ga0207700_10228021
1564 Ga0207664_10000098
1565 Ga0207664_10000236
1566 Ga0207664_10006442
1567 Ga0207664_10152939
1568 Ga0207664_10168756
1569 Ga0207664_10182327
1570 Ga0207644_10019899
1571 Ga0207644_10044605
1572 Ga0207690_10015345
1573 Ga0207706_10002255
1574 Ga0207706_10017718
1575 Ga0207706_10057458
1576 Ga0207706_10103675
1577 Ga0207670_10015855
1578 Ga0207704_10036846
1579 Ga0207665_10000358
1580 Ga0207665_10004365
1581 Ga0207665_10012284
1582 Ga0207665_10027306
1583 Ga0207665_10027941
1584 Ga0207665_10087926
1585 Ga0207665_10102034
1586 Ga0207665_10168366
1587 Ga0207665_10186763
1588 Ga0207691_10003568
1589 Ga0207711_10014801
1590 Ga0207711_10041085
1591 Ga0207711_10051892
1592 Ga0207689_10000542
1593 Ga0207689_10002682
1594 Ga0207689_10007004
1595 Ga0207689_10011534
1596 Ga0207689_10127005
1597 Ga0207661_10001208
1598 Ga0207661_10088275
1599 Ga0207661_10167122
1600 Ga0207661_10174741
1601 Ga0207679_10001783
1602 Ga0207679_10111452
1603 Ga0207679_10145463
1604 Ga0207667_10007869
1605 Ga0207667_10064866
1606 Ga0207667_10120976
1607 Ga0207667_10144355
1608 Ga0207667_10177880
1609 Ga0207667_10463604
1610 Ga0207651_10001496
1611 Ga0207640_10011254
1612 Ga0207640_10044413
1613 Ga0207640_10044827
1614 Ga0207658_10005363
1615 Ga0207658_10048547
1616 Ga0207677_10002399
1617 Ga0207677_10009986
1618 Ga0207677_10023183
1619 Ga0207703_10032180
1620 Ga0207703_10032365
1621 Ga0207703_10037964
1622 Ga0207703_10064606
1623 Ga0207703_10229424
1624 Ga0207639_10000640
1625 Ga0207639_10020974
1626 Ga0207639_10060639
1627 Ga0207639_10255054
1628 Ga0207678_10000840
1629 Ga0207678_10006402
1630 Ga0207708_10039749
1631 Ga0207702_10000962
1632 Ga0207702_10000989
1633 Ga0207702_10005687
1634 Ga0207702_10007050
1635 Ga0207702_10009982
1636 Ga0207702_10031974
1637 Ga0207702_10049632
1638 Ga0207702_10051111
1639 Ga0207641_10000104
1640 Ga0207641_10020452
1641 Ga0207641_10048986
1642 Ga0207641_10124490
1643 Ga0207648_10002557
1644 Ga0207648_10003472
1645 Ga0207648_10047789
1646 Ga0207676_10000491
1647 Ga0207676_10033521
1648 Ga0207676_10141069
1649 Ga0207676_10161916
1650 Ga0207674_10000867
1651 Ga0207674_10001318
1652 Ga0207674_10010008
1653 Ga0207674_10027636
1654 Ga0207675_100047635
1655 Ga0207675_100134021
1656 Ga0207683_10003204
1657 Ga0207683_10054308
1658 Ga0207698_10126136
1659 Ga0207698_10306128
1660 Ga0265356_1000478
1661 Ga0268264_10073344
1662 Ga0268264_10103983
1663 Ga0268264_10266229
1664 Ga0265319_1001935
1665 Ga0265318_10000470
1666 Ga0265323_10002678
1667 Ga0265338_10000833
1668 Ga0265338_10011557
1669 Ga0265338_10040971
1670 Ga0265762_1000119
1671 Ga0265762_1000777
1672 Ga0265760_10021498
1673 Ga0265330_10000124
1674 Ga0265330_10001029
1675 Ga0265330_10002039
1676 Ga0265330_10076568
1677 Ga0265332_10000212
1678 Ga0265332_10048198
1679 Ga0265328_10019321
1680 Ga0265328_10057548
1681 Ga0265320_10000458
1682 Ga0265325_10001657
1683 Ga0265325_10003282
1684 Ga0265325_10017529
1685 Ga0265325_10021709
1686 Ga0265325_10037343
1687 Ga0265329_10000608
1688 Ga0265329_10001963
1689 Ga0265340_10009453
1690 Ga0265340_10033192
1691 Ga0265340_10048740
1692 Ga0265339_10003136
1693 Ga0265339_10006988
1694 Ga0265339_10013445
1695 Ga0265339_10015031
1696 Ga0265339_10027092
1697 Ga0265339_10060133
1698 Ga0265331_10000626
1699 Ga0265331_10030706
1700 Ga0265331_10038598
1701 Ga0265316_10000007
1702 Ga0265316_10001212
1703 Ga0265316_10001409
1704 Ga0265316_10001455
1705 Ga0265316_10006292
1706 Ga0265316_10014345
1707 Ga0265316_10018684
1708 Ga0265316_10104097
1709 Ga0265316_10113100
1710 Ga0265316_10136540
1711 Ga0307408_100082813
1712 Ga0265313_10002578
1713 Ga0265313_10007574
1714 Ga0265313_10027981
1715 Ga0265314_10000005
1716 Ga0265314_10024310
1717 Ga0265314_10026888
1718 Ga0265314_10060022
1719 Ga0265314_10063551
1720 Ga0265342_10000005
1721 Ga0265342_10001134
1722 Ga0265342_10004629
1723 Ga0265342_10019414
1724 Ga0265342_10031316
1725 Ga0265342_10036519
1726 Ga0307410_10030830
1727 Ga0307409_100012125
1728 Ga0307409_100024575
1729 Ga0307416_100108397
1730 Ga0307416_100140771
1731 Ga0307411_10030856
1732 Ga0307411_10092114
1733 Ga0307415_100012606
1734 Ga0316212_1001343
1735 Ga0373926_0004972
1736 Ga0373926_0010368
1737 Ga0373926_0015292
1738 Ga0373923_0022376
1739 Ga0373923_0059778
1740 Ga0373923_0106516
1741 Ga0373936_0000926
1742 Ga0373936_0011529
1743 Ga0373936_0081728
1744 Ga0373945_0001045
1745 Ga0373945_0007285
1746 Ga0373953_0031745
1747 Ga0373954_0001164
1748 Ga0373954_0001795
1749 Ga0373954_0021171
1750 Ga0373954_0066734
1751 Ga0373956_0008228
1752 Ga0373956_0020933
1753 Ga0373957_0038484
1754 Ga0373943_0000008
1755 Ga0373943_0001310
1756 Ga0373943_0001571
1757 Ga0373943_0012801
1758 Ga0373943_0094993
1759 Ga0373943_0112791
1760 Ga0373946_0001764
1761 Ga0373946_0005469
1762 Ga0373946_0008093
1763 Ga0373946_0015286
1764 Ga0373955_0004246
1765 Ga0373955_0033059
1766 Ga0373924_0037381
1767 Ga0373935_0001333
1768 Ga0373935_0003639
1769 Ga0373935_0009893
1770 Ga0373935_0011396
1771 Ga0373935_0012288
1772 Ga0373935_0024750
1773 Ga0373935_0060369
1774 Ga0373935_0231910
1775 Ga0373927_0000102
1776 Ga0373927_0000282
1777 Ga0373927_0004903
1778 Ga0373927_0010628
1779 Ga0373927_0016685
1780 Ga0373927_0019643
1781 Ga0373927_0020788
1782 Ga0373933_0006743
1783 Ga0373933_0029242
1784 Ga0373933_0117310
1785 Ga0373947_0000085
1786 Ga0373947_0003324
1787 Ga0373947_0003884
1788 Ga0373947_0006708
1789 Ga0373947_0116762
1790 Ga0373937_0001894
1791 Ga0373937_0002447
1792 Ga0373937_0005085
1793 Ga0373937_0011706
1794 Ga0373937_0038559
1795 Ga0373937_0083614
1796 Ga0373937_0220607
1797 Ga0373937_0580937
1798 Ga0373925_0001250
1799 Ga0373925_0001997
1800 Ga0373925_0004385
1801 Ga0373925_0005430
1802 Ga0373925_0006324
1803 Ga0373925_0008172
1804 Ga0373925_0009582
1805 Ga0373925_0022106
1806 Ga0373925_0027423
1807 Ga0373925_0195655
1808 Ga0373925_0198205
1809 Ga0395900_0389009
1810 Ga0395898_0018272
1811 Ga0395905_0052302
1812 Ga0395905_0222452
1813 Ga0436364_0111624
1814 Ga0436364_0800841
1815 Ga0436364_1031116
1816 Ga0400483_037104
1817 Ga0436365_1001330
1818 Ga0436360_0296885
1819 Ga0436361_0511551
1820 Ga0436363_1035544
1821 Ga0436363_1571670
1822 Ga0436362_0552319
1823 Ga0451577_0000523
1824 Ga0451577_0137874
1825 Ga0466969_0041440
1826 Ga0453683_0001517
1827 Ga0453683_0003698
1828 Ga0453683_0075830
1829 Ga0466966_0006612
1830 Ga0466963_0007856
1831 Ga0466963_0039646
1832 Ga0466963_0165055
1833 Ga0466964_0057564
1834 Ga0453684_0000951
1835 Ga0453684_0007605
1836 Ga0453684_0290717
1837 Ga0466957_0005729
1838 Ga0466957_0042258
1839 Ga0466957_0131339
1840 Ga0466959_0030420
1841 Ga0466959_0133235
1842 Ga0466959_0210256
1843 Ga0451576_0010527
1844 Ga0451576_0034449
1845 Ga0451576_0080028
1846 Ga0451576_0273611
1847 Ga0466958_0016272
1848 Ga0466967_0036308
1849 Ga0466967_0106794
1850 Ga0466967_0172547
1851 Ga0466967_0330482
1852 Ga0466967_0372808
1853 Ga0495592_0052904
1854 Ga0495592_0088598
1855 Ga0495603_0067613
1856 Ga0495629_0018762
1857 Ga0495651_0001954
1858 Ga0495651_0012679
1859 Ga0495651_0016421
1860 Ga0495651_0029697
1861 Ga0495651_0151062
1862 Ga0495653_0025083
1863 Ga0495580_0000345
1864 Ga0495580_0000603
1865 Ga0495580_0001544
1866 Ga0495580_0002140
1867 Ga0495580_0011670
1868 Ga0495580_0011687
1869 Ga0495580_0016391
1870 Ga0495580_0034691
1871 Ga0495580_0043314
1872 Ga0495580_0053894
1873 Ga0495580_0063084
1874 Ga0495580_0076385
1875 Ga0495580_0081695
1876 Ga0495580_0095575
1877 Ga0495580_0124499
1878 Ga0495582_0000622
1879 Ga0495582_0001976
1880 Ga0495664_0016600
1881 Ga0495664_0039253
1882 Ga0495664_0098607
1883 Ga0495594_0058971
1884 Ga0495608_0005808
1885 Ga0495608_0026115
1886 Ga0495608_0031296
1887 Ga0495618_0051470
1888 Ga0495628_0007555
1889 Ga0495628_0026495
1890 Ga0495628_0034642
1891 Ga0495630_0003848
1892 Ga0495630_0081791
1893 Ga0495630_0189669
1894 Ga0495630_0264763
1895 Ga0495666_0035186
1896 Ga0495652_0004346
1897 Ga0495652_0039044
1898 Ga0495665_0001833
1899 Ga0495665_0001960
1900 Ga0495665_0072920
1901 Ga0495665_0078394
1902 Ga0495586_0075562
1903 Ga0495587_0000442
1904 Ga0495587_0004541
1905 Ga0495587_0010761
1906 Ga0495587_0053780
1907 Ga0495667_0007526
1908 Ga0495667_0044689
1909 Ga0495635_0016351
1910 Ga0495635_0033122
1911 Ga0495635_0153091
1912 Ga0495659_0008336
1913 Ga0495657_0013658
1914 Ga0495657_0074612
1915 Ga0495599_0008189
1916 Ga0495599_0108798
1917 Ga0495623_0001371
1918 Ga0495646_0011292
1919 Ga0495658_0007843
1920 Ga0495669_0035913
1921 Ga0495669_0043013
1922 Ga0495600_0005598
1923 Ga0495600_0021037
1924 Ga0495604_0000979
1925 Ga0495604_0045188
1926 Ga0495604_0055899
1927 Ga0495604_0059116
1928 Ga0495674_0001505
1929 Ga0495674_0004208
1930 Ga0495674_0031174
1931 Ga0495674_0062055
1932 Ga0495674_0167501
1933 Ga0495676_0140941
1934 Ga0495680_0000547
1935 Ga0495675_0000027
1936 Ga0495675_0014852
1937 Ga0495675_0023510
1938 Ga0495675_0155111
1939 Ga0495684_0029877
1940 Ga0495684_0060295
1941 Ga0495684_0124963
1942 Ga0495593_0022382
1943 Ga0495602_0002605
1944 Ga0495602_0008897
1945 Ga0495602_0104366
1946 Ga0495614_0087577
1947 Ga0496100_0062003
1948 Ga0496100_0123429
1949 Ga0496102_0000786
1950 Ga0496102_0030087
1951 Ga0496102_0062839
1952 Ga0496102_0142404
1953 Ga0496102_0363525
1954 Ga0496104_0201121
1955 Ga0496104_0232464
1956 Ga0496104_0440221
1957 Ga0496105_0000399
1958 Ga0496105_0008491
1959 Ga0496105_0041633
1960 Ga0496106_0152843
1961 Ga0496108_0000629
1962 Ga0496109_0000270
1963 Ga0496109_0078788
1964 Ga0496109_0173966
1965 Ga0496109_0321638
1966 Ga0496110_0002501
1967 Ga0496110_0080645
1968 Ga0496112_0000121
1969 Ga0496112_0001114
1970 Ga0496112_0003512
1971 Ga0496112_0005362
1972 Ga0496112_0006571
1973 Ga0496112_0027881
1974 Ga0496112_0031725
1975 Ga0496112_0039232
1976 Ga0496112_0061570
1977 Ga0496112_0116729
1978 Ga0496112_0120908
1979 Ga0496112_0172253
1980 Ga0496112_0190516
1981 Ga0496112_0258193
1982 Ga0496112_0313136
1983 Ga0496113_0002775
1984 Ga0496113_0072803
1985 Ga0496113_0075589
1986 Ga0496113_0114865
1987 Ga0496114_0138203
1988 Ga0496115_0039011
1989 Ga0496115_0100120
1990 Ga0496115_0113427
1991 Ga0496115_0148247
1992 Ga0496115_0278163
1993 Ga0501032_0005704
1994 Ga0501033_0037420
1995 Ga0501034_0130187
1996 Ga0501034_0215273
1997 Ga0501036_0114081
1998 Ga0501037_0009000
1999 Ga0501038_0251947
2000 Ga0501040_0049459
2001 Ga0501043_0009517
2002 Ga0501047_0017578
2003 Ga0501048_0006576
2004 Ga0501068_0001225
2005 Ga0501070_0010893
2006 Ga0501072_0001261
2007 Ga0501073_0002323
2008 Ga0501074_0012760
2009 Ga0501076_0071055
2010 Ga0501077_0012602
2011 Ga0501257_016927
2012 Ga0501080_0000017
2013 Ga0501268_003670
2014 Ga0501270_006070
2015 Ga0501035_0029617
2016 Ga0501044_0010324
2017 Ga0501044_0025922
2018 nmdc:mga05p37_339084_c1
2019 nmdc:mga09592_87263_c1
2020 nmdc:mga0n895_1177_c1
2021 nmdc:mga0n895_184695_c1
2022 nmdc:mga0n895_299932_c1
2023 nmdc:mga0n895_62884_c1
2024 nmdc:mga0n895_92004_c1
2025 nmdc:mga0rr50_18350_c1
2026 nmdc:mga08x19_131676_c1
2027 nmdc:mga08x19_134_c1
2028 nmdc:mga08x19_20953_c1
2029 nmdc:mga08x19_2332_c1
2030 nmdc:mga08x19_26514_c1
2031 nmdc:mga08x19_5825_c2
2032 nmdc:mga08x19_6467_c1
2033 nmdc:mga08x19_7445_c1
2034 nmdc:mga0a205_109175_c1
2035 nmdc:mga0a205_8182_c1
2036 Ga0495601_0001642
2037 Ga0495601_0015532
2038 Ga0495612_0002730
2039 Ga0495619_0003442
2040 2673165357

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

246

461

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xev-assembly1.cif.gz_A-2 crystal structure of a novel xaa-pro dipeptidase from deinococcus radiodurans 0.9288 14 398
5xev-assembly1.cif.gz_A-2 crystal structure of a novel xaa-pro dipeptidase from deinococcus radiodurans 0.8909 14 398
3s6b-assembly1.cif.gz_A crystal structure of methionine aminopeptidase 1b from plasmodium falciparum, pf10_0150 0.8026 153 396
4a6v-assembly1.cif.gz_A x-ray structures of oxazole hydroxamate ecmetap-mn complexes 0.7901 153 397
8p2k-assembly1.cif.gz_MA ternary complex of translating ribosome, nac and metap1 0.778 153 397
ID Description Score Start End Superfamily
af_P9WHS7_144_374_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9117 154 400 3.90.230.10
2howB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9064 155 401 3.90.230.10
5cdlA02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9055 154 397 3.90.230.10
1wy2A02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9032 155 399 3.90.230.10
2howB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8987 155 401 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A1Q7V5U3-F1-model_v4 Peptidase M24 domain-containing protein 0.9975 14 401
AF-Q1IIU2-F1-model_v4 Peptidase M24 0.9957 14 401
AF-A0A1Q7V5U3-F1-model_v4 Peptidase M24 domain-containing protein 0.995 14 401
AF-A0A7C7LAW6-F1-model_v4 Aminopeptidase P family protein 0.9936 200 401 GO:0004177
AF-Q1IIU2-F1-model_v4 Peptidase M24 0.9932 14 401

Map