F488148

General Info

Members Datasets Scaffolds Average Seq Length
1011 220 1011 417

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0283871|Ga0395900_0283871_80_1489
Length 469
Sequence MRESVSRLGSDSIVSGNDRYRVWRDAQSWLCVRTYSDGSPRAPTLIQNITHLLRARRFVPLFATQFLGAFNDSLFKQAVVLFVTYQLFSDPHREFQFSAIAQGLFILPFFLFSALAGQIADDHDKARLIRIIKFAEILIMILGGAGLMLANIPLMLAGVFAMGIHSTFFGPIKYAILPQHLDRDEVLGGTGLVEAGTYIAILLGTILAGVLASRPQSAAAAVLVFALLGYFAGRQVPPAPPAAERLPITWHIIHASIELVSGTLHIRRLFLAILSISFFWTIGAVLIIIFPPLVKNVLGADEQVASLFIAIFSIGIAIGSVAINRMLKSEVSARFAPASVIAMGLFVLLLHFVALSWGKHNGPSLTTLANFLFNPMAWPLILCLLGVAITGGMFVVPLYAFLTTTVPKTETARTVAANNIVNSGAMVIXXXXAFGLSSAGVGPVGQLLLVAGMCLVSAWLGWKLHLACD

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
168 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
169 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
216 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
217 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 3.86
Rhizosphere 95.25
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000905 3300001915 Bacteria 8936
2 JGI24740J21852_10000708 3300001979 Bacteria 14454
3 JGI24740J21852_10001368 3300001979 Bacteria 11122
4 JGI24740J21852_10002192 3300001979 Bacteria 8929
5 JGI24740J21852_10004085 3300001979 Bacteria 6316
6 JGI24740J21852_10009591 3300001979 Bacteria 3780
7 JGI24739J22299_10005249 3300001989 Bacteria 4936
8 JGI24739J22299_10005592 3300001989 Bacteria 4767
9 JGI24739J22299_10017121 3300001989 Bacteria 2618
10 JGI24737J22298_10000083 3300001990 Bacteria 27631
11 JGI24737J22298_10000489 3300001990 Bacteria 13756
12 JGI24737J22298_10000515 3300001990 Bacteria 13560
13 JGI24737J22298_10004705 3300001990 Bacteria 4744
14 JGI24737J22298_10007117 3300001990 Bacteria 3791
15 JGI24743J22301_10008145 3300001991 Bacteria 1833
16 JGI24735J21928_10000952 3300002067 Bacteria 10337
17 JGI24735J21928_10024019 3300002067 Bacteria 1847
18 JGI24738J21930_10000137 3300002075 Bacteria 17884
19 JGI24738J21930_10000658 3300002075 Bacteria 10012
20 JGI24738J21930_10003143 3300002075 Bacteria 4227
21 JGI24738J21930_10008137 3300002075 Bacteria 2392
22 JGI24744J21845_10000562 3300002077 Bacteria 6714
23 Ga0065715_10027510 3300005293 Bacteria 1545
24 Ga0070658_10000130 3300005327 Bacteria 66295
25 Ga0070658_10001253 3300005327 Bacteria 21758
26 Ga0070658_10003302 3300005327 Bacteria 13307
27 Ga0070658_10008670 3300005327 Bacteria 8169
28 Ga0070658_10013565 3300005327 Bacteria 6537
29 Ga0070658_10027498 3300005327 Bacteria 4563
30 Ga0070658_10035785 3300005327 Bacteria 4000
31 Ga0070658_10037552 3300005327 Bacteria 3905
32 Ga0070658_10058340 3300005327 Bacteria 3141
33 Ga0070658_10060755 3300005327 Bacteria 3078
34 Ga0070658_10078019 3300005327 Bacteria 2718
35 Ga0070658_10194499 3300005327 Bacteria 1710
36 Ga0070676_10001742 3300005328 Bacteria 11077
37 Ga0070676_10005075 3300005328 Bacteria 6981
38 Ga0070676_10012653 3300005328 Bacteria 4613
39 Ga0070683_100003807 3300005329 Bacteria 12325
40 Ga0070683_100017720 3300005329 Bacteria 6293
41 Ga0070683_100017806 3300005329 Bacteria 6278
42 Ga0070683_100049766 3300005329 Bacteria 3877
43 Ga0070683_100090024 3300005329 Bacteria 2880
44 Ga0070683_100171655 3300005329 Bacteria 2058
45 Ga0070683_100205234 3300005329 Bacteria 1872
46 Ga0070690_100015310 3300005330 Bacteria 4573
47 Ga0070690_100029475 3300005330 Bacteria 3405
48 Ga0070670_100003621 3300005331 Bacteria 12862
49 Ga0070670_100007935 3300005331 Bacteria 9032
50 Ga0070670_100009865 3300005331 Bacteria 8154
51 Ga0070670_100014320 3300005331 Bacteria 6804
52 Ga0070670_100019881 3300005331 Bacteria 5765
53 Ga0070670_100021575 3300005331 Bacteria 5538
54 Ga0070670_100024843 3300005331 Bacteria 5155
55 Ga0070670_100038410 3300005331 Bacteria 4117
56 Ga0070670_100047086 3300005331 Bacteria 3709
57 Ga0070677_10004870 3300005333 Bacteria 4407
58 Ga0068869_100000354 3300005334 Bacteria 24639
59 Ga0070666_10000413 3300005335 Bacteria 26576
60 Ga0070666_10000841 3300005335 Bacteria 18619
61 Ga0070666_10013618 3300005335 Bacteria 5164
62 Ga0070666_10018324 3300005335 Bacteria 4499
63 Ga0070666_10074062 3300005335 Bacteria 2320
64 Ga0070680_100002095 3300005336 Bacteria 14733
65 Ga0070680_100002826 3300005336 Bacteria 12903
66 Ga0070680_100004105 3300005336 Bacteria 10908
67 Ga0070680_100007978 3300005336 Bacteria 8082
68 Ga0070680_100033294 3300005336 Bacteria 4153
69 Ga0070680_100067459 3300005336 Bacteria 2934
70 Ga0070680_100143961 3300005336 Bacteria 1999
71 Ga0070682_100023584 3300005337 Bacteria 3654
72 Ga0068868_100000103 3300005338 Bacteria 52264
73 Ga0068868_100000237 3300005338 Bacteria 37449
74 Ga0068868_100014704 3300005338 Bacteria 5772
75 Ga0068868_100062346 3300005338 Bacteria 2955
76 Ga0068868_100190274 3300005338 Bacteria 1706
77 Ga0070660_100000391 3300005339 Bacteria 29107
78 Ga0070660_100000830 3300005339 Bacteria 20537
79 Ga0070660_100001016 3300005339 Bacteria 18852
80 Ga0070660_100002265 3300005339 Bacteria 13215
81 Ga0070660_100026890 3300005339 Bacteria 4287
82 Ga0070660_100028243 3300005339 Bacteria 4195
83 Ga0070660_100031872 3300005339 Bacteria 3962
84 Ga0070660_100042325 3300005339 Bacteria 3476
85 Ga0070660_100044154 3300005339 Bacteria 3408
86 Ga0070660_100095608 3300005339 Bacteria 2348
87 Ga0070689_100041464 3300005340 Bacteria 3534
88 Ga0070691_10048544 3300005341 Bacteria 2020
89 Ga0070687_100008048 3300005343 Bacteria 4439
90 Ga0070661_100000206 3300005344 Bacteria 48811
91 Ga0070661_100005164 3300005344 Bacteria 8988
92 Ga0070661_100006011 3300005344 Bacteria 8354
93 Ga0070661_100010905 3300005344 Bacteria 6329
94 Ga0070661_100011275 3300005344 Bacteria 6227
95 Ga0070661_100013976 3300005344 Bacteria 5644
96 Ga0070661_100027769 3300005344 Bacteria 4077
97 Ga0070661_100029153 3300005344 Bacteria 3982
98 Ga0070661_100037305 3300005344 Bacteria 3535
99 Ga0070661_100039088 3300005344 Bacteria 3456
100 Ga0070661_100047459 3300005344 Bacteria 3143
101 Ga0070661_100048908 3300005344 Bacteria 3096
102 Ga0070661_100072306 3300005344 Bacteria 2538
103 Ga0070692_10001029 3300005345 Bacteria 9613
104 Ga0070692_10005490 3300005345 Bacteria 5416
105 Ga0070692_10007460 3300005345 Bacteria 4815
106 Ga0070692_10013194 3300005345 Bacteria 3847
107 Ga0070692_10017011 3300005345 Bacteria 3469
108 Ga0070692_10066586 3300005345 Bacteria 1910
109 Ga0070668_100004880 3300005347 Bacteria 9938
110 Ga0070668_100068423 3300005347 Bacteria 2760
111 Ga0070669_100000870 3300005353 Bacteria 21987
112 Ga0070669_100024763 3300005353 Bacteria 4306
113 Ga0070669_100032494 3300005353 Bacteria 3769
114 Ga0070669_100055113 3300005353 Bacteria 2913
115 Ga0070675_100003436 3300005354 Bacteria 12002
116 Ga0070675_100036547 3300005354 Bacteria 3998
117 Ga0070675_100053466 3300005354 Bacteria 3321
118 Ga0070675_100064279 3300005354 Bacteria 3034
119 Ga0070671_100001277 3300005355 Bacteria 18890
120 Ga0070671_100002146 3300005355 Bacteria 15236
121 Ga0070671_100003748 3300005355 Bacteria 11935
122 Ga0070671_100006325 3300005355 Bacteria 9448
123 Ga0070671_100011816 3300005355 Bacteria 7024
124 Ga0070671_100012700 3300005355 Bacteria 6788
125 Ga0070671_100022040 3300005355 Bacteria 5204
126 Ga0070671_100022396 3300005355 Bacteria 5160
127 Ga0070671_100022833 3300005355 Bacteria 5111
128 Ga0070671_100035764 3300005355 Bacteria 4115
129 Ga0070671_100047487 3300005355 Bacteria 3570
130 Ga0070671_100186377 3300005355 Bacteria 1758
131 Ga0070674_100008282 3300005356 Bacteria 6185
132 Ga0070674_100009998 3300005356 Bacteria 5713
133 Ga0070674_100013432 3300005356 Bacteria 5063
134 Ga0070674_100019817 3300005356 Bacteria 4282
135 Ga0070674_100071873 3300005356 Bacteria 2448
136 Ga0070673_100000336 3300005364 Bacteria 24639
137 Ga0070673_100002521 3300005364 Bacteria 11187
138 Ga0070673_100003078 3300005364 Bacteria 10322
139 Ga0070673_100004667 3300005364 Bacteria 8699
140 Ga0070673_100008886 3300005364 Bacteria 6713
141 Ga0070673_100011294 3300005364 Bacteria 6090
142 Ga0070673_100035919 3300005364 Bacteria 3762
143 Ga0070659_100000817 3300005366 Bacteria 22741
144 Ga0070659_100000884 3300005366 Bacteria 21912
145 Ga0070659_100014992 3300005366 Bacteria 5797
146 Ga0070659_100015136 3300005366 Bacteria 5770
147 Ga0070659_100017370 3300005366 Bacteria 5413
148 Ga0070659_100020644 3300005366 Bacteria 5007
149 Ga0070659_100039160 3300005366 Bacteria 3699
150 Ga0070659_100039913 3300005366 Bacteria 3666
151 Ga0070659_100045782 3300005366 Bacteria 3428
152 Ga0070659_100057226 3300005366 Bacteria 3074
153 Ga0070667_100001053 3300005367 Bacteria 25196
154 Ga0070667_100003548 3300005367 Bacteria 13295
155 Ga0070667_100004684 3300005367 Bacteria 11476
156 Ga0070667_100019140 3300005367 Bacteria 5678
157 Ga0070667_100019866 3300005367 Bacteria 5574
158 Ga0070667_100043584 3300005367 Bacteria 3766
159 Ga0070709_10112984 3300005434 Bacteria 1829
160 Ga0070714_100006882 3300005435 Bacteria 8812
161 Ga0070714_100008944 3300005435 Bacteria 7838
162 Ga0070714_100022003 3300005435 Bacteria 5223
163 Ga0070714_100035022 3300005435 Bacteria 4206
164 Ga0070714_100104375 3300005435 Bacteria 2501
165 Ga0070713_100007630 3300005436 Bacteria 7614
166 Ga0070713_100014226 3300005436 Bacteria 5899
167 Ga0070713_100020489 3300005436 Bacteria 5070
168 Ga0070713_100154752 3300005436 Bacteria 2042
169 Ga0070694_100005307 3300005444 Bacteria 7794
170 Ga0070663_100002583 3300005455 Bacteria 10225
171 Ga0070663_100003200 3300005455 Bacteria 9403
172 Ga0070663_100004737 3300005455 Bacteria 8026
173 Ga0070663_100015559 3300005455 Bacteria 4916
174 Ga0070663_100016846 3300005455 Bacteria 4755
175 Ga0070663_100029359 3300005455 Bacteria 3757
176 Ga0070663_100046077 3300005455 Bacteria 3083
177 Ga0070663_100144032 3300005455 Bacteria 1822
178 Ga0070663_100209215 3300005455 Bacteria 1526
179 Ga0070678_100011880 3300005456 Bacteria 5389
180 Ga0070678_100012771 3300005456 Bacteria 5237
181 Ga0070678_100075221 3300005456 Bacteria 2540
182 Ga0070678_100111532 3300005456 Bacteria 2140
183 Ga0070662_100000107 3300005457 Bacteria 46051
184 Ga0070662_100000592 3300005457 Bacteria 22043
185 Ga0070662_100007824 3300005457 Bacteria 6942
186 Ga0070662_100008319 3300005457 Bacteria 6761
187 Ga0070662_100008913 3300005457 Bacteria 6540
188 Ga0070662_100010853 3300005457 Bacteria 5999
189 Ga0070662_100034454 3300005457 Bacteria 3571
190 Ga0070662_100057658 3300005457 Bacteria 2823
191 Ga0070662_100069466 3300005457 Bacteria 2592
192 Ga0070662_100083480 3300005457 Bacteria 2384
193 Ga0070662_100094581 3300005457 Bacteria 2250
194 Ga0070662_100220010 3300005457 Bacteria 1515
195 Ga0070681_10016414 3300005458 Bacteria 7392
196 Ga0070681_10054043 3300005458 Bacteria 4001
197 Ga0070681_10056741 3300005458 Bacteria 3897
198 Ga0070681_10065948 3300005458 Bacteria 3589
199 Ga0070681_10125763 3300005458 Bacteria 2496
200 Ga0070681_10129102 3300005458 Bacteria 2460
201 Ga0070681_10151535 3300005458 Bacteria 2245
202 Ga0070681_10166978 3300005458 Bacteria 2123
203 Ga0070681_10187917 3300005458 Bacteria 1986
204 Ga0068867_100000319 3300005459 Bacteria 31796
205 Ga0068867_100003291 3300005459 Bacteria 11370
206 Ga0068867_100015757 3300005459 Bacteria 5365
207 Ga0068867_100024875 3300005459 Bacteria 4294
208 Ga0068867_100029478 3300005459 Bacteria 3954
209 Ga0070679_100020767 3300005530 Bacteria 6406
210 Ga0070679_100054168 3300005530 Bacteria 3993
211 Ga0070679_100119070 3300005530 Bacteria 2625
212 Ga0070679_100119874 3300005530 Bacteria 2616
213 Ga0070679_100125523 3300005530 Bacteria 2549
214 Ga0070684_100002809 3300005535 Bacteria 12917
215 Ga0070684_100005959 3300005535 Bacteria 9391
216 Ga0070684_100008971 3300005535 Bacteria 7855
217 Ga0070684_100014804 3300005535 Bacteria 6329
218 Ga0070684_100019710 3300005535 Bacteria 5583
219 Ga0070684_100137913 3300005535 Bacteria 2204
220 Ga0068853_100000172 3300005539 Bacteria 45090
221 Ga0068853_100000360 3300005539 Bacteria 31342
222 Ga0068853_100006073 3300005539 Bacteria 9560
223 Ga0068853_100008708 3300005539 Bacteria 8162
224 Ga0068853_100023202 3300005539 Bacteria 5192
225 Ga0068853_100037060 3300005539 Bacteria 4148
226 Ga0068853_100037971 3300005539 Bacteria 4101
227 Ga0068853_100071667 3300005539 Bacteria 3018
228 Ga0068853_100091317 3300005539 Bacteria 2678
229 Ga0068853_100091548 3300005539 Bacteria 2675
230 Ga0068853_100161294 3300005539 Bacteria 2023
231 Ga0070672_100001298 3300005543 Bacteria 15390
232 Ga0070672_100001617 3300005543 Bacteria 14007
233 Ga0070672_100010275 3300005543 Bacteria 6488
234 Ga0070672_100010641 3300005543 Bacteria 6388
235 Ga0070672_100079739 3300005543 Bacteria 2621
236 Ga0070672_100131052 3300005543 Bacteria 2061
237 Ga0070695_100066139 3300005545 Bacteria 2355
238 Ga0070696_100009220 3300005546 Bacteria 6605
239 Ga0070693_100000967 3300005547 Bacteria 12766
240 Ga0070693_100015696 3300005547 Bacteria 3905
241 Ga0070665_100001570 3300005548 Bacteria 26346
242 Ga0070665_100001716 3300005548 Bacteria 25115
243 Ga0070665_100004175 3300005548 Bacteria 15195
244 Ga0070665_100012999 3300005548 Bacteria 8384
245 Ga0070665_100013480 3300005548 Bacteria 8223
246 Ga0070665_100018505 3300005548 Bacteria 6982
247 Ga0070665_100033315 3300005548 Bacteria 5184
248 Ga0070665_100037959 3300005548 Bacteria 4843
249 Ga0068855_100000640 3300005563 Bacteria 42846
250 Ga0068855_100006629 3300005563 Bacteria 14062
251 Ga0068855_100009143 3300005563 Bacteria 11968
252 Ga0068855_100009305 3300005563 Bacteria 11862
253 Ga0068855_100021901 3300005563 Bacteria 7661
254 Ga0068855_100025452 3300005563 Bacteria 7080
255 Ga0068855_100034044 3300005563 Bacteria 6077
256 Ga0068855_100062513 3300005563 Bacteria 4347
257 Ga0068855_100063164 3300005563 Bacteria 4322
258 Ga0068855_100143024 3300005563 Bacteria 2725
259 Ga0070664_100000032 3300005564 Bacteria 88298
260 Ga0070664_100001881 3300005564 Bacteria 16845
261 Ga0070664_100004011 3300005564 Bacteria 11822
262 Ga0070664_100004443 3300005564 Bacteria 11262
263 Ga0070664_100004751 3300005564 Bacteria 10894
264 Ga0070664_100007489 3300005564 Bacteria 8813
265 Ga0070664_100017818 3300005564 Bacteria 5832
266 Ga0070664_100019031 3300005564 Bacteria 5646
267 Ga0070664_100024097 3300005564 Bacteria 5031
268 Ga0070664_100036997 3300005564 Bacteria 4102
269 Ga0070664_100044861 3300005564 Bacteria 3733
270 Ga0070664_100079991 3300005564 Bacteria 2814
271 Ga0070664_100151036 3300005564 Bacteria 2051
272 Ga0068857_100000727 3300005577 Bacteria 24565
273 Ga0068857_100002020 3300005577 Bacteria 16453
274 Ga0068857_100007161 3300005577 Bacteria 9609
275 Ga0068857_100007759 3300005577 Bacteria 9247
276 Ga0068857_100009126 3300005577 Bacteria 8605
277 Ga0068857_100022950 3300005577 Bacteria 5489
278 Ga0068857_100057080 3300005577 Bacteria 3465
279 Ga0068857_100070654 3300005577 Bacteria 3110
280 Ga0068857_100099662 3300005577 Bacteria 2606
281 Ga0068857_100190312 3300005577 Bacteria 1869
282 Ga0068854_100000197 3300005578 Bacteria 40599
283 Ga0068854_100007242 3300005578 Bacteria 7083
284 Ga0068854_100015934 3300005578 Bacteria 4996
285 Ga0068854_100020084 3300005578 Bacteria 4512
286 Ga0068856_100000364 3300005614 Bacteria 49715
287 Ga0068856_100015239 3300005614 Bacteria 7428
288 Ga0068856_100026603 3300005614 Bacteria 5641
289 Ga0068852_100000780 3300005616 Bacteria 20902
290 Ga0068852_100002189 3300005616 Bacteria 13410
291 Ga0068852_100003915 3300005616 Bacteria 10462
292 Ga0068852_100018475 3300005616 Bacteria 5494
293 Ga0068852_100076608 3300005616 Bacteria 2953
294 Ga0068852_100109864 3300005616 Bacteria 2505
295 Ga0068859_100003376 3300005617 Bacteria 16233
296 Ga0068859_100011644 3300005617 Bacteria 8841
297 Ga0068859_100015465 3300005617 Bacteria 7665
298 Ga0068859_100029265 3300005617 Bacteria 5526
299 Ga0068859_100038508 3300005617 Bacteria 4797
300 Ga0068859_100130423 3300005617 Bacteria 2585
301 Ga0068864_100000331 3300005618 Bacteria 41699
302 Ga0068864_100000716 3300005618 Bacteria 27804
303 Ga0068864_100013298 3300005618 Bacteria 6817
304 Ga0068864_100014656 3300005618 Bacteria 6512
305 Ga0068864_100343928 3300005618 Bacteria 1406
306 Ga0068866_10015398 3300005718 Bacteria 3397
307 Ga0068866_10072421 3300005718 Bacteria 1825
308 Ga0068851_10006817 3300005834 Bacteria 5228
309 Ga0068851_10008326 3300005834 Bacteria 4794
310 Ga0068851_10015630 3300005834 Bacteria 3618
311 Ga0068851_10102752 3300005834 Bacteria 1518
312 Ga0068851_10107711 3300005834 Bacteria 1485
313 Ga0068870_10022008 3300005840 Bacteria 3128
314 Ga0068863_100006196 3300005841 Bacteria 11733
315 Ga0068863_100008814 3300005841 Bacteria 9850
316 Ga0068863_100011229 3300005841 Bacteria 8680
317 Ga0068863_100015760 3300005841 Bacteria 7258
318 Ga0068863_100022629 3300005841 Bacteria 6002
319 Ga0068863_100046144 3300005841 Bacteria 4135
320 Ga0068863_100055577 3300005841 Bacteria 3748
321 Ga0068863_100077693 3300005841 Bacteria 3142
322 Ga0068858_100000642 3300005842 Bacteria 36408
323 Ga0068858_100001213 3300005842 Bacteria 26754
324 Ga0068858_100004459 3300005842 Bacteria 13721
325 Ga0068858_100009762 3300005842 Bacteria 9139
326 Ga0068858_100015868 3300005842 Bacteria 7081
327 Ga0068858_100030657 3300005842 Bacteria 4994
328 Ga0068860_100002891 3300005843 Bacteria 17805
329 Ga0068860_100019853 3300005843 Bacteria 6517
330 Ga0068860_100020991 3300005843 Bacteria 6328
331 Ga0068860_100053149 3300005843 Bacteria 3852
332 Ga0068860_100101529 3300005843 Bacteria 2745
333 Ga0068860_100106469 3300005843 Bacteria 2678
334 Ga0068860_100211996 3300005843 Bacteria 1879
335 Ga0068862_100001236 3300005844 Bacteria 24103
336 Ga0068862_100013388 3300005844 Bacteria 6786
337 Ga0068862_100019041 3300005844 Bacteria 5724
338 Ga0068862_100037656 3300005844 Bacteria 4100
339 Ga0068862_100044284 3300005844 Bacteria 3795
340 Ga0070712_100018385 3300006175 Bacteria 4540
341 Ga0097621_100007314 3300006237 Bacteria 7890
342 Ga0068871_100045352 3300006358 Bacteria 3538
343 Ga0068871_100112995 3300006358 Bacteria 2287
344 Ga0068871_100262397 3300006358 Bacteria 1507
345 Ga0068865_100022651 3300006881 Bacteria 4101
346 Ga0097620_100003376 3300006931 Bacteria 16233
347 Ga0097620_100011643 3300006931 Bacteria 8841
348 Ga0097620_100015465 3300006931 Bacteria 7665
349 Ga0097620_100029264 3300006931 Bacteria 5526
350 Ga0097620_100038509 3300006931 Bacteria 4797
351 Ga0097620_100130426 3300006931 Bacteria 2585
352 Ga0105240_10036403 3300009093 Bacteria 6332
353 Ga0105245_10000407 3300009098 Bacteria 39932
354 Ga0105243_10083438 3300009148 Bacteria 2614
355 Ga0105241_10041508 3300009174 Bacteria 3476
356 Ga0105241_10072331 3300009174 Bacteria 2679
357 Ga0105248_10000238 3300009177 Bacteria 63658
358 Ga0105248_10001673 3300009177 Bacteria 24666
359 Ga0105248_10001772 3300009177 Bacteria 24028
360 Ga0105248_10008090 3300009177 Bacteria 11542
361 Ga0105248_10020703 3300009177 Bacteria 7289
362 Ga0105248_10021850 3300009177 Bacteria 7090
363 Ga0105248_10023558 3300009177 Bacteria 6839
364 Ga0105248_10033985 3300009177 Bacteria 5700
365 Ga0105248_10034417 3300009177 Bacteria 5664
366 Ga0105248_10037507 3300009177 Bacteria 5423
367 Ga0105248_10046685 3300009177 Bacteria 4855
368 Ga0105248_10082338 3300009177 Bacteria 3619
369 Ga0105248_10147419 3300009177 Bacteria 2655
370 Ga0105237_10014995 3300009545 Bacteria 8077
371 Ga0105238_10010961 3300009551 Bacteria 9115
372 Ga0105238_10012445 3300009551 Bacteria 8582
373 Ga0105238_10151955 3300009551 Bacteria 2290
374 Ga0105238_10166366 3300009551 Bacteria 2181
375 Ga0105249_10061591 3300009553 Bacteria 3444
376 Ga0105249_10149430 3300009553 Bacteria 2248
377 Ga0105239_10143098 3300010375 Bacteria 2666
378 Ga0105246_10073833 3300011119 Bacteria 2409
379 Ga0157373_10002206 3300013100 Bacteria 14740
380 Ga0157373_10011750 3300013100 Bacteria 6433
381 Ga0157373_10020464 3300013100 Bacteria 4809
382 Ga0157373_10039550 3300013100 Bacteria 3376
383 Ga0157373_10047873 3300013100 Bacteria 3049
384 Ga0157373_10061734 3300013100 Bacteria 2654
385 Ga0157373_10075414 3300013100 Bacteria 2380
386 Ga0157373_10078940 3300013100 Bacteria 2321
387 Ga0157371_10001390 3300013102 Bacteria 25250
388 Ga0157371_10002868 3300013102 Bacteria 16118
389 Ga0157371_10010430 3300013102 Bacteria 7238
390 Ga0157371_10012775 3300013102 Bacteria 6402
391 Ga0157371_10023169 3300013102 Bacteria 4540
392 Ga0157371_10023918 3300013102 Bacteria 4464
393 Ga0157371_10028922 3300013102 Bacteria 4012
394 Ga0157371_10042987 3300013102 Bacteria 3220
395 Ga0157371_10067933 3300013102 Bacteria 2523
396 Ga0157371_10095294 3300013102 Bacteria 2109
397 Ga0157371_10115536 3300013102 Bacteria 1906
398 Ga0157371_10171870 3300013102 Bacteria 1549
399 Ga0157371_10192786 3300013102 Bacteria 1459
400 Ga0157370_10001517 3300013104 Bacteria 28707
401 Ga0157370_10030709 3300013104 Bacteria 5263
402 Ga0157370_10084885 3300013104 Bacteria 2975
403 Ga0157370_10092250 3300013104 Bacteria 2843
404 Ga0157369_10000201 3300013105 Bacteria 82836
405 Ga0157369_10011815 3300013105 Bacteria 9917
406 Ga0157369_10032604 3300013105 Bacteria 5728
407 Ga0157369_10050586 3300013105 Bacteria 4499
408 Ga0157369_10051385 3300013105 Bacteria 4460
409 Ga0157369_10074576 3300013105 Bacteria 3638
410 Ga0157369_10080836 3300013105 Bacteria 3479
411 Ga0157369_10089239 3300013105 Bacteria 3291
412 Ga0157369_10141296 3300013105 Bacteria 2548
413 Ga0157374_10004801 3300013296 Bacteria 11345
414 Ga0157374_10011760 3300013296 Bacteria 7595
415 Ga0157374_10012198 3300013296 Bacteria 7468
416 Ga0157374_10053784 3300013296 Bacteria 3754
417 Ga0157374_10056725 3300013296 Bacteria 3657
418 Ga0157374_10067150 3300013296 Bacteria 3371
419 Ga0157378_10010391 3300013297 Bacteria 8128
420 Ga0157378_10021008 3300013297 Bacteria 5743
421 Ga0157378_10055263 3300013297 Bacteria 3536
422 Ga0157378_10232902 3300013297 Bacteria 1756
423 Ga0163162_10015017 3300013306 Bacteria 7564
424 Ga0163162_10050330 3300013306 Bacteria 4178
425 Ga0163162_10051750 3300013306 Bacteria 4122
426 Ga0163162_10084817 3300013306 Bacteria 3244
427 Ga0163162_10217946 3300013306 Bacteria 2038
428 Ga0163162_10354051 3300013306 Bacteria 1601
429 Ga0157372_10004206 3300013307 Bacteria 15406
430 Ga0157372_10037174 3300013307 Bacteria 5367
431 Ga0157372_10076321 3300013307 Bacteria 3783
432 Ga0157372_10077732 3300013307 Bacteria 3749
433 Ga0157372_10131890 3300013307 Bacteria 2875
434 Ga0157372_10143455 3300013307 Bacteria 2754
435 Ga0157372_10195159 3300013307 Bacteria 2345
436 Ga0157372_10201607 3300013307 Bacteria 2305
437 Ga0157372_10303387 3300013307 Bacteria 1858
438 Ga0157375_10000628 3300013308 Bacteria 31364
439 Ga0157375_10005662 3300013308 Bacteria 10873
440 Ga0157375_10036423 3300013308 Bacteria 4707
441 Ga0157375_10043314 3300013308 Bacteria 4364
442 Ga0157375_10049209 3300013308 Bacteria 4128
443 Ga0157375_10102558 3300013308 Bacteria 2946
444 Ga0157375_10119316 3300013308 Bacteria 2745
445 Ga0163163_10000543 3300014325 Bacteria 33382
446 Ga0163163_10001581 3300014325 Bacteria 19174
447 Ga0163163_10005921 3300014325 Bacteria 10638
448 Ga0163163_10017559 3300014325 Bacteria 6678
449 Ga0163163_10043038 3300014325 Bacteria 4426
450 Ga0182008_10019281 3300014497 Bacteria 3522
451 Ga0182008_10028870 3300014497 Bacteria 2805
452 Ga0157377_10051881 3300014745 Bacteria 2315
453 Ga0157379_10006904 3300014968 Bacteria 9818
454 Ga0207697_10000104 3300025315 Bacteria 38619
455 Ga0207697_10005074 3300025315 Bacteria 6166
456 Ga0207656_10005263 3300025321 Bacteria 4560
457 Ga0207656_10009031 3300025321 Bacteria 3694
458 Ga0207682_10025748 3300025893 Bacteria 2333
459 Ga0207682_10032988 3300025893 Bacteria 2082
460 Ga0207642_10007779 3300025899 Bacteria 3635
461 Ga0207688_10001426 3300025901 Bacteria 12466
462 Ga0207688_10005488 3300025901 Bacteria 6897
463 Ga0207680_10001311 3300025903 Bacteria 11747
464 Ga0207680_10017198 3300025903 Bacteria 3816
465 Ga0207680_10020116 3300025903 Bacteria 3584
466 Ga0207680_10059519 3300025903 Bacteria 2321
467 Ga0207680_10090324 3300025903 Bacteria 1946
468 Ga0207647_10001144 3300025904 Bacteria 20400
469 Ga0207647_10002185 3300025904 Bacteria 14916
470 Ga0207647_10002253 3300025904 Bacteria 14695
471 Ga0207647_10009369 3300025904 Bacteria 6959
472 Ga0207647_10010193 3300025904 Bacteria 6640
473 Ga0207647_10011244 3300025904 Bacteria 6284
474 Ga0207647_10022523 3300025904 Bacteria 4182
475 Ga0207647_10023792 3300025904 Bacteria 4047
476 Ga0207647_10024775 3300025904 Bacteria 3953
477 Ga0207647_10102282 3300025904 Bacteria 1699
478 Ga0207645_10005343 3300025907 Bacteria 9337
479 Ga0207645_10006392 3300025907 Bacteria 8462
480 Ga0207645_10040683 3300025907 Bacteria 2976
481 Ga0207705_10000200 3300025909 Bacteria 60434
482 Ga0207705_10001216 3300025909 Bacteria 20824
483 Ga0207705_10004522 3300025909 Bacteria 10510
484 Ga0207705_10008123 3300025909 Bacteria 7685
485 Ga0207705_10009761 3300025909 Bacteria 6985
486 Ga0207705_10013369 3300025909 Bacteria 5920
487 Ga0207705_10014212 3300025909 Bacteria 5735
488 Ga0207705_10023463 3300025909 Bacteria 4400
489 Ga0207705_10025066 3300025909 Bacteria 4257
490 Ga0207705_10048708 3300025909 Bacteria 3049
491 Ga0207705_10072990 3300025909 Bacteria 2489
492 Ga0207705_10153577 3300025909 Bacteria 1726
493 Ga0207654_10021170 3300025911 Bacteria 3455
494 Ga0207654_10043581 3300025911 Bacteria 2544
495 Ga0207707_10010810 3300025912 Bacteria 7932
496 Ga0207707_10053133 3300025912 Bacteria 3527
497 Ga0207707_10142456 3300025912 Bacteria 2096
498 Ga0207707_10163012 3300025912 Bacteria 1949
499 Ga0207695_10038327 3300025913 Bacteria 5161
500 Ga0207695_10086508 3300025913 Bacteria 3161
501 Ga0207693_10016452 3300025915 Bacteria 5909
502 Ga0207660_10004335 3300025917 Bacteria 9252
503 Ga0207660_10018885 3300025917 Bacteria 4603
504 Ga0207660_10021615 3300025917 Bacteria 4328
505 Ga0207660_10028327 3300025917 Bacteria 3830
506 Ga0207660_10040569 3300025917 Bacteria 3260
507 Ga0207657_10000128 3300025919 Bacteria 76013
508 Ga0207657_10000468 3300025919 Bacteria 42779
509 Ga0207657_10000643 3300025919 Bacteria 37091
510 Ga0207657_10001403 3300025919 Bacteria 25687
511 Ga0207657_10002144 3300025919 Bacteria 21379
512 Ga0207657_10002853 3300025919 Bacteria 18578
513 Ga0207657_10003915 3300025919 Bacteria 15799
514 Ga0207657_10006400 3300025919 Bacteria 12224
515 Ga0207657_10006837 3300025919 Bacteria 11767
516 Ga0207657_10008661 3300025919 Bacteria 10301
517 Ga0207657_10009276 3300025919 Bacteria 9912
518 Ga0207657_10009943 3300025919 Bacteria 9519
519 Ga0207657_10013729 3300025919 Bacteria 7928
520 Ga0207657_10017445 3300025919 Bacteria 6881
521 Ga0207657_10027996 3300025919 Bacteria 5150
522 Ga0207657_10028939 3300025919 Bacteria 5047
523 Ga0207657_10050781 3300025919 Bacteria 3607
524 Ga0207657_10063717 3300025919 Bacteria 3150
525 Ga0207657_10105287 3300025919 Bacteria 2335
526 Ga0207657_10108137 3300025919 Bacteria 2299
527 Ga0207649_10000362 3300025920 Bacteria 34070
528 Ga0207649_10015100 3300025920 Bacteria 4336
529 Ga0207649_10022491 3300025920 Bacteria 3643
530 Ga0207649_10024959 3300025920 Bacteria 3479
531 Ga0207649_10067049 3300025920 Bacteria 2277
532 Ga0207652_10001035 3300025921 Bacteria 25477
533 Ga0207652_10004394 3300025921 Bacteria 11481
534 Ga0207652_10089311 3300025921 Bacteria 2706
535 Ga0207681_10021541 3300025923 Bacteria 4099
536 Ga0207681_10038204 3300025923 Bacteria 3179
537 Ga0207694_10006948 3300025924 Bacteria 8594
538 Ga0207694_10021780 3300025924 Bacteria 4858
539 Ga0207694_10053090 3300025924 Bacteria 3142
540 Ga0207650_10013727 3300025925 Bacteria 5615
541 Ga0207650_10027776 3300025925 Bacteria 4053
542 Ga0207650_10100393 3300025925 Bacteria 2226
543 Ga0207650_10163966 3300025925 Bacteria 1762
544 Ga0207659_10001010 3300025926 Bacteria 16736
545 Ga0207659_10023279 3300025926 Bacteria 4132
546 Ga0207659_10026382 3300025926 Bacteria 3920
547 Ga0207659_10048956 3300025926 Bacteria 2996
548 Ga0207687_10003635 3300025927 Bacteria 10393
549 Ga0207687_10080748 3300025927 Bacteria 2348
550 Ga0207700_10037527 3300025928 Bacteria 3510
551 Ga0207700_10049843 3300025928 Bacteria 3117
552 Ga0207664_10009182 3300025929 Bacteria 6929
553 Ga0207664_10016142 3300025929 Bacteria 5441
554 Ga0207664_10065498 3300025929 Bacteria 2909
555 Ga0207664_10074862 3300025929 Bacteria 2737
556 Ga0207644_10000683 3300025931 Bacteria 21431
557 Ga0207644_10002090 3300025931 Bacteria 12933
558 Ga0207644_10003126 3300025931 Bacteria 10659
559 Ga0207644_10004110 3300025931 Bacteria 9431
560 Ga0207644_10004471 3300025931 Bacteria 9079
561 Ga0207644_10007550 3300025931 Bacteria 7089
562 Ga0207644_10010323 3300025931 Bacteria 6154
563 Ga0207644_10022270 3300025931 Bacteria 4328
564 Ga0207644_10028505 3300025931 Bacteria 3866
565 Ga0207644_10051726 3300025931 Bacteria 2950
566 Ga0207644_10067308 3300025931 Bacteria 2610
567 Ga0207690_10000062 3300025932 Bacteria 96511
568 Ga0207690_10001552 3300025932 Bacteria 14381
569 Ga0207690_10003253 3300025932 Bacteria 9747
570 Ga0207690_10004163 3300025932 Bacteria 8549
571 Ga0207690_10012561 3300025932 Bacteria 5069
572 Ga0207690_10014725 3300025932 Bacteria 4729
573 Ga0207690_10020149 3300025932 Bacteria 4117
574 Ga0207690_10030232 3300025932 Bacteria 3453
575 Ga0207690_10097886 3300025932 Bacteria 2088
576 Ga0207690_10102186 3300025932 Bacteria 2049
577 Ga0207706_10000211 3300025933 Bacteria 63984
578 Ga0207706_10000346 3300025933 Bacteria 50165
579 Ga0207706_10000866 3300025933 Bacteria 31146
580 Ga0207706_10001233 3300025933 Bacteria 25812
581 Ga0207706_10002307 3300025933 Bacteria 18608
582 Ga0207706_10004449 3300025933 Bacteria 13166
583 Ga0207706_10008019 3300025933 Bacteria 9744
584 Ga0207706_10012742 3300025933 Bacteria 7653
585 Ga0207706_10014422 3300025933 Bacteria 7162
586 Ga0207706_10033561 3300025933 Bacteria 4568
587 Ga0207706_10034971 3300025933 Bacteria 4469
588 Ga0207706_10055114 3300025933 Bacteria 3507
589 Ga0207706_10109445 3300025933 Bacteria 2431
590 Ga0207706_10147739 3300025933 Bacteria 2068
591 Ga0207706_10254300 3300025933 Bacteria 1534
592 Ga0207670_10025891 3300025936 Bacteria 3689
593 Ga0207669_10019022 3300025937 Bacteria 3567
594 Ga0207669_10048574 3300025937 Bacteria 2522
595 Ga0207704_10106537 3300025938 Bacteria 1883
596 Ga0207691_10001025 3300025940 Bacteria 27647
597 Ga0207691_10007200 3300025940 Bacteria 10732
598 Ga0207691_10012322 3300025940 Bacteria 8197
599 Ga0207691_10017470 3300025940 Bacteria 6801
600 Ga0207691_10044678 3300025940 Bacteria 4076
601 Ga0207691_10112598 3300025940 Bacteria 2418
602 Ga0207691_10203044 3300025940 Bacteria 1724
603 Ga0207711_10000044 3300025941 Bacteria 157113
604 Ga0207711_10000567 3300025941 Bacteria 37685
605 Ga0207711_10000826 3300025941 Bacteria 30270
606 Ga0207711_10001518 3300025941 Bacteria 21567
607 Ga0207711_10001908 3300025941 Bacteria 18939
608 Ga0207711_10003425 3300025941 Bacteria 13721
609 Ga0207711_10003594 3300025941 Bacteria 13410
610 Ga0207711_10008075 3300025941 Bacteria 8810
611 Ga0207711_10009332 3300025941 Bacteria 8191
612 Ga0207711_10011201 3300025941 Bacteria 7451
613 Ga0207711_10012774 3300025941 Bacteria 6977
614 Ga0207711_10018079 3300025941 Bacteria 5861
615 Ga0207711_10158239 3300025941 Bacteria 2048
616 Ga0207689_10000033 3300025942 Bacteria 95815
617 Ga0207689_10005042 3300025942 Bacteria 11903
618 Ga0207689_10010397 3300025942 Bacteria 8013
619 Ga0207661_10007618 3300025944 Bacteria 7700
620 Ga0207661_10010702 3300025944 Bacteria 6610
621 Ga0207661_10012427 3300025944 Bacteria 6187
622 Ga0207661_10025242 3300025944 Bacteria 4515
623 Ga0207679_10000506 3300025945 Bacteria 26758
624 Ga0207679_10005182 3300025945 Bacteria 8167
625 Ga0207679_10006404 3300025945 Bacteria 7436
626 Ga0207679_10020437 3300025945 Bacteria 4468
627 Ga0207679_10029743 3300025945 Bacteria 3806
628 Ga0207679_10038626 3300025945 Bacteria 3402
629 Ga0207679_10065843 3300025945 Bacteria 2713
630 Ga0207679_10200304 3300025945 Bacteria 1667
631 Ga0207667_10006936 3300025949 Bacteria 13691
632 Ga0207667_10011406 3300025949 Bacteria 10329
633 Ga0207667_10037451 3300025949 Bacteria 5184
634 Ga0207667_10043138 3300025949 Bacteria 4787
635 Ga0207667_10140190 3300025949 Bacteria 2489
636 Ga0207667_10276454 3300025949 Bacteria 1716
637 Ga0207651_10000139 3300025960 Bacteria 31720
638 Ga0207651_10002769 3300025960 Bacteria 8418
639 Ga0207651_10004400 3300025960 Bacteria 7094
640 Ga0207651_10019458 3300025960 Bacteria 4070
641 Ga0207651_10025639 3300025960 Bacteria 3668
642 Ga0207651_10061923 3300025960 Bacteria 2605
643 Ga0207712_10003387 3300025961 Bacteria 10081
644 Ga0207712_10028459 3300025961 Bacteria 3739
645 Ga0207668_10000150 3300025972 Bacteria 48022
646 Ga0207668_10014820 3300025972 Bacteria 4832
647 Ga0207668_10061309 3300025972 Bacteria 2645
648 Ga0207668_10068129 3300025972 Bacteria 2529
649 Ga0207640_10000853 3300025981 Bacteria 17297
650 Ga0207640_10011087 3300025981 Bacteria 5092
651 Ga0207640_10012845 3300025981 Bacteria 4784
652 Ga0207640_10036628 3300025981 Bacteria 3082
653 Ga0207640_10131459 3300025981 Bacteria 1810
654 Ga0207640_10151535 3300025981 Bacteria 1704
655 Ga0207658_10003798 3300025986 Bacteria 10633
656 Ga0207658_10004749 3300025986 Bacteria 9408
657 Ga0207658_10005167 3300025986 Bacteria 8992
658 Ga0207658_10020604 3300025986 Bacteria 4565
659 Ga0207658_10023660 3300025986 Bacteria 4290
660 Ga0207658_10023742 3300025986 Bacteria 4283
661 Ga0207658_10026685 3300025986 Bacteria 4051
662 Ga0207658_10073853 3300025986 Bacteria 2589
663 Ga0207677_10000472 3300026023 Bacteria 26482
664 Ga0207677_10000612 3300026023 Bacteria 21892
665 Ga0207677_10044133 3300026023 Bacteria 2968
666 Ga0207677_10076123 3300026023 Bacteria 2388
667 Ga0207703_10002917 3300026035 Bacteria 14554
668 Ga0207703_10011839 3300026035 Bacteria 6792
669 Ga0207703_10014891 3300026035 Bacteria 6069
670 Ga0207703_10015184 3300026035 Bacteria 6009
671 Ga0207703_10027050 3300026035 Bacteria 4518
672 Ga0207703_10072309 3300026035 Bacteria 2851
673 Ga0207703_10137555 3300026035 Bacteria 2116
674 Ga0207703_10154767 3300026035 Bacteria 2002
675 Ga0207639_10000532 3300026041 Bacteria 26198
676 Ga0207639_10000990 3300026041 Bacteria 19349
677 Ga0207639_10022105 3300026041 Bacteria 4578
678 Ga0207639_10030452 3300026041 Bacteria 3957
679 Ga0207639_10037378 3300026041 Bacteria 3606
680 Ga0207639_10050623 3300026041 Bacteria 3155
681 Ga0207639_10064947 3300026041 Bacteria 2831
682 Ga0207639_10071569 3300026041 Bacteria 2713
683 Ga0207639_10074993 3300026041 Bacteria 2658
684 Ga0207678_10000325 3300026067 Bacteria 42910
685 Ga0207678_10002765 3300026067 Bacteria 15882
686 Ga0207678_10003985 3300026067 Bacteria 13281
687 Ga0207678_10007964 3300026067 Bacteria 9345
688 Ga0207678_10016569 3300026067 Bacteria 6472
689 Ga0207678_10016860 3300026067 Bacteria 6414
690 Ga0207678_10021371 3300026067 Bacteria 5675
691 Ga0207678_10026950 3300026067 Bacteria 5012
692 Ga0207678_10041131 3300026067 Bacteria 4007
693 Ga0207678_10066815 3300026067 Bacteria 3087
694 Ga0207702_10001280 3300026078 Bacteria 25252
695 Ga0207702_10002086 3300026078 Bacteria 19309
696 Ga0207702_10029638 3300026078 Bacteria 4555
697 Ga0207702_10034812 3300026078 Bacteria 4212
698 Ga0207641_10004609 3300026088 Bacteria 11901
699 Ga0207641_10005321 3300026088 Bacteria 10989
700 Ga0207641_10008031 3300026088 Bacteria 8747
701 Ga0207641_10046505 3300026088 Bacteria 3658
702 Ga0207648_10000554 3300026089 Bacteria 41815
703 Ga0207648_10000889 3300026089 Bacteria 33700
704 Ga0207648_10001898 3300026089 Bacteria 22839
705 Ga0207648_10011713 3300026089 Bacteria 8246
706 Ga0207648_10072619 3300026089 Bacteria 2998
707 Ga0207648_10093664 3300026089 Bacteria 2627
708 Ga0207648_10179403 3300026089 Bacteria 1874
709 Ga0207676_10000439 3300026095 Bacteria 35156
710 Ga0207676_10003029 3300026095 Bacteria 11987
711 Ga0207676_10015869 3300026095 Bacteria 5447
712 Ga0207676_10031379 3300026095 Bacteria 3996
713 Ga0207676_10082689 3300026095 Bacteria 2613
714 Ga0207676_10090305 3300026095 Bacteria 2513
715 Ga0207674_10000104 3300026116 Bacteria 96273
716 Ga0207674_10000410 3300026116 Bacteria 55768
717 Ga0207674_10000641 3300026116 Bacteria 45504
718 Ga0207674_10002803 3300026116 Bacteria 21702
719 Ga0207674_10005074 3300026116 Bacteria 15715
720 Ga0207674_10005803 3300026116 Bacteria 14650
721 Ga0207674_10014333 3300026116 Bacteria 8758
722 Ga0207674_10015759 3300026116 Bacteria 8291
723 Ga0207674_10020766 3300026116 Bacteria 7088
724 Ga0207674_10022581 3300026116 Bacteria 6754
725 Ga0207674_10027592 3300026116 Bacteria 6003
726 Ga0207674_10063685 3300026116 Bacteria 3721
727 Ga0207674_10098836 3300026116 Bacteria 2901
728 Ga0207674_10214516 3300026116 Bacteria 1873
729 Ga0207675_100181007 3300026118 Bacteria 2018
730 Ga0207683_10003836 3300026121 Bacteria 13025
731 Ga0207683_10013902 3300026121 Bacteria 6863
732 Ga0207683_10028924 3300026121 Bacteria 4795
733 Ga0207683_10031581 3300026121 Bacteria 4596
734 Ga0207683_10066672 3300026121 Bacteria 3174
735 Ga0207683_10082285 3300026121 Bacteria 2860
736 Ga0207698_10000336 3300026142 Bacteria 27862
737 Ga0207698_10000775 3300026142 Bacteria 18575
738 Ga0207698_10000958 3300026142 Bacteria 16760
739 Ga0207698_10001668 3300026142 Bacteria 12960
740 Ga0207698_10002149 3300026142 Bacteria 11646
741 Ga0207698_10010764 3300026142 Bacteria 5901
742 Ga0207698_10011185 3300026142 Bacteria 5806
743 Ga0207698_10022265 3300026142 Bacteria 4399
744 Ga0207698_10162540 3300026142 Bacteria 1955
745 Ga0207698_10182631 3300026142 Bacteria 1860
746 Ga0268266_10001840 3300028379 Bacteria 23953
747 Ga0268266_10023948 3300028379 Bacteria 5196
748 Ga0268266_10024060 3300028379 Bacteria 5184
749 Ga0268266_10024349 3300028379 Bacteria 5149
750 Ga0268266_10030023 3300028379 Bacteria 4619
751 Ga0268266_10036777 3300028379 Bacteria 4170
752 Ga0268265_10022143 3300028380 Bacteria 4460
753 Ga0268265_10025308 3300028380 Bacteria 4210
754 Ga0268264_10000338 3300028381 Bacteria 72206
755 Ga0268264_10002226 3300028381 Bacteria 17195
756 Ga0268264_10005389 3300028381 Bacteria 10830
757 Ga0268264_10006757 3300028381 Bacteria 9640
758 Ga0268264_10176771 3300028381 Bacteria 1935
759 Ga0268264_10303614 3300028381 Bacteria 1503
760 Ga0307408_100063600 3300031548 Bacteria 2700
761 Ga0307409_100025475 3300031995 Bacteria 4150
762 Ga0307416_100017484 3300032002 Bacteria 5021
763 Ga0307414_10055500 3300032004 Bacteria 2774
764 Ga0307411_10163509 3300032005 Bacteria 1670
765 Ga0373923_0064233 3300035111 Bacteria 1565
766 Ga0373955_0076717 3300035172 Bacteria 1880
767 Ga0373931_0004625 3300035691 Bacteria 6293
768 Ga0373947_0137371 3300035725 Bacteria 1565
769 Ga0373937_0015662 3300036401 Bacteria 6714
770 Ga0373925_0007654 3300037068 Bacteria 7868
771 Ga0395899_0000103 3300037312 Bacteria 147274
772 Ga0395899_0000917 3300037312 Bacteria 27698
773 Ga0395899_0001385 3300037312 Bacteria 20802
774 Ga0395899_0001799 3300037312 Bacteria 17765
775 Ga0395899_0015642 3300037312 Bacteria 5786
776 Ga0395899_0020357 3300037312 Bacteria 5031
777 Ga0395899_0024773 3300037312 Bacteria 4534
778 Ga0395899_0024899 3300037312 Bacteria 4520
779 Ga0395899_0024913 3300037312 Bacteria 4519
780 Ga0395899_0037206 3300037312 Bacteria 3649
781 Ga0395899_0047200 3300037312 Bacteria 3207
782 Ga0395899_0054727 3300037312 Bacteria 2952
783 Ga0395899_0072265 3300037312 Bacteria 2524
784 Ga0395899_0074055 3300037312 Bacteria 2488
785 Ga0395899_0127398 3300037312 Bacteria 1820
786 Ga0395899_0181061 3300037312 Bacteria 1479
787 Ga0395900_0000031 3300037418 Bacteria 262393
788 Ga0395900_0000093 3300037418 Bacteria 166505
789 Ga0395900_0006491 3300037418 Bacteria 12195
790 Ga0395900_0006570 3300037418 Bacteria 12115
791 Ga0395900_0009496 3300037418 Bacteria 9972
792 Ga0395900_0017627 3300037418 Bacteria 7286
793 Ga0395900_0021609 3300037418 Bacteria 6578
794 Ga0395900_0023881 3300037418 Bacteria 6256
795 Ga0395900_0033954 3300037418 Bacteria 5251
796 Ga0395900_0041618 3300037418 Bacteria 4736
797 Ga0395900_0052438 3300037418 Bacteria 4199
798 Ga0395900_0059395 3300037418 Bacteria 3936
799 Ga0395900_0063710 3300037418 Bacteria 3789
800 Ga0395900_0064455 3300037418 Bacteria 3765
801 Ga0395900_0087589 3300037418 Bacteria 3200
802 Ga0395900_0098963 3300037418 Bacteria 2996
803 Ga0395900_0134992 3300037418 Bacteria 2528
804 Ga0395900_0135829 3300037418 Bacteria 2519
805 Ga0395900_0136135 3300037418 Bacteria 2516
806 Ga0395900_0138454 3300037418 Bacteria 2493
807 Ga0395900_0162885 3300037418 Bacteria 2274
808 Ga0395900_0165660 3300037418 Bacteria 2252
809 Ga0395900_0183696 3300037418 Bacteria 2123
810 Ga0395900_0194163 3300037418 Bacteria 2057
811 Ga0395900_0235400 3300037418 Bacteria 1839
812 Ga0395900_0259497 3300037418 Bacteria 1736
813 Ga0395900_0280978 3300037418 Bacteria 1656
814 Ga0395900_0283871 3300037418 Bacteria 1646
815 Ga0395900_0284345 3300037418 Bacteria 1645
816 Ga0395900_0288086 3300037418 Bacteria 1632
817 Ga0395900_0332316 3300037418 Bacteria 1497
818 Ga0395898_0000053 3300037466 Bacteria 279600
819 Ga0395898_0002184 3300037466 Bacteria 23910
820 Ga0395898_0007615 3300037466 Bacteria 11495
821 Ga0395898_0007670 3300037466 Bacteria 11460
822 Ga0395898_0007743 3300037466 Bacteria 11404
823 Ga0395898_0008057 3300037466 Bacteria 11167
824 Ga0395898_0022140 3300037466 Bacteria 6439
825 Ga0395898_0028334 3300037466 Bacteria 5613
826 Ga0395898_0033883 3300037466 Bacteria 5094
827 Ga0395898_0036635 3300037466 Bacteria 4870
828 Ga0395898_0052453 3300037466 Bacteria 3984
829 Ga0395898_0061968 3300037466 Bacteria 3633
830 Ga0395898_0114325 3300037466 Bacteria 2586
831 Ga0395898_0164011 3300037466 Bacteria 2125
832 Ga0395898_0225689 3300037466 Bacteria 1786
833 Ga0395905_0000031 3300037471 Bacteria 286757
834 Ga0395905_0000298 3300037471 Bacteria 72500
835 Ga0395905_0001393 3300037471 Bacteria 29331
836 Ga0395905_0001433 3300037471 Bacteria 28692
837 Ga0395905_0003189 3300037471 Bacteria 17660
838 Ga0395905_0003199 3300037471 Bacteria 17636
839 Ga0395905_0005682 3300037471 Bacteria 12680
840 Ga0395905_0008961 3300037471 Bacteria 9819
841 Ga0395905_0010035 3300037471 Bacteria 9233
842 Ga0395905_0010719 3300037471 Bacteria 8889
843 Ga0395905_0013358 3300037471 Bacteria 7869
844 Ga0395905_0017739 3300037471 Bacteria 6758
845 Ga0395905_0018559 3300037471 Bacteria 6600
846 Ga0395905_0020888 3300037471 Bacteria 6200
847 Ga0395905_0027864 3300037471 Bacteria 5327
848 Ga0395905_0044774 3300037471 Bacteria 4151
849 Ga0395905_0044803 3300037471 Bacteria 4150
850 Ga0395905_0060933 3300037471 Bacteria 3529
851 Ga0395905_0068435 3300037471 Bacteria 3325
852 Ga0395905_0076579 3300037471 Bacteria 3135
853 Ga0395905_0086748 3300037471 Bacteria 2934
854 Ga0395905_0095470 3300037471 Bacteria 2790
855 Ga0395905_0111648 3300037471 Bacteria 2567
856 Ga0395905_0122079 3300037471 Bacteria 2449
857 Ga0395905_0163368 3300037471 Bacteria 2092
858 Ga0395905_0186960 3300037471 Bacteria 1944
859 Ga0395905_0236811 3300037471 Bacteria 1706
860 Ga0395901_0000035 3300038443 Bacteria 223888
861 Ga0395901_0000140 3300038443 Bacteria 94487
862 Ga0395901_0000163 3300038443 Bacteria 87103
863 Ga0395901_0002602 3300038443 Bacteria 18273
864 Ga0395901_0007270 3300038443 Bacteria 11175
865 Ga0395901_0007987 3300038443 Bacteria 10679
866 Ga0395901_0013469 3300038443 Bacteria 8314
867 Ga0395901_0014591 3300038443 Bacteria 7986
868 Ga0395901_0015826 3300038443 Bacteria 7686
869 Ga0395901_0021151 3300038443 Bacteria 6664
870 Ga0395901_0023924 3300038443 Bacteria 6266
871 Ga0395901_0032674 3300038443 Bacteria 5367
872 Ga0395901_0035963 3300038443 Bacteria 5117
873 Ga0395901_0036894 3300038443 Bacteria 5053
874 Ga0395901_0039743 3300038443 Bacteria 4869
875 Ga0395901_0051165 3300038443 Bacteria 4293
876 Ga0395901_0060934 3300038443 Bacteria 3927
877 Ga0395901_0062838 3300038443 Bacteria 3864
878 Ga0395901_0095605 3300038443 Bacteria 3113
879 Ga0395901_0144392 3300038443 Bacteria 2501
880 Ga0395901_0213372 3300038443 Bacteria 2019
881 Ga0395901_0213817 3300038443 Bacteria 2017
882 Ga0395901_0221317 3300038443 Bacteria 1978
883 Ga0395901_0242737 3300038443 Bacteria 1878
884 Ga0395901_0275699 3300038443 Bacteria 1748
885 Ga0395901_0287918 3300038443 Bacteria 1705
886 Ga0439455_0010576 3300042012 Bacteria 2033
887 Ga0450889_000016 3300042144 Bacteria 15020
888 Ga0439458_0000630 3300042157 Bacteria 9139
889 Ga0439458_0008580 3300042157 Bacteria 2277
890 Ga0439464_0009234 3300042439 Bacteria 2593
891 Ga0466969_0000621 3300044656 Bacteria 19186
892 Ga0466972_0031843 3300044658 Bacteria 2592
893 Ga0466965_0028059 3300044683 Bacteria 2733
894 Ga0466966_0008485 3300044684 Bacteria 6802
895 Ga0466966_0010180 3300044684 Bacteria 6236
896 Ga0466966_0094212 3300044684 Bacteria 1856
897 Ga0466966_0109430 3300044684 Bacteria 1704
898 Ga0466966_0128645 3300044684 Bacteria 1552
899 Ga0466961_0009637 3300044693 Bacteria 6149
900 Ga0466961_0010371 3300044693 Bacteria 5944
901 Ga0466961_0021929 3300044693 Bacteria 4110
902 Ga0466961_0081131 3300044693 Bacteria 2053
903 Ga0466961_0118341 3300044693 Bacteria 1664
904 Ga0466963_0024507 3300044694 Bacteria 3842
905 Ga0466963_0027439 3300044694 Bacteria 3646
906 Ga0466963_0036704 3300044694 Bacteria 3197
907 Ga0466963_0066469 3300044694 Bacteria 2418
908 Ga0466963_0085314 3300044694 Bacteria 2144
909 Ga0466963_0108692 3300044694 Bacteria 1902
910 Ga0466964_0002327 3300044706 Bacteria 6738
911 Ga0466971_0014113 3300044719 Bacteria 3512
912 Ga0466971_0018509 3300044719 Bacteria 3085
913 Ga0466971_0029693 3300044719 Bacteria 2445
914 Ga0466968_0001195 3300044735 Bacteria 9182
915 Ga0466957_0001433 3300044842 Bacteria 12457
916 Ga0466957_0002504 3300044842 Bacteria 9881
917 Ga0466957_0026759 3300044842 Bacteria 3423
918 Ga0466957_0040332 3300044842 Bacteria 2819
919 Ga0466957_0092362 3300044842 Bacteria 1898
920 Ga0466960_0086791 3300044901 Bacteria 1587
921 Ga0466959_0016786 3300045049 Bacteria 5357
922 Ga0466959_0079804 3300045049 Bacteria 2359
923 Ga0466958_0001865 3300045836 Bacteria 10293
924 Ga0466958_0005586 3300045836 Bacteria 6782
925 Ga0466958_0006030 3300045836 Bacteria 6569
926 Ga0466958_0016995 3300045836 Bacteria 4197
927 Ga0466958_0151376 3300045836 Bacteria 1463
928 Ga0466967_0002551 3300045976 Bacteria 11415
929 Ga0466967_0003894 3300045976 Bacteria 9905
930 Ga0466967_0017710 3300045976 Bacteria 5667
931 Ga0466967_0036403 3300045976 Bacteria 4201
932 Ga0466967_0048122 3300045976 Bacteria 3722
933 Ga0466967_0048202 3300045976 Bacteria 3719
934 Ga0466967_0049235 3300045976 Bacteria 3684
935 Ga0466967_0070720 3300045976 Bacteria 3122
936 Ga0466967_0098140 3300045976 Bacteria 2674
937 Ga0466967_0109991 3300045976 Bacteria 2530
938 Ga0466967_0117840 3300045976 Bacteria 2448
939 Ga0466967_0121145 3300045976 Bacteria 2417
940 Ga0466967_0167670 3300045976 Bacteria 2064
941 Ga0495663_0027930 3300046525 Bacteria 1658
942 Ga0495598_0005475 3300046537 Bacteria 2817
943 Ga0495621_0001621 3300046539 Bacteria 5879
944 Ga0495633_0001909 3300046558 Bacteria 15173
945 Ga0495668_0009686 3300046616 Bacteria 5889
946 Ga0495668_0010783 3300046616 Bacteria 5514
947 Ga0495668_0010993 3300046616 Bacteria 5446
948 Ga0495668_0013297 3300046616 Bacteria 4861
949 Ga0495661_0093519 3300046665 Bacteria 1706
950 Ga0495669_0000442 3300046684 Bacteria 19636
951 Ga0495669_0000793 3300046684 Bacteria 13512
952 Ga0495669_0002160 3300046684 Bacteria 8075
953 Ga0495669_0003343 3300046684 Bacteria 6603
954 Ga0495669_0013474 3300046684 Bacteria 3484
955 Ga0495669_0034986 3300046684 Bacteria 2216
956 Ga0495670_0034649 3300046691 Bacteria 2515
957 Ga0495677_0004456 3300047445 Bacteria 5378
958 Ga0495602_0020274 3300048088 Bacteria 6574
959 Ga0496100_0022557 3300048903 Bacteria 3810
960 Ga0496100_0157170 3300048903 Bacteria 1627
961 Ga0496101_0015674 3300048904 Bacteria 5114
962 Ga0496101_0060197 3300048904 Bacteria 2755
963 Ga0496101_0087538 3300048904 Bacteria 2312
964 Ga0496101_0160927 3300048904 Bacteria 1721
965 Ga0496102_0131883 3300048905 Bacteria 2340
966 Ga0496106_0007914 3300048909 Bacteria 7856
967 Ga0496107_0021466 3300048910 Bacteria 4563
968 Ga0496108_0002584 3300048911 Bacteria 14509
969 Ga0496108_0011108 3300048911 Bacteria 7314
970 Ga0496108_0025841 3300048911 Bacteria 4842
971 Ga0496108_0035471 3300048911 Bacteria 4146
972 Ga0496108_0044171 3300048911 Bacteria 3720
973 Ga0496108_0102734 3300048911 Bacteria 2439
974 Ga0496108_0156934 3300048911 Bacteria 1965
975 Ga0496109_0002022 3300048912 Bacteria 16815
976 Ga0496109_0009994 3300048912 Bacteria 8101
977 Ga0496109_0047395 3300048912 Bacteria 3907
978 Ga0496110_0011799 3300048913 Bacteria 7172
979 Ga0496110_0015896 3300048913 Bacteria 6275
980 Ga0496110_0017806 3300048913 Bacteria 5946
981 Ga0496111_0012549 3300048914 Bacteria 5741
982 Ga0496111_0025286 3300048914 Bacteria 4189
983 Ga0496111_0065813 3300048914 Bacteria 2631
984 Ga0496112_0007858 3300048915 Bacteria 9496
985 Ga0496112_0016612 3300048915 Bacteria 6900
986 Ga0496112_0025295 3300048915 Bacteria 5700
987 Ga0496112_0063172 3300048915 Bacteria 3652
988 Ga0496112_0071321 3300048915 Bacteria 3433
989 Ga0496112_0220124 3300048915 Bacteria 1854
990 Ga0496113_0000477 3300048916 Bacteria 19609
991 Ga0496113_0004906 3300048916 Bacteria 8285
992 Ga0496113_0007008 3300048916 Bacteria 7208
993 Ga0496113_0030474 3300048916 Bacteria 3905
994 Ga0496113_0102931 3300048916 Bacteria 2215
995 Ga0496114_0000092 3300048917 Bacteria 64974
996 Ga0496114_0058179 3300048917 Bacteria 3227
997 Ga0496115_0003182 3300048918 Bacteria 11797
998 Ga0496122_0005326 3300048925 Bacteria 15379
999 Ga0496123_0000335 3300048926 Bacteria 89251
1000 Ga0496125_0026063 3300048928 Bacteria 5339
1001 Ga0501067_0034153 3300049583 Bacteria 2822
1002 Ga0501070_0037756 3300049586 Bacteria 4032
1003 nmdc:mga0a205_3470_c1 3300050515 Bacteria 14082
1004 Ga0500643_012158 3300053087 Bacteria 3094
1005 Ga0500556_0000013 3300053104 Bacteria 243797
1006 Ga0500594_0000617 3300053118 Bacteria 7612
1007 Ga0500642_0000002 3300053130 Bacteria 795093
1008 Ga0500658_0000177 3300053134 Bacteria 30497
1009 Ga0500645_000898 3300053730 Bacteria 17208
1010 Ga0466962_0001560 3300061719 Bacteria 10699
1011 Ga0466962_0044517 3300061719 Bacteria 2123

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046684 Ga0495669_0000793 Ga0495669_0000793_22_1113 342
2 3300028381 Ga0268264_10303614 Ga0268264_103036142 344
3 3300044719 Ga0466971_0029693 Ga0466971_0029693_1112_2434 363
4 3300001989 JGI24739J22299_10005592 JGI24739J22299_100055923 364
5 3300002075 JGI24738J21930_10008137 JGI24738J21930_100081371 364
6 3300002077 JGI24744J21845_10000562 JGI24744J21845_100005623 364
7 3300005331 Ga0070670_100009865 Ga0070670_1000098652 364
8 3300005338 Ga0068868_100190274 Ga0068868_1001902742 364
9 3300005343 Ga0070687_100008048 Ga0070687_1000080483 364
10 3300005344 Ga0070661_100037305 Ga0070661_1000373051 364
11 3300005354 Ga0070675_100053466 Ga0070675_1000534663 364
12 3300005356 Ga0070674_100071873 Ga0070674_1000718733 364
13 3300005456 Ga0070678_100111532 Ga0070678_1001115321 364
14 3300005458 Ga0070681_10129102 Ga0070681_101291021 364
15 3300005543 Ga0070672_100079739 Ga0070672_1000797392 364
16 3300005564 Ga0070664_100007489 Ga0070664_1000074894 364
17 3300005616 Ga0068852_100076608 Ga0068852_1000766083 364
18 3300005718 Ga0068866_10072421 Ga0068866_100724212 364
19 3300006358 Ga0068871_100112995 Ga0068871_1001129952 364
20 3300025315 Ga0207697_10005074 Ga0207697_100050744 364
21 3300025901 Ga0207688_10005488 Ga0207688_100054884 364
22 3300025907 Ga0207645_10040683 Ga0207645_100406832 364
23 3300025912 Ga0207707_10163012 Ga0207707_101630122 364
24 3300025919 Ga0207657_10006837 Ga0207657_100068378 364
25 3300025933 Ga0207706_10004449 Ga0207706_100044493 364
26 3300025940 Ga0207691_10007200 Ga0207691_100072006 364
27 3300025942 Ga0207689_10010397 Ga0207689_100103972 364
28 3300026067 Ga0207678_10016860 Ga0207678_100168604 364
29 3300026089 Ga0207648_10000889 Ga0207648_1000088926 364
30 3300026121 Ga0207683_10031581 Ga0207683_100315813 364
31 3300005327 Ga0070658_10037552 Ga0070658_100375523 365
32 3300005339 Ga0070660_100028243 Ga0070660_1000282433 365
33 3300005344 Ga0070661_100039088 Ga0070661_1000390882 365
34 3300005455 Ga0070663_100209215 Ga0070663_1002092151 365
35 3300005539 Ga0068853_100091317 Ga0068853_1000913173 365
36 3300025933 Ga0207706_10147739 Ga0207706_101477392 365
37 3300025903 Ga0207680_10090324 Ga0207680_100903243 369
38 3300044656 Ga0466969_0000621 Ga0466969_0000621_2248_3570 371
39 3300044684 Ga0466966_0008485 Ga0466966_0008485_4825_6147 371
40 3300044693 Ga0466961_0009637 Ga0466961_0009637_172_1494 371
41 3300044842 Ga0466957_0002504 Ga0466957_0002504_7651_8973 371
42 3300045836 Ga0466958_0001865 Ga0466958_0001865_6090_7412 371
43 3300005327 Ga0070658_10194499 Ga0070658_101944992 377
44 3300025909 Ga0207705_10153577 Ga0207705_101535772 377
45 3300037418 Ga0395900_0041618 Ga0395900_0041618_493_1773 377
46 3300037471 Ga0395905_0001393 Ga0395905_0001393_24797_26077 377
47 3300005457 Ga0070662_100057658 Ga0070662_1000576581 378
48 3300013102 Ga0157371_10115536 Ga0157371_101155362 378
49 3300013297 Ga0157378_10021008 Ga0157378_100210084 378
50 3300014745 Ga0157377_10051881 Ga0157377_100518812 378
51 3300025933 Ga0207706_10034971 Ga0207706_100349714 378
52 3300046525 Ga0495663_0027930 Ga0495663_0027930_303_1577 378
53 3300046537 Ga0495598_0005475 Ga0495598_0005475_198_1472 378
54 3300046558 Ga0495633_0001909 Ga0495633_0001909_10671_11945 378
55 3300046665 Ga0495661_0093519 Ga0495661_0093519_196_1470 378
56 3300048905 Ga0496102_0131883 Ga0496102_0131883_397_1671 378
57 3300005548 Ga0070665_100004175 Ga0070665_1000041759 379
58 3300005564 Ga0070664_100019031 Ga0070664_1000190312 379
59 3300005834 Ga0068851_10008326 Ga0068851_100083263 379
60 3300025909 Ga0207705_10023463 Ga0207705_100234631 379
61 3300025919 Ga0207657_10009276 Ga0207657_100092766 379
62 3300025920 Ga0207649_10024959 Ga0207649_100249592 379
63 3300025932 Ga0207690_10102186 Ga0207690_101021861 379
64 3300026041 Ga0207639_10071569 Ga0207639_100715693 379
65 3300037418 Ga0395900_0162885 Ga0395900_0162885_600_1874 379
66 3300037471 Ga0395905_0095470 Ga0395905_0095470_719_1993 379
67 3300038443 Ga0395901_0032674 Ga0395901_0032674_1883_3157 379
68 3300046616 Ga0495668_0009686 Ga0495668_0009686_1579_2853 379
69 3300046616 Ga0495668_0010993 Ga0495668_0010993_2483_3757 379
70 3300046684 Ga0495669_0002160 Ga0495669_0002160_3946_5220 379
71 3300046684 Ga0495669_0034986 Ga0495669_0034986_462_1736 379
72 3300025925 Ga0207650_10163966 Ga0207650_101639662 380
73 3300042157 Ga0439458_0000630 Ga0439458_0000630_1076_2350 381
74 3300005329 Ga0070683_100017806 Ga0070683_1000178063 382
75 3300005336 Ga0070680_100002826 Ga0070680_1000028262 382
76 3300005337 Ga0070682_100023584 Ga0070682_1000235842 382
77 3300005457 Ga0070662_100083480 Ga0070662_1000834802 382
78 3300005535 Ga0070684_100008971 Ga0070684_1000089713 382
79 3300005564 Ga0070664_100017818 Ga0070664_1000178185 382
80 3300005577 Ga0068857_100099662 Ga0068857_1000996623 382
81 3300009551 Ga0105238_10151955 Ga0105238_101519552 382
82 3300013100 Ga0157373_10039550 Ga0157373_100395503 382
83 3300013307 Ga0157372_10077732 Ga0157372_100777323 382
84 3300025904 Ga0207647_10002253 Ga0207647_100022536 382
85 3300025911 Ga0207654_10021170 Ga0207654_100211703 382
86 3300025912 Ga0207707_10142456 Ga0207707_101424563 382
87 3300025913 Ga0207695_10086508 Ga0207695_100865082 382
88 3300025919 Ga0207657_10013729 Ga0207657_100137297 382
89 3300025924 Ga0207694_10053090 Ga0207694_100530902 382
90 3300025932 Ga0207690_10014725 Ga0207690_100147252 382
91 3300025933 Ga0207706_10109445 Ga0207706_101094452 382
92 3300025981 Ga0207640_10012845 Ga0207640_100128453 382
93 3300026041 Ga0207639_10022105 Ga0207639_100221053 382
94 3300026078 Ga0207702_10002086 Ga0207702_100020863 382
95 3300026116 Ga0207674_10002803 Ga0207674_1000280314 382
96 3300026142 Ga0207698_10001668 Ga0207698_1000166815 382
97 3300037312 Ga0395899_0024899 Ga0395899_0024899_1686_2960 382
98 3300038443 Ga0395901_0035963 Ga0395901_0035963_950_2227 382
99 3300005329 Ga0070683_100017720 Ga0070683_1000177204 384
100 3300005336 Ga0070680_100033294 Ga0070680_1000332943 384
101 3300005455 Ga0070663_100004737 Ga0070663_1000047374 384
102 3300005458 Ga0070681_10151535 Ga0070681_101515353 384
103 3300005530 Ga0070679_100125523 Ga0070679_1001255232 384
104 3300005535 Ga0070684_100005959 Ga0070684_1000059599 384
105 3300005539 Ga0068853_100071667 Ga0068853_1000716672 384
106 3300005577 Ga0068857_100007161 Ga0068857_1000071616 384
107 3300009174 Ga0105241_10072331 Ga0105241_100723312 384
108 3300013102 Ga0157371_10028922 Ga0157371_100289223 384
109 3300013105 Ga0157369_10074576 Ga0157369_100745762 384
110 3300025919 Ga0207657_10006400 Ga0207657_1000640011 384
111 3300025944 Ga0207661_10010702 Ga0207661_100107025 384
112 3300025949 Ga0207667_10043138 Ga0207667_100431383 384
113 3300026067 Ga0207678_10007964 Ga0207678_100079646 384
114 3300026078 Ga0207702_10034812 Ga0207702_100348123 384
115 3300026116 Ga0207674_10005074 Ga0207674_100050746 384
116 3300005335 Ga0070666_10013618 Ga0070666_100136183 386
117 3300025903 Ga0207680_10020116 Ga0207680_100201163 386
118 3300031548 Ga0307408_100063600 Ga0307408_1000636003 386
119 3300037471 Ga0395905_0001433 Ga0395905_0001433_12295_13569 386
120 3300038443 Ga0395901_0060934 Ga0395901_0060934_1048_2322 386
121 3300045976 Ga0466967_0002551 Ga0466967_0002551_6632_7906 386
122 3300046684 Ga0495669_0013474 Ga0495669_0013474_263_1537 386
123 3300013100 Ga0157373_10078940 Ga0157373_100789402 387
124 3300037312 Ga0395899_0072265 Ga0395899_0072265_778_2052 387
125 3300037418 Ga0395900_0064455 Ga0395900_0064455_1672_2946 387
126 3300048915 Ga0496112_0071321 Ga0496112_0071321_2184_3413 387
127 3300037471 Ga0395905_0008961 Ga0395905_0008961_7290_8564 388
128 3300038443 Ga0395901_0062838 Ga0395901_0062838_1593_2867 388
129 3300001979 JGI24740J21852_10001368 JGI24740J21852_100013683 389
130 3300001989 JGI24739J22299_10017121 JGI24739J22299_100171213 389
131 3300001990 JGI24737J22298_10000083 JGI24737J22298_1000008318 389
132 3300002075 JGI24738J21930_10000137 JGI24738J21930_1000013711 389
133 3300005328 Ga0070676_10005075 Ga0070676_100050757 389
134 3300005330 Ga0070690_100015310 Ga0070690_1000153101 389
135 3300005330 Ga0070690_100029475 Ga0070690_1000294752 389
136 3300005334 Ga0068869_100000354 Ga0068869_10000035427 389
137 3300005335 Ga0070666_10000413 Ga0070666_100004136 389
138 3300005338 Ga0068868_100000103 Ga0068868_10000010327 389
139 3300005338 Ga0068868_100000237 Ga0068868_10000023712 389
140 3300005339 Ga0070660_100001016 Ga0070660_10000101622 389
141 3300005340 Ga0070689_100041464 Ga0070689_1000414644 389
142 3300005344 Ga0070661_100048908 Ga0070661_1000489084 389
143 3300005353 Ga0070669_100000870 Ga0070669_10000087022 389
144 3300005355 Ga0070671_100022040 Ga0070671_1000220407 389
145 3300005355 Ga0070671_100047487 Ga0070671_1000474873 389
146 3300005356 Ga0070674_100008282 Ga0070674_1000082827 389
147 3300005356 Ga0070674_100019817 Ga0070674_1000198173 389
148 3300005364 Ga0070673_100000336 Ga0070673_1000003367 389
149 3300005364 Ga0070673_100004667 Ga0070673_1000046673 389
150 3300005366 Ga0070659_100000817 Ga0070659_10000081718 389
151 3300005367 Ga0070667_100001053 Ga0070667_10000105323 389
152 3300005434 Ga0070709_10112984 Ga0070709_101129841 389
153 3300005435 Ga0070714_100022003 Ga0070714_1000220033 389
154 3300005436 Ga0070713_100014226 Ga0070713_1000142263 389
155 3300005457 Ga0070662_100007824 Ga0070662_1000078242 389
156 3300005459 Ga0068867_100000319 Ga0068867_1000003198 389
157 3300005459 Ga0068867_100015757 Ga0068867_1000157573 389
158 3300005539 Ga0068853_100000360 Ga0068853_1000003608 389
159 3300005543 Ga0070672_100001298 Ga0070672_1000012982 389
160 3300005548 Ga0070665_100001570 Ga0070665_10000157019 389
161 3300005563 Ga0068855_100000640 Ga0068855_1000006408 389
162 3300005577 Ga0068857_100000727 Ga0068857_10000072716 389
163 3300005578 Ga0068854_100000197 Ga0068854_1000001979 389
164 3300005617 Ga0068859_100011644 Ga0068859_1000116444 389
165 3300005618 Ga0068864_100000331 Ga0068864_10000033143 389
166 3300005718 Ga0068866_10015398 Ga0068866_100153983 389
167 3300005834 Ga0068851_10006817 Ga0068851_100068176 389
168 3300005834 Ga0068851_10107711 Ga0068851_101077111 389
169 3300005840 Ga0068870_10022008 Ga0068870_100220082 389
170 3300005841 Ga0068863_100006196 Ga0068863_1000061969 389
171 3300005842 Ga0068858_100001213 Ga0068858_10000121328 389
172 3300005842 Ga0068858_100015868 Ga0068858_1000158687 389
173 3300005843 Ga0068860_100002891 Ga0068860_10000289113 389
174 3300005844 Ga0068862_100013388 Ga0068862_1000133881 389
175 3300006931 Ga0097620_100011643 Ga0097620_1000116434 389
176 3300009098 Ga0105245_10000407 Ga0105245_1000040719 389
177 3300009177 Ga0105248_10001673 Ga0105248_100016733 389
178 3300010375 Ga0105239_10143098 Ga0105239_101430982 389
179 3300013100 Ga0157373_10011750 Ga0157373_100117504 389
180 3300013102 Ga0157371_10001390 Ga0157371_100013905 389
181 3300013297 Ga0157378_10010391 Ga0157378_100103917 389
182 3300013306 Ga0163162_10015017 Ga0163162_100150173 389
183 3300013307 Ga0157372_10131890 Ga0157372_101318904 389
184 3300025315 Ga0207697_10000104 Ga0207697_100001047 389
185 3300025321 Ga0207656_10005263 Ga0207656_100052632 389
186 3300025899 Ga0207642_10007779 Ga0207642_100077793 389
187 3300025901 Ga0207688_10001426 Ga0207688_100014266 389
188 3300025903 Ga0207680_10001311 Ga0207680_100013119 389
189 3300025904 Ga0207647_10001144 Ga0207647_1000114423 389
190 3300025904 Ga0207647_10009369 Ga0207647_100093696 389
191 3300025907 Ga0207645_10006392 Ga0207645_100063927 389
192 3300025919 Ga0207657_10009943 Ga0207657_100099437 389
193 3300025919 Ga0207657_10108137 Ga0207657_101081373 389
194 3300025926 Ga0207659_10048956 Ga0207659_100489563 389
195 3300025927 Ga0207687_10003635 Ga0207687_100036353 389
196 3300025931 Ga0207644_10003126 Ga0207644_100031266 389
197 3300025931 Ga0207644_10010323 Ga0207644_100103233 389
198 3300025931 Ga0207644_10067308 Ga0207644_100673082 389
199 3300025932 Ga0207690_10001552 Ga0207690_100015523 389
200 3300025933 Ga0207706_10000346 Ga0207706_1000034618 389
201 3300025933 Ga0207706_10055114 Ga0207706_100551143 389
202 3300025936 Ga0207670_10025891 Ga0207670_100258913 389
203 3300025937 Ga0207669_10019022 Ga0207669_100190223 389
204 3300025937 Ga0207669_10048574 Ga0207669_100485741 389
205 3300025940 Ga0207691_10044678 Ga0207691_100446786 389
206 3300025941 Ga0207711_10000826 Ga0207711_1000082612 389
207 3300025941 Ga0207711_10003594 Ga0207711_100035943 389
208 3300025941 Ga0207711_10018079 Ga0207711_100180793 389
209 3300025942 Ga0207689_10000033 Ga0207689_1000003375 389
210 3300025960 Ga0207651_10000139 Ga0207651_1000013916 389
211 3300025960 Ga0207651_10002769 Ga0207651_100027697 389
212 3300025972 Ga0207668_10014820 Ga0207668_100148203 389
213 3300025981 Ga0207640_10000853 Ga0207640_1000085311 389
214 3300025986 Ga0207658_10005167 Ga0207658_100051676 389
215 3300026023 Ga0207677_10000472 Ga0207677_1000047213 389
216 3300026023 Ga0207677_10000612 Ga0207677_1000061221 389
217 3300026035 Ga0207703_10002917 Ga0207703_1000291715 389
218 3300026035 Ga0207703_10011839 Ga0207703_100118397 389
219 3300026041 Ga0207639_10050623 Ga0207639_100506233 389
220 3300026088 Ga0207641_10004609 Ga0207641_100046095 389
221 3300026089 Ga0207648_10000554 Ga0207648_100005547 389
222 3300026089 Ga0207648_10011713 Ga0207648_100117134 389
223 3300026095 Ga0207676_10000439 Ga0207676_1000043923 389
224 3300026116 Ga0207674_10000104 Ga0207674_1000010450 389
225 3300026116 Ga0207674_10214516 Ga0207674_102145162 389
226 3300026118 Ga0207675_100181007 Ga0207675_1001810072 389
227 3300026121 Ga0207683_10028924 Ga0207683_100289243 389
228 3300026142 Ga0207698_10002149 Ga0207698_100021499 389
229 3300026142 Ga0207698_10011185 Ga0207698_100111854 389
230 3300028379 Ga0268266_10001840 Ga0268266_100018404 389
231 3300028381 Ga0268264_10002226 Ga0268264_100022263 389
232 3300031995 Ga0307409_100025475 Ga0307409_1000254753 389
233 3300032004 Ga0307414_10055500 Ga0307414_100555003 389
234 3300037312 Ga0395899_0000103 Ga0395899_0000103_106103_107380 389
235 3300037418 Ga0395900_0000093 Ga0395900_0000093_160704_161981 389
236 3300037466 Ga0395898_0000053 Ga0395898_0000053_160704_161981 389
237 3300037471 Ga0395905_0000031 Ga0395905_0000031_124777_126054 389
238 3300037471 Ga0395905_0236811 Ga0395905_0236811_19_1296 389
239 3300038443 Ga0395901_0000163 Ga0395901_0000163_85593_86870 389
240 3300053118 Ga0500594_0000617 Ga0500594_0000617_2803_4131 389
241 3300005327 Ga0070658_10078019 Ga0070658_100780192 390
242 3300005457 Ga0070662_100220010 Ga0070662_1002200101 390
243 3300005564 Ga0070664_100151036 Ga0070664_1001510362 390
244 3300009177 Ga0105248_10001772 Ga0105248_1000177216 390
245 3300013104 Ga0157370_10001517 Ga0157370_100015173 390
246 3300025909 Ga0207705_10072990 Ga0207705_100729903 390
247 3300025919 Ga0207657_10050781 Ga0207657_100507812 390
248 3300025931 Ga0207644_10028505 Ga0207644_100285052 390
249 3300025941 Ga0207711_10001908 Ga0207711_1000190812 390
250 3300025945 Ga0207679_10029743 Ga0207679_100297433 390
251 3300037418 Ga0395900_0135829 Ga0395900_0135829_399_1673 390
252 3300048909 Ga0496106_0007914 Ga0496106_0007914_6572_7846 390
253 3300048911 Ga0496108_0102734 Ga0496108_0102734_1039_2313 390
254 3300048914 Ga0496111_0012549 Ga0496111_0012549_3621_4895 390
255 3300048915 Ga0496112_0025295 Ga0496112_0025295_3433_4707 390
256 3300005577 Ga0068857_100009126 Ga0068857_1000091268 391
257 3300005841 Ga0068863_100011229 Ga0068863_1000112299 391
258 3300013102 Ga0157371_10023169 Ga0157371_100231695 391
259 3300014325 Ga0163163_10017559 Ga0163163_100175595 391
260 3300025904 Ga0207647_10102282 Ga0207647_101022822 391
261 3300026088 Ga0207641_10046505 Ga0207641_100465053 391
262 3300026116 Ga0207674_10000410 Ga0207674_1000041056 391
263 3300037418 Ga0395900_0098963 Ga0395900_0098963_708_1982 391
264 3300048910 Ga0496107_0021466 Ga0496107_0021466_204_1478 391
265 3300048912 Ga0496109_0002022 Ga0496109_0002022_3416_4690 391
266 3300025981 Ga0207640_10151535 Ga0207640_101515352 392
267 3300005435 Ga0070714_100104375 Ga0070714_1001043753 393
268 3300005436 Ga0070713_100007630 Ga0070713_1000076307 393
269 3300005436 Ga0070713_100020489 Ga0070713_1000204896 393
270 3300025928 Ga0207700_10037527 Ga0207700_100375273 393
271 3300037471 Ga0395905_0005682 Ga0395905_0005682_2820_4097 393
272 3300044683 Ga0466965_0028059 Ga0466965_0028059_584_1900 393
273 3300044693 Ga0466961_0021929 Ga0466961_0021929_880_2196 393
274 3300044706 Ga0466964_0002327 Ga0466964_0002327_2563_3879 393
275 3300044735 Ga0466968_0001195 Ga0466968_0001195_4325_5641 393
276 3300045049 Ga0466959_0016786 Ga0466959_0016786_3013_4329 393
277 3300045836 Ga0466958_0016995 Ga0466958_0016995_883_2199 393
278 3300045976 Ga0466967_0036403 Ga0466967_0036403_189_1463 393
279 3300005339 Ga0070660_100031872 Ga0070660_1000318723 394
280 3300037418 Ga0395900_0087589 Ga0395900_0087589_392_1666 395
281 3300038443 Ga0395901_0013469 Ga0395901_0013469_965_2239 395
282 3300005328 Ga0070676_10001742 Ga0070676_1000174213 396
283 3300005329 Ga0070683_100090024 Ga0070683_1000900243 396
284 3300005336 Ga0070680_100004105 Ga0070680_1000041056 396
285 3300005336 Ga0070680_100143961 Ga0070680_1001439612 396
286 3300005347 Ga0070668_100004880 Ga0070668_1000048803 396
287 3300005353 Ga0070669_100024763 Ga0070669_1000247632 396
288 3300005356 Ga0070674_100009998 Ga0070674_1000099983 396
289 3300005458 Ga0070681_10125763 Ga0070681_101257633 396
290 3300005459 Ga0068867_100003291 Ga0068867_10000329110 396
291 3300005577 Ga0068857_100190312 Ga0068857_1001903122 396
292 3300005844 Ga0068862_100001236 Ga0068862_1000012366 396
293 3300006881 Ga0068865_100022651 Ga0068865_1000226512 396
294 3300009177 Ga0105248_10147419 Ga0105248_101474193 396
295 3300013297 Ga0157378_10232902 Ga0157378_102329021 396
296 3300013306 Ga0163162_10217946 Ga0163162_102179462 396
297 3300013308 Ga0157375_10000628 Ga0157375_100006286 396
298 3300013308 Ga0157375_10043314 Ga0157375_100433144 396
299 3300025917 Ga0207660_10004335 Ga0207660_100043356 396
300 3300025938 Ga0207704_10106537 Ga0207704_101065372 396
301 3300025940 Ga0207691_10012322 Ga0207691_100123224 396
302 3300025972 Ga0207668_10000150 Ga0207668_1000015036 396
303 3300026089 Ga0207648_10001898 Ga0207648_1000189816 396
304 3300026116 Ga0207674_10098836 Ga0207674_100988363 396
305 3300026121 Ga0207683_10082285 Ga0207683_100822853 396
306 3300028380 Ga0268265_10022143 Ga0268265_100221434 396
307 3300028381 Ga0268264_10005389 Ga0268264_100053893 396
308 3300037418 Ga0395900_0332316 Ga0395900_0332316_15_1268 396
309 3300038443 Ga0395901_0275699 Ga0395901_0275699_272_1567 396
310 3300044694 Ga0466963_0036704 Ga0466963_0036704_1758_3071 396
311 3300044694 Ga0466963_0066469 Ga0466963_0066469_237_1511 396
312 3300044719 Ga0466971_0014113 Ga0466971_0014113_642_1916 396
313 3300044719 Ga0466971_0018509 Ga0466971_0018509_1349_2623 396
314 3300044842 Ga0466957_0001433 Ga0466957_0001433_8033_9307 396
315 3300045836 Ga0466958_0005586 Ga0466958_0005586_3448_4722 396
316 3300045976 Ga0466967_0017710 Ga0466967_0017710_1524_2798 396
317 3300045976 Ga0466967_0070720 Ga0466967_0070720_218_1513 396
318 3300045976 Ga0466967_0098140 Ga0466967_0098140_716_1969 396
319 3300045976 Ga0466967_0117840 Ga0466967_0117840_567_1841 396
320 3300005327 Ga0070658_10027498 Ga0070658_100274982 397
321 3300005329 Ga0070683_100003807 Ga0070683_1000038076 397
322 3300005535 Ga0070684_100002809 Ga0070684_1000028096 397
323 3300013105 Ga0157369_10051385 Ga0157369_100513852 397
324 3300025909 Ga0207705_10009761 Ga0207705_100097613 397
325 3300025944 Ga0207661_10012427 Ga0207661_100124273 397
326 3300037418 Ga0395900_0009496 Ga0395900_0009496_6420_7715 397
327 3300037466 Ga0395898_0164011 Ga0395898_0164011_750_2045 397
328 3300037471 Ga0395905_0163368 Ga0395905_0163368_48_1343 397
329 3300044693 Ga0466961_0081131 Ga0466961_0081131_82_1428 397
330 3300044694 Ga0466963_0027439 Ga0466963_0027439_2306_3580 397
331 3300044694 Ga0466963_0108692 Ga0466963_0108692_254_1528 397
332 3300045976 Ga0466967_0048122 Ga0466967_0048122_366_1640 397
333 3300061719 Ga0466962_0044517 Ga0466962_0044517_55_1401 397
334 3300005367 Ga0070667_100043584 Ga0070667_1000435842 398
335 3300005563 Ga0068855_100063164 Ga0068855_1000631642 398
336 3300005843 Ga0068860_100106469 Ga0068860_1001064693 398
337 3300013102 Ga0157371_10067933 Ga0157371_100679332 398
338 3300013105 Ga0157369_10080836 Ga0157369_100808363 398
339 3300025917 Ga0207660_10040569 Ga0207660_100405693 398
340 3300025986 Ga0207658_10023742 Ga0207658_100237424 398
341 3300026142 Ga0207698_10000336 Ga0207698_1000033628 398
342 3300042157 Ga0439458_0008580 Ga0439458_0008580_60_1334 398
343 3300044684 Ga0466966_0094212 Ga0466966_0094212_336_1610 398
344 3300045836 Ga0466958_0151376 Ga0466958_0151376_64_1338 398
345 3300045976 Ga0466967_0049235 Ga0466967_0049235_484_1758 398
346 3300045976 Ga0466967_0121145 Ga0466967_0121145_883_2178 398
347 3300001979 JGI24740J21852_10009591 JGI24740J21852_100095911 399
348 3300001990 JGI24737J22298_10000489 JGI24737J22298_1000048911 399
349 3300002075 JGI24738J21930_10000658 JGI24738J21930_100006585 399
350 3300005327 Ga0070658_10000130 Ga0070658_1000013032 399
351 3300005327 Ga0070658_10001253 Ga0070658_1000125317 399
352 3300005329 Ga0070683_100049766 Ga0070683_1000497663 399
353 3300005335 Ga0070666_10000841 Ga0070666_1000084118 399
354 3300005339 Ga0070660_100000391 Ga0070660_10000039110 399
355 3300005339 Ga0070660_100002265 Ga0070660_10000226510 399
356 3300005344 Ga0070661_100000206 Ga0070661_10000020628 399
357 3300005345 Ga0070692_10017011 Ga0070692_100170112 399
358 3300005355 Ga0070671_100001277 Ga0070671_10000127718 399
359 3300005366 Ga0070659_100000884 Ga0070659_10000088410 399
360 3300005367 Ga0070667_100003548 Ga0070667_10000354810 399
361 3300005455 Ga0070663_100002583 Ga0070663_1000025832 399
362 3300005457 Ga0070662_100000107 Ga0070662_10000010736 399
363 3300005535 Ga0070684_100019710 Ga0070684_1000197103 399
364 3300005539 Ga0068853_100000172 Ga0068853_10000017222 399
365 3300005547 Ga0070693_100000967 Ga0070693_1000009673 399
366 3300005548 Ga0070665_100001716 Ga0070665_10000171622 399
367 3300005563 Ga0068855_100006629 Ga0068855_1000066296 399
368 3300005564 Ga0070664_100000032 Ga0070664_10000003210 399
369 3300005578 Ga0068854_100020084 Ga0068854_1000200846 399
370 3300005614 Ga0068856_100000364 Ga0068856_10000036427 399
371 3300005616 Ga0068852_100003915 Ga0068852_1000039156 399
372 3300005618 Ga0068864_100014656 Ga0068864_1000146563 399
373 3300006358 Ga0068871_100262397 Ga0068871_1002623971 399
374 3300009174 Ga0105241_10041508 Ga0105241_100415083 399
375 3300009177 Ga0105248_10000238 Ga0105248_1000023827 399
376 3300009551 Ga0105238_10010961 Ga0105238_100109614 399
377 3300013102 Ga0157371_10002868 Ga0157371_100028688 399
378 3300013102 Ga0157371_10012775 Ga0157371_100127755 399
379 3300013104 Ga0157370_10092250 Ga0157370_100922501 399
380 3300013296 Ga0157374_10011760 Ga0157374_100117603 399
381 3300014325 Ga0163163_10000543 Ga0163163_100005436 399
382 3300025904 Ga0207647_10022523 Ga0207647_100225233 399
383 3300025909 Ga0207705_10000200 Ga0207705_1000020063 399
384 3300025909 Ga0207705_10014212 Ga0207705_100142124 399
385 3300025911 Ga0207654_10043581 Ga0207654_100435813 399
386 3300025919 Ga0207657_10000643 Ga0207657_100006436 399
387 3300025919 Ga0207657_10001403 Ga0207657_1000140321 399
388 3300025920 Ga0207649_10000362 Ga0207649_1000036219 399
389 3300025924 Ga0207694_10021780 Ga0207694_100217804 399
390 3300025931 Ga0207644_10002090 Ga0207644_1000209016 399
391 3300025932 Ga0207690_10000062 Ga0207690_1000006231 399
392 3300025933 Ga0207706_10000211 Ga0207706_1000021127 399
393 3300025941 Ga0207711_10001518 Ga0207711_100015184 399
394 3300025944 Ga0207661_10007618 Ga0207661_100076187 399
395 3300025945 Ga0207679_10000506 Ga0207679_1000050622 399
396 3300025949 Ga0207667_10006936 Ga0207667_100069366 399
397 3300025981 Ga0207640_10011087 Ga0207640_100110872 399
398 3300025986 Ga0207658_10004749 Ga0207658_100047493 399
399 3300026041 Ga0207639_10000532 Ga0207639_1000053221 399
400 3300026078 Ga0207702_10001280 Ga0207702_1000128011 399
401 3300026095 Ga0207676_10015869 Ga0207676_100158696 399
402 3300026142 Ga0207698_10000958 Ga0207698_1000095811 399
403 3300028379 Ga0268266_10024349 Ga0268266_100243493 399
404 3300035691 Ga0373931_0004625 Ga0373931_0004625_4289_5563 399
405 3300037312 Ga0395899_0000917 Ga0395899_0000917_22623_23918 399
406 3300037418 Ga0395900_0000031 Ga0395900_0000031_156467_157762 399
407 3300037466 Ga0395898_0022140 Ga0395898_0022140_3341_4636 399
408 3300038443 Ga0395901_0000035 Ga0395901_0000035_128150_129445 399
409 3300005344 Ga0070661_100027769 Ga0070661_1000277693 401
410 3300005366 Ga0070659_100045782 Ga0070659_1000457823 401
411 3300005435 Ga0070714_100006882 Ga0070714_1000068826 401
412 3300005435 Ga0070714_100008944 Ga0070714_1000089445 401
413 3300005436 Ga0070713_100154752 Ga0070713_1001547522 401
414 3300005455 Ga0070663_100046077 Ga0070663_1000460773 401
415 3300005539 Ga0068853_100091548 Ga0068853_1000915483 401
416 3300013100 Ga0157373_10020464 Ga0157373_100204646 401
417 3300025929 Ga0207664_10074862 Ga0207664_100748622 401
418 3300006237 Ga0097621_100007314 Ga0097621_1000073144 402
419 3300026116 Ga0207674_10015759 Ga0207674_100157593 402
420 3300048917 Ga0496114_0000092 Ga0496114_0000092_60661_61974 402
421 3300048928 Ga0496125_0026063 Ga0496125_0026063_2603_3901 402
422 3300001979 JGI24740J21852_10002192 JGI24740J21852_100021923 403
423 3300001979 JGI24740J21852_10004085 JGI24740J21852_100040856 403
424 3300001990 JGI24737J22298_10004705 JGI24737J22298_100047052 403
425 3300001990 JGI24737J22298_10007117 JGI24737J22298_100071173 403
426 3300001991 JGI24743J22301_10008145 JGI24743J22301_100081452 403
427 3300002067 JGI24735J21928_10024019 JGI24735J21928_100240192 403
428 3300002075 JGI24738J21930_10003143 JGI24738J21930_100031436 403
429 3300005293 Ga0065715_10027510 Ga0065715_100275101 403
430 3300005327 Ga0070658_10008670 Ga0070658_100086707 403
431 3300005327 Ga0070658_10058340 Ga0070658_100583403 403
432 3300005329 Ga0070683_100171655 Ga0070683_1001716552 403
433 3300005331 Ga0070670_100007935 Ga0070670_1000079357 403
434 3300005331 Ga0070670_100014320 Ga0070670_1000143204 403
435 3300005331 Ga0070670_100019881 Ga0070670_1000198814 403
436 3300005331 Ga0070670_100024843 Ga0070670_1000248433 403
437 3300005331 Ga0070670_100047086 Ga0070670_1000470864 403
438 3300005333 Ga0070677_10004870 Ga0070677_100048703 403
439 3300005335 Ga0070666_10018324 Ga0070666_100183242 403
440 3300005335 Ga0070666_10074062 Ga0070666_100740622 403
441 3300005336 Ga0070680_100067459 Ga0070680_1000674592 403
442 3300005338 Ga0068868_100014704 Ga0068868_1000147043 403
443 3300005338 Ga0068868_100062346 Ga0068868_1000623463 403
444 3300005339 Ga0070660_100026890 Ga0070660_1000268905 403
445 3300005339 Ga0070660_100095608 Ga0070660_1000956083 403
446 3300005344 Ga0070661_100013976 Ga0070661_1000139766 403
447 3300005344 Ga0070661_100047459 Ga0070661_1000474593 403
448 3300005345 Ga0070692_10013194 Ga0070692_100131943 403
449 3300005347 Ga0070668_100068423 Ga0070668_1000684233 403
450 3300005353 Ga0070669_100055113 Ga0070669_1000551133 403
451 3300005354 Ga0070675_100003436 Ga0070675_1000034367 403
452 3300005354 Ga0070675_100036547 Ga0070675_1000365473 403
453 3300005355 Ga0070671_100003748 Ga0070671_1000037483 403
454 3300005355 Ga0070671_100006325 Ga0070671_1000063255 403
455 3300005355 Ga0070671_100012700 Ga0070671_1000127003 403
456 3300005355 Ga0070671_100022396 Ga0070671_1000223965 403
457 3300005355 Ga0070671_100186377 Ga0070671_1001863771 403
458 3300005364 Ga0070673_100002521 Ga0070673_1000025215 403
459 3300005364 Ga0070673_100003078 Ga0070673_1000030789 403
460 3300005364 Ga0070673_100008886 Ga0070673_1000088863 403
461 3300005364 Ga0070673_100011294 Ga0070673_1000112946 403
462 3300005364 Ga0070673_100035919 Ga0070673_1000359194 403
463 3300005366 Ga0070659_100014992 Ga0070659_1000149923 403
464 3300005366 Ga0070659_100015136 Ga0070659_1000151362 403
465 3300005366 Ga0070659_100017370 Ga0070659_1000173703 403
466 3300005366 Ga0070659_100039913 Ga0070659_1000399133 403
467 3300005366 Ga0070659_100057226 Ga0070659_1000572263 403
468 3300005367 Ga0070667_100004684 Ga0070667_10000468413 403
469 3300005367 Ga0070667_100019866 Ga0070667_1000198663 403
470 3300005444 Ga0070694_100005307 Ga0070694_1000053072 403
471 3300005455 Ga0070663_100016846 Ga0070663_1000168463 403
472 3300005455 Ga0070663_100029359 Ga0070663_1000293593 403
473 3300005456 Ga0070678_100012771 Ga0070678_1000127716 403
474 3300005456 Ga0070678_100075221 Ga0070678_1000752211 403
475 3300005457 Ga0070662_100008319 Ga0070662_1000083196 403
476 3300005457 Ga0070662_100008913 Ga0070662_1000089134 403
477 3300005457 Ga0070662_100034454 Ga0070662_1000344543 403
478 3300005457 Ga0070662_100069466 Ga0070662_1000694663 403
479 3300005457 Ga0070662_100094581 Ga0070662_1000945812 403
480 3300005458 Ga0070681_10054043 Ga0070681_100540432 403
481 3300005458 Ga0070681_10187917 Ga0070681_101879172 403
482 3300005459 Ga0068867_100024875 Ga0068867_1000248753 403
483 3300005459 Ga0068867_100029478 Ga0068867_1000294783 403
484 3300005530 Ga0070679_100020767 Ga0070679_1000207675 403
485 3300005535 Ga0070684_100137913 Ga0070684_1001379131 403
486 3300005539 Ga0068853_100161294 Ga0068853_1001612942 403
487 3300005543 Ga0070672_100001617 Ga0070672_1000016176 403
488 3300005543 Ga0070672_100010275 Ga0070672_1000102752 403
489 3300005543 Ga0070672_100010641 Ga0070672_1000106413 403
490 3300005543 Ga0070672_100131052 Ga0070672_1001310523 403
491 3300005545 Ga0070695_100066139 Ga0070695_1000661391 403
492 3300005547 Ga0070693_100015696 Ga0070693_1000156965 403
493 3300005548 Ga0070665_100012999 Ga0070665_1000129994 403
494 3300005548 Ga0070665_100013480 Ga0070665_1000134804 403
495 3300005548 Ga0070665_100018505 Ga0070665_1000185054 403
496 3300005548 Ga0070665_100033315 Ga0070665_1000333156 403
497 3300005548 Ga0070665_100037959 Ga0070665_1000379592 403
498 3300005563 Ga0068855_100009305 Ga0068855_1000093056 403
499 3300005564 Ga0070664_100001881 Ga0070664_1000018815 403
500 3300005564 Ga0070664_100004443 Ga0070664_10000444310 403
501 3300005564 Ga0070664_100004751 Ga0070664_10000475111 403
502 3300005564 Ga0070664_100036997 Ga0070664_1000369974 403
503 3300005564 Ga0070664_100079991 Ga0070664_1000799913 403
504 3300005577 Ga0068857_100002020 Ga0068857_10000202012 403
505 3300005577 Ga0068857_100022950 Ga0068857_1000229503 403
506 3300005578 Ga0068854_100007242 Ga0068854_1000072425 403
507 3300005614 Ga0068856_100015239 Ga0068856_1000152393 403
508 3300005617 Ga0068859_100003376 Ga0068859_1000033762 403
509 3300005617 Ga0068859_100015465 Ga0068859_1000154652 403
510 3300005617 Ga0068859_100029265 Ga0068859_1000292654 403
511 3300005617 Ga0068859_100130423 Ga0068859_1001304233 403
512 3300005618 Ga0068864_100000716 Ga0068864_10000071610 403
513 3300005618 Ga0068864_100013298 Ga0068864_1000132983 403
514 3300005618 Ga0068864_100343928 Ga0068864_1003439281 403
515 3300005834 Ga0068851_10102752 Ga0068851_101027522 403
516 3300005841 Ga0068863_100008814 Ga0068863_1000088143 403
517 3300005841 Ga0068863_100022629 Ga0068863_1000226293 403
518 3300005841 Ga0068863_100046144 Ga0068863_1000461443 403
519 3300005841 Ga0068863_100055577 Ga0068863_1000555773 403
520 3300005841 Ga0068863_100077693 Ga0068863_1000776931 403
521 3300005842 Ga0068858_100000642 Ga0068858_1000006426 403
522 3300005842 Ga0068858_100004459 Ga0068858_10000445912 403
523 3300005842 Ga0068858_100030657 Ga0068858_1000306576 403
524 3300005843 Ga0068860_100019853 Ga0068860_1000198537 403
525 3300005843 Ga0068860_100053149 Ga0068860_1000531493 403
526 3300005843 Ga0068860_100211996 Ga0068860_1002119962 403
527 3300005844 Ga0068862_100037656 Ga0068862_1000376562 403
528 3300005844 Ga0068862_100044284 Ga0068862_1000442842 403
529 3300006175 Ga0070712_100018385 Ga0070712_1000183853 403
530 3300006358 Ga0068871_100045352 Ga0068871_1000453523 403
531 3300006931 Ga0097620_100003376 Ga0097620_1000033762 403
532 3300006931 Ga0097620_100015465 Ga0097620_1000154657 403
533 3300006931 Ga0097620_100029264 Ga0097620_1000292644 403
534 3300006931 Ga0097620_100130426 Ga0097620_1001304263 403
535 3300009148 Ga0105243_10083438 Ga0105243_100834383 403
536 3300009177 Ga0105248_10008090 Ga0105248_100080906 403
537 3300009177 Ga0105248_10020703 Ga0105248_100207036 403
538 3300009177 Ga0105248_10021850 Ga0105248_100218506 403
539 3300009177 Ga0105248_10023558 Ga0105248_100235587 403
540 3300009177 Ga0105248_10033985 Ga0105248_100339853 403
541 3300009177 Ga0105248_10034417 Ga0105248_100344173 403
542 3300009177 Ga0105248_10046685 Ga0105248_100466854 403
543 3300009553 Ga0105249_10149430 Ga0105249_101494302 403
544 3300013100 Ga0157373_10002206 Ga0157373_100022066 403
545 3300013100 Ga0157373_10075414 Ga0157373_100754143 403
546 3300013102 Ga0157371_10095294 Ga0157371_100952943 403
547 3300013102 Ga0157371_10171870 Ga0157371_101718701 403
548 3300013102 Ga0157371_10192786 Ga0157371_101927861 403
549 3300013104 Ga0157370_10030709 Ga0157370_100307093 403
550 3300013104 Ga0157370_10084885 Ga0157370_100848853 403
551 3300013105 Ga0157369_10089239 Ga0157369_100892393 403
552 3300013105 Ga0157369_10141296 Ga0157369_101412962 403
553 3300013296 Ga0157374_10004801 Ga0157374_100048013 403
554 3300013296 Ga0157374_10012198 Ga0157374_100121986 403
555 3300013296 Ga0157374_10056725 Ga0157374_100567253 403
556 3300013296 Ga0157374_10067150 Ga0157374_100671503 403
557 3300013297 Ga0157378_10055263 Ga0157378_100552632 403
558 3300013306 Ga0163162_10050330 Ga0163162_100503306 403
559 3300013306 Ga0163162_10051750 Ga0163162_100517503 403
560 3300013306 Ga0163162_10084817 Ga0163162_100848173 403
561 3300013306 Ga0163162_10354051 Ga0163162_103540512 403
562 3300013307 Ga0157372_10143455 Ga0157372_101434553 403
563 3300013307 Ga0157372_10195159 Ga0157372_101951592 403
564 3300013307 Ga0157372_10303387 Ga0157372_103033873 403
565 3300013308 Ga0157375_10005662 Ga0157375_100056629 403
566 3300013308 Ga0157375_10036423 Ga0157375_100364233 403
567 3300013308 Ga0157375_10049209 Ga0157375_100492093 403
568 3300013308 Ga0157375_10102558 Ga0157375_101025583 403
569 3300013308 Ga0157375_10119316 Ga0157375_101193164 403
570 3300014325 Ga0163163_10001581 Ga0163163_1000158116 403
571 3300014325 Ga0163163_10005921 Ga0163163_1000592110 403
572 3300014968 Ga0157379_10006904 Ga0157379_100069048 403
573 3300025893 Ga0207682_10032988 Ga0207682_100329881 403
574 3300025903 Ga0207680_10017198 Ga0207680_100171983 403
575 3300025903 Ga0207680_10059519 Ga0207680_100595193 403
576 3300025904 Ga0207647_10002185 Ga0207647_100021853 403
577 3300025904 Ga0207647_10010193 Ga0207647_100101934 403
578 3300025904 Ga0207647_10011244 Ga0207647_100112443 403
579 3300025904 Ga0207647_10023792 Ga0207647_100237923 403
580 3300025907 Ga0207645_10005343 Ga0207645_100053434 403
581 3300025909 Ga0207705_10013369 Ga0207705_100133692 403
582 3300025909 Ga0207705_10025066 Ga0207705_100250664 403
583 3300025909 Ga0207705_10048708 Ga0207705_100487082 403
584 3300025912 Ga0207707_10053133 Ga0207707_100531333 403
585 3300025915 Ga0207693_10016452 Ga0207693_100164524 403
586 3300025917 Ga0207660_10018885 Ga0207660_100188853 403
587 3300025919 Ga0207657_10002144 Ga0207657_100021446 403
588 3300025919 Ga0207657_10008661 Ga0207657_100086616 403
589 3300025919 Ga0207657_10017445 Ga0207657_100174457 403
590 3300025919 Ga0207657_10027996 Ga0207657_100279962 403
591 3300025919 Ga0207657_10105287 Ga0207657_101052873 403
592 3300025921 Ga0207652_10001035 Ga0207652_1000103521 403
593 3300025923 Ga0207681_10038204 Ga0207681_100382043 403
594 3300025925 Ga0207650_10013727 Ga0207650_100137275 403
595 3300025925 Ga0207650_10027776 Ga0207650_100277763 403
596 3300025925 Ga0207650_10100393 Ga0207650_101003932 403
597 3300025926 Ga0207659_10001010 Ga0207659_1000101015 403
598 3300025926 Ga0207659_10026382 Ga0207659_100263823 403
599 3300025927 Ga0207687_10080748 Ga0207687_100807482 403
600 3300025928 Ga0207700_10049843 Ga0207700_100498432 403
601 3300025929 Ga0207664_10016142 Ga0207664_100161423 403
602 3300025929 Ga0207664_10065498 Ga0207664_100654981 403
603 3300025931 Ga0207644_10000683 Ga0207644_100006836 403
604 3300025931 Ga0207644_10004110 Ga0207644_100041109 403
605 3300025931 Ga0207644_10004471 Ga0207644_100044713 403
606 3300025931 Ga0207644_10007550 Ga0207644_100075506 403
607 3300025931 Ga0207644_10022270 Ga0207644_100222703 403
608 3300025931 Ga0207644_10051726 Ga0207644_100517262 403
609 3300025932 Ga0207690_10003253 Ga0207690_100032536 403
610 3300025932 Ga0207690_10020149 Ga0207690_100201493 403
611 3300025932 Ga0207690_10030232 Ga0207690_100302322 403
612 3300025933 Ga0207706_10000866 Ga0207706_1000086626 403
613 3300025933 Ga0207706_10008019 Ga0207706_100080194 403
614 3300025933 Ga0207706_10012742 Ga0207706_100127427 403
615 3300025933 Ga0207706_10033561 Ga0207706_100335616 403
616 3300025933 Ga0207706_10254300 Ga0207706_102543001 403
617 3300025940 Ga0207691_10001025 Ga0207691_1000102531 403
618 3300025940 Ga0207691_10017470 Ga0207691_100174706 403
619 3300025940 Ga0207691_10112598 Ga0207691_101125982 403
620 3300025940 Ga0207691_10203044 Ga0207691_102030442 403
621 3300025941 Ga0207711_10000044 Ga0207711_10000044156 403
622 3300025941 Ga0207711_10000567 Ga0207711_100005678 403
623 3300025941 Ga0207711_10003425 Ga0207711_100034253 403
624 3300025941 Ga0207711_10009332 Ga0207711_100093327 403
625 3300025941 Ga0207711_10011201 Ga0207711_100112016 403
626 3300025941 Ga0207711_10012774 Ga0207711_100127742 403
627 3300025942 Ga0207689_10005042 Ga0207689_1000504210 403
628 3300025945 Ga0207679_10005182 Ga0207679_100051828 403
629 3300025945 Ga0207679_10038626 Ga0207679_100386263 403
630 3300025945 Ga0207679_10065843 Ga0207679_100658432 403
631 3300025949 Ga0207667_10011406 Ga0207667_100114065 403
632 3300025960 Ga0207651_10004400 Ga0207651_100044006 403
633 3300025960 Ga0207651_10019458 Ga0207651_100194583 403
634 3300025960 Ga0207651_10025639 Ga0207651_100256394 403
635 3300025961 Ga0207712_10003387 Ga0207712_100033876 403
636 3300025961 Ga0207712_10028459 Ga0207712_100284593 403
637 3300025972 Ga0207668_10061309 Ga0207668_100613092 403
638 3300025972 Ga0207668_10068129 Ga0207668_100681294 403
639 3300025981 Ga0207640_10036628 Ga0207640_100366282 403
640 3300025981 Ga0207640_10131459 Ga0207640_101314592 403
641 3300025986 Ga0207658_10003798 Ga0207658_100037983 403
642 3300025986 Ga0207658_10020604 Ga0207658_100206042 403
643 3300025986 Ga0207658_10023660 Ga0207658_100236603 403
644 3300025986 Ga0207658_10026685 Ga0207658_100266854 403
645 3300025986 Ga0207658_10073853 Ga0207658_100738532 403
646 3300026023 Ga0207677_10044133 Ga0207677_100441333 403
647 3300026023 Ga0207677_10076123 Ga0207677_100761232 403
648 3300026035 Ga0207703_10014891 Ga0207703_100148917 403
649 3300026035 Ga0207703_10015184 Ga0207703_100151844 403
650 3300026035 Ga0207703_10027050 Ga0207703_100270502 403
651 3300026035 Ga0207703_10072309 Ga0207703_100723092 403
652 3300026035 Ga0207703_10154767 Ga0207703_101547672 403
653 3300026067 Ga0207678_10000325 Ga0207678_1000032547 403
654 3300026067 Ga0207678_10003985 Ga0207678_100039856 403
655 3300026067 Ga0207678_10021371 Ga0207678_100213713 403
656 3300026088 Ga0207641_10005321 Ga0207641_1000532110 403
657 3300026088 Ga0207641_10008031 Ga0207641_100080315 403
658 3300026089 Ga0207648_10072619 Ga0207648_100726193 403
659 3300026089 Ga0207648_10093664 Ga0207648_100936642 403
660 3300026095 Ga0207676_10003029 Ga0207676_100030294 403
661 3300026095 Ga0207676_10031379 Ga0207676_100313794 403
662 3300026095 Ga0207676_10082689 Ga0207676_100826893 403
663 3300026095 Ga0207676_10090305 Ga0207676_100903053 403
664 3300026116 Ga0207674_10000641 Ga0207674_1000064152 403
665 3300026116 Ga0207674_10014333 Ga0207674_100143333 403
666 3300026116 Ga0207674_10027592 Ga0207674_100275924 403
667 3300026116 Ga0207674_10063685 Ga0207674_100636854 403
668 3300026121 Ga0207683_10003836 Ga0207683_100038366 403
669 3300026121 Ga0207683_10013902 Ga0207683_100139023 403
670 3300026121 Ga0207683_10066672 Ga0207683_100666723 403
671 3300026142 Ga0207698_10162540 Ga0207698_101625402 403
672 3300028379 Ga0268266_10023948 Ga0268266_100239486 403
673 3300028379 Ga0268266_10024060 Ga0268266_100240603 403
674 3300028379 Ga0268266_10030023 Ga0268266_100300232 403
675 3300028379 Ga0268266_10036777 Ga0268266_100367772 403
676 3300028380 Ga0268265_10025308 Ga0268265_100253084 403
677 3300028381 Ga0268264_10000338 Ga0268264_100003386 403
678 3300028381 Ga0268264_10006757 Ga0268264_100067574 403
679 3300032002 Ga0307416_100017484 Ga0307416_1000174843 403
680 3300035111 Ga0373923_0064233 Ga0373923_0064233_68_1342 403
681 3300035172 Ga0373955_0076717 Ga0373955_0076717_504_1778 403
682 3300035725 Ga0373947_0137371 Ga0373947_0137371_59_1336 403
683 3300036401 Ga0373937_0015662 Ga0373937_0015662_4892_6166 403
684 3300037068 Ga0373925_0007654 Ga0373925_0007654_1861_3138 403
685 3300037312 Ga0395899_0001385 Ga0395899_0001385_4628_5905 403
686 3300037312 Ga0395899_0024773 Ga0395899_0024773_817_2094 403
687 3300037312 Ga0395899_0037206 Ga0395899_0037206_1691_2965 403
688 3300037312 Ga0395899_0127398 Ga0395899_0127398_276_1550 403
689 3300037312 Ga0395899_0181061 Ga0395899_0181061_146_1420 403
690 3300037418 Ga0395900_0006570 Ga0395900_0006570_5668_6942 403
691 3300037418 Ga0395900_0023881 Ga0395900_0023881_3473_4747 403
692 3300037418 Ga0395900_0052438 Ga0395900_0052438_814_2088 403
693 3300037418 Ga0395900_0165660 Ga0395900_0165660_101_1375 403
694 3300037418 Ga0395900_0183696 Ga0395900_0183696_340_1614 403
695 3300037418 Ga0395900_0235400 Ga0395900_0235400_405_1679 403
696 3300037418 Ga0395900_0259497 Ga0395900_0259497_57_1334 403
697 3300037418 Ga0395900_0284345 Ga0395900_0284345_144_1418 403
698 3300037466 Ga0395898_0002184 Ga0395898_0002184_20394_21668 403
699 3300037466 Ga0395898_0007615 Ga0395898_0007615_673_1950 403
700 3300037466 Ga0395898_0008057 Ga0395898_0008057_4832_6109 403
701 3300037466 Ga0395898_0033883 Ga0395898_0033883_312_1586 403
702 3300037466 Ga0395898_0052453 Ga0395898_0052453_101_1375 403
703 3300037466 Ga0395898_0225689 Ga0395898_0225689_377_1651 403
704 3300037471 Ga0395905_0010035 Ga0395905_0010035_2961_4235 403
705 3300037471 Ga0395905_0010719 Ga0395905_0010719_6083_7357 403
706 3300037471 Ga0395905_0013358 Ga0395905_0013358_5900_7177 403
707 3300037471 Ga0395905_0020888 Ga0395905_0020888_2400_3674 403
708 3300037471 Ga0395905_0027864 Ga0395905_0027864_238_1512 403
709 3300037471 Ga0395905_0044774 Ga0395905_0044774_744_2018 403
710 3300037471 Ga0395905_0060933 Ga0395905_0060933_1167_2441 403
711 3300037471 Ga0395905_0076579 Ga0395905_0076579_1113_2387 403
712 3300038443 Ga0395901_0014591 Ga0395901_0014591_4418_5692 403
713 3300038443 Ga0395901_0015826 Ga0395901_0015826_4909_6186 403
714 3300038443 Ga0395901_0039743 Ga0395901_0039743_3519_4793 403
715 3300038443 Ga0395901_0051165 Ga0395901_0051165_210_1484 403
716 3300038443 Ga0395901_0095605 Ga0395901_0095605_828_2105 403
717 3300038443 Ga0395901_0144392 Ga0395901_0144392_472_1749 403
718 3300038443 Ga0395901_0213372 Ga0395901_0213372_585_1859 403
719 3300042012 Ga0439455_0010576 Ga0439455_0010576_470_1744 403
720 3300042144 Ga0450889_000016 Ga0450889_000016_3886_5160 403
721 3300042439 Ga0439464_0009234 Ga0439464_0009234_511_1785 403
722 3300044684 Ga0466966_0010180 Ga0466966_0010180_61_1377 403
723 3300044693 Ga0466961_0118341 Ga0466961_0118341_348_1622 403
724 3300044694 Ga0466963_0024507 Ga0466963_0024507_11_1285 403
725 3300044842 Ga0466957_0092362 Ga0466957_0092362_533_1807 403
726 3300044901 Ga0466960_0086791 Ga0466960_0086791_257_1531 403
727 3300045976 Ga0466967_0003894 Ga0466967_0003894_6219_7493 403
728 3300045976 Ga0466967_0048202 Ga0466967_0048202_320_1594 403
729 3300045976 Ga0466967_0109991 Ga0466967_0109991_863_2140 403
730 3300045976 Ga0466967_0167670 Ga0466967_0167670_596_1870 403
731 3300046539 Ga0495621_0001621 Ga0495621_0001621_3658_4932 403
732 3300046616 Ga0495668_0010783 Ga0495668_0010783_838_2112 403
733 3300046684 Ga0495669_0000442 Ga0495669_0000442_3746_5020 403
734 3300046691 Ga0495670_0034649 Ga0495670_0034649_281_1555 403
735 3300048088 Ga0495602_0020274 Ga0495602_0020274_3014_4288 403
736 3300048903 Ga0496100_0022557 Ga0496100_0022557_1371_2648 403
737 3300048904 Ga0496101_0015674 Ga0496101_0015674_2802_4079 403
738 3300048904 Ga0496101_0060197 Ga0496101_0060197_1040_2314 403
739 3300048904 Ga0496101_0087538 Ga0496101_0087538_640_1914 403
740 3300048904 Ga0496101_0160927 Ga0496101_0160927_368_1645 403
741 3300048911 Ga0496108_0002584 Ga0496108_0002584_6981_8258 403
742 3300048911 Ga0496108_0011108 Ga0496108_0011108_1836_3110 403
743 3300048911 Ga0496108_0044171 Ga0496108_0044171_807_2081 403
744 3300048912 Ga0496109_0047395 Ga0496109_0047395_1406_2683 403
745 3300048913 Ga0496110_0011799 Ga0496110_0011799_3829_5103 403
746 3300048913 Ga0496110_0017806 Ga0496110_0017806_942_2219 403
747 3300048914 Ga0496111_0025286 Ga0496111_0025286_942_2219 403
748 3300048914 Ga0496111_0065813 Ga0496111_0065813_85_1359 403
749 3300048915 Ga0496112_0007858 Ga0496112_0007858_2675_3952 403
750 3300048915 Ga0496112_0220124 Ga0496112_0220124_349_1623 403
751 3300048916 Ga0496113_0004906 Ga0496113_0004906_5473_6750 403
752 3300048916 Ga0496113_0007008 Ga0496113_0007008_1703_2980 403
753 3300048916 Ga0496113_0030474 Ga0496113_0030474_807_2081 403
754 3300048917 Ga0496114_0058179 Ga0496114_0058179_1000_2277 403
755 3300048918 Ga0496115_0003182 Ga0496115_0003182_3537_4811 403
756 3300049583 Ga0501067_0034153 Ga0501067_0034153_372_1649 403
757 3300050515 nmdc:mga0a205_3470_c1 nmdc:mga0a205_3470_c1_10149_11426 403
758 3300053134 Ga0500658_0000177 Ga0500658_0000177_442_1716 403
759 3300037312 Ga0395899_0024913 Ga0395899_0024913_3011_4375 404
760 3300037312 Ga0395899_0047200 Ga0395899_0047200_13_1344 404
761 3300037418 Ga0395900_0017627 Ga0395900_0017627_5479_6810 404
762 3300037418 Ga0395900_0021609 Ga0395900_0021609_2638_4002 404
763 3300037466 Ga0395898_0007670 Ga0395898_0007670_9010_10341 404
764 3300037471 Ga0395905_0003199 Ga0395905_0003199_8517_9848 404
765 3300037471 Ga0395905_0086748 Ga0395905_0086748_34_1398 404
766 3300038443 Ga0395901_0007270 Ga0395901_0007270_8170_9501 404
767 3300038443 Ga0395901_0221317 Ga0395901_0221317_438_1802 404
768 3300044694 Ga0466963_0085314 Ga0466963_0085314_32_1363 406
769 3300005327 Ga0070658_10060755 Ga0070658_100607552 407
770 3300005345 Ga0070692_10066586 Ga0070692_100665863 407
771 3300005563 Ga0068855_100143024 Ga0068855_1001430243 407
772 3300013307 Ga0157372_10201607 Ga0157372_102016072 407
773 3300037312 Ga0395899_0054727 Ga0395899_0054727_1023_2318 407
774 3300037418 Ga0395900_0280978 Ga0395900_0280978_155_1450 407
775 3300037466 Ga0395898_0061968 Ga0395898_0061968_718_2013 407
776 3300037466 Ga0395898_0114325 Ga0395898_0114325_207_1502 407
777 3300037471 Ga0395905_0122079 Ga0395905_0122079_538_1833 407
778 3300038443 Ga0395901_0287918 Ga0395901_0287918_129_1424 407
779 3300046616 Ga0495668_0013297 Ga0495668_0013297_2658_3977 407
780 3300048925 Ga0496122_0005326 Ga0496122_0005326_9462_10778 407
781 3300048926 Ga0496123_0000335 Ga0496123_0000335_56619_57935 407
782 3300053087 Ga0500643_012158 Ga0500643_012158_1139_2458 407
783 3300053104 Ga0500556_0000013 Ga0500556_0000013_178524_179843 407
784 3300053130 Ga0500642_0000002 Ga0500642_0000002_411929_413248 407
785 3300053730 Ga0500645_000898 Ga0500645_000898_10816_12135 407
786 3300005435 Ga0070714_100035022 Ga0070714_1000350223 408
787 3300025929 Ga0207664_10009182 Ga0207664_100091823 408
788 3300044684 Ga0466966_0109430 Ga0466966_0109430_282_1667 408
789 3300005539 Ga0068853_100037971 Ga0068853_1000379713 409
790 3300026041 Ga0207639_10074993 Ga0207639_100749932 409
791 3300048911 Ga0496108_0156934 Ga0496108_0156934_139_1443 409
792 3300001990 JGI24737J22298_10000515 JGI24737J22298_1000051512 410
793 3300005327 Ga0070658_10003302 Ga0070658_100033027 410
794 3300005327 Ga0070658_10035785 Ga0070658_100357853 410
795 3300005331 Ga0070670_100021575 Ga0070670_1000215751 410
796 3300005331 Ga0070670_100038410 Ga0070670_1000384106 410
797 3300005339 Ga0070660_100000830 Ga0070660_10000083010 410
798 3300005341 Ga0070691_10048544 Ga0070691_100485442 410
799 3300005344 Ga0070661_100011275 Ga0070661_1000112756 410
800 3300005344 Ga0070661_100072306 Ga0070661_1000723064 410
801 3300005366 Ga0070659_100020644 Ga0070659_1000206442 410
802 3300005458 Ga0070681_10016414 Ga0070681_100164141 410
803 3300005458 Ga0070681_10166978 Ga0070681_101669782 410
804 3300005539 Ga0068853_100008708 Ga0068853_1000087082 410
805 3300005539 Ga0068853_100023202 Ga0068853_1000232024 410
806 3300005563 Ga0068855_100009143 Ga0068855_10000914312 410
807 3300005563 Ga0068855_100021901 Ga0068855_10002190110 410
808 3300005563 Ga0068855_100025452 Ga0068855_1000254526 410
809 3300005577 Ga0068857_100070654 Ga0068857_1000706544 410
810 3300005578 Ga0068854_100015934 Ga0068854_1000159341 410
811 3300005616 Ga0068852_100000780 Ga0068852_1000007805 410
812 3300009545 Ga0105237_10014995 Ga0105237_100149955 410
813 3300009551 Ga0105238_10012445 Ga0105238_1001244510 410
814 3300013102 Ga0157371_10010430 Ga0157371_100104308 410
815 3300013105 Ga0157369_10000201 Ga0157369_1000020173 410
816 3300013105 Ga0157369_10011815 Ga0157369_100118155 410
817 3300013105 Ga0157369_10050586 Ga0157369_100505864 410
818 3300013296 Ga0157374_10053784 Ga0157374_100537843 410
819 3300013307 Ga0157372_10004206 Ga0157372_1000420617 410
820 3300025321 Ga0207656_10009031 Ga0207656_100090313 410
821 3300025904 Ga0207647_10024775 Ga0207647_100247752 410
822 3300025909 Ga0207705_10001216 Ga0207705_100012164 410
823 3300025919 Ga0207657_10000128 Ga0207657_1000012868 410
824 3300025919 Ga0207657_10000468 Ga0207657_1000046838 410
825 3300025919 Ga0207657_10003915 Ga0207657_1000391514 410
826 3300025919 Ga0207657_10028939 Ga0207657_100289396 410
827 3300025920 Ga0207649_10022491 Ga0207649_100224914 410
828 3300025923 Ga0207681_10021541 Ga0207681_100215415 410
829 3300025924 Ga0207694_10006948 Ga0207694_100069481 410
830 3300025926 Ga0207659_10023279 Ga0207659_100232792 410
831 3300025932 Ga0207690_10012561 Ga0207690_100125616 410
832 3300025932 Ga0207690_10097886 Ga0207690_100978862 410
833 3300025945 Ga0207679_10200304 Ga0207679_102003042 410
834 3300025949 Ga0207667_10037451 Ga0207667_100374511 410
835 3300025949 Ga0207667_10140190 Ga0207667_101401902 410
836 3300025960 Ga0207651_10061923 Ga0207651_100619233 410
837 3300026041 Ga0207639_10000990 Ga0207639_100009908 410
838 3300026041 Ga0207639_10037378 Ga0207639_100373782 410
839 3300026041 Ga0207639_10064947 Ga0207639_100649473 410
840 3300026116 Ga0207674_10020766 Ga0207674_100207667 410
841 3300026142 Ga0207698_10000775 Ga0207698_1000077522 410
842 3300037312 Ga0395899_0015642 Ga0395899_0015642_2093_3388 410
843 3300037312 Ga0395899_0020357 Ga0395899_0020357_2830_4125 410
844 3300037418 Ga0395900_0063710 Ga0395900_0063710_198_1493 410
845 3300037418 Ga0395900_0138454 Ga0395900_0138454_689_2005 410
846 3300037418 Ga0395900_0194163 Ga0395900_0194163_68_1363 410
847 3300037418 Ga0395900_0288086 Ga0395900_0288086_242_1537 410
848 3300037466 Ga0395898_0028334 Ga0395898_0028334_325_1620 410
849 3300037471 Ga0395905_0017739 Ga0395905_0017739_3640_4935 410
850 3300038443 Ga0395901_0007987 Ga0395901_0007987_5114_6409 410
851 3300038443 Ga0395901_0023924 Ga0395901_0023924_2668_3966 410
852 3300038443 Ga0395901_0036894 Ga0395901_0036894_1465_2760 410
853 3300038443 Ga0395901_0242737 Ga0395901_0242737_74_1390 410
854 3300037418 Ga0395900_0033954 Ga0395900_0033954_2679_4064 412
855 3300044658 Ga0466972_0031843 Ga0466972_0031843_588_1931 412
856 3300044693 Ga0466961_0010371 Ga0466961_0010371_2224_3540 412
857 3300044842 Ga0466957_0026759 Ga0466957_0026759_702_2018 412
858 3300045836 Ga0466958_0006030 Ga0466958_0006030_2971_4287 412
859 3300061719 Ga0466962_0001560 Ga0466962_0001560_9235_10551 412
860 3300037418 Ga0395900_0006491 Ga0395900_0006491_3550_4884 413
861 3300038443 Ga0395901_0000140 Ga0395901_0000140_45760_47094 413
862 3300046684 Ga0495669_0003343 Ga0495669_0003343_4135_5451 413
863 3300047445 Ga0495677_0004456 Ga0495677_0004456_265_1581 413
864 3300037471 Ga0395905_0000298 Ga0395905_0000298_29005_30321 414
865 3300005329 Ga0070683_100205234 Ga0070683_1002052342 415
866 3300005336 Ga0070680_100007978 Ga0070680_1000079783 415
867 3300005345 Ga0070692_10001029 Ga0070692_100010296 415
868 3300005345 Ga0070692_10007460 Ga0070692_100074604 415
869 3300005455 Ga0070663_100144032 Ga0070663_1001440322 415
870 3300005458 Ga0070681_10065948 Ga0070681_100659483 415
871 3300005530 Ga0070679_100054168 Ga0070679_1000541683 415
872 3300009093 Ga0105240_10036403 Ga0105240_100364036 415
873 3300009551 Ga0105238_10166366 Ga0105238_101663662 415
874 3300013100 Ga0157373_10061734 Ga0157373_100617342 415
875 3300013105 Ga0157369_10032604 Ga0157369_100326043 415
876 3300013307 Ga0157372_10076321 Ga0157372_100763212 415
877 3300025909 Ga0207705_10008123 Ga0207705_100081235 415
878 3300025913 Ga0207695_10038327 Ga0207695_100383276 415
879 3300025917 Ga0207660_10028327 Ga0207660_100283273 415
880 3300026067 Ga0207678_10066815 Ga0207678_100668152 415
881 3300037312 Ga0395899_0074055 Ga0395899_0074055_1116_2453 415
882 3300037418 Ga0395900_0136135 Ga0395900_0136135_1019_2356 415
883 3300037471 Ga0395905_0068435 Ga0395905_0068435_1710_3047 415
884 3300005344 Ga0070661_100005164 Ga0070661_1000051645 416
885 3300005355 Ga0070671_100035764 Ga0070671_1000357641 416
886 3300009177 Ga0105248_10082338 Ga0105248_100823381 416
887 3300048911 Ga0496108_0025841 Ga0496108_0025841_753_2093 416
888 3300005328 Ga0070676_10012653 Ga0070676_100126533 417
889 3300005331 Ga0070670_100003621 Ga0070670_1000036213 417
890 3300005339 Ga0070660_100044154 Ga0070660_1000441543 417
891 3300005344 Ga0070661_100006011 Ga0070661_1000060116 417
892 3300005355 Ga0070671_100002146 Ga0070671_10000214612 417
893 3300005455 Ga0070663_100003200 Ga0070663_1000032004 417
894 3300005456 Ga0070678_100011880 Ga0070678_1000118803 417
895 3300005539 Ga0068853_100006073 Ga0068853_1000060733 417
896 3300005546 Ga0070696_100009220 Ga0070696_1000092206 417
897 3300005564 Ga0070664_100004011 Ga0070664_1000040118 417
898 3300005564 Ga0070664_100044861 Ga0070664_1000448613 417
899 3300005577 Ga0068857_100007759 Ga0068857_1000077596 417
900 3300005614 Ga0068856_100026603 Ga0068856_1000266036 417
901 3300005616 Ga0068852_100002189 Ga0068852_1000021894 417
902 3300005616 Ga0068852_100109864 Ga0068852_1001098643 417
903 3300005617 Ga0068859_100038508 Ga0068859_1000385086 417
904 3300005834 Ga0068851_10015630 Ga0068851_100156301 417
905 3300005841 Ga0068863_100015760 Ga0068863_1000157608 417
906 3300005842 Ga0068858_100009762 Ga0068858_1000097625 417
907 3300005843 Ga0068860_100020991 Ga0068860_1000209914 417
908 3300005844 Ga0068862_100019041 Ga0068862_1000190414 417
909 3300006931 Ga0097620_100038509 Ga0097620_1000385096 417
910 3300009553 Ga0105249_10061591 Ga0105249_100615913 417
911 3300013100 Ga0157373_10047873 Ga0157373_100478733 417
912 3300014497 Ga0182008_10028870 Ga0182008_100288703 417
913 3300025893 Ga0207682_10025748 Ga0207682_100257483 417
914 3300025919 Ga0207657_10063717 Ga0207657_100637172 417
915 3300025920 Ga0207649_10015100 Ga0207649_100151004 417
916 3300025933 Ga0207706_10014422 Ga0207706_100144226 417
917 3300025945 Ga0207679_10020437 Ga0207679_100204372 417
918 3300026035 Ga0207703_10137555 Ga0207703_101375552 417
919 3300026067 Ga0207678_10002765 Ga0207678_1000276515 417
920 3300026067 Ga0207678_10026950 Ga0207678_100269506 417
921 3300026078 Ga0207702_10029638 Ga0207702_100296383 417
922 3300026089 Ga0207648_10179403 Ga0207648_101794032 417
923 3300026116 Ga0207674_10005803 Ga0207674_100058036 417
924 3300026142 Ga0207698_10010764 Ga0207698_100107645 417
925 3300028381 Ga0268264_10176771 Ga0268264_101767712 417
926 3300032005 Ga0307411_10163509 Ga0307411_101635091 417
927 3300037312 Ga0395899_0001799 Ga0395899_0001799_1732_3051 417
928 3300037418 Ga0395900_0059395 Ga0395900_0059395_986_2305 417
929 3300037418 Ga0395900_0134992 Ga0395900_0134992_251_1567 417
930 3300037466 Ga0395898_0007743 Ga0395898_0007743_10014_11333 417
931 3300037471 Ga0395905_0003189 Ga0395905_0003189_9501_10820 417
932 3300037471 Ga0395905_0018559 Ga0395905_0018559_1991_3310 417
933 3300037471 Ga0395905_0111648 Ga0395905_0111648_1175_2494 417
934 3300037471 Ga0395905_0186960 Ga0395905_0186960_583_1899 417
935 3300038443 Ga0395901_0002602 Ga0395901_0002602_6729_8048 417
936 3300038443 Ga0395901_0213817 Ga0395901_0213817_258_1577 417
937 3300044684 Ga0466966_0128645 Ga0466966_0128645_190_1506 417
938 3300044842 Ga0466957_0040332 Ga0466957_0040332_604_1920 417
939 3300045049 Ga0466959_0079804 Ga0466959_0079804_262_1578 417
940 3300049586 Ga0501070_0037756 Ga0501070_0037756_1196_2512 417
941 3300005344 Ga0070661_100010905 Ga0070661_1000109054 422
942 3300005355 Ga0070671_100011816 Ga0070671_1000118166 422
943 3300005355 Ga0070671_100022833 Ga0070671_1000228332 422
944 3300005356 Ga0070674_100013432 Ga0070674_1000134322 422
945 3300005366 Ga0070659_100039160 Ga0070659_1000391603 422
946 3300005367 Ga0070667_100019140 Ga0070667_1000191404 422
947 3300005457 Ga0070662_100000592 Ga0070662_1000005925 422
948 3300005843 Ga0068860_100101529 Ga0068860_1001015293 422
949 3300009177 Ga0105248_10037507 Ga0105248_100375077 422
950 3300011119 Ga0105246_10073833 Ga0105246_100738333 422
951 3300014325 Ga0163163_10043038 Ga0163163_100430383 422
952 3300014497 Ga0182008_10019281 Ga0182008_100192811 422
953 3300025933 Ga0207706_10001233 Ga0207706_100012333 422
954 3300025941 Ga0207711_10008075 Ga0207711_100080751 422
955 3300025941 Ga0207711_10158239 Ga0207711_101582392 422
956 3300037418 Ga0395900_0283871 Ga0395900_0283871_80_1489 422
957 3300037466 Ga0395898_0036635 Ga0395898_0036635_3079_4431 422
958 3300037471 Ga0395905_0044803 Ga0395905_0044803_868_2220 422
959 3300038443 Ga0395901_0021151 Ga0395901_0021151_2544_3896 422
960 3300048903 Ga0496100_0157170 Ga0496100_0157170_217_1557 422
961 3300048911 Ga0496108_0035471 Ga0496108_0035471_2046_3386 422
962 3300048912 Ga0496109_0009994 Ga0496109_0009994_5486_6826 422
963 3300048913 Ga0496110_0015896 Ga0496110_0015896_1443_2783 422
964 3300048915 Ga0496112_0016612 Ga0496112_0016612_3759_5099 422
965 3300048915 Ga0496112_0063172 Ga0496112_0063172_934_2274 422
966 3300048916 Ga0496113_0000477 Ga0496113_0000477_10518_11858 422
967 3300048916 Ga0496113_0102931 Ga0496113_0102931_205_1545 422
968 3300005336 Ga0070680_100002095 Ga0070680_1000020954 423
969 3300005530 Ga0070679_100119874 Ga0070679_1001198743 423
970 3300005563 Ga0068855_100062513 Ga0068855_1000625132 423
971 3300025921 Ga0207652_10089311 Ga0207652_100893113 423
972 3300026067 Ga0207678_10041131 Ga0207678_100411314 424
973 3300026142 Ga0207698_10182631 Ga0207698_101826312 424
974 3300001915 JGI24741J21665_1000905 JGI24741J21665_10009056 429
975 3300001979 JGI24740J21852_10000708 JGI24740J21852_1000070810 429
976 3300001989 JGI24739J22299_10005249 JGI24739J22299_100052496 429
977 3300002067 JGI24735J21928_10000952 JGI24735J21928_100009529 429
978 3300005327 Ga0070658_10013565 Ga0070658_100135651 429
979 3300005339 Ga0070660_100042325 Ga0070660_1000423252 429
980 3300005344 Ga0070661_100029153 Ga0070661_1000291532 429
981 3300005345 Ga0070692_10005490 Ga0070692_100054903 429
982 3300005353 Ga0070669_100032494 Ga0070669_1000324946 429
983 3300005354 Ga0070675_100064279 Ga0070675_1000642792 429
984 3300005455 Ga0070663_100015559 Ga0070663_1000155593 429
985 3300005457 Ga0070662_100010853 Ga0070662_1000108533 429
986 3300005458 Ga0070681_10056741 Ga0070681_100567411 429
987 3300005530 Ga0070679_100119070 Ga0070679_1001190702 429
988 3300005535 Ga0070684_100014804 Ga0070684_1000148043 429
989 3300005539 Ga0068853_100037060 Ga0068853_1000370606 429
990 3300005563 Ga0068855_100034044 Ga0068855_1000340446 429
991 3300005564 Ga0070664_100024097 Ga0070664_1000240973 429
992 3300005577 Ga0068857_100057080 Ga0068857_1000570803 429
993 3300005616 Ga0068852_100018475 Ga0068852_1000184753 429
994 3300013102 Ga0157371_10023918 Ga0157371_100239183 429
995 3300013102 Ga0157371_10042987 Ga0157371_100429873 429
996 3300013307 Ga0157372_10037174 Ga0157372_100371746 429
997 3300025909 Ga0207705_10004522 Ga0207705_1000452211 429
998 3300025912 Ga0207707_10010810 Ga0207707_100108104 429
999 3300025917 Ga0207660_10021615 Ga0207660_100216152 429
1000 3300025919 Ga0207657_10002853 Ga0207657_100028536 429
1001 3300025920 Ga0207649_10067049 Ga0207649_100670493 429
1002 3300025921 Ga0207652_10004394 Ga0207652_100043944 429
1003 3300025932 Ga0207690_10004163 Ga0207690_100041633 429
1004 3300025933 Ga0207706_10002307 Ga0207706_100023076 429
1005 3300025944 Ga0207661_10025242 Ga0207661_100252424 429
1006 3300025945 Ga0207679_10006404 Ga0207679_100064043 429
1007 3300025949 Ga0207667_10276454 Ga0207667_102764542 429
1008 3300026041 Ga0207639_10030452 Ga0207639_100304523 429
1009 3300026067 Ga0207678_10016569 Ga0207678_100165696 429
1010 3300026116 Ga0207674_10022581 Ga0207674_100225816 429
1011 3300026142 Ga0207698_10022265 Ga0207698_100222655 429

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

57

430

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wik-assembly1.cif.gz_A cryo-em structure of slc40/ferroportin with fab in the presence of hepcidin 0.7188 24 425
6wbv-assembly1.cif.gz_A structure of human ferroportin bound to hepcidin and cobalt in lipid nanodisc 0.7095 23 421
8ex5-assembly1.cif.gz_A human s1p transporter spns2 in an outward-facing open conformation (state 4) 0.7022 31 419
8dl6-assembly1.cif.gz_A cryo-em structure of human ferroportin/slc40 bound to ca2+ in nanodisc 0.6992 26 425
8dl8-assembly1.cif.gz_A cryo-em structure of human ferroportin/slc40 bound to co2+ in nanodisc 0.6978 24 424
ID Description Score Start End Superfamily
af_Q9VCJ5_201_360_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8599 67 211 1.20.1250.20
af_Q2FXH1_4_180_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.84 34 208 1.20.1250.20
af_A0A1D6L8U4_23_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8398 32 221 1.20.1250.20
af_Q22409_28_242_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8357 32 215 1.20.1250.20
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8338 27 224 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6M4H4S5-F1-model_v4 Lysophospholipid transporter LplT 0.8548 26 420 GO:0005886
GO:0016746
GO:0022857
AF-A0A2E6LYR6-F1-model_v4 MFS transporter 0.8471 23 419 GO:0005886
GO:0016746
GO:0022857
AF-A0A3D4YF71-F1-model_v4 Acyl-[ACP]--phospholipid O-acyltransferase 0.8324 26 421 GO:0006631
GO:0016020
GO:0016746
GO:0022857
GO:0031956
AF-A0A1Q6UG25-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.8238 27 421 GO:0005886
GO:0016746
GO:0022857
AF-B6W2L4-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.7901 35 302 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
78.47 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map