F488114

General Info

Members Datasets Scaffolds Average Seq Length
1010 355 2020 147

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10001160|Ga0213875_100011602
Length 172
Sequence MATVEVTFTPLPAHVRTARLVATAVARRSGVDESVLDEVRLAVGEACSRAVEAHRRHCPRQPIRVELTDHEERFEVVVTDSAPASENGRPGEHSGGGLGGITPPGTTEPADLQLPEGVGLAVIAGLADDVRISPAGAGISVRMSWKRRPHPETSLRLPGAPRIPGQRIPSFV

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
88 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
89 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
90 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
91 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
109 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300023680 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
117 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
171 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
172 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
173 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
174 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
175 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
176 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
179 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031633 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
193 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
197 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
198 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
199 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
231 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
239 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
240 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
284 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
289 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
328 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
329 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
332 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
343 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
344 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
345 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
346 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
347 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
348 2891562705 Microbispora tritici MT50 Isolate Unclassified
349 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
350 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
351 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
352 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
353 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
354 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
355 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.06
Metatranscriptomes 4.55
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.86
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 2.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10001160 3300021388 Bacteria 18079
2 JGI25404J52841_10003762 3300003659 Bacteria 3025
3 Ga0070658_10284147 3300005327 Bacteria 1409
4 Ga0070683_100154698 3300005329 Bacteria 2174
5 Ga0070683_100710506 3300005329 Bacteria 963
6 Ga0070690_100094826 3300005330 Bacteria 1969
7 Ga0070670_100812426 3300005331 Bacteria 845
8 Ga0068869_100307235 3300005334 Bacteria 1282
9 Ga0070680_100196932 3300005336 Bacteria 1698
10 Ga0070682_100216137 3300005337 Bacteria 1361
11 Ga0070682_100357397 3300005337 Bacteria 1091
12 Ga0068868_100600223 3300005338 Bacteria 975
13 Ga0068868_100719615 3300005338 Bacteria 894
14 Ga0070660_100099506 3300005339 Bacteria 2302
15 Ga0070689_100207991 3300005340 Bacteria 1601
16 Ga0070689_100722283 3300005340 Bacteria 871
17 Ga0070691_10076430 3300005341 Bacteria 1632
18 Ga0070661_100224898 3300005344 Bacteria 1440
19 Ga0070661_100276960 3300005344 Bacteria 1300
20 Ga0070692_10292496 3300005345 Bacteria 991
21 Ga0070668_100144901 3300005347 Bacteria 1916
22 Ga0070669_100223061 3300005353 Bacteria 1491
23 Ga0070671_100119704 3300005355 Bacteria 2215
24 Ga0070671_100438242 3300005355 Bacteria 1120
25 Ga0070671_100479365 3300005355 Bacteria 1069
26 Ga0070673_100113602 3300005364 Bacteria 2249
27 Ga0070688_100363395 3300005365 Bacteria 1063
28 Ga0070659_100202729 3300005366 Bacteria 1633
29 Ga0070667_100456397 3300005367 Bacteria 1168
30 Ga0070703_10006853 3300005406 Bacteria 3198
31 Ga0070709_10000478 3300005434 Bacteria 23598
32 Ga0070709_10021259 3300005434 Bacteria 3777
33 Ga0070709_10071599 3300005434 Bacteria 2239
34 Ga0070709_10083502 3300005434 Bacteria 2089
35 Ga0070709_10164330 3300005434 Bacteria 1546
36 Ga0070709_10614025 3300005434 Bacteria 838
37 Ga0070709_10718634 3300005434 Bacteria 778
38 Ga0070709_11585718 3300005434 Unclassified 533
39 Ga0070714_100002062 3300005435 Bacteria 14717
40 Ga0070714_100007589 3300005435 Bacteria 8446
41 Ga0070714_100016536 3300005435 Bacteria 5961
42 Ga0070714_100109366 3300005435 Bacteria 2445
43 Ga0070714_100112050 3300005435 Bacteria 2417
44 Ga0070714_100185883 3300005435 Bacteria 1893
45 Ga0070714_100220589 3300005435 Bacteria 1742
46 Ga0070714_100228724 3300005435 Bacteria 1712
47 Ga0070714_100277013 3300005435 Bacteria 1557
48 Ga0070714_100378322 3300005435 Bacteria 1334
49 Ga0070714_100423584 3300005435 Bacteria 1261
50 Ga0070714_100640804 3300005435 Bacteria 1022
51 Ga0070714_100652102 3300005435 Bacteria 1013
52 Ga0070714_101344698 3300005435 Bacteria 697
53 Ga0070713_100010874 3300005436 Bacteria 6598
54 Ga0070713_100016958 3300005436 Bacteria 5492
55 Ga0070713_100126314 3300005436 Bacteria 2250
56 Ga0070713_100141140 3300005436 Bacteria 2134
57 Ga0070713_100228817 3300005436 Bacteria 1689
58 Ga0070713_100241708 3300005436 Bacteria 1644
59 Ga0070713_100259696 3300005436 Bacteria 1587
60 Ga0070713_100272128 3300005436 Bacteria 1551
61 Ga0070713_100283152 3300005436 Bacteria 1521
62 Ga0070713_100353127 3300005436 Bacteria 1364
63 Ga0070713_100594909 3300005436 Bacteria 1050
64 Ga0070713_100741177 3300005436 Bacteria 939
65 Ga0070713_100804043 3300005436 Bacteria 901
66 Ga0070713_100948755 3300005436 Bacteria 828
67 Ga0070713_101241646 3300005436 Bacteria 722
68 Ga0070710_10000218 3300005437 Bacteria 26778
69 Ga0070710_10026373 3300005437 Bacteria 3086
70 Ga0070710_10043894 3300005437 Bacteria 2478
71 Ga0070710_10049761 3300005437 Bacteria 2345
72 Ga0070710_10084656 3300005437 Bacteria 1858
73 Ga0070710_10099489 3300005437 Bacteria 1729
74 Ga0070710_10278556 3300005437 Bacteria 1084
75 Ga0070710_10294392 3300005437 Bacteria 1057
76 Ga0070710_10325408 3300005437 Bacteria 1010
77 Ga0070710_10511471 3300005437 Bacteria 824
78 Ga0070710_11008735 3300005437 Bacteria 607
79 Ga0070701_10073219 3300005438 Bacteria 1837
80 Ga0070711_100043962 3300005439 Bacteria 3029
81 Ga0070711_100139861 3300005439 Bacteria 1814
82 Ga0070711_100319795 3300005439 Bacteria 1239
83 Ga0070711_100629776 3300005439 Bacteria 897
84 Ga0070705_100085548 3300005440 Bacteria 1949
85 Ga0070705_100134147 3300005440 Bacteria 1619
86 Ga0070705_100761545 3300005440 Bacteria 766
87 Ga0070708_100038950 3300005445 Bacteria 4157
88 Ga0070708_100141416 3300005445 Bacteria 2232
89 Ga0070708_100470073 3300005445 Bacteria 1186
90 Ga0070708_100520054 3300005445 Bacteria 1122
91 Ga0070708_100791130 3300005445 Bacteria 892
92 Ga0070708_100842242 3300005445 Bacteria 862
93 Ga0070663_100224380 3300005455 Bacteria 1476
94 Ga0070663_100441960 3300005455 Bacteria 1070
95 Ga0070678_100070412 3300005456 Bacteria 2614
96 Ga0070678_100150114 3300005456 Bacteria 1876
97 Ga0070662_100091588 3300005457 Bacteria 2284
98 Ga0070681_10148159 3300005458 Bacteria 2274
99 Ga0070681_10381700 3300005458 Bacteria 1320
100 Ga0070681_11086708 3300005458 Unclassified 721
101 Ga0068867_100173855 3300005459 Bacteria 1708
102 Ga0070706_100001339 3300005467 Bacteria 26189
103 Ga0070706_100003066 3300005467 Bacteria 16547
104 Ga0070706_100003951 3300005467 Bacteria 14437
105 Ga0070706_100011013 3300005467 Bacteria 8398
106 Ga0070706_100020290 3300005467 Bacteria 6125
107 Ga0070706_100092042 3300005467 Bacteria 2813
108 Ga0070706_100230597 3300005467 Bacteria 1728
109 Ga0070706_100311049 3300005467 Bacteria 1470
110 Ga0070706_100320556 3300005467 Bacteria 1445
111 Ga0070706_100342712 3300005467 Bacteria 1393
112 Ga0070706_101167113 3300005467 Bacteria 708
113 Ga0070707_100001503 3300005468 Bacteria 22738
114 Ga0070707_100002309 3300005468 Bacteria 18227
115 Ga0070707_100049280 3300005468 Bacteria 4037
116 Ga0070707_100051048 3300005468 Bacteria 3964
117 Ga0070707_100098856 3300005468 Bacteria 2827
118 Ga0070707_100392986 3300005468 Bacteria 1347
119 Ga0070707_100555568 3300005468 Bacteria 1110
120 Ga0070707_100637878 3300005468 Bacteria 1028
121 Ga0070707_100694760 3300005468 Bacteria 980
122 Ga0070707_100763163 3300005468 Bacteria 930
123 Ga0070698_100000546 3300005471 Bacteria 40175
124 Ga0070698_100000665 3300005471 Bacteria 36678
125 Ga0070698_100005898 3300005471 Bacteria 13363
126 Ga0070698_100026037 3300005471 Bacteria 6092
127 Ga0070698_100042199 3300005471 Bacteria 4679
128 Ga0070698_100318507 3300005471 Bacteria 1486
129 Ga0070698_100882412 3300005471 Bacteria 840
130 Ga0070699_100010962 3300005518 Bacteria 7838
131 Ga0070699_100321904 3300005518 Bacteria 1390
132 Ga0070699_101701285 3300005518 Bacteria 578
133 Ga0070679_100104922 3300005530 Bacteria 2812
134 Ga0070679_101690239 3300005530 Unclassified 581
135 Ga0070684_100266179 3300005535 Bacteria 1568
136 Ga0070684_100339750 3300005535 Bacteria 1380
137 Ga0070684_100802935 3300005535 Bacteria 880
138 Ga0070697_100037989 3300005536 Bacteria 3889
139 Ga0070697_100085732 3300005536 Bacteria 2599
140 Ga0068853_100104187 3300005539 Bacteria 2511
141 Ga0070672_100458414 3300005543 Bacteria 1099
142 Ga0070686_100030161 3300005544 Bacteria 3305
143 Ga0070696_100255956 3300005546 Bacteria 1326
144 Ga0070665_100231408 3300005548 Bacteria 1848
145 Ga0070665_100535172 3300005548 Bacteria 1183
146 Ga0070704_100123917 3300005549 Bacteria 1990
147 Ga0068855_100164436 3300005563 Bacteria 2516
148 Ga0070664_100078162 3300005564 Bacteria 2846
149 Ga0070664_101066061 3300005564 Bacteria 760
150 Ga0068857_100041418 3300005577 Bacteria 4084
151 Ga0068857_100532833 3300005577 Bacteria 1105
152 Ga0068856_100008941 3300005614 Bacteria 9743
153 Ga0068856_100081996 3300005614 Bacteria 3200
154 Ga0068856_100810969 3300005614 Bacteria 955
155 Ga0070702_100075402 3300005615 Bacteria 2004
156 Ga0070702_100456884 3300005615 Bacteria 928
157 Ga0068852_100934634 3300005616 Bacteria 885
158 Ga0068864_100197116 3300005618 Bacteria 1848
159 Ga0068864_100411271 3300005618 Bacteria 1287
160 Ga0068866_10137407 3300005718 Bacteria 1398
161 Ga0068861_100260870 3300005719 Bacteria 1483
162 Ga0068863_100064425 3300005841 Bacteria 3466
163 Ga0068863_100265685 3300005841 Bacteria 1660
164 Ga0068858_101468641 3300005842 Bacteria 672
165 Ga0081540_1000345 3300005983 Bacteria 46912
166 Ga0081540_1002862 3300005983 Bacteria 13954
167 Ga0070717_10001611 3300006028 Bacteria 15618
168 Ga0070717_10045967 3300006028 Bacteria 3571
169 Ga0070717_10097050 3300006028 Bacteria 2497
170 Ga0070717_10099155 3300006028 Bacteria 2471
171 Ga0070717_10133015 3300006028 Bacteria 2140
172 Ga0070717_10153160 3300006028 Bacteria 1996
173 Ga0070717_10243900 3300006028 Bacteria 1585
174 Ga0070717_10320531 3300006028 Bacteria 1381
175 Ga0070717_10323441 3300006028 Bacteria 1374
176 Ga0070717_10337377 3300006028 Bacteria 1345
177 Ga0070717_10517372 3300006028 Bacteria 1079
178 Ga0070717_10519169 3300006028 Bacteria 1077
179 Ga0070717_10621238 3300006028 Bacteria 980
180 Ga0070717_11378659 3300006028 Bacteria 640
181 Ga0070715_10001165 3300006163 Bacteria 7542
182 Ga0070715_10016810 3300006163 Bacteria 2757
183 Ga0070715_10085671 3300006163 Bacteria 1439
184 Ga0070716_100000108 3300006173 Bacteria 32360
185 Ga0070716_100001275 3300006173 Bacteria 11109
186 Ga0070716_100004463 3300006173 Bacteria 6689
187 Ga0070716_100016224 3300006173 Bacteria 3839
188 Ga0070716_100024749 3300006173 Bacteria 3198
189 Ga0070716_100276055 3300006173 Bacteria 1157
190 Ga0070716_100491260 3300006173 Bacteria 903
191 Ga0070716_100570682 3300006173 Bacteria 847
192 Ga0070712_100000686 3300006175 Bacteria 19993
193 Ga0070712_100003387 3300006175 Bacteria 9805
194 Ga0070712_100007538 3300006175 Bacteria 6802
195 Ga0070712_100030461 3300006175 Bacteria 3625
196 Ga0070712_100043680 3300006175 Bacteria 3086
197 Ga0070712_100083295 3300006175 Bacteria 2322
198 Ga0070712_100182981 3300006175 Bacteria 1634
199 Ga0070712_100253315 3300006175 Bacteria 1408
200 Ga0070712_100298903 3300006175 Bacteria 1302
201 Ga0070712_100420574 3300006175 Bacteria 1107
202 Ga0070712_100566534 3300006175 Bacteria 958
203 Ga0070712_100710598 3300006175 Bacteria 857
204 Ga0070712_100747826 3300006175 Bacteria 836
205 Ga0070712_100842040 3300006175 Bacteria 788
206 Ga0070712_100909025 3300006175 Bacteria 759
207 Ga0070712_101202135 3300006175 Bacteria 659
208 Ga0070712_101250169 3300006175 Bacteria 646
209 Ga0097621_100063674 3300006237 Bacteria 3031
210 Ga0075433_10042000 3300006852 Bacteria 3965
211 Ga0075433_10153362 3300006852 Bacteria 2049
212 Ga0075433_10321934 3300006852 Bacteria 1368
213 Ga0075434_100018311 3300006871 Bacteria 6764
214 Ga0075434_100021691 3300006871 Bacteria 6246
215 Ga0075434_100056332 3300006871 Bacteria 3906
216 Ga0075434_100693747 3300006871 Bacteria 1036
217 Ga0068865_100079207 3300006881 Bacteria 2353
218 Ga0075436_100068189 3300006914 Bacteria 2458
219 Ga0075436_100147320 3300006914 Bacteria 1655
220 Ga0075436_100214019 3300006914 Bacteria 1367
221 Ga0075436_100307763 3300006914 Bacteria 1136
222 Ga0075436_100358679 3300006914 Bacteria 1051
223 Ga0075435_100013330 3300007076 Bacteria 6111
224 Ga0075435_100033580 3300007076 Bacteria 4058
225 Ga0075435_100185638 3300007076 Bacteria 1758
226 Ga0099794_10025796 3300007265 Bacteria 2711
227 Ga0099794_10153458 3300007265 Bacteria 1169
228 Ga0099795_10065815 3300007788 Bacteria 1356
229 Ga0105251_10024110 3300009011 Bacteria 3127
230 Ga0105250_10263711 3300009092 Bacteria 738
231 Ga0105240_10275493 3300009093 Bacteria 1935
232 Ga0111539_10037919 3300009094 Bacteria 5815
233 Ga0105247_10101372 3300009101 Bacteria 1841
234 Ga0114129_10008379 3300009147 Bacteria 14730
235 Ga0114129_10279459 3300009147 Bacteria 2231
236 Ga0105241_10154259 3300009174 Bacteria 1882
237 Ga0105242_10074221 3300009176 Bacteria 2830
238 Ga0105248_10493613 3300009177 Bacteria 1380
239 Ga0105237_10987780 3300009545 Bacteria 849
240 Ga0105238_10245644 3300009551 Bacteria 1767
241 Ga0105238_10282092 3300009551 Bacteria 1642
242 Ga0099796_10036400 3300010159 Bacteria 1639
243 Ga0099796_10167333 3300010159 Bacteria 875
244 Ga0105246_10098480 3300011119 Bacteria 2124
245 Ga0157329_1000987 3300012491 Bacteria 1332
246 Ga0157341_1001858 3300012494 Bacteria 1329
247 Ga0157315_1003551 3300012508 Bacteria 1059
248 Ga0157338_1003156 3300012515 Bacteria 1347
249 Ga0154012_171739 3300013059 Bacteria 1039
250 Ga0157373_10149527 3300013100 Bacteria 1643
251 Ga0157371_10022428 3300013102 Bacteria 4626
252 Ga0157370_10432552 3300013104 Bacteria 1210
253 Ga0157369_10431851 3300013105 Bacteria 1365
254 Ga0157369_11132908 3300013105 Bacteria 799
255 Ga0157374_10298902 3300013296 Bacteria 1592
256 Ga0157374_10664203 3300013296 Bacteria 1054
257 Ga0157374_11314565 3300013296 Bacteria 745
258 Ga0157372_11870916 3300013307 Bacteria 690
259 Ga0157375_10143340 3300013308 Bacteria 2518
260 Ga0163163_10748687 3300014325 Bacteria 1040
261 Ga0157380_10130229 3300014326 Bacteria 2145
262 Ga0157379_10164260 3300014968 Bacteria 2004
263 Ga0157376_11050093 3300014969 Bacteria 839
264 Ga0157376_12845313 3300014969 Bacteria 524
265 Ga0163161_10132536 3300017792 Bacteria 1881
266 Ga0184596_100859 3300019176 Bacteria 1107
267 Ga0197907_10094249 3300020069 Bacteria 1079
268 Ga0197907_10330890 3300020069 Bacteria 1099
269 Ga0197907_10856800 3300020069 Bacteria 630
270 Ga0206356_10087393 3300020070 Bacteria 1216
271 Ga0206356_10126861 3300020070 Bacteria 961
272 Ga0206356_10418263 3300020070 Bacteria 1038
273 Ga0206349_1383630 3300020075 Bacteria 676
274 Ga0206349_1475694 3300020075 Bacteria 946
275 Ga0206349_1940810 3300020075 Bacteria 848
276 Ga0206355_1227789 3300020076 Bacteria 1199
277 Ga0206352_10009035 3300020078 Bacteria 694
278 Ga0206352_10622047 3300020078 Bacteria 1132
279 Ga0206350_10153199 3300020080 Bacteria 955
280 Ga0206350_10191192 3300020080 Bacteria 1155
281 Ga0206354_10444123 3300020081 Bacteria 1244
282 Ga0206354_10534952 3300020081 Bacteria 1567
283 Ga0206354_10765260 3300020081 Bacteria 1250
284 Ga0206353_10666110 3300020082 Bacteria 859
285 Ga0206353_10731065 3300020082 Unclassified 682
286 Ga0206353_11517539 3300020082 Bacteria 1087
287 Ga0206353_11921151 3300020082 Bacteria 1081
288 Ga0154015_1425898 3300020610 Bacteria 992
289 Ga0213873_10161504 3300021358 Bacteria 679
290 Ga0213875_10000363 3300021388 Bacteria 42235
291 Ga0213875_10108273 3300021388 Bacteria 1297
292 Ga0224712_10010529 3300022467 Bacteria 2832
293 Ga0224712_10133398 3300022467 Bacteria 1086
294 Ga0224712_10294026 3300022467 Bacteria 758
295 Ga0224712_10300870 3300022467 Bacteria 750
296 Ga0224712_10385772 3300022467 Unclassified 666
297 Ga0247528_106423 3300023680 Bacteria 929
298 Ga0224572_1023820 3300024225 Bacteria 1176
299 Ga0207656_10166207 3300025321 Bacteria 1052
300 Ga0207653_10012809 3300025885 Bacteria 2622
301 Ga0207692_10000147 3300025898 Bacteria 21958
302 Ga0207692_10005038 3300025898 Bacteria 5262
303 Ga0207692_10022809 3300025898 Bacteria 2886
304 Ga0207692_10023512 3300025898 Bacteria 2851
305 Ga0207692_10055962 3300025898 Bacteria 2022
306 Ga0207692_10111604 3300025898 Bacteria 1517
307 Ga0207692_10163826 3300025898 Bacteria 1283
308 Ga0207692_10178991 3300025898 Bacteria 1234
309 Ga0207692_10243710 3300025898 Bacteria 1074
310 Ga0207642_10018159 3300025899 Bacteria 2693
311 Ga0207710_10053403 3300025900 Bacteria 1818
312 Ga0207688_10062564 3300025901 Bacteria 2098
313 Ga0207647_10037539 3300025904 Bacteria 3071
314 Ga0207647_10238194 3300025904 Bacteria 1045
315 Ga0207685_10007363 3300025905 Bacteria 3063
316 Ga0207685_10096340 3300025905 Bacteria 1257
317 Ga0207699_10000291 3300025906 Bacteria 27048
318 Ga0207699_10003997 3300025906 Bacteria 7056
319 Ga0207699_10005864 3300025906 Bacteria 5910
320 Ga0207699_10057636 3300025906 Bacteria 2320
321 Ga0207699_10085697 3300025906 Bacteria 1965
322 Ga0207699_10144157 3300025906 Bacteria 1568
323 Ga0207699_10145888 3300025906 Bacteria 1560
324 Ga0207699_10199061 3300025906 Bacteria 1356
325 Ga0207699_10371758 3300025906 Bacteria 1013
326 Ga0207645_10210798 3300025907 Bacteria 1280
327 Ga0207643_10012094 3300025908 Bacteria 4663
328 Ga0207705_10191336 3300025909 Bacteria 1547
329 Ga0207684_10000323 3300025910 Bacteria 67693
330 Ga0207684_10003999 3300025910 Bacteria 14104
331 Ga0207684_10019980 3300025910 Bacteria 5723
332 Ga0207684_10020435 3300025910 Bacteria 5657
333 Ga0207684_10025297 3300025910 Bacteria 5058
334 Ga0207684_10100554 3300025910 Bacteria 2471
335 Ga0207684_10290158 3300025910 Bacteria 1411
336 Ga0207654_10140334 3300025911 Bacteria 1540
337 Ga0207654_10416163 3300025911 Bacteria 937
338 Ga0207707_10001352 3300025912 Bacteria 22855
339 Ga0207707_10129156 3300025912 Bacteria 2210
340 Ga0207707_10217601 3300025912 Bacteria 1663
341 Ga0207707_10385518 3300025912 Bacteria 1204
342 Ga0207693_10003946 3300025915 Bacteria 12610
343 Ga0207693_10009037 3300025915 Bacteria 8133
344 Ga0207693_10025346 3300025915 Bacteria 4703
345 Ga0207693_10136892 3300025915 Bacteria 1926
346 Ga0207693_10171076 3300025915 Bacteria 1711
347 Ga0207693_10210364 3300025915 Bacteria 1529
348 Ga0207693_10213112 3300025915 Bacteria 1518
349 Ga0207693_10464740 3300025915 Bacteria 988
350 Ga0207693_10584641 3300025915 Bacteria 870
351 Ga0207693_10799546 3300025915 Bacteria 727
352 Ga0207663_10032294 3300025916 Bacteria 3106
353 Ga0207663_10037969 3300025916 Bacteria 2907
354 Ga0207663_10038329 3300025916 Bacteria 2896
355 Ga0207663_10040069 3300025916 Bacteria 2844
356 Ga0207663_10111458 3300025916 Bacteria 1857
357 Ga0207663_10183244 3300025916 Bacteria 1497
358 Ga0207663_10196750 3300025916 Bacteria 1451
359 Ga0207663_10259957 3300025916 Bacteria 1281
360 Ga0207663_10271298 3300025916 Bacteria 1257
361 Ga0207660_10166316 3300025917 Bacteria 1705
362 Ga0207662_10010759 3300025918 Bacteria 5058
363 Ga0207657_10014600 3300025919 Bacteria 7655
364 Ga0207657_10046061 3300025919 Bacteria 3821
365 Ga0207649_10313302 3300025920 Bacteria 1151
366 Ga0207652_10827156 3300025921 Unclassified 821
367 Ga0207652_11393918 3300025921 Unclassified 604
368 Ga0207646_10000050 3300025922 Bacteria 171554
369 Ga0207646_10005341 3300025922 Bacteria 13534
370 Ga0207646_10009312 3300025922 Bacteria 9713
371 Ga0207646_10010964 3300025922 Bacteria 8799
372 Ga0207646_10049754 3300025922 Bacteria 3753
373 Ga0207646_10245815 3300025922 Bacteria 1616
374 Ga0207646_10460672 3300025922 Bacteria 1147
375 Ga0207687_11464673 3300025927 Unclassified 587
376 Ga0207700_10000216 3300025928 Bacteria 34369
377 Ga0207700_10009909 3300025928 Bacteria 5980
378 Ga0207700_10014818 3300025928 Bacteria 5120
379 Ga0207700_10021282 3300025928 Bacteria 4425
380 Ga0207700_10049581 3300025928 Bacteria 3124
381 Ga0207700_10059951 3300025928 Bacteria 2880
382 Ga0207700_10128357 3300025928 Bacteria 2066
383 Ga0207700_10129475 3300025928 Bacteria 2058
384 Ga0207700_10131899 3300025928 Bacteria 2041
385 Ga0207700_10187336 3300025928 Bacteria 1737
386 Ga0207700_10282417 3300025928 Bacteria 1428
387 Ga0207700_10294442 3300025928 Bacteria 1400
388 Ga0207700_10556096 3300025928 Bacteria 1019
389 Ga0207700_11010361 3300025928 Bacteria 744
390 Ga0207700_11545537 3300025928 Bacteria 588
391 Ga0207664_10000379 3300025929 Bacteria 32303
392 Ga0207664_10002673 3300025929 Bacteria 11825
393 Ga0207664_10004775 3300025929 Bacteria 9211
394 Ga0207664_10011886 3300025929 Bacteria 6211
395 Ga0207664_10019743 3300025929 Bacteria 4988
396 Ga0207664_10020810 3300025929 Bacteria 4868
397 Ga0207664_10021804 3300025929 Bacteria 4773
398 Ga0207664_10031128 3300025929 Bacteria 4079
399 Ga0207664_10054930 3300025929 Bacteria 3158
400 Ga0207664_10098379 3300025929 Bacteria 2412
401 Ga0207664_10111576 3300025929 Bacteria 2275
402 Ga0207664_10209663 3300025929 Bacteria 1685
403 Ga0207664_10254304 3300025929 Bacteria 1534
404 Ga0207664_10277737 3300025929 Bacteria 1469
405 Ga0207664_10391758 3300025929 Bacteria 1234
406 Ga0207664_10411769 3300025929 Bacteria 1203
407 Ga0207664_10529653 3300025929 Bacteria 1056
408 Ga0207664_10559757 3300025929 Bacteria 1026
409 Ga0207664_11475265 3300025929 Unclassified 602
410 Ga0207644_10176509 3300025931 Bacteria 1672
411 Ga0207644_10499891 3300025931 Bacteria 1003
412 Ga0207644_10520164 3300025931 Bacteria 983
413 Ga0207690_10085785 3300025932 Bacteria 2211
414 Ga0207706_10007021 3300025933 Bacteria 10410
415 Ga0207665_10000785 3300025939 Bacteria 21393
416 Ga0207665_10001106 3300025939 Bacteria 18140
417 Ga0207665_10005661 3300025939 Bacteria 8323
418 Ga0207665_10008399 3300025939 Bacteria 6812
419 Ga0207665_10018898 3300025939 Bacteria 4528
420 Ga0207665_10350041 3300025939 Bacteria 1115
421 Ga0207665_10541641 3300025939 Bacteria 903
422 Ga0207691_10064364 3300025940 Bacteria 3322
423 Ga0207689_10129846 3300025942 Bacteria 2074
424 Ga0207661_10059815 3300025944 Bacteria 3072
425 Ga0207661_10220843 3300025944 Bacteria 1675
426 Ga0207661_10295746 3300025944 Unclassified 1450
427 Ga0207679_10117036 3300025945 Bacteria 2114
428 Ga0207651_10465055 3300025960 Bacteria 1087
429 Ga0207712_10164479 3300025961 Bacteria 1728
430 Ga0207668_10385891 3300025972 Bacteria 1180
431 Ga0207640_10119910 3300025981 Bacteria 1882
432 Ga0207640_10371390 3300025981 Bacteria 1156
433 Ga0207658_10047012 3300025986 Bacteria 3156
434 Ga0207677_10556318 3300026023 Bacteria 1001
435 Ga0207703_10646367 3300026035 Bacteria 1003
436 Ga0207703_10896662 3300026035 Bacteria 849
437 Ga0207639_10307058 3300026041 Bacteria 1404
438 Ga0207639_10486186 3300026041 Bacteria 1126
439 Ga0207678_10066516 3300026067 Bacteria 3095
440 Ga0207678_10122511 3300026067 Bacteria 2219
441 Ga0207678_10274302 3300026067 Bacteria 1447
442 Ga0207708_10097339 3300026075 Bacteria 2274
443 Ga0207702_10055808 3300026078 Bacteria 3351
444 Ga0207702_10096073 3300026078 Bacteria 2605
445 Ga0207702_10142508 3300026078 Bacteria 2170
446 Ga0207641_10098295 3300026088 Bacteria 2574
447 Ga0207641_10164144 3300026088 Bacteria 2021
448 Ga0207641_12168406 3300026088 Bacteria 556
449 Ga0207676_10464554 3300026095 Bacteria 1196
450 Ga0207676_10823454 3300026095 Bacteria 907
451 Ga0207674_10105189 3300026116 Bacteria 2801
452 Ga0207674_10228847 3300026116 Bacteria 1807
453 Ga0207674_10697502 3300026116 Bacteria 980
454 Ga0207675_100010739 3300026118 Bacteria 8579
455 Ga0207683_10047963 3300026121 Bacteria 3740
456 Ga0207683_10141883 3300026121 Bacteria 2165
457 Ga0207698_12010292 3300026142 Bacteria 592
458 Ga0268264_10213603 3300028381 Bacteria 1772
459 Ga0265337_1002783 3300028556 Bacteria 7836
460 Ga0265326_10004145 3300028558 Bacteria 4675
461 Ga0265319_1008471 3300028563 Bacteria 4503
462 Ga0265334_10000618 3300028573 Bacteria 17860
463 Ga0265318_10008064 3300028577 Bacteria 4711
464 Ga0265322_10012266 3300028654 Bacteria 2478
465 Ga0265336_10011453 3300028666 Bacteria 3015
466 Ga0265338_10001346 3300028800 Bacteria 40029
467 Ga0265338_10004892 3300028800 Bacteria 17842
468 Ga0265338_10006911 3300028800 Bacteria 14280
469 Ga0265338_10050905 3300028800 Bacteria 3737
470 Ga0265338_10322327 3300028800 Bacteria 1118
471 Ga0265324_10008253 3300029957 Bacteria 4149
472 Ga0265769_101534 3300030888 Bacteria 1120
473 Ga0265768_101823 3300030963 Bacteria 1039
474 Ga0265330_10036834 3300031235 Bacteria 2179
475 Ga0265332_10000905 3300031238 Bacteria 17790
476 Ga0265328_10241079 3300031239 Bacteria 691
477 Ga0265320_10011279 3300031240 Bacteria 5265
478 Ga0265320_10078344 3300031240 Bacteria 1546
479 Ga0265325_10004585 3300031241 Bacteria 8685
480 Ga0265325_10181945 3300031241 Bacteria 978
481 Ga0265329_10062314 3300031242 Bacteria 1181
482 Ga0265340_10004914 3300031247 Bacteria 7434
483 Ga0265339_10014972 3300031249 Bacteria 4662
484 Ga0265339_10045905 3300031249 Bacteria 2403
485 Ga0265316_10022565 3300031344 Bacteria 5302
486 Ga0265316_10540194 3300031344 Bacteria 830
487 Ga0265313_10042257 3300031595 Bacteria 2240
488 Ga0265313_10154659 3300031595 Bacteria 977
489 Ga0307508_10447104 3300031616 Bacteria 885
490 Ga0310108_118602 3300031633 Bacteria 657
491 Ga0310101_109030 3300031690 Bacteria 1154
492 Ga0265314_10015366 3300031711 Bacteria 6078
493 Ga0265314_10019718 3300031711 Bacteria 5216
494 Ga0265342_10016032 3300031712 Bacteria 4908
495 Ga0265342_10131296 3300031712 Bacteria 1403
496 Ga0316212_1004821 3300033547 Bacteria 1958
497 Ga0373930_0004163 3300034816 Bacteria 2340
498 Ga0373948_0001671 3300034817 Bacteria 3135
499 Ga0373938_0085554 3300034957 Bacteria 773
500 Ga0373926_0004416 3300035083 Bacteria 4612
501 Ga0373926_0010520 3300035083 Bacteria 3102
502 Ga0373928_0013307 3300035084 Bacteria 1651
503 Ga0373928_0051135 3300035084 Bacteria 976
504 Ga0373929_0021923 3300035085 Bacteria 1300
505 Ga0373934_0000032 3300035086 Bacteria 44940
506 Ga0373934_0004079 3300035086 Bacteria 5383
507 Ga0373934_0004937 3300035086 Bacteria 4939
508 Ga0373934_0009173 3300035086 Bacteria 3703
509 Ga0373934_0049378 3300035086 Bacteria 1666
510 Ga0373934_0429403 3300035086 Bacteria 553
511 Ga0373940_0069054 3300035088 Bacteria 1025
512 Ga0373944_0012091 3300035089 Bacteria 2374
513 Ga0373944_0016653 3300035089 Bacteria 2076
514 Ga0373949_0021004 3300035090 Bacteria 1498
515 Ga0373949_0021772 3300035090 Bacteria 1474
516 Ga0373951_0017198 3300035091 Bacteria 1635
517 Ga0373923_0000472 3300035111 Bacteria 9588
518 Ga0373923_0008843 3300035111 Bacteria 3612
519 Ga0373923_0013796 3300035111 Bacteria 3019
520 Ga0373923_0105969 3300035111 Bacteria 1244
521 Ga0373923_0161999 3300035111 Bacteria 1021
522 Ga0373932_0013806 3300035112 Bacteria 2018
523 Ga0373936_0001930 3300035113 Bacteria 7666
524 Ga0373936_0006056 3300035113 Bacteria 4558
525 Ga0373936_0356643 3300035113 Bacteria 666
526 Ga0373939_0025178 3300035114 Bacteria 1665
527 Ga0373945_0000693 3300035116 Bacteria 9746
528 Ga0373945_0003551 3300035116 Bacteria 4909
529 Ga0373945_0120835 3300035116 Bacteria 1041
530 Ga0373945_0186966 3300035116 Bacteria 855
531 Ga0373945_0216534 3300035116 Bacteria 800
532 Ga0373953_0000145 3300035117 Bacteria 18034
533 Ga0373953_0002637 3300035117 Bacteria 5431
534 Ga0373953_0009915 3300035117 Bacteria 3299
535 Ga0373953_0033681 3300035117 Bacteria 2004
536 Ga0373953_0045499 3300035117 Bacteria 1759
537 Ga0373953_0124333 3300035117 Bacteria 1097
538 Ga0373953_0144631 3300035117 Bacteria 1018
539 Ga0373954_0004824 3300035118 Bacteria 5814
540 Ga0373954_0011407 3300035118 Bacteria 3938
541 Ga0373954_0020285 3300035118 Bacteria 3005
542 Ga0373956_0000096 3300035119 Bacteria 29760
543 Ga0373956_0014918 3300035119 Bacteria 3249
544 Ga0373956_0034894 3300035119 Bacteria 2216
545 Ga0373957_0000565 3300035120 Bacteria 9401
546 Ga0373957_0003369 3300035120 Bacteria 4713
547 Ga0373957_0005890 3300035120 Bacteria 3829
548 Ga0373957_0013296 3300035120 Bacteria 2790
549 Ga0373957_0036898 3300035120 Bacteria 1823
550 Ga0373960_0025527 3300035121 Bacteria 1607
551 Ga0373960_0035890 3300035121 Bacteria 1409
552 Ga0373943_0000869 3300035170 Bacteria 13282
553 Ga0373943_0222164 3300035170 Bacteria 1052
554 Ga0373943_0292337 3300035170 Bacteria 923
555 Ga0373943_0339857 3300035170 Bacteria 859
556 Ga0373943_0413160 3300035170 Bacteria 780
557 Ga0373943_0491204 3300035170 Bacteria 716
558 Ga0373943_0497872 3300035170 Unclassified 712
559 Ga0373943_0890847 3300035170 Bacteria 531
560 Ga0373946_0002754 3300035171 Bacteria 6216
561 Ga0373946_0005561 3300035171 Bacteria 4547
562 Ga0373946_0051713 3300035171 Bacteria 1720
563 Ga0373946_0233862 3300035171 Bacteria 891
564 Ga0373946_0405003 3300035171 Bacteria 689
565 Ga0373955_0000015 3300035172 Bacteria 72056
566 Ga0373955_0014041 3300035172 Bacteria 3888
567 Ga0373955_0032656 3300035172 Bacteria 2734
568 Ga0373955_0222087 3300035172 Unclassified 1129
569 Ga0373955_0247308 3300035172 Bacteria 1069
570 Ga0373955_0745712 3300035172 Bacteria 601
571 Ga0373955_0881183 3300035172 Bacteria 550
572 Ga0373942_0048046 3300035207 Bacteria 1188
573 Ga0373962_0041763 3300035242 Bacteria 1294
574 Ga0373962_0084282 3300035242 Bacteria 969
575 Ga0373924_0003840 3300035410 Bacteria 5199
576 Ga0373924_0015260 3300035410 Bacteria 2918
577 Ga0373924_0018110 3300035410 Bacteria 2711
578 Ga0373924_0063887 3300035410 Bacteria 1544
579 Ga0373924_0157661 3300035410 Bacteria 995
580 Ga0373924_0308401 3300035410 Unclassified 703
581 Ga0373931_0072221 3300035691 Bacteria 1886
582 Ga0373931_1032602 3300035691 Unclassified 557
583 Ga0373935_0002772 3300035692 Bacteria 10079
584 Ga0373935_0019853 3300035692 Bacteria 4101
585 Ga0373935_0041841 3300035692 Bacteria 2880
586 Ga0373935_0074104 3300035692 Bacteria 2200
587 Ga0373935_0285230 3300035692 Bacteria 1163
588 Ga0373927_0005785 3300035695 Bacteria 8484
589 Ga0373927_0182495 3300035695 Bacteria 1376
590 Ga0373927_0291959 3300035695 Bacteria 1073
591 Ga0373927_0331473 3300035695 Bacteria 1002
592 Ga0373927_0462653 3300035695 Bacteria 838
593 Ga0373927_0869913 3300035695 Bacteria 595
594 Ga0373933_0000004 3300035724 Bacteria 143741
595 Ga0373933_0012151 3300035724 Bacteria 4756
596 Ga0373933_0016458 3300035724 Bacteria 4135
597 Ga0373933_0066301 3300035724 Bacteria 2187
598 Ga0373933_0069093 3300035724 Bacteria 2146
599 Ga0373933_0081570 3300035724 Bacteria 1984
600 Ga0373933_0200322 3300035724 Bacteria 1277
601 Ga0373947_0002525 3300035725 Bacteria 10999
602 Ga0373947_0036414 3300035725 Bacteria 2918
603 Ga0373947_0068140 3300035725 Bacteria 2175
604 Ga0373947_0211250 3300035725 Bacteria 1273
605 Ga0373947_0214627 3300035725 Bacteria 1263
606 Ga0373947_0442814 3300035725 Bacteria 879
607 Ga0373947_0749792 3300035725 Bacteria 666
608 Ga0373937_0000012 3300036401 Bacteria 159418
609 Ga0373937_0016525 3300036401 Bacteria 6555
610 Ga0373937_0023070 3300036401 Bacteria 5599
611 Ga0373937_0035993 3300036401 Bacteria 4509
612 Ga0373937_0065143 3300036401 Bacteria 3353
613 Ga0373937_0128883 3300036401 Bacteria 2362
614 Ga0373937_0194066 3300036401 Bacteria 1908
615 Ga0373937_0581475 3300036401 Bacteria 1063
616 Ga0373937_1168156 3300036401 Bacteria 718
617 Ga0372808_018230 3300036459 Bacteria 1009
618 Ga0310109_014140 3300036534 Bacteria 1083
619 Ga0373925_0000021 3300037068 Bacteria 162277
620 Ga0373925_0005148 3300037068 Bacteria 9798
621 Ga0373925_0049126 3300037068 Bacteria 3144
622 Ga0373925_0063191 3300037068 Bacteria 2785
623 Ga0373925_0100426 3300037068 Bacteria 2223
624 Ga0373925_0345450 3300037068 Bacteria 1207
625 Ga0373925_0365597 3300037068 Bacteria 1173
626 Ga0373925_0954490 3300037068 Bacteria 706
627 Ga0395899_0004117 3300037312 Bacteria 11452
628 Ga0395898_0023865 3300037466 Bacteria 6174
629 Ga0395898_1008864 3300037466 Bacteria 768
630 Ga0436364_0136351 3300037853 Bacteria 1650
631 Ga0436364_0866950 3300037853 Bacteria 801
632 Ga0436364_0989727 3300037853 Bacteria 883
633 Ga0436364_1018157 3300037853 Bacteria 78603
634 Ga0436364_1160722 3300037853 Bacteria 1722
635 Ga0436364_1303572 3300037853 Bacteria 3726
636 Ga0436364_1314967 3300037853 Bacteria 702
637 Ga0436364_1427311 3300037853 Bacteria 97691
638 Ga0436365_1301466 3300039437 Bacteria 589
639 Ga0436363_0158367 3300039450 Bacteria 2547
640 Ga0436363_0276775 3300039450 Bacteria 1111
641 Ga0436363_1335153 3300039450 Bacteria 1907
642 Ga0436363_1525360 3300039450 Bacteria 1293
643 Ga0436362_0069517 3300039453 Bacteria 1041
644 Ga0436362_1023179 3300039453 Bacteria 756
645 Ga0451789_0954289 3300041443 Bacteria 1438
646 Ga0451793_1539502 3300041452 Bacteria 1724
647 Ga0466966_0019698 3300044684 Bacteria 4439
648 Ga0466961_0040225 3300044693 Bacteria 2998
649 Ga0466961_0082735 3300044693 Bacteria 2030
650 Ga0466963_0405621 3300044694 Bacteria 961
651 Ga0466971_0120291 3300044719 Bacteria 1215
652 Ga0466968_0166062 3300044735 Bacteria 1021
653 Ga0466968_0270693 3300044735 Bacteria 811
654 Ga0466959_0190702 3300045049 Bacteria 1431
655 Ga0466959_0192506 3300045049 Bacteria 1423
656 Ga0466959_0221305 3300045049 Bacteria 1313
657 Ga0466958_0110214 3300045836 Bacteria 1718
658 Ga0466958_0427089 3300045836 Unclassified 857
659 Ga0466967_0239113 3300045976 Bacteria 1732
660 Ga0466967_0512969 3300045976 Bacteria 1177
661 Ga0466967_0784508 3300045976 Bacteria 946
662 Ga0466967_2410919 3300045976 Bacteria 521
663 Ga0495592_0001038 3300046454 Bacteria 19287
664 Ga0495592_0025030 3300046454 Bacteria 4533
665 Ga0495592_0065020 3300046454 Bacteria 2671
666 Ga0495592_0115181 3300046454 Bacteria 1898
667 Ga0495592_0204941 3300046454 Bacteria 1328
668 Ga0495592_0322135 3300046454 Bacteria 998
669 Ga0495603_0085584 3300046455 Bacteria 1845
670 Ga0495603_0120564 3300046455 Bacteria 1528
671 Ga0495629_0001307 3300046459 Bacteria 19594
672 Ga0495629_0050225 3300046459 Bacteria 2921
673 Ga0495629_0105596 3300046459 Bacteria 1964
674 Ga0495641_0003608 3300046461 Bacteria 11461
675 Ga0495641_0020494 3300046461 Bacteria 3351
676 Ga0495641_0023199 3300046461 Bacteria 3088
677 Ga0495641_0073864 3300046461 Bacteria 1529
678 Ga0495651_0000007 3300046462 Bacteria 158577
679 Ga0495651_0004063 3300046462 Bacteria 11179
680 Ga0495651_0014480 3300046462 Bacteria 6095
681 Ga0495651_0016969 3300046462 Bacteria 5639
682 Ga0495651_0019156 3300046462 Bacteria 5302
683 Ga0495651_0371659 3300046462 Bacteria 940
684 Ga0495651_0378679 3300046462 Bacteria 928
685 Ga0495651_0630536 3300046462 Bacteria 673
686 Ga0495653_0004863 3300046463 Bacteria 10899
687 Ga0495653_0005400 3300046463 Bacteria 10403
688 Ga0495653_0029402 3300046463 Bacteria 4386
689 Ga0495653_0030612 3300046463 Bacteria 4284
690 Ga0495653_0040372 3300046463 Bacteria 3647
691 Ga0495653_0047918 3300046463 Bacteria 3302
692 Ga0495653_0061892 3300046463 Bacteria 2829
693 Ga0495653_0071907 3300046463 Bacteria 2584
694 Ga0495580_0480138 3300046472 Bacteria 831
695 Ga0495580_0749010 3300046472 Bacteria 636
696 Ga0495582_0001211 3300046473 Bacteria 14514
697 Ga0495582_0005652 3300046473 Bacteria 6961
698 Ga0495582_0161218 3300046473 Bacteria 1275
699 Ga0495582_0270248 3300046473 Bacteria 975
700 Ga0495639_0010409 3300046475 Bacteria 4006
701 Ga0495662_0012967 3300046476 Bacteria 4060
702 Ga0495662_0024097 3300046476 Bacteria 2936
703 Ga0495662_0159693 3300046476 Bacteria 1110
704 Ga0495662_0407590 3300046476 Bacteria 667
705 Ga0495664_0004193 3300046477 Bacteria 7873
706 Ga0495664_0012427 3300046477 Bacteria 4823
707 Ga0495664_0019880 3300046477 Bacteria 3867
708 Ga0495664_0029664 3300046477 Bacteria 3200
709 Ga0495664_0051898 3300046477 Bacteria 2435
710 Ga0495608_0000015 3300046511 Bacteria 200266
711 Ga0495608_0003113 3300046511 Bacteria 11853
712 Ga0495608_0027673 3300046511 Bacteria 3856
713 Ga0495608_0039886 3300046511 Bacteria 3146
714 Ga0495608_0052193 3300046511 Bacteria 2707
715 Ga0495608_0360469 3300046511 Bacteria 893
716 Ga0495608_0504370 3300046511 Bacteria 732
717 Ga0495608_0916610 3300046511 Unclassified 512
718 Ga0495618_0007498 3300046514 Bacteria 6601
719 Ga0495618_0019010 3300046514 Bacteria 4222
720 Ga0495618_0025441 3300046514 Bacteria 3673
721 Ga0495618_0098542 3300046514 Bacteria 1870
722 Ga0495618_0119274 3300046514 Bacteria 1689
723 Ga0495618_0125980 3300046514 Bacteria 1640
724 Ga0495618_0127174 3300046514 Bacteria 1631
725 Ga0495618_0237778 3300046514 Bacteria 1145
726 Ga0495628_0000737 3300046516 Bacteria 30357
727 Ga0495628_0017665 3300046516 Bacteria 5930
728 Ga0495628_0084215 3300046516 Bacteria 2467
729 Ga0495628_0085998 3300046516 Bacteria 2439
730 Ga0495628_0336945 3300046516 Bacteria 1111
731 Ga0495630_0018483 3300046517 Bacteria 5121
732 Ga0495630_0041563 3300046517 Bacteria 3433
733 Ga0495630_0058292 3300046517 Bacteria 2894
734 Ga0495630_0086488 3300046517 Bacteria 2367
735 Ga0495630_0204619 3300046517 Bacteria 1506
736 Ga0495630_0212093 3300046517 Bacteria 1478
737 Ga0495666_0185939 3300046526 Bacteria 958
738 Ga0495652_0000074 3300046529 Bacteria 105662
739 Ga0495652_0012772 3300046529 Bacteria 7567
740 Ga0495652_0023128 3300046529 Bacteria 5510
741 Ga0495652_0103996 3300046529 Bacteria 2297
742 Ga0495652_0107955 3300046529 Bacteria 2244
743 Ga0495652_0195934 3300046529 Bacteria 1537
744 Ga0495652_0368490 3300046529 Bacteria 1024
745 Ga0495652_0982404 3300046529 Bacteria 553
746 Ga0495665_0005298 3300046531 Bacteria 6951
747 Ga0495665_0005836 3300046531 Bacteria 6644
748 Ga0495665_0005892 3300046531 Bacteria 6599
749 Ga0495665_0020140 3300046531 Bacteria 3584
750 Ga0495665_0123402 3300046531 Bacteria 1356
751 Ga0495665_0262560 3300046531 Bacteria 888
752 Ga0495640_0008749 3300046533 Bacteria 7930
753 Ga0495640_0028840 3300046533 Bacteria 3991
754 Ga0495640_0105248 3300046533 Bacteria 1848
755 Ga0495640_0209627 3300046533 Bacteria 1232
756 Ga0495640_0456209 3300046533 Bacteria 780
757 Ga0495586_0010989 3300046535 Bacteria 4810
758 Ga0495586_0012705 3300046535 Bacteria 4466
759 Ga0495586_0141080 3300046535 Bacteria 1352
760 Ga0495587_0000085 3300046536 Bacteria 72715
761 Ga0495587_0003258 3300046536 Bacteria 10849
762 Ga0495587_0010139 3300046536 Bacteria 6010
763 Ga0495587_0056265 3300046536 Bacteria 2314
764 Ga0495587_0173421 3300046536 Bacteria 1224
765 Ga0495645_0030868 3300046543 Bacteria 3903
766 Ga0495645_0035606 3300046543 Bacteria 3628
767 Ga0495645_0074422 3300046543 Bacteria 2445
768 Ga0495645_0089644 3300046543 Bacteria 2199
769 Ga0495645_0102970 3300046543 Bacteria 2028
770 Ga0495645_0346412 3300046543 Bacteria 958
771 Ga0495667_0000033 3300046559 Bacteria 143083
772 Ga0495667_0003641 3300046559 Bacteria 10369
773 Ga0495667_0004750 3300046559 Bacteria 9187
774 Ga0495667_0009929 3300046559 Bacteria 6448
775 Ga0495667_0804607 3300046559 Unclassified 579
776 Ga0495634_0004108 3300046642 Bacteria 11528
777 Ga0495634_0023454 3300046642 Bacteria 4337
778 Ga0495634_0028120 3300046642 Bacteria 3905
779 Ga0495634_0098564 3300046642 Bacteria 1891
780 Ga0495634_0129038 3300046642 Bacteria 1613
781 Ga0495635_0003052 3300046663 Bacteria 11507
782 Ga0495635_0011882 3300046663 Bacteria 6103
783 Ga0495635_0042090 3300046663 Bacteria 3155
784 Ga0495635_0049734 3300046663 Bacteria 2889
785 Ga0495635_0057761 3300046663 Bacteria 2669
786 Ga0495635_0067987 3300046663 Bacteria 2443
787 Ga0495635_0236790 3300046663 Bacteria 1232
788 Ga0495588_0480831 3300046674 Bacteria 651
789 Ga0495657_0001345 3300046675 Bacteria 21381
790 Ga0495657_0004406 3300046675 Bacteria 11239
791 Ga0495657_0007140 3300046675 Bacteria 8665
792 Ga0495657_0024425 3300046675 Bacteria 4305
793 Ga0495657_0027020 3300046675 Bacteria 4056
794 Ga0495657_0058343 3300046675 Bacteria 2563
795 Ga0495657_0106458 3300046675 Bacteria 1780
796 Ga0495599_0000018 3300046678 Bacteria 144334
797 Ga0495599_0005426 3300046678 Bacteria 7620
798 Ga0495599_0016500 3300046678 Bacteria 4585
799 Ga0495599_0030374 3300046678 Bacteria 3390
800 Ga0495599_0088154 3300046678 Bacteria 1937
801 Ga0495599_0139626 3300046678 Bacteria 1503
802 Ga0495599_0205349 3300046678 Bacteria 1209
803 Ga0495599_0281206 3300046678 Bacteria 1008
804 Ga0495623_0000075 3300046679 Bacteria 59383
805 Ga0495623_0009174 3300046679 Bacteria 6417
806 Ga0495623_0027076 3300046679 Bacteria 3687
807 Ga0495623_0155803 3300046679 Bacteria 1346
808 Ga0495623_0169115 3300046679 Bacteria 1278
809 Ga0495646_0005199 3300046680 Bacteria 8208
810 Ga0495646_0025764 3300046680 Bacteria 3697
811 Ga0495646_0037718 3300046680 Bacteria 2988
812 Ga0495646_0061783 3300046680 Bacteria 2229
813 Ga0495646_0074293 3300046680 Bacteria 1995
814 Ga0495646_0115853 3300046680 Bacteria 1521
815 Ga0495646_0159912 3300046680 Unclassified 1248
816 Ga0495646_0281571 3300046680 Bacteria 883
817 Ga0495646_0388313 3300046680 Bacteria 727
818 Ga0495647_0080114 3300046681 Bacteria 1323
819 Ga0495658_0063337 3300046683 Bacteria 2127
820 Ga0495658_0565057 3300046683 Bacteria 728
821 Ga0495613_0005089 3300046689 Bacteria 9851
822 Ga0495613_0005645 3300046689 Bacteria 9385
823 Ga0495613_0085253 3300046689 Bacteria 2292
824 Ga0495613_0094696 3300046689 Bacteria 2160
825 Ga0495624_0007746 3300046690 Bacteria 7533
826 Ga0495624_0011024 3300046690 Bacteria 6222
827 Ga0495624_0343095 3300046690 Bacteria 898
828 Ga0495624_0460696 3300046690 Bacteria 761
829 Ga0495600_0003461 3300046809 Bacteria 9283
830 Ga0495600_0004210 3300046809 Bacteria 8586
831 Ga0495600_0018634 3300046809 Bacteria 4424
832 Ga0495600_0035402 3300046809 Bacteria 3242
833 Ga0495600_0163115 3300046809 Bacteria 1440
834 Ga0495581_0002245 3300047315 Bacteria 10864
835 Ga0495581_0004730 3300047315 Bacteria 7857
836 Ga0495581_0080075 3300047315 Bacteria 1890
837 Ga0495581_0093271 3300047315 Bacteria 1747
838 Ga0495581_0505669 3300047315 Bacteria 702
839 Ga0495604_0000025 3300047317 Bacteria 145481
840 Ga0495604_0015271 3300047317 Bacteria 6131
841 Ga0495604_0041000 3300047317 Bacteria 3632
842 Ga0495604_0071431 3300047317 Bacteria 2625
843 Ga0495604_0082497 3300047317 Bacteria 2404
844 Ga0495604_0264199 3300047317 Bacteria 1169
845 Ga0495674_0013169 3300047319 Bacteria 7775
846 Ga0495674_0013242 3300047319 Bacteria 7754
847 Ga0495674_0020722 3300047319 Bacteria 6087
848 Ga0495674_0026819 3300047319 Bacteria 5269
849 Ga0495674_0033400 3300047319 Bacteria 4661
850 Ga0495674_0980895 3300047319 Bacteria 648
851 Ga0495674_1377981 3300047319 Bacteria 526
852 Ga0495676_0023696 3300047321 Bacteria 5322
853 Ga0495676_0070119 3300047321 Bacteria 2701
854 Ga0495676_0253490 3300047321 Bacteria 1199
855 Ga0495676_0474429 3300047321 Bacteria 823
856 Ga0495676_0600715 3300047321 Bacteria 716
857 Ga0495676_0647148 3300047321 Bacteria 686
858 Ga0495680_0000015 3300047322 Bacteria 131335
859 Ga0495680_0011499 3300047322 Bacteria 7829
860 Ga0495680_0019388 3300047322 Bacteria 5740
861 Ga0495680_0024054 3300047322 Bacteria 5057
862 Ga0495680_0028019 3300047322 Bacteria 4621
863 Ga0495680_0037139 3300047322 Bacteria 3904
864 Ga0495680_0044700 3300047322 Bacteria 3501
865 Ga0495680_0047383 3300047322 Bacteria 3381
866 Ga0495680_0061680 3300047322 Bacteria 2883
867 Ga0495680_0221492 3300047322 Bacteria 1350
868 Ga0495675_0000702 3300047444 Bacteria 20920
869 Ga0495675_0012372 3300047444 Bacteria 5371
870 Ga0495675_0018050 3300047444 Bacteria 4473
871 Ga0495675_0086657 3300047444 Bacteria 1968
872 Ga0495675_0220939 3300047444 Bacteria 1147
873 Ga0495684_0004873 3300047471 Bacteria 10469
874 Ga0495684_0053358 3300047471 Bacteria 3084
875 Ga0495684_0064631 3300047471 Bacteria 2781
876 Ga0495684_0093548 3300047471 Bacteria 2276
877 Ga0495684_0300712 3300047471 Bacteria 1152
878 Ga0495684_0650686 3300047471 Bacteria 705
879 Ga0495684_0825416 3300047471 Bacteria 604
880 Ga0495593_0003014 3300047673 Bacteria 10148
881 Ga0495593_0020518 3300047673 Bacteria 3701
882 Ga0495593_0065145 3300047673 Bacteria 1900
883 Ga0495593_0164734 3300047673 Bacteria 1118
884 Ga0495593_0182618 3300047673 Bacteria 1056
885 Ga0495602_0000065 3300048088 Bacteria 104080
886 Ga0495602_0011079 3300048088 Bacteria 9335
887 Ga0495602_0027529 3300048088 Bacteria 5461
888 Ga0495602_0039997 3300048088 Bacteria 4309
889 Ga0495602_0083248 3300048088 Bacteria 2681
890 Ga0495602_0222104 3300048088 Bacteria 1425
891 Ga0495602_0446462 3300048088 Bacteria 914
892 Ga0496100_0443258 3300048903 Bacteria 994
893 Ga0496101_0611565 3300048904 Bacteria 861
894 Ga0496102_0051607 3300048905 Bacteria 3747
895 Ga0496102_0451162 3300048905 Bacteria 1206
896 Ga0496102_0913326 3300048905 Bacteria 799
897 Ga0496103_0053998 3300048906 Bacteria 2490
898 Ga0496103_0402367 3300048906 Unclassified 879
899 Ga0496104_0014773 3300048907 Bacteria 7056
900 Ga0496104_0061932 3300048907 Bacteria 3547
901 Ga0496104_0129945 3300048907 Bacteria 2419
902 Ga0496105_0054363 3300048908 Bacteria 3305
903 Ga0496105_0106953 3300048908 Bacteria 2309
904 Ga0496106_0461084 3300048909 Bacteria 1021
905 Ga0496107_0069211 3300048910 Bacteria 2561
906 Ga0496107_0124441 3300048910 Bacteria 1901
907 Ga0496107_0166482 3300048910 Bacteria 1634
908 Ga0496108_0017599 3300048911 Bacteria 5847
909 Ga0496108_0107297 3300048911 Bacteria 2384
910 Ga0496108_1086089 3300048911 Bacteria 680
911 Ga0496109_0014415 3300048912 Bacteria 6878
912 Ga0496109_0179360 3300048912 Bacteria 1989
913 Ga0496109_0246698 3300048912 Bacteria 1681
914 Ga0496109_0998750 3300048912 Bacteria 774
915 Ga0496110_0062954 3300048913 Bacteria 3277
916 Ga0496110_1469677 3300048913 Unclassified 591
917 Ga0496111_0088933 3300048914 Bacteria 2262
918 Ga0496111_0125687 3300048914 Bacteria 1895
919 Ga0496111_0595163 3300048914 Bacteria 810
920 Ga0496112_0060441 3300048915 Bacteria 3734
921 Ga0496112_0125224 3300048915 Bacteria 2541
922 Ga0496113_0025110 3300048916 Bacteria 4244
923 Ga0496113_0061466 3300048916 Bacteria 2834
924 Ga0496113_0406899 3300048916 Bacteria 1092
925 Ga0496114_0175872 3300048917 Bacteria 1868
926 Ga0496114_1116797 3300048917 Unclassified 673
927 Ga0496115_0008866 3300048918 Bacteria 7455
928 Ga0496115_0051191 3300048918 Bacteria 3311
929 Ga0496126_0042649 3300048929 Bacteria 4189
930 Ga0496126_0043718 3300048929 Bacteria 4130
931 Ga0496126_0564029 3300048929 Bacteria 902
932 Ga0501034_0721819 3300049571 Bacteria 894
933 Ga0501037_0014884 3300049573 Bacteria 5723
934 Ga0501037_0153419 3300049573 Bacteria 1645
935 Ga0501038_0111223 3300049574 Bacteria 2269
936 Ga0501039_0057382 3300049575 Bacteria 3015
937 Ga0501042_0005377 3300049578 Bacteria 8241
938 Ga0501042_0008967 3300049578 Bacteria 6640
939 Ga0501043_0011292 3300049579 Bacteria 6990
940 Ga0501047_0046138 3300049581 Bacteria 4211
941 Ga0501047_0084672 3300049581 Bacteria 3047
942 Ga0501070_0948602 3300049586 Bacteria 669
943 Ga0501074_0004998 3300049590 Bacteria 9516
944 Ga0501077_0203751 3300049593 Bacteria 1257
945 Ga0501044_0377778 3300049823 Bacteria 1332
946 nmdc:mga05p37_35974_c2 3300050507 Bacteria 3241
947 nmdc:mga0n895_111117_c1 3300050512 Bacteria 2757
948 nmdc:mga0n895_379457_c1 3300050512 Bacteria 1431
949 nmdc:mga0rr50_1087972_c1 3300050513 Bacteria 680
950 nmdc:mga0rr50_112665_c1 3300050513 Bacteria 2155
951 nmdc:mga0rr50_143507_c1 3300050513 Bacteria 1923
952 nmdc:mga0rr50_255610_c1 3300050513 Bacteria 1456
953 nmdc:mga0rr50_653046_c1 3300050513 Bacteria 898
954 nmdc:mga0rr50_801608_c1 3300050513 Bacteria 804
955 nmdc:mga08x19_161124_c1 3300050514 Bacteria 1524
956 nmdc:mga08x19_293683_c1 3300050514 Bacteria 1128
957 nmdc:mga08x19_469241_c1 3300050514 Bacteria 887
958 nmdc:mga08x19_518876_c1 3300050514 Bacteria 842
959 nmdc:mga08x19_59556_c1 3300050514 Bacteria 2472
960 nmdc:mga0a205_126363_c1 3300050515 Bacteria 2457
961 nmdc:mga0a205_194452_c1 3300050515 Bacteria 1920
962 Ga0495601_0069529 3300053077 Bacteria 2246
963 Ga0495601_0098757 3300053077 Bacteria 1884
964 Ga0495601_0148954 3300053077 Bacteria 1527
965 Ga0495601_0152021 3300053077 Bacteria 1511
966 Ga0495601_0350914 3300053077 Bacteria 959
967 Ga0495612_0003458 3300053078 Bacteria 6545
968 Ga0495612_0007651 3300053078 Bacteria 4413
969 Ga0495612_0008570 3300053078 Bacteria 4147
970 Ga0495612_0044484 3300053078 Bacteria 1817
971 Ga0495612_0085043 3300053078 Bacteria 1333
972 Ga0495612_0086713 3300053078 Bacteria 1320
973 Ga0495655_0232021 3300053083 Unclassified 615
974 Ga0495595_0001179 3300053084 Bacteria 10154
975 Ga0495595_0007432 3300053084 Bacteria 4486
976 Ga0495595_0009129 3300053084 Bacteria 4096
977 Ga0495595_0010655 3300053084 Bacteria 3827
978 Ga0495595_0028051 3300053084 Bacteria 2512
979 Ga0495619_0010762 3300053085 Bacteria 5756
980 Ga0495619_0027610 3300053085 Bacteria 3657
981 Ga0495619_0042518 3300053085 Bacteria 2976
982 Ga0495619_0050933 3300053085 Bacteria 2735
983 Ga0495619_0236489 3300053085 Bacteria 1266
984 Ga0495619_0452760 3300053085 Bacteria 885
985 Ga0495619_0710119 3300053085 Bacteria 683
986 Ga0590075_038196 3300059424 Bacteria 1225
987 Ga0587073_0150374 3300059492 Bacteria 658
988 Ga0587077_049332 3300059493 Bacteria 875
989 Ga0587088_023521 3300059508 Bacteria 1048
990 Ga0587091_011184 3300059511 Bacteria 1394
991 Ga0587092_016024 3300059512 Bacteria 1105
992 Ga0587113_004762 3300059625 Bacteria 1094
993 Ga0587115_008978 3300059626 Bacteria 1217
994 Ga0587122_004286 3300059628 Bacteria 1146
995 Ga0587069_014528 3300059642 Bacteria 1099
996 Ga0587107_054003 3300059652 Unclassified 690
997 2676495095 2675903060 Bacteria 10051191
998 2856747335 2856741275 Bacteria 8096094
999 2873314959 2873314349 Bacteria 8512634
1000 2884694262 2884693830 Bacteria 11273186
1001 2891402545 2891395885 Bacteria 9251614
1002 2891554879 2891554331 Bacteria 8812224
1003 2891562812 2891562705 Bacteria 8039471
1004 2895435681 2895427314 Bacteria 13147766
1005 2895444702 2895442618 Bacteria 11027144
1006 3003006229 3002998708 Bacteria 11715108
1007 8053951850 8053945823 Bacteria 8962862
1008 8055072615 8055066027 Bacteria 9479577
1009 8055175750 8055172936 Bacteria 9305943
1010 8056060534 8056060235 Bacteria 7259403
1011 Ga0213875_10001160
1012 JGI25404J52841_10003762
1013 Ga0070658_10284147
1014 Ga0070683_100154698
1015 Ga0070683_100710506
1016 Ga0070690_100094826
1017 Ga0070670_100812426
1018 Ga0068869_100307235
1019 Ga0070680_100196932
1020 Ga0070682_100216137
1021 Ga0070682_100357397
1022 Ga0068868_100600223
1023 Ga0068868_100719615
1024 Ga0070660_100099506
1025 Ga0070689_100207991
1026 Ga0070689_100722283
1027 Ga0070691_10076430
1028 Ga0070661_100224898
1029 Ga0070661_100276960
1030 Ga0070692_10292496
1031 Ga0070668_100144901
1032 Ga0070669_100223061
1033 Ga0070671_100119704
1034 Ga0070671_100438242
1035 Ga0070671_100479365
1036 Ga0070673_100113602
1037 Ga0070688_100363395
1038 Ga0070659_100202729
1039 Ga0070667_100456397
1040 Ga0070703_10006853
1041 Ga0070709_10000478
1042 Ga0070709_10021259
1043 Ga0070709_10071599
1044 Ga0070709_10083502
1045 Ga0070709_10164330
1046 Ga0070709_10614025
1047 Ga0070709_10718634
1048 Ga0070709_11585718
1049 Ga0070714_100002062
1050 Ga0070714_100007589
1051 Ga0070714_100016536
1052 Ga0070714_100109366
1053 Ga0070714_100112050
1054 Ga0070714_100185883
1055 Ga0070714_100220589
1056 Ga0070714_100228724
1057 Ga0070714_100277013
1058 Ga0070714_100378322
1059 Ga0070714_100423584
1060 Ga0070714_100640804
1061 Ga0070714_100652102
1062 Ga0070714_101344698
1063 Ga0070713_100010874
1064 Ga0070713_100016958
1065 Ga0070713_100126314
1066 Ga0070713_100141140
1067 Ga0070713_100228817
1068 Ga0070713_100241708
1069 Ga0070713_100259696
1070 Ga0070713_100272128
1071 Ga0070713_100283152
1072 Ga0070713_100353127
1073 Ga0070713_100594909
1074 Ga0070713_100741177
1075 Ga0070713_100804043
1076 Ga0070713_100948755
1077 Ga0070713_101241646
1078 Ga0070710_10000218
1079 Ga0070710_10026373
1080 Ga0070710_10043894
1081 Ga0070710_10049761
1082 Ga0070710_10084656
1083 Ga0070710_10099489
1084 Ga0070710_10278556
1085 Ga0070710_10294392
1086 Ga0070710_10325408
1087 Ga0070710_10511471
1088 Ga0070710_11008735
1089 Ga0070701_10073219
1090 Ga0070711_100043962
1091 Ga0070711_100139861
1092 Ga0070711_100319795
1093 Ga0070711_100629776
1094 Ga0070705_100085548
1095 Ga0070705_100134147
1096 Ga0070705_100761545
1097 Ga0070708_100038950
1098 Ga0070708_100141416
1099 Ga0070708_100470073
1100 Ga0070708_100520054
1101 Ga0070708_100791130
1102 Ga0070708_100842242
1103 Ga0070663_100224380
1104 Ga0070663_100441960
1105 Ga0070678_100070412
1106 Ga0070678_100150114
1107 Ga0070662_100091588
1108 Ga0070681_10148159
1109 Ga0070681_10381700
1110 Ga0070681_11086708
1111 Ga0068867_100173855
1112 Ga0070706_100001339
1113 Ga0070706_100003066
1114 Ga0070706_100003951
1115 Ga0070706_100011013
1116 Ga0070706_100020290
1117 Ga0070706_100092042
1118 Ga0070706_100230597
1119 Ga0070706_100311049
1120 Ga0070706_100320556
1121 Ga0070706_100342712
1122 Ga0070706_101167113
1123 Ga0070707_100001503
1124 Ga0070707_100002309
1125 Ga0070707_100049280
1126 Ga0070707_100051048
1127 Ga0070707_100098856
1128 Ga0070707_100392986
1129 Ga0070707_100555568
1130 Ga0070707_100637878
1131 Ga0070707_100694760
1132 Ga0070707_100763163
1133 Ga0070698_100000546
1134 Ga0070698_100000665
1135 Ga0070698_100005898
1136 Ga0070698_100026037
1137 Ga0070698_100042199
1138 Ga0070698_100318507
1139 Ga0070698_100882412
1140 Ga0070699_100010962
1141 Ga0070699_100321904
1142 Ga0070699_101701285
1143 Ga0070679_100104922
1144 Ga0070679_101690239
1145 Ga0070684_100266179
1146 Ga0070684_100339750
1147 Ga0070684_100802935
1148 Ga0070697_100037989
1149 Ga0070697_100085732
1150 Ga0068853_100104187
1151 Ga0070672_100458414
1152 Ga0070686_100030161
1153 Ga0070696_100255956
1154 Ga0070665_100231408
1155 Ga0070665_100535172
1156 Ga0070704_100123917
1157 Ga0068855_100164436
1158 Ga0070664_100078162
1159 Ga0070664_101066061
1160 Ga0068857_100041418
1161 Ga0068857_100532833
1162 Ga0068856_100008941
1163 Ga0068856_100081996
1164 Ga0068856_100810969
1165 Ga0070702_100075402
1166 Ga0070702_100456884
1167 Ga0068852_100934634
1168 Ga0068864_100197116
1169 Ga0068864_100411271
1170 Ga0068866_10137407
1171 Ga0068861_100260870
1172 Ga0068863_100064425
1173 Ga0068863_100265685
1174 Ga0068858_101468641
1175 Ga0081540_1000345
1176 Ga0081540_1002862
1177 Ga0070717_10001611
1178 Ga0070717_10045967
1179 Ga0070717_10097050
1180 Ga0070717_10099155
1181 Ga0070717_10133015
1182 Ga0070717_10153160
1183 Ga0070717_10243900
1184 Ga0070717_10320531
1185 Ga0070717_10323441
1186 Ga0070717_10337377
1187 Ga0070717_10517372
1188 Ga0070717_10519169
1189 Ga0070717_10621238
1190 Ga0070717_11378659
1191 Ga0070715_10001165
1192 Ga0070715_10016810
1193 Ga0070715_10085671
1194 Ga0070716_100000108
1195 Ga0070716_100001275
1196 Ga0070716_100004463
1197 Ga0070716_100016224
1198 Ga0070716_100024749
1199 Ga0070716_100276055
1200 Ga0070716_100491260
1201 Ga0070716_100570682
1202 Ga0070712_100000686
1203 Ga0070712_100003387
1204 Ga0070712_100007538
1205 Ga0070712_100030461
1206 Ga0070712_100043680
1207 Ga0070712_100083295
1208 Ga0070712_100182981
1209 Ga0070712_100253315
1210 Ga0070712_100298903
1211 Ga0070712_100420574
1212 Ga0070712_100566534
1213 Ga0070712_100710598
1214 Ga0070712_100747826
1215 Ga0070712_100842040
1216 Ga0070712_100909025
1217 Ga0070712_101202135
1218 Ga0070712_101250169
1219 Ga0097621_100063674
1220 Ga0075433_10042000
1221 Ga0075433_10153362
1222 Ga0075433_10321934
1223 Ga0075434_100018311
1224 Ga0075434_100021691
1225 Ga0075434_100056332
1226 Ga0075434_100693747
1227 Ga0068865_100079207
1228 Ga0075436_100068189
1229 Ga0075436_100147320
1230 Ga0075436_100214019
1231 Ga0075436_100307763
1232 Ga0075436_100358679
1233 Ga0075435_100013330
1234 Ga0075435_100033580
1235 Ga0075435_100185638
1236 Ga0099794_10025796
1237 Ga0099794_10153458
1238 Ga0099795_10065815
1239 Ga0105251_10024110
1240 Ga0105250_10263711
1241 Ga0105240_10275493
1242 Ga0111539_10037919
1243 Ga0105247_10101372
1244 Ga0114129_10008379
1245 Ga0114129_10279459
1246 Ga0105241_10154259
1247 Ga0105242_10074221
1248 Ga0105248_10493613
1249 Ga0105237_10987780
1250 Ga0105238_10245644
1251 Ga0105238_10282092
1252 Ga0099796_10036400
1253 Ga0099796_10167333
1254 Ga0105246_10098480
1255 Ga0157329_1000987
1256 Ga0157341_1001858
1257 Ga0157315_1003551
1258 Ga0157338_1003156
1259 Ga0154012_171739
1260 Ga0157373_10149527
1261 Ga0157371_10022428
1262 Ga0157370_10432552
1263 Ga0157369_10431851
1264 Ga0157369_11132908
1265 Ga0157374_10298902
1266 Ga0157374_10664203
1267 Ga0157374_11314565
1268 Ga0157372_11870916
1269 Ga0157375_10143340
1270 Ga0163163_10748687
1271 Ga0157380_10130229
1272 Ga0157379_10164260
1273 Ga0157376_11050093
1274 Ga0157376_12845313
1275 Ga0163161_10132536
1276 Ga0184596_100859
1277 Ga0197907_10094249
1278 Ga0197907_10330890
1279 Ga0197907_10856800
1280 Ga0206356_10087393
1281 Ga0206356_10126861
1282 Ga0206356_10418263
1283 Ga0206349_1383630
1284 Ga0206349_1475694
1285 Ga0206349_1940810
1286 Ga0206355_1227789
1287 Ga0206352_10009035
1288 Ga0206352_10622047
1289 Ga0206350_10153199
1290 Ga0206350_10191192
1291 Ga0206354_10444123
1292 Ga0206354_10534952
1293 Ga0206354_10765260
1294 Ga0206353_10666110
1295 Ga0206353_10731065
1296 Ga0206353_11517539
1297 Ga0206353_11921151
1298 Ga0154015_1425898
1299 Ga0213873_10161504
1300 Ga0213875_10000363
1301 Ga0213875_10108273
1302 Ga0224712_10010529
1303 Ga0224712_10133398
1304 Ga0224712_10294026
1305 Ga0224712_10300870
1306 Ga0224712_10385772
1307 Ga0247528_106423
1308 Ga0224572_1023820
1309 Ga0207656_10166207
1310 Ga0207653_10012809
1311 Ga0207692_10000147
1312 Ga0207692_10005038
1313 Ga0207692_10022809
1314 Ga0207692_10023512
1315 Ga0207692_10055962
1316 Ga0207692_10111604
1317 Ga0207692_10163826
1318 Ga0207692_10178991
1319 Ga0207692_10243710
1320 Ga0207642_10018159
1321 Ga0207710_10053403
1322 Ga0207688_10062564
1323 Ga0207647_10037539
1324 Ga0207647_10238194
1325 Ga0207685_10007363
1326 Ga0207685_10096340
1327 Ga0207699_10000291
1328 Ga0207699_10003997
1329 Ga0207699_10005864
1330 Ga0207699_10057636
1331 Ga0207699_10085697
1332 Ga0207699_10144157
1333 Ga0207699_10145888
1334 Ga0207699_10199061
1335 Ga0207699_10371758
1336 Ga0207645_10210798
1337 Ga0207643_10012094
1338 Ga0207705_10191336
1339 Ga0207684_10000323
1340 Ga0207684_10003999
1341 Ga0207684_10019980
1342 Ga0207684_10020435
1343 Ga0207684_10025297
1344 Ga0207684_10100554
1345 Ga0207684_10290158
1346 Ga0207654_10140334
1347 Ga0207654_10416163
1348 Ga0207707_10001352
1349 Ga0207707_10129156
1350 Ga0207707_10217601
1351 Ga0207707_10385518
1352 Ga0207693_10003946
1353 Ga0207693_10009037
1354 Ga0207693_10025346
1355 Ga0207693_10136892
1356 Ga0207693_10171076
1357 Ga0207693_10210364
1358 Ga0207693_10213112
1359 Ga0207693_10464740
1360 Ga0207693_10584641
1361 Ga0207693_10799546
1362 Ga0207663_10032294
1363 Ga0207663_10037969
1364 Ga0207663_10038329
1365 Ga0207663_10040069
1366 Ga0207663_10111458
1367 Ga0207663_10183244
1368 Ga0207663_10196750
1369 Ga0207663_10259957
1370 Ga0207663_10271298
1371 Ga0207660_10166316
1372 Ga0207662_10010759
1373 Ga0207657_10014600
1374 Ga0207657_10046061
1375 Ga0207649_10313302
1376 Ga0207652_10827156
1377 Ga0207652_11393918
1378 Ga0207646_10000050
1379 Ga0207646_10005341
1380 Ga0207646_10009312
1381 Ga0207646_10010964
1382 Ga0207646_10049754
1383 Ga0207646_10245815
1384 Ga0207646_10460672
1385 Ga0207687_11464673
1386 Ga0207700_10000216
1387 Ga0207700_10009909
1388 Ga0207700_10014818
1389 Ga0207700_10021282
1390 Ga0207700_10049581
1391 Ga0207700_10059951
1392 Ga0207700_10128357
1393 Ga0207700_10129475
1394 Ga0207700_10131899
1395 Ga0207700_10187336
1396 Ga0207700_10282417
1397 Ga0207700_10294442
1398 Ga0207700_10556096
1399 Ga0207700_11010361
1400 Ga0207700_11545537
1401 Ga0207664_10000379
1402 Ga0207664_10002673
1403 Ga0207664_10004775
1404 Ga0207664_10011886
1405 Ga0207664_10019743
1406 Ga0207664_10020810
1407 Ga0207664_10021804
1408 Ga0207664_10031128
1409 Ga0207664_10054930
1410 Ga0207664_10098379
1411 Ga0207664_10111576
1412 Ga0207664_10209663
1413 Ga0207664_10254304
1414 Ga0207664_10277737
1415 Ga0207664_10391758
1416 Ga0207664_10411769
1417 Ga0207664_10529653
1418 Ga0207664_10559757
1419 Ga0207664_11475265
1420 Ga0207644_10176509
1421 Ga0207644_10499891
1422 Ga0207644_10520164
1423 Ga0207690_10085785
1424 Ga0207706_10007021
1425 Ga0207665_10000785
1426 Ga0207665_10001106
1427 Ga0207665_10005661
1428 Ga0207665_10008399
1429 Ga0207665_10018898
1430 Ga0207665_10350041
1431 Ga0207665_10541641
1432 Ga0207691_10064364
1433 Ga0207689_10129846
1434 Ga0207661_10059815
1435 Ga0207661_10220843
1436 Ga0207661_10295746
1437 Ga0207679_10117036
1438 Ga0207651_10465055
1439 Ga0207712_10164479
1440 Ga0207668_10385891
1441 Ga0207640_10119910
1442 Ga0207640_10371390
1443 Ga0207658_10047012
1444 Ga0207677_10556318
1445 Ga0207703_10646367
1446 Ga0207703_10896662
1447 Ga0207639_10307058
1448 Ga0207639_10486186
1449 Ga0207678_10066516
1450 Ga0207678_10122511
1451 Ga0207678_10274302
1452 Ga0207708_10097339
1453 Ga0207702_10055808
1454 Ga0207702_10096073
1455 Ga0207702_10142508
1456 Ga0207641_10098295
1457 Ga0207641_10164144
1458 Ga0207641_12168406
1459 Ga0207676_10464554
1460 Ga0207676_10823454
1461 Ga0207674_10105189
1462 Ga0207674_10228847
1463 Ga0207674_10697502
1464 Ga0207675_100010739
1465 Ga0207683_10047963
1466 Ga0207683_10141883
1467 Ga0207698_12010292
1468 Ga0268264_10213603
1469 Ga0265337_1002783
1470 Ga0265326_10004145
1471 Ga0265319_1008471
1472 Ga0265334_10000618
1473 Ga0265318_10008064
1474 Ga0265322_10012266
1475 Ga0265336_10011453
1476 Ga0265338_10001346
1477 Ga0265338_10004892
1478 Ga0265338_10006911
1479 Ga0265338_10050905
1480 Ga0265338_10322327
1481 Ga0265324_10008253
1482 Ga0265769_101534
1483 Ga0265768_101823
1484 Ga0265330_10036834
1485 Ga0265332_10000905
1486 Ga0265328_10241079
1487 Ga0265320_10011279
1488 Ga0265320_10078344
1489 Ga0265325_10004585
1490 Ga0265325_10181945
1491 Ga0265329_10062314
1492 Ga0265340_10004914
1493 Ga0265339_10014972
1494 Ga0265339_10045905
1495 Ga0265316_10022565
1496 Ga0265316_10540194
1497 Ga0265313_10042257
1498 Ga0265313_10154659
1499 Ga0307508_10447104
1500 Ga0310108_118602
1501 Ga0310101_109030
1502 Ga0265314_10015366
1503 Ga0265314_10019718
1504 Ga0265342_10016032
1505 Ga0265342_10131296
1506 Ga0316212_1004821
1507 Ga0373930_0004163
1508 Ga0373948_0001671
1509 Ga0373938_0085554
1510 Ga0373926_0004416
1511 Ga0373926_0010520
1512 Ga0373928_0013307
1513 Ga0373928_0051135
1514 Ga0373929_0021923
1515 Ga0373934_0000032
1516 Ga0373934_0004079
1517 Ga0373934_0004937
1518 Ga0373934_0009173
1519 Ga0373934_0049378
1520 Ga0373934_0429403
1521 Ga0373940_0069054
1522 Ga0373944_0012091
1523 Ga0373944_0016653
1524 Ga0373949_0021004
1525 Ga0373949_0021772
1526 Ga0373951_0017198
1527 Ga0373923_0000472
1528 Ga0373923_0008843
1529 Ga0373923_0013796
1530 Ga0373923_0105969
1531 Ga0373923_0161999
1532 Ga0373932_0013806
1533 Ga0373936_0001930
1534 Ga0373936_0006056
1535 Ga0373936_0356643
1536 Ga0373939_0025178
1537 Ga0373945_0000693
1538 Ga0373945_0003551
1539 Ga0373945_0120835
1540 Ga0373945_0186966
1541 Ga0373945_0216534
1542 Ga0373953_0000145
1543 Ga0373953_0002637
1544 Ga0373953_0009915
1545 Ga0373953_0033681
1546 Ga0373953_0045499
1547 Ga0373953_0124333
1548 Ga0373953_0144631
1549 Ga0373954_0004824
1550 Ga0373954_0011407
1551 Ga0373954_0020285
1552 Ga0373956_0000096
1553 Ga0373956_0014918
1554 Ga0373956_0034894
1555 Ga0373957_0000565
1556 Ga0373957_0003369
1557 Ga0373957_0005890
1558 Ga0373957_0013296
1559 Ga0373957_0036898
1560 Ga0373960_0025527
1561 Ga0373960_0035890
1562 Ga0373943_0000869
1563 Ga0373943_0222164
1564 Ga0373943_0292337
1565 Ga0373943_0339857
1566 Ga0373943_0413160
1567 Ga0373943_0491204
1568 Ga0373943_0497872
1569 Ga0373943_0890847
1570 Ga0373946_0002754
1571 Ga0373946_0005561
1572 Ga0373946_0051713
1573 Ga0373946_0233862
1574 Ga0373946_0405003
1575 Ga0373955_0000015
1576 Ga0373955_0014041
1577 Ga0373955_0032656
1578 Ga0373955_0222087
1579 Ga0373955_0247308
1580 Ga0373955_0745712
1581 Ga0373955_0881183
1582 Ga0373942_0048046
1583 Ga0373962_0041763
1584 Ga0373962_0084282
1585 Ga0373924_0003840
1586 Ga0373924_0015260
1587 Ga0373924_0018110
1588 Ga0373924_0063887
1589 Ga0373924_0157661
1590 Ga0373924_0308401
1591 Ga0373931_0072221
1592 Ga0373931_1032602
1593 Ga0373935_0002772
1594 Ga0373935_0019853
1595 Ga0373935_0041841
1596 Ga0373935_0074104
1597 Ga0373935_0285230
1598 Ga0373927_0005785
1599 Ga0373927_0182495
1600 Ga0373927_0291959
1601 Ga0373927_0331473
1602 Ga0373927_0462653
1603 Ga0373927_0869913
1604 Ga0373933_0000004
1605 Ga0373933_0012151
1606 Ga0373933_0016458
1607 Ga0373933_0066301
1608 Ga0373933_0069093
1609 Ga0373933_0081570
1610 Ga0373933_0200322
1611 Ga0373947_0002525
1612 Ga0373947_0036414
1613 Ga0373947_0068140
1614 Ga0373947_0211250
1615 Ga0373947_0214627
1616 Ga0373947_0442814
1617 Ga0373947_0749792
1618 Ga0373937_0000012
1619 Ga0373937_0016525
1620 Ga0373937_0023070
1621 Ga0373937_0035993
1622 Ga0373937_0065143
1623 Ga0373937_0128883
1624 Ga0373937_0194066
1625 Ga0373937_0581475
1626 Ga0373937_1168156
1627 Ga0372808_018230
1628 Ga0310109_014140
1629 Ga0373925_0000021
1630 Ga0373925_0005148
1631 Ga0373925_0049126
1632 Ga0373925_0063191
1633 Ga0373925_0100426
1634 Ga0373925_0345450
1635 Ga0373925_0365597
1636 Ga0373925_0954490
1637 Ga0395899_0004117
1638 Ga0395898_0023865
1639 Ga0395898_1008864
1640 Ga0436364_0136351
1641 Ga0436364_0866950
1642 Ga0436364_0989727
1643 Ga0436364_1018157
1644 Ga0436364_1160722
1645 Ga0436364_1303572
1646 Ga0436364_1314967
1647 Ga0436364_1427311
1648 Ga0436365_1301466
1649 Ga0436363_0158367
1650 Ga0436363_0276775
1651 Ga0436363_1335153
1652 Ga0436363_1525360
1653 Ga0436362_0069517
1654 Ga0436362_1023179
1655 Ga0451789_0954289
1656 Ga0451793_1539502
1657 Ga0466966_0019698
1658 Ga0466961_0040225
1659 Ga0466961_0082735
1660 Ga0466963_0405621
1661 Ga0466971_0120291
1662 Ga0466968_0166062
1663 Ga0466968_0270693
1664 Ga0466959_0190702
1665 Ga0466959_0192506
1666 Ga0466959_0221305
1667 Ga0466958_0110214
1668 Ga0466958_0427089
1669 Ga0466967_0239113
1670 Ga0466967_0512969
1671 Ga0466967_0784508
1672 Ga0466967_2410919
1673 Ga0495592_0001038
1674 Ga0495592_0025030
1675 Ga0495592_0065020
1676 Ga0495592_0115181
1677 Ga0495592_0204941
1678 Ga0495592_0322135
1679 Ga0495603_0085584
1680 Ga0495603_0120564
1681 Ga0495629_0001307
1682 Ga0495629_0050225
1683 Ga0495629_0105596
1684 Ga0495641_0003608
1685 Ga0495641_0020494
1686 Ga0495641_0023199
1687 Ga0495641_0073864
1688 Ga0495651_0000007
1689 Ga0495651_0004063
1690 Ga0495651_0014480
1691 Ga0495651_0016969
1692 Ga0495651_0019156
1693 Ga0495651_0371659
1694 Ga0495651_0378679
1695 Ga0495651_0630536
1696 Ga0495653_0004863
1697 Ga0495653_0005400
1698 Ga0495653_0029402
1699 Ga0495653_0030612
1700 Ga0495653_0040372
1701 Ga0495653_0047918
1702 Ga0495653_0061892
1703 Ga0495653_0071907
1704 Ga0495580_0480138
1705 Ga0495580_0749010
1706 Ga0495582_0001211
1707 Ga0495582_0005652
1708 Ga0495582_0161218
1709 Ga0495582_0270248
1710 Ga0495639_0010409
1711 Ga0495662_0012967
1712 Ga0495662_0024097
1713 Ga0495662_0159693
1714 Ga0495662_0407590
1715 Ga0495664_0004193
1716 Ga0495664_0012427
1717 Ga0495664_0019880
1718 Ga0495664_0029664
1719 Ga0495664_0051898
1720 Ga0495608_0000015
1721 Ga0495608_0003113
1722 Ga0495608_0027673
1723 Ga0495608_0039886
1724 Ga0495608_0052193
1725 Ga0495608_0360469
1726 Ga0495608_0504370
1727 Ga0495608_0916610
1728 Ga0495618_0007498
1729 Ga0495618_0019010
1730 Ga0495618_0025441
1731 Ga0495618_0098542
1732 Ga0495618_0119274
1733 Ga0495618_0125980
1734 Ga0495618_0127174
1735 Ga0495618_0237778
1736 Ga0495628_0000737
1737 Ga0495628_0017665
1738 Ga0495628_0084215
1739 Ga0495628_0085998
1740 Ga0495628_0336945
1741 Ga0495630_0018483
1742 Ga0495630_0041563
1743 Ga0495630_0058292
1744 Ga0495630_0086488
1745 Ga0495630_0204619
1746 Ga0495630_0212093
1747 Ga0495666_0185939
1748 Ga0495652_0000074
1749 Ga0495652_0012772
1750 Ga0495652_0023128
1751 Ga0495652_0103996
1752 Ga0495652_0107955
1753 Ga0495652_0195934
1754 Ga0495652_0368490
1755 Ga0495652_0982404
1756 Ga0495665_0005298
1757 Ga0495665_0005836
1758 Ga0495665_0005892
1759 Ga0495665_0020140
1760 Ga0495665_0123402
1761 Ga0495665_0262560
1762 Ga0495640_0008749
1763 Ga0495640_0028840
1764 Ga0495640_0105248
1765 Ga0495640_0209627
1766 Ga0495640_0456209
1767 Ga0495586_0010989
1768 Ga0495586_0012705
1769 Ga0495586_0141080
1770 Ga0495587_0000085
1771 Ga0495587_0003258
1772 Ga0495587_0010139
1773 Ga0495587_0056265
1774 Ga0495587_0173421
1775 Ga0495645_0030868
1776 Ga0495645_0035606
1777 Ga0495645_0074422
1778 Ga0495645_0089644
1779 Ga0495645_0102970
1780 Ga0495645_0346412
1781 Ga0495667_0000033
1782 Ga0495667_0003641
1783 Ga0495667_0004750
1784 Ga0495667_0009929
1785 Ga0495667_0804607
1786 Ga0495634_0004108
1787 Ga0495634_0023454
1788 Ga0495634_0028120
1789 Ga0495634_0098564
1790 Ga0495634_0129038
1791 Ga0495635_0003052
1792 Ga0495635_0011882
1793 Ga0495635_0042090
1794 Ga0495635_0049734
1795 Ga0495635_0057761
1796 Ga0495635_0067987
1797 Ga0495635_0236790
1798 Ga0495588_0480831
1799 Ga0495657_0001345
1800 Ga0495657_0004406
1801 Ga0495657_0007140
1802 Ga0495657_0024425
1803 Ga0495657_0027020
1804 Ga0495657_0058343
1805 Ga0495657_0106458
1806 Ga0495599_0000018
1807 Ga0495599_0005426
1808 Ga0495599_0016500
1809 Ga0495599_0030374
1810 Ga0495599_0088154
1811 Ga0495599_0139626
1812 Ga0495599_0205349
1813 Ga0495599_0281206
1814 Ga0495623_0000075
1815 Ga0495623_0009174
1816 Ga0495623_0027076
1817 Ga0495623_0155803
1818 Ga0495623_0169115
1819 Ga0495646_0005199
1820 Ga0495646_0025764
1821 Ga0495646_0037718
1822 Ga0495646_0061783
1823 Ga0495646_0074293
1824 Ga0495646_0115853
1825 Ga0495646_0159912
1826 Ga0495646_0281571
1827 Ga0495646_0388313
1828 Ga0495647_0080114
1829 Ga0495658_0063337
1830 Ga0495658_0565057
1831 Ga0495613_0005089
1832 Ga0495613_0005645
1833 Ga0495613_0085253
1834 Ga0495613_0094696
1835 Ga0495624_0007746
1836 Ga0495624_0011024
1837 Ga0495624_0343095
1838 Ga0495624_0460696
1839 Ga0495600_0003461
1840 Ga0495600_0004210
1841 Ga0495600_0018634
1842 Ga0495600_0035402
1843 Ga0495600_0163115
1844 Ga0495581_0002245
1845 Ga0495581_0004730
1846 Ga0495581_0080075
1847 Ga0495581_0093271
1848 Ga0495581_0505669
1849 Ga0495604_0000025
1850 Ga0495604_0015271
1851 Ga0495604_0041000
1852 Ga0495604_0071431
1853 Ga0495604_0082497
1854 Ga0495604_0264199
1855 Ga0495674_0013169
1856 Ga0495674_0013242
1857 Ga0495674_0020722
1858 Ga0495674_0026819
1859 Ga0495674_0033400
1860 Ga0495674_0980895
1861 Ga0495674_1377981
1862 Ga0495676_0023696
1863 Ga0495676_0070119
1864 Ga0495676_0253490
1865 Ga0495676_0474429
1866 Ga0495676_0600715
1867 Ga0495676_0647148
1868 Ga0495680_0000015
1869 Ga0495680_0011499
1870 Ga0495680_0019388
1871 Ga0495680_0024054
1872 Ga0495680_0028019
1873 Ga0495680_0037139
1874 Ga0495680_0044700
1875 Ga0495680_0047383
1876 Ga0495680_0061680
1877 Ga0495680_0221492
1878 Ga0495675_0000702
1879 Ga0495675_0012372
1880 Ga0495675_0018050
1881 Ga0495675_0086657
1882 Ga0495675_0220939
1883 Ga0495684_0004873
1884 Ga0495684_0053358
1885 Ga0495684_0064631
1886 Ga0495684_0093548
1887 Ga0495684_0300712
1888 Ga0495684_0650686
1889 Ga0495684_0825416
1890 Ga0495593_0003014
1891 Ga0495593_0020518
1892 Ga0495593_0065145
1893 Ga0495593_0164734
1894 Ga0495593_0182618
1895 Ga0495602_0000065
1896 Ga0495602_0011079
1897 Ga0495602_0027529
1898 Ga0495602_0039997
1899 Ga0495602_0083248
1900 Ga0495602_0222104
1901 Ga0495602_0446462
1902 Ga0496100_0443258
1903 Ga0496101_0611565
1904 Ga0496102_0051607
1905 Ga0496102_0451162
1906 Ga0496102_0913326
1907 Ga0496103_0053998
1908 Ga0496103_0402367
1909 Ga0496104_0014773
1910 Ga0496104_0061932
1911 Ga0496104_0129945
1912 Ga0496105_0054363
1913 Ga0496105_0106953
1914 Ga0496106_0461084
1915 Ga0496107_0069211
1916 Ga0496107_0124441
1917 Ga0496107_0166482
1918 Ga0496108_0017599
1919 Ga0496108_0107297
1920 Ga0496108_1086089
1921 Ga0496109_0014415
1922 Ga0496109_0179360
1923 Ga0496109_0246698
1924 Ga0496109_0998750
1925 Ga0496110_0062954
1926 Ga0496110_1469677
1927 Ga0496111_0088933
1928 Ga0496111_0125687
1929 Ga0496111_0595163
1930 Ga0496112_0060441
1931 Ga0496112_0125224
1932 Ga0496113_0025110
1933 Ga0496113_0061466
1934 Ga0496113_0406899
1935 Ga0496114_0175872
1936 Ga0496114_1116797
1937 Ga0496115_0008866
1938 Ga0496115_0051191
1939 Ga0496126_0042649
1940 Ga0496126_0043718
1941 Ga0496126_0564029
1942 Ga0501034_0721819
1943 Ga0501037_0014884
1944 Ga0501037_0153419
1945 Ga0501038_0111223
1946 Ga0501039_0057382
1947 Ga0501042_0005377
1948 Ga0501042_0008967
1949 Ga0501043_0011292
1950 Ga0501047_0046138
1951 Ga0501047_0084672
1952 Ga0501070_0948602
1953 Ga0501074_0004998
1954 Ga0501077_0203751
1955 Ga0501044_0377778
1956 nmdc:mga05p37_35974_c2
1957 nmdc:mga0n895_111117_c1
1958 nmdc:mga0n895_379457_c1
1959 nmdc:mga0rr50_1087972_c1
1960 nmdc:mga0rr50_112665_c1
1961 nmdc:mga0rr50_143507_c1
1962 nmdc:mga0rr50_255610_c1
1963 nmdc:mga0rr50_653046_c1
1964 nmdc:mga0rr50_801608_c1
1965 nmdc:mga08x19_161124_c1
1966 nmdc:mga08x19_293683_c1
1967 nmdc:mga08x19_469241_c1
1968 nmdc:mga08x19_518876_c1
1969 nmdc:mga08x19_59556_c1
1970 nmdc:mga0a205_126363_c1
1971 nmdc:mga0a205_194452_c1
1972 Ga0495601_0069529
1973 Ga0495601_0098757
1974 Ga0495601_0148954
1975 Ga0495601_0152021
1976 Ga0495601_0350914
1977 Ga0495612_0003458
1978 Ga0495612_0007651
1979 Ga0495612_0008570
1980 Ga0495612_0044484
1981 Ga0495612_0085043
1982 Ga0495612_0086713
1983 Ga0495655_0232021
1984 Ga0495595_0001179
1985 Ga0495595_0007432
1986 Ga0495595_0009129
1987 Ga0495595_0010655
1988 Ga0495595_0028051
1989 Ga0495619_0010762
1990 Ga0495619_0027610
1991 Ga0495619_0042518
1992 Ga0495619_0050933
1993 Ga0495619_0236489
1994 Ga0495619_0452760
1995 Ga0495619_0710119
1996 Ga0590075_038196
1997 Ga0587073_0150374
1998 Ga0587077_049332
1999 Ga0587088_023521
2000 Ga0587091_011184
2001 Ga0587092_016024
2002 Ga0587113_004762
2003 Ga0587115_008978
2004 Ga0587122_004286
2005 Ga0587069_014528
2006 Ga0587107_054003
2007 2676495095
2008 2856747335
2009 2873314959
2010 2884694262
2011 2891402545
2012 2891554879
2013 2891562812
2014 2895435681
2015 2895444702
2016 3003006229
2017 8053951850
2018 8055072615
2019 8055175750
2020 8056060534

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

8

145

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly2.cif.gz_K the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9363 2 145
6m36-assembly2.cif.gz_I the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9297 2 145
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9287 2 146
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9262 2 145
6m37-assembly1.cif.gz_A-2 the crystal structure of b. subtilis rsbv/rsbw complex in the hexagonal crystal form 0.9161 1 146
ID Description Score Start End Superfamily
af_P9WLZ7_398_539_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8535 1 143 3.30.565.10
af_Q57727_14_160_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8312 10 54 1.10.357.140
af_P9WGX7_40_164_3.90.1100.10 Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; 0.8202 4 147 3.90.1100.10
af_P9WGX7_40_164_3.90.1100.10 Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; 0.8082 4 147 3.90.1100.10
3ke6B02 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7908 1 143 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A3C1DPD3-F1-model_v4 Anti-sigma regulatory factor 0.9158 2 150 GO:0004674
AF-A0A537YVJ7-F1-model_v4 ATP-binding protein 0.9108 4 146 GO:0004674
GO:0005524
AF-A0A1W9WD54-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.8957 2 145
AF-A0A537YVJ7-F1-model_v4 ATP-binding protein 0.8899 4 146 GO:0004674
GO:0005524
AF-A0A125Q1H6-F1-model_v4 deleted 0.8818 4 147

Map