F488114
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1010 | 355 | 2020 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300021388|Ga0213875_10001160|Ga0213875_100011602 |
| Length | 172 |
| Sequence | MATVEVTFTPLPAHVRTARLVATAVARRSGVDESVLDEVRLAVGEACSRAVEAHRRHCPRQPIRVELTDHEERFEVVVTDSAPASENGRPGEHSGGGLGGITPPGTTEPADLQLPEGVGLAVIAGLADDVRISPAGAGISVRMSWKRRPHPETSLRLPGAPRIPGQRIPSFV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 73 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 74 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 88 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 89 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 90 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 91 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300019176 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 109 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 115 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300023680 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 117 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 184 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 186 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031633 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 193 | 3300031690 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 197 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 199 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 203 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 212 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 217 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 223 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 231 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 238 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 239 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 241 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 242 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 243 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 244 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 245 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 246 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 247 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 305 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 306 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 307 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 308 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 309 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 332 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 343 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 344 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 345 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 346 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 347 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 348 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 349 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 350 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 351 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 352 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 353 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 354 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 355 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.06 |
| Metatranscriptomes | 4.55 |
| Isolates | 1.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.86 |
| Rhizosphere | 92.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0213875_10001160 | 3300021388 | Bacteria | 18079 |
| 2 | JGI25404J52841_10003762 | 3300003659 | Bacteria | 3025 |
| 3 | Ga0070658_10284147 | 3300005327 | Bacteria | 1409 |
| 4 | Ga0070683_100154698 | 3300005329 | Bacteria | 2174 |
| 5 | Ga0070683_100710506 | 3300005329 | Bacteria | 963 |
| 6 | Ga0070690_100094826 | 3300005330 | Bacteria | 1969 |
| 7 | Ga0070670_100812426 | 3300005331 | Bacteria | 845 |
| 8 | Ga0068869_100307235 | 3300005334 | Bacteria | 1282 |
| 9 | Ga0070680_100196932 | 3300005336 | Bacteria | 1698 |
| 10 | Ga0070682_100216137 | 3300005337 | Bacteria | 1361 |
| 11 | Ga0070682_100357397 | 3300005337 | Bacteria | 1091 |
| 12 | Ga0068868_100600223 | 3300005338 | Bacteria | 975 |
| 13 | Ga0068868_100719615 | 3300005338 | Bacteria | 894 |
| 14 | Ga0070660_100099506 | 3300005339 | Bacteria | 2302 |
| 15 | Ga0070689_100207991 | 3300005340 | Bacteria | 1601 |
| 16 | Ga0070689_100722283 | 3300005340 | Bacteria | 871 |
| 17 | Ga0070691_10076430 | 3300005341 | Bacteria | 1632 |
| 18 | Ga0070661_100224898 | 3300005344 | Bacteria | 1440 |
| 19 | Ga0070661_100276960 | 3300005344 | Bacteria | 1300 |
| 20 | Ga0070692_10292496 | 3300005345 | Bacteria | 991 |
| 21 | Ga0070668_100144901 | 3300005347 | Bacteria | 1916 |
| 22 | Ga0070669_100223061 | 3300005353 | Bacteria | 1491 |
| 23 | Ga0070671_100119704 | 3300005355 | Bacteria | 2215 |
| 24 | Ga0070671_100438242 | 3300005355 | Bacteria | 1120 |
| 25 | Ga0070671_100479365 | 3300005355 | Bacteria | 1069 |
| 26 | Ga0070673_100113602 | 3300005364 | Bacteria | 2249 |
| 27 | Ga0070688_100363395 | 3300005365 | Bacteria | 1063 |
| 28 | Ga0070659_100202729 | 3300005366 | Bacteria | 1633 |
| 29 | Ga0070667_100456397 | 3300005367 | Bacteria | 1168 |
| 30 | Ga0070703_10006853 | 3300005406 | Bacteria | 3198 |
| 31 | Ga0070709_10000478 | 3300005434 | Bacteria | 23598 |
| 32 | Ga0070709_10021259 | 3300005434 | Bacteria | 3777 |
| 33 | Ga0070709_10071599 | 3300005434 | Bacteria | 2239 |
| 34 | Ga0070709_10083502 | 3300005434 | Bacteria | 2089 |
| 35 | Ga0070709_10164330 | 3300005434 | Bacteria | 1546 |
| 36 | Ga0070709_10614025 | 3300005434 | Bacteria | 838 |
| 37 | Ga0070709_10718634 | 3300005434 | Bacteria | 778 |
| 38 | Ga0070709_11585718 | 3300005434 | Unclassified | 533 |
| 39 | Ga0070714_100002062 | 3300005435 | Bacteria | 14717 |
| 40 | Ga0070714_100007589 | 3300005435 | Bacteria | 8446 |
| 41 | Ga0070714_100016536 | 3300005435 | Bacteria | 5961 |
| 42 | Ga0070714_100109366 | 3300005435 | Bacteria | 2445 |
| 43 | Ga0070714_100112050 | 3300005435 | Bacteria | 2417 |
| 44 | Ga0070714_100185883 | 3300005435 | Bacteria | 1893 |
| 45 | Ga0070714_100220589 | 3300005435 | Bacteria | 1742 |
| 46 | Ga0070714_100228724 | 3300005435 | Bacteria | 1712 |
| 47 | Ga0070714_100277013 | 3300005435 | Bacteria | 1557 |
| 48 | Ga0070714_100378322 | 3300005435 | Bacteria | 1334 |
| 49 | Ga0070714_100423584 | 3300005435 | Bacteria | 1261 |
| 50 | Ga0070714_100640804 | 3300005435 | Bacteria | 1022 |
| 51 | Ga0070714_100652102 | 3300005435 | Bacteria | 1013 |
| 52 | Ga0070714_101344698 | 3300005435 | Bacteria | 697 |
| 53 | Ga0070713_100010874 | 3300005436 | Bacteria | 6598 |
| 54 | Ga0070713_100016958 | 3300005436 | Bacteria | 5492 |
| 55 | Ga0070713_100126314 | 3300005436 | Bacteria | 2250 |
| 56 | Ga0070713_100141140 | 3300005436 | Bacteria | 2134 |
| 57 | Ga0070713_100228817 | 3300005436 | Bacteria | 1689 |
| 58 | Ga0070713_100241708 | 3300005436 | Bacteria | 1644 |
| 59 | Ga0070713_100259696 | 3300005436 | Bacteria | 1587 |
| 60 | Ga0070713_100272128 | 3300005436 | Bacteria | 1551 |
| 61 | Ga0070713_100283152 | 3300005436 | Bacteria | 1521 |
| 62 | Ga0070713_100353127 | 3300005436 | Bacteria | 1364 |
| 63 | Ga0070713_100594909 | 3300005436 | Bacteria | 1050 |
| 64 | Ga0070713_100741177 | 3300005436 | Bacteria | 939 |
| 65 | Ga0070713_100804043 | 3300005436 | Bacteria | 901 |
| 66 | Ga0070713_100948755 | 3300005436 | Bacteria | 828 |
| 67 | Ga0070713_101241646 | 3300005436 | Bacteria | 722 |
| 68 | Ga0070710_10000218 | 3300005437 | Bacteria | 26778 |
| 69 | Ga0070710_10026373 | 3300005437 | Bacteria | 3086 |
| 70 | Ga0070710_10043894 | 3300005437 | Bacteria | 2478 |
| 71 | Ga0070710_10049761 | 3300005437 | Bacteria | 2345 |
| 72 | Ga0070710_10084656 | 3300005437 | Bacteria | 1858 |
| 73 | Ga0070710_10099489 | 3300005437 | Bacteria | 1729 |
| 74 | Ga0070710_10278556 | 3300005437 | Bacteria | 1084 |
| 75 | Ga0070710_10294392 | 3300005437 | Bacteria | 1057 |
| 76 | Ga0070710_10325408 | 3300005437 | Bacteria | 1010 |
| 77 | Ga0070710_10511471 | 3300005437 | Bacteria | 824 |
| 78 | Ga0070710_11008735 | 3300005437 | Bacteria | 607 |
| 79 | Ga0070701_10073219 | 3300005438 | Bacteria | 1837 |
| 80 | Ga0070711_100043962 | 3300005439 | Bacteria | 3029 |
| 81 | Ga0070711_100139861 | 3300005439 | Bacteria | 1814 |
| 82 | Ga0070711_100319795 | 3300005439 | Bacteria | 1239 |
| 83 | Ga0070711_100629776 | 3300005439 | Bacteria | 897 |
| 84 | Ga0070705_100085548 | 3300005440 | Bacteria | 1949 |
| 85 | Ga0070705_100134147 | 3300005440 | Bacteria | 1619 |
| 86 | Ga0070705_100761545 | 3300005440 | Bacteria | 766 |
| 87 | Ga0070708_100038950 | 3300005445 | Bacteria | 4157 |
| 88 | Ga0070708_100141416 | 3300005445 | Bacteria | 2232 |
| 89 | Ga0070708_100470073 | 3300005445 | Bacteria | 1186 |
| 90 | Ga0070708_100520054 | 3300005445 | Bacteria | 1122 |
| 91 | Ga0070708_100791130 | 3300005445 | Bacteria | 892 |
| 92 | Ga0070708_100842242 | 3300005445 | Bacteria | 862 |
| 93 | Ga0070663_100224380 | 3300005455 | Bacteria | 1476 |
| 94 | Ga0070663_100441960 | 3300005455 | Bacteria | 1070 |
| 95 | Ga0070678_100070412 | 3300005456 | Bacteria | 2614 |
| 96 | Ga0070678_100150114 | 3300005456 | Bacteria | 1876 |
| 97 | Ga0070662_100091588 | 3300005457 | Bacteria | 2284 |
| 98 | Ga0070681_10148159 | 3300005458 | Bacteria | 2274 |
| 99 | Ga0070681_10381700 | 3300005458 | Bacteria | 1320 |
| 100 | Ga0070681_11086708 | 3300005458 | Unclassified | 721 |
| 101 | Ga0068867_100173855 | 3300005459 | Bacteria | 1708 |
| 102 | Ga0070706_100001339 | 3300005467 | Bacteria | 26189 |
| 103 | Ga0070706_100003066 | 3300005467 | Bacteria | 16547 |
| 104 | Ga0070706_100003951 | 3300005467 | Bacteria | 14437 |
| 105 | Ga0070706_100011013 | 3300005467 | Bacteria | 8398 |
| 106 | Ga0070706_100020290 | 3300005467 | Bacteria | 6125 |
| 107 | Ga0070706_100092042 | 3300005467 | Bacteria | 2813 |
| 108 | Ga0070706_100230597 | 3300005467 | Bacteria | 1728 |
| 109 | Ga0070706_100311049 | 3300005467 | Bacteria | 1470 |
| 110 | Ga0070706_100320556 | 3300005467 | Bacteria | 1445 |
| 111 | Ga0070706_100342712 | 3300005467 | Bacteria | 1393 |
| 112 | Ga0070706_101167113 | 3300005467 | Bacteria | 708 |
| 113 | Ga0070707_100001503 | 3300005468 | Bacteria | 22738 |
| 114 | Ga0070707_100002309 | 3300005468 | Bacteria | 18227 |
| 115 | Ga0070707_100049280 | 3300005468 | Bacteria | 4037 |
| 116 | Ga0070707_100051048 | 3300005468 | Bacteria | 3964 |
| 117 | Ga0070707_100098856 | 3300005468 | Bacteria | 2827 |
| 118 | Ga0070707_100392986 | 3300005468 | Bacteria | 1347 |
| 119 | Ga0070707_100555568 | 3300005468 | Bacteria | 1110 |
| 120 | Ga0070707_100637878 | 3300005468 | Bacteria | 1028 |
| 121 | Ga0070707_100694760 | 3300005468 | Bacteria | 980 |
| 122 | Ga0070707_100763163 | 3300005468 | Bacteria | 930 |
| 123 | Ga0070698_100000546 | 3300005471 | Bacteria | 40175 |
| 124 | Ga0070698_100000665 | 3300005471 | Bacteria | 36678 |
| 125 | Ga0070698_100005898 | 3300005471 | Bacteria | 13363 |
| 126 | Ga0070698_100026037 | 3300005471 | Bacteria | 6092 |
| 127 | Ga0070698_100042199 | 3300005471 | Bacteria | 4679 |
| 128 | Ga0070698_100318507 | 3300005471 | Bacteria | 1486 |
| 129 | Ga0070698_100882412 | 3300005471 | Bacteria | 840 |
| 130 | Ga0070699_100010962 | 3300005518 | Bacteria | 7838 |
| 131 | Ga0070699_100321904 | 3300005518 | Bacteria | 1390 |
| 132 | Ga0070699_101701285 | 3300005518 | Bacteria | 578 |
| 133 | Ga0070679_100104922 | 3300005530 | Bacteria | 2812 |
| 134 | Ga0070679_101690239 | 3300005530 | Unclassified | 581 |
| 135 | Ga0070684_100266179 | 3300005535 | Bacteria | 1568 |
| 136 | Ga0070684_100339750 | 3300005535 | Bacteria | 1380 |
| 137 | Ga0070684_100802935 | 3300005535 | Bacteria | 880 |
| 138 | Ga0070697_100037989 | 3300005536 | Bacteria | 3889 |
| 139 | Ga0070697_100085732 | 3300005536 | Bacteria | 2599 |
| 140 | Ga0068853_100104187 | 3300005539 | Bacteria | 2511 |
| 141 | Ga0070672_100458414 | 3300005543 | Bacteria | 1099 |
| 142 | Ga0070686_100030161 | 3300005544 | Bacteria | 3305 |
| 143 | Ga0070696_100255956 | 3300005546 | Bacteria | 1326 |
| 144 | Ga0070665_100231408 | 3300005548 | Bacteria | 1848 |
| 145 | Ga0070665_100535172 | 3300005548 | Bacteria | 1183 |
| 146 | Ga0070704_100123917 | 3300005549 | Bacteria | 1990 |
| 147 | Ga0068855_100164436 | 3300005563 | Bacteria | 2516 |
| 148 | Ga0070664_100078162 | 3300005564 | Bacteria | 2846 |
| 149 | Ga0070664_101066061 | 3300005564 | Bacteria | 760 |
| 150 | Ga0068857_100041418 | 3300005577 | Bacteria | 4084 |
| 151 | Ga0068857_100532833 | 3300005577 | Bacteria | 1105 |
| 152 | Ga0068856_100008941 | 3300005614 | Bacteria | 9743 |
| 153 | Ga0068856_100081996 | 3300005614 | Bacteria | 3200 |
| 154 | Ga0068856_100810969 | 3300005614 | Bacteria | 955 |
| 155 | Ga0070702_100075402 | 3300005615 | Bacteria | 2004 |
| 156 | Ga0070702_100456884 | 3300005615 | Bacteria | 928 |
| 157 | Ga0068852_100934634 | 3300005616 | Bacteria | 885 |
| 158 | Ga0068864_100197116 | 3300005618 | Bacteria | 1848 |
| 159 | Ga0068864_100411271 | 3300005618 | Bacteria | 1287 |
| 160 | Ga0068866_10137407 | 3300005718 | Bacteria | 1398 |
| 161 | Ga0068861_100260870 | 3300005719 | Bacteria | 1483 |
| 162 | Ga0068863_100064425 | 3300005841 | Bacteria | 3466 |
| 163 | Ga0068863_100265685 | 3300005841 | Bacteria | 1660 |
| 164 | Ga0068858_101468641 | 3300005842 | Bacteria | 672 |
| 165 | Ga0081540_1000345 | 3300005983 | Bacteria | 46912 |
| 166 | Ga0081540_1002862 | 3300005983 | Bacteria | 13954 |
| 167 | Ga0070717_10001611 | 3300006028 | Bacteria | 15618 |
| 168 | Ga0070717_10045967 | 3300006028 | Bacteria | 3571 |
| 169 | Ga0070717_10097050 | 3300006028 | Bacteria | 2497 |
| 170 | Ga0070717_10099155 | 3300006028 | Bacteria | 2471 |
| 171 | Ga0070717_10133015 | 3300006028 | Bacteria | 2140 |
| 172 | Ga0070717_10153160 | 3300006028 | Bacteria | 1996 |
| 173 | Ga0070717_10243900 | 3300006028 | Bacteria | 1585 |
| 174 | Ga0070717_10320531 | 3300006028 | Bacteria | 1381 |
| 175 | Ga0070717_10323441 | 3300006028 | Bacteria | 1374 |
| 176 | Ga0070717_10337377 | 3300006028 | Bacteria | 1345 |
| 177 | Ga0070717_10517372 | 3300006028 | Bacteria | 1079 |
| 178 | Ga0070717_10519169 | 3300006028 | Bacteria | 1077 |
| 179 | Ga0070717_10621238 | 3300006028 | Bacteria | 980 |
| 180 | Ga0070717_11378659 | 3300006028 | Bacteria | 640 |
| 181 | Ga0070715_10001165 | 3300006163 | Bacteria | 7542 |
| 182 | Ga0070715_10016810 | 3300006163 | Bacteria | 2757 |
| 183 | Ga0070715_10085671 | 3300006163 | Bacteria | 1439 |
| 184 | Ga0070716_100000108 | 3300006173 | Bacteria | 32360 |
| 185 | Ga0070716_100001275 | 3300006173 | Bacteria | 11109 |
| 186 | Ga0070716_100004463 | 3300006173 | Bacteria | 6689 |
| 187 | Ga0070716_100016224 | 3300006173 | Bacteria | 3839 |
| 188 | Ga0070716_100024749 | 3300006173 | Bacteria | 3198 |
| 189 | Ga0070716_100276055 | 3300006173 | Bacteria | 1157 |
| 190 | Ga0070716_100491260 | 3300006173 | Bacteria | 903 |
| 191 | Ga0070716_100570682 | 3300006173 | Bacteria | 847 |
| 192 | Ga0070712_100000686 | 3300006175 | Bacteria | 19993 |
| 193 | Ga0070712_100003387 | 3300006175 | Bacteria | 9805 |
| 194 | Ga0070712_100007538 | 3300006175 | Bacteria | 6802 |
| 195 | Ga0070712_100030461 | 3300006175 | Bacteria | 3625 |
| 196 | Ga0070712_100043680 | 3300006175 | Bacteria | 3086 |
| 197 | Ga0070712_100083295 | 3300006175 | Bacteria | 2322 |
| 198 | Ga0070712_100182981 | 3300006175 | Bacteria | 1634 |
| 199 | Ga0070712_100253315 | 3300006175 | Bacteria | 1408 |
| 200 | Ga0070712_100298903 | 3300006175 | Bacteria | 1302 |
| 201 | Ga0070712_100420574 | 3300006175 | Bacteria | 1107 |
| 202 | Ga0070712_100566534 | 3300006175 | Bacteria | 958 |
| 203 | Ga0070712_100710598 | 3300006175 | Bacteria | 857 |
| 204 | Ga0070712_100747826 | 3300006175 | Bacteria | 836 |
| 205 | Ga0070712_100842040 | 3300006175 | Bacteria | 788 |
| 206 | Ga0070712_100909025 | 3300006175 | Bacteria | 759 |
| 207 | Ga0070712_101202135 | 3300006175 | Bacteria | 659 |
| 208 | Ga0070712_101250169 | 3300006175 | Bacteria | 646 |
| 209 | Ga0097621_100063674 | 3300006237 | Bacteria | 3031 |
| 210 | Ga0075433_10042000 | 3300006852 | Bacteria | 3965 |
| 211 | Ga0075433_10153362 | 3300006852 | Bacteria | 2049 |
| 212 | Ga0075433_10321934 | 3300006852 | Bacteria | 1368 |
| 213 | Ga0075434_100018311 | 3300006871 | Bacteria | 6764 |
| 214 | Ga0075434_100021691 | 3300006871 | Bacteria | 6246 |
| 215 | Ga0075434_100056332 | 3300006871 | Bacteria | 3906 |
| 216 | Ga0075434_100693747 | 3300006871 | Bacteria | 1036 |
| 217 | Ga0068865_100079207 | 3300006881 | Bacteria | 2353 |
| 218 | Ga0075436_100068189 | 3300006914 | Bacteria | 2458 |
| 219 | Ga0075436_100147320 | 3300006914 | Bacteria | 1655 |
| 220 | Ga0075436_100214019 | 3300006914 | Bacteria | 1367 |
| 221 | Ga0075436_100307763 | 3300006914 | Bacteria | 1136 |
| 222 | Ga0075436_100358679 | 3300006914 | Bacteria | 1051 |
| 223 | Ga0075435_100013330 | 3300007076 | Bacteria | 6111 |
| 224 | Ga0075435_100033580 | 3300007076 | Bacteria | 4058 |
| 225 | Ga0075435_100185638 | 3300007076 | Bacteria | 1758 |
| 226 | Ga0099794_10025796 | 3300007265 | Bacteria | 2711 |
| 227 | Ga0099794_10153458 | 3300007265 | Bacteria | 1169 |
| 228 | Ga0099795_10065815 | 3300007788 | Bacteria | 1356 |
| 229 | Ga0105251_10024110 | 3300009011 | Bacteria | 3127 |
| 230 | Ga0105250_10263711 | 3300009092 | Bacteria | 738 |
| 231 | Ga0105240_10275493 | 3300009093 | Bacteria | 1935 |
| 232 | Ga0111539_10037919 | 3300009094 | Bacteria | 5815 |
| 233 | Ga0105247_10101372 | 3300009101 | Bacteria | 1841 |
| 234 | Ga0114129_10008379 | 3300009147 | Bacteria | 14730 |
| 235 | Ga0114129_10279459 | 3300009147 | Bacteria | 2231 |
| 236 | Ga0105241_10154259 | 3300009174 | Bacteria | 1882 |
| 237 | Ga0105242_10074221 | 3300009176 | Bacteria | 2830 |
| 238 | Ga0105248_10493613 | 3300009177 | Bacteria | 1380 |
| 239 | Ga0105237_10987780 | 3300009545 | Bacteria | 849 |
| 240 | Ga0105238_10245644 | 3300009551 | Bacteria | 1767 |
| 241 | Ga0105238_10282092 | 3300009551 | Bacteria | 1642 |
| 242 | Ga0099796_10036400 | 3300010159 | Bacteria | 1639 |
| 243 | Ga0099796_10167333 | 3300010159 | Bacteria | 875 |
| 244 | Ga0105246_10098480 | 3300011119 | Bacteria | 2124 |
| 245 | Ga0157329_1000987 | 3300012491 | Bacteria | 1332 |
| 246 | Ga0157341_1001858 | 3300012494 | Bacteria | 1329 |
| 247 | Ga0157315_1003551 | 3300012508 | Bacteria | 1059 |
| 248 | Ga0157338_1003156 | 3300012515 | Bacteria | 1347 |
| 249 | Ga0154012_171739 | 3300013059 | Bacteria | 1039 |
| 250 | Ga0157373_10149527 | 3300013100 | Bacteria | 1643 |
| 251 | Ga0157371_10022428 | 3300013102 | Bacteria | 4626 |
| 252 | Ga0157370_10432552 | 3300013104 | Bacteria | 1210 |
| 253 | Ga0157369_10431851 | 3300013105 | Bacteria | 1365 |
| 254 | Ga0157369_11132908 | 3300013105 | Bacteria | 799 |
| 255 | Ga0157374_10298902 | 3300013296 | Bacteria | 1592 |
| 256 | Ga0157374_10664203 | 3300013296 | Bacteria | 1054 |
| 257 | Ga0157374_11314565 | 3300013296 | Bacteria | 745 |
| 258 | Ga0157372_11870916 | 3300013307 | Bacteria | 690 |
| 259 | Ga0157375_10143340 | 3300013308 | Bacteria | 2518 |
| 260 | Ga0163163_10748687 | 3300014325 | Bacteria | 1040 |
| 261 | Ga0157380_10130229 | 3300014326 | Bacteria | 2145 |
| 262 | Ga0157379_10164260 | 3300014968 | Bacteria | 2004 |
| 263 | Ga0157376_11050093 | 3300014969 | Bacteria | 839 |
| 264 | Ga0157376_12845313 | 3300014969 | Bacteria | 524 |
| 265 | Ga0163161_10132536 | 3300017792 | Bacteria | 1881 |
| 266 | Ga0184596_100859 | 3300019176 | Bacteria | 1107 |
| 267 | Ga0197907_10094249 | 3300020069 | Bacteria | 1079 |
| 268 | Ga0197907_10330890 | 3300020069 | Bacteria | 1099 |
| 269 | Ga0197907_10856800 | 3300020069 | Bacteria | 630 |
| 270 | Ga0206356_10087393 | 3300020070 | Bacteria | 1216 |
| 271 | Ga0206356_10126861 | 3300020070 | Bacteria | 961 |
| 272 | Ga0206356_10418263 | 3300020070 | Bacteria | 1038 |
| 273 | Ga0206349_1383630 | 3300020075 | Bacteria | 676 |
| 274 | Ga0206349_1475694 | 3300020075 | Bacteria | 946 |
| 275 | Ga0206349_1940810 | 3300020075 | Bacteria | 848 |
| 276 | Ga0206355_1227789 | 3300020076 | Bacteria | 1199 |
| 277 | Ga0206352_10009035 | 3300020078 | Bacteria | 694 |
| 278 | Ga0206352_10622047 | 3300020078 | Bacteria | 1132 |
| 279 | Ga0206350_10153199 | 3300020080 | Bacteria | 955 |
| 280 | Ga0206350_10191192 | 3300020080 | Bacteria | 1155 |
| 281 | Ga0206354_10444123 | 3300020081 | Bacteria | 1244 |
| 282 | Ga0206354_10534952 | 3300020081 | Bacteria | 1567 |
| 283 | Ga0206354_10765260 | 3300020081 | Bacteria | 1250 |
| 284 | Ga0206353_10666110 | 3300020082 | Bacteria | 859 |
| 285 | Ga0206353_10731065 | 3300020082 | Unclassified | 682 |
| 286 | Ga0206353_11517539 | 3300020082 | Bacteria | 1087 |
| 287 | Ga0206353_11921151 | 3300020082 | Bacteria | 1081 |
| 288 | Ga0154015_1425898 | 3300020610 | Bacteria | 992 |
| 289 | Ga0213873_10161504 | 3300021358 | Bacteria | 679 |
| 290 | Ga0213875_10000363 | 3300021388 | Bacteria | 42235 |
| 291 | Ga0213875_10108273 | 3300021388 | Bacteria | 1297 |
| 292 | Ga0224712_10010529 | 3300022467 | Bacteria | 2832 |
| 293 | Ga0224712_10133398 | 3300022467 | Bacteria | 1086 |
| 294 | Ga0224712_10294026 | 3300022467 | Bacteria | 758 |
| 295 | Ga0224712_10300870 | 3300022467 | Bacteria | 750 |
| 296 | Ga0224712_10385772 | 3300022467 | Unclassified | 666 |
| 297 | Ga0247528_106423 | 3300023680 | Bacteria | 929 |
| 298 | Ga0224572_1023820 | 3300024225 | Bacteria | 1176 |
| 299 | Ga0207656_10166207 | 3300025321 | Bacteria | 1052 |
| 300 | Ga0207653_10012809 | 3300025885 | Bacteria | 2622 |
| 301 | Ga0207692_10000147 | 3300025898 | Bacteria | 21958 |
| 302 | Ga0207692_10005038 | 3300025898 | Bacteria | 5262 |
| 303 | Ga0207692_10022809 | 3300025898 | Bacteria | 2886 |
| 304 | Ga0207692_10023512 | 3300025898 | Bacteria | 2851 |
| 305 | Ga0207692_10055962 | 3300025898 | Bacteria | 2022 |
| 306 | Ga0207692_10111604 | 3300025898 | Bacteria | 1517 |
| 307 | Ga0207692_10163826 | 3300025898 | Bacteria | 1283 |
| 308 | Ga0207692_10178991 | 3300025898 | Bacteria | 1234 |
| 309 | Ga0207692_10243710 | 3300025898 | Bacteria | 1074 |
| 310 | Ga0207642_10018159 | 3300025899 | Bacteria | 2693 |
| 311 | Ga0207710_10053403 | 3300025900 | Bacteria | 1818 |
| 312 | Ga0207688_10062564 | 3300025901 | Bacteria | 2098 |
| 313 | Ga0207647_10037539 | 3300025904 | Bacteria | 3071 |
| 314 | Ga0207647_10238194 | 3300025904 | Bacteria | 1045 |
| 315 | Ga0207685_10007363 | 3300025905 | Bacteria | 3063 |
| 316 | Ga0207685_10096340 | 3300025905 | Bacteria | 1257 |
| 317 | Ga0207699_10000291 | 3300025906 | Bacteria | 27048 |
| 318 | Ga0207699_10003997 | 3300025906 | Bacteria | 7056 |
| 319 | Ga0207699_10005864 | 3300025906 | Bacteria | 5910 |
| 320 | Ga0207699_10057636 | 3300025906 | Bacteria | 2320 |
| 321 | Ga0207699_10085697 | 3300025906 | Bacteria | 1965 |
| 322 | Ga0207699_10144157 | 3300025906 | Bacteria | 1568 |
| 323 | Ga0207699_10145888 | 3300025906 | Bacteria | 1560 |
| 324 | Ga0207699_10199061 | 3300025906 | Bacteria | 1356 |
| 325 | Ga0207699_10371758 | 3300025906 | Bacteria | 1013 |
| 326 | Ga0207645_10210798 | 3300025907 | Bacteria | 1280 |
| 327 | Ga0207643_10012094 | 3300025908 | Bacteria | 4663 |
| 328 | Ga0207705_10191336 | 3300025909 | Bacteria | 1547 |
| 329 | Ga0207684_10000323 | 3300025910 | Bacteria | 67693 |
| 330 | Ga0207684_10003999 | 3300025910 | Bacteria | 14104 |
| 331 | Ga0207684_10019980 | 3300025910 | Bacteria | 5723 |
| 332 | Ga0207684_10020435 | 3300025910 | Bacteria | 5657 |
| 333 | Ga0207684_10025297 | 3300025910 | Bacteria | 5058 |
| 334 | Ga0207684_10100554 | 3300025910 | Bacteria | 2471 |
| 335 | Ga0207684_10290158 | 3300025910 | Bacteria | 1411 |
| 336 | Ga0207654_10140334 | 3300025911 | Bacteria | 1540 |
| 337 | Ga0207654_10416163 | 3300025911 | Bacteria | 937 |
| 338 | Ga0207707_10001352 | 3300025912 | Bacteria | 22855 |
| 339 | Ga0207707_10129156 | 3300025912 | Bacteria | 2210 |
| 340 | Ga0207707_10217601 | 3300025912 | Bacteria | 1663 |
| 341 | Ga0207707_10385518 | 3300025912 | Bacteria | 1204 |
| 342 | Ga0207693_10003946 | 3300025915 | Bacteria | 12610 |
| 343 | Ga0207693_10009037 | 3300025915 | Bacteria | 8133 |
| 344 | Ga0207693_10025346 | 3300025915 | Bacteria | 4703 |
| 345 | Ga0207693_10136892 | 3300025915 | Bacteria | 1926 |
| 346 | Ga0207693_10171076 | 3300025915 | Bacteria | 1711 |
| 347 | Ga0207693_10210364 | 3300025915 | Bacteria | 1529 |
| 348 | Ga0207693_10213112 | 3300025915 | Bacteria | 1518 |
| 349 | Ga0207693_10464740 | 3300025915 | Bacteria | 988 |
| 350 | Ga0207693_10584641 | 3300025915 | Bacteria | 870 |
| 351 | Ga0207693_10799546 | 3300025915 | Bacteria | 727 |
| 352 | Ga0207663_10032294 | 3300025916 | Bacteria | 3106 |
| 353 | Ga0207663_10037969 | 3300025916 | Bacteria | 2907 |
| 354 | Ga0207663_10038329 | 3300025916 | Bacteria | 2896 |
| 355 | Ga0207663_10040069 | 3300025916 | Bacteria | 2844 |
| 356 | Ga0207663_10111458 | 3300025916 | Bacteria | 1857 |
| 357 | Ga0207663_10183244 | 3300025916 | Bacteria | 1497 |
| 358 | Ga0207663_10196750 | 3300025916 | Bacteria | 1451 |
| 359 | Ga0207663_10259957 | 3300025916 | Bacteria | 1281 |
| 360 | Ga0207663_10271298 | 3300025916 | Bacteria | 1257 |
| 361 | Ga0207660_10166316 | 3300025917 | Bacteria | 1705 |
| 362 | Ga0207662_10010759 | 3300025918 | Bacteria | 5058 |
| 363 | Ga0207657_10014600 | 3300025919 | Bacteria | 7655 |
| 364 | Ga0207657_10046061 | 3300025919 | Bacteria | 3821 |
| 365 | Ga0207649_10313302 | 3300025920 | Bacteria | 1151 |
| 366 | Ga0207652_10827156 | 3300025921 | Unclassified | 821 |
| 367 | Ga0207652_11393918 | 3300025921 | Unclassified | 604 |
| 368 | Ga0207646_10000050 | 3300025922 | Bacteria | 171554 |
| 369 | Ga0207646_10005341 | 3300025922 | Bacteria | 13534 |
| 370 | Ga0207646_10009312 | 3300025922 | Bacteria | 9713 |
| 371 | Ga0207646_10010964 | 3300025922 | Bacteria | 8799 |
| 372 | Ga0207646_10049754 | 3300025922 | Bacteria | 3753 |
| 373 | Ga0207646_10245815 | 3300025922 | Bacteria | 1616 |
| 374 | Ga0207646_10460672 | 3300025922 | Bacteria | 1147 |
| 375 | Ga0207687_11464673 | 3300025927 | Unclassified | 587 |
| 376 | Ga0207700_10000216 | 3300025928 | Bacteria | 34369 |
| 377 | Ga0207700_10009909 | 3300025928 | Bacteria | 5980 |
| 378 | Ga0207700_10014818 | 3300025928 | Bacteria | 5120 |
| 379 | Ga0207700_10021282 | 3300025928 | Bacteria | 4425 |
| 380 | Ga0207700_10049581 | 3300025928 | Bacteria | 3124 |
| 381 | Ga0207700_10059951 | 3300025928 | Bacteria | 2880 |
| 382 | Ga0207700_10128357 | 3300025928 | Bacteria | 2066 |
| 383 | Ga0207700_10129475 | 3300025928 | Bacteria | 2058 |
| 384 | Ga0207700_10131899 | 3300025928 | Bacteria | 2041 |
| 385 | Ga0207700_10187336 | 3300025928 | Bacteria | 1737 |
| 386 | Ga0207700_10282417 | 3300025928 | Bacteria | 1428 |
| 387 | Ga0207700_10294442 | 3300025928 | Bacteria | 1400 |
| 388 | Ga0207700_10556096 | 3300025928 | Bacteria | 1019 |
| 389 | Ga0207700_11010361 | 3300025928 | Bacteria | 744 |
| 390 | Ga0207700_11545537 | 3300025928 | Bacteria | 588 |
| 391 | Ga0207664_10000379 | 3300025929 | Bacteria | 32303 |
| 392 | Ga0207664_10002673 | 3300025929 | Bacteria | 11825 |
| 393 | Ga0207664_10004775 | 3300025929 | Bacteria | 9211 |
| 394 | Ga0207664_10011886 | 3300025929 | Bacteria | 6211 |
| 395 | Ga0207664_10019743 | 3300025929 | Bacteria | 4988 |
| 396 | Ga0207664_10020810 | 3300025929 | Bacteria | 4868 |
| 397 | Ga0207664_10021804 | 3300025929 | Bacteria | 4773 |
| 398 | Ga0207664_10031128 | 3300025929 | Bacteria | 4079 |
| 399 | Ga0207664_10054930 | 3300025929 | Bacteria | 3158 |
| 400 | Ga0207664_10098379 | 3300025929 | Bacteria | 2412 |
| 401 | Ga0207664_10111576 | 3300025929 | Bacteria | 2275 |
| 402 | Ga0207664_10209663 | 3300025929 | Bacteria | 1685 |
| 403 | Ga0207664_10254304 | 3300025929 | Bacteria | 1534 |
| 404 | Ga0207664_10277737 | 3300025929 | Bacteria | 1469 |
| 405 | Ga0207664_10391758 | 3300025929 | Bacteria | 1234 |
| 406 | Ga0207664_10411769 | 3300025929 | Bacteria | 1203 |
| 407 | Ga0207664_10529653 | 3300025929 | Bacteria | 1056 |
| 408 | Ga0207664_10559757 | 3300025929 | Bacteria | 1026 |
| 409 | Ga0207664_11475265 | 3300025929 | Unclassified | 602 |
| 410 | Ga0207644_10176509 | 3300025931 | Bacteria | 1672 |
| 411 | Ga0207644_10499891 | 3300025931 | Bacteria | 1003 |
| 412 | Ga0207644_10520164 | 3300025931 | Bacteria | 983 |
| 413 | Ga0207690_10085785 | 3300025932 | Bacteria | 2211 |
| 414 | Ga0207706_10007021 | 3300025933 | Bacteria | 10410 |
| 415 | Ga0207665_10000785 | 3300025939 | Bacteria | 21393 |
| 416 | Ga0207665_10001106 | 3300025939 | Bacteria | 18140 |
| 417 | Ga0207665_10005661 | 3300025939 | Bacteria | 8323 |
| 418 | Ga0207665_10008399 | 3300025939 | Bacteria | 6812 |
| 419 | Ga0207665_10018898 | 3300025939 | Bacteria | 4528 |
| 420 | Ga0207665_10350041 | 3300025939 | Bacteria | 1115 |
| 421 | Ga0207665_10541641 | 3300025939 | Bacteria | 903 |
| 422 | Ga0207691_10064364 | 3300025940 | Bacteria | 3322 |
| 423 | Ga0207689_10129846 | 3300025942 | Bacteria | 2074 |
| 424 | Ga0207661_10059815 | 3300025944 | Bacteria | 3072 |
| 425 | Ga0207661_10220843 | 3300025944 | Bacteria | 1675 |
| 426 | Ga0207661_10295746 | 3300025944 | Unclassified | 1450 |
| 427 | Ga0207679_10117036 | 3300025945 | Bacteria | 2114 |
| 428 | Ga0207651_10465055 | 3300025960 | Bacteria | 1087 |
| 429 | Ga0207712_10164479 | 3300025961 | Bacteria | 1728 |
| 430 | Ga0207668_10385891 | 3300025972 | Bacteria | 1180 |
| 431 | Ga0207640_10119910 | 3300025981 | Bacteria | 1882 |
| 432 | Ga0207640_10371390 | 3300025981 | Bacteria | 1156 |
| 433 | Ga0207658_10047012 | 3300025986 | Bacteria | 3156 |
| 434 | Ga0207677_10556318 | 3300026023 | Bacteria | 1001 |
| 435 | Ga0207703_10646367 | 3300026035 | Bacteria | 1003 |
| 436 | Ga0207703_10896662 | 3300026035 | Bacteria | 849 |
| 437 | Ga0207639_10307058 | 3300026041 | Bacteria | 1404 |
| 438 | Ga0207639_10486186 | 3300026041 | Bacteria | 1126 |
| 439 | Ga0207678_10066516 | 3300026067 | Bacteria | 3095 |
| 440 | Ga0207678_10122511 | 3300026067 | Bacteria | 2219 |
| 441 | Ga0207678_10274302 | 3300026067 | Bacteria | 1447 |
| 442 | Ga0207708_10097339 | 3300026075 | Bacteria | 2274 |
| 443 | Ga0207702_10055808 | 3300026078 | Bacteria | 3351 |
| 444 | Ga0207702_10096073 | 3300026078 | Bacteria | 2605 |
| 445 | Ga0207702_10142508 | 3300026078 | Bacteria | 2170 |
| 446 | Ga0207641_10098295 | 3300026088 | Bacteria | 2574 |
| 447 | Ga0207641_10164144 | 3300026088 | Bacteria | 2021 |
| 448 | Ga0207641_12168406 | 3300026088 | Bacteria | 556 |
| 449 | Ga0207676_10464554 | 3300026095 | Bacteria | 1196 |
| 450 | Ga0207676_10823454 | 3300026095 | Bacteria | 907 |
| 451 | Ga0207674_10105189 | 3300026116 | Bacteria | 2801 |
| 452 | Ga0207674_10228847 | 3300026116 | Bacteria | 1807 |
| 453 | Ga0207674_10697502 | 3300026116 | Bacteria | 980 |
| 454 | Ga0207675_100010739 | 3300026118 | Bacteria | 8579 |
| 455 | Ga0207683_10047963 | 3300026121 | Bacteria | 3740 |
| 456 | Ga0207683_10141883 | 3300026121 | Bacteria | 2165 |
| 457 | Ga0207698_12010292 | 3300026142 | Bacteria | 592 |
| 458 | Ga0268264_10213603 | 3300028381 | Bacteria | 1772 |
| 459 | Ga0265337_1002783 | 3300028556 | Bacteria | 7836 |
| 460 | Ga0265326_10004145 | 3300028558 | Bacteria | 4675 |
| 461 | Ga0265319_1008471 | 3300028563 | Bacteria | 4503 |
| 462 | Ga0265334_10000618 | 3300028573 | Bacteria | 17860 |
| 463 | Ga0265318_10008064 | 3300028577 | Bacteria | 4711 |
| 464 | Ga0265322_10012266 | 3300028654 | Bacteria | 2478 |
| 465 | Ga0265336_10011453 | 3300028666 | Bacteria | 3015 |
| 466 | Ga0265338_10001346 | 3300028800 | Bacteria | 40029 |
| 467 | Ga0265338_10004892 | 3300028800 | Bacteria | 17842 |
| 468 | Ga0265338_10006911 | 3300028800 | Bacteria | 14280 |
| 469 | Ga0265338_10050905 | 3300028800 | Bacteria | 3737 |
| 470 | Ga0265338_10322327 | 3300028800 | Bacteria | 1118 |
| 471 | Ga0265324_10008253 | 3300029957 | Bacteria | 4149 |
| 472 | Ga0265769_101534 | 3300030888 | Bacteria | 1120 |
| 473 | Ga0265768_101823 | 3300030963 | Bacteria | 1039 |
| 474 | Ga0265330_10036834 | 3300031235 | Bacteria | 2179 |
| 475 | Ga0265332_10000905 | 3300031238 | Bacteria | 17790 |
| 476 | Ga0265328_10241079 | 3300031239 | Bacteria | 691 |
| 477 | Ga0265320_10011279 | 3300031240 | Bacteria | 5265 |
| 478 | Ga0265320_10078344 | 3300031240 | Bacteria | 1546 |
| 479 | Ga0265325_10004585 | 3300031241 | Bacteria | 8685 |
| 480 | Ga0265325_10181945 | 3300031241 | Bacteria | 978 |
| 481 | Ga0265329_10062314 | 3300031242 | Bacteria | 1181 |
| 482 | Ga0265340_10004914 | 3300031247 | Bacteria | 7434 |
| 483 | Ga0265339_10014972 | 3300031249 | Bacteria | 4662 |
| 484 | Ga0265339_10045905 | 3300031249 | Bacteria | 2403 |
| 485 | Ga0265316_10022565 | 3300031344 | Bacteria | 5302 |
| 486 | Ga0265316_10540194 | 3300031344 | Bacteria | 830 |
| 487 | Ga0265313_10042257 | 3300031595 | Bacteria | 2240 |
| 488 | Ga0265313_10154659 | 3300031595 | Bacteria | 977 |
| 489 | Ga0307508_10447104 | 3300031616 | Bacteria | 885 |
| 490 | Ga0310108_118602 | 3300031633 | Bacteria | 657 |
| 491 | Ga0310101_109030 | 3300031690 | Bacteria | 1154 |
| 492 | Ga0265314_10015366 | 3300031711 | Bacteria | 6078 |
| 493 | Ga0265314_10019718 | 3300031711 | Bacteria | 5216 |
| 494 | Ga0265342_10016032 | 3300031712 | Bacteria | 4908 |
| 495 | Ga0265342_10131296 | 3300031712 | Bacteria | 1403 |
| 496 | Ga0316212_1004821 | 3300033547 | Bacteria | 1958 |
| 497 | Ga0373930_0004163 | 3300034816 | Bacteria | 2340 |
| 498 | Ga0373948_0001671 | 3300034817 | Bacteria | 3135 |
| 499 | Ga0373938_0085554 | 3300034957 | Bacteria | 773 |
| 500 | Ga0373926_0004416 | 3300035083 | Bacteria | 4612 |
| 501 | Ga0373926_0010520 | 3300035083 | Bacteria | 3102 |
| 502 | Ga0373928_0013307 | 3300035084 | Bacteria | 1651 |
| 503 | Ga0373928_0051135 | 3300035084 | Bacteria | 976 |
| 504 | Ga0373929_0021923 | 3300035085 | Bacteria | 1300 |
| 505 | Ga0373934_0000032 | 3300035086 | Bacteria | 44940 |
| 506 | Ga0373934_0004079 | 3300035086 | Bacteria | 5383 |
| 507 | Ga0373934_0004937 | 3300035086 | Bacteria | 4939 |
| 508 | Ga0373934_0009173 | 3300035086 | Bacteria | 3703 |
| 509 | Ga0373934_0049378 | 3300035086 | Bacteria | 1666 |
| 510 | Ga0373934_0429403 | 3300035086 | Bacteria | 553 |
| 511 | Ga0373940_0069054 | 3300035088 | Bacteria | 1025 |
| 512 | Ga0373944_0012091 | 3300035089 | Bacteria | 2374 |
| 513 | Ga0373944_0016653 | 3300035089 | Bacteria | 2076 |
| 514 | Ga0373949_0021004 | 3300035090 | Bacteria | 1498 |
| 515 | Ga0373949_0021772 | 3300035090 | Bacteria | 1474 |
| 516 | Ga0373951_0017198 | 3300035091 | Bacteria | 1635 |
| 517 | Ga0373923_0000472 | 3300035111 | Bacteria | 9588 |
| 518 | Ga0373923_0008843 | 3300035111 | Bacteria | 3612 |
| 519 | Ga0373923_0013796 | 3300035111 | Bacteria | 3019 |
| 520 | Ga0373923_0105969 | 3300035111 | Bacteria | 1244 |
| 521 | Ga0373923_0161999 | 3300035111 | Bacteria | 1021 |
| 522 | Ga0373932_0013806 | 3300035112 | Bacteria | 2018 |
| 523 | Ga0373936_0001930 | 3300035113 | Bacteria | 7666 |
| 524 | Ga0373936_0006056 | 3300035113 | Bacteria | 4558 |
| 525 | Ga0373936_0356643 | 3300035113 | Bacteria | 666 |
| 526 | Ga0373939_0025178 | 3300035114 | Bacteria | 1665 |
| 527 | Ga0373945_0000693 | 3300035116 | Bacteria | 9746 |
| 528 | Ga0373945_0003551 | 3300035116 | Bacteria | 4909 |
| 529 | Ga0373945_0120835 | 3300035116 | Bacteria | 1041 |
| 530 | Ga0373945_0186966 | 3300035116 | Bacteria | 855 |
| 531 | Ga0373945_0216534 | 3300035116 | Bacteria | 800 |
| 532 | Ga0373953_0000145 | 3300035117 | Bacteria | 18034 |
| 533 | Ga0373953_0002637 | 3300035117 | Bacteria | 5431 |
| 534 | Ga0373953_0009915 | 3300035117 | Bacteria | 3299 |
| 535 | Ga0373953_0033681 | 3300035117 | Bacteria | 2004 |
| 536 | Ga0373953_0045499 | 3300035117 | Bacteria | 1759 |
| 537 | Ga0373953_0124333 | 3300035117 | Bacteria | 1097 |
| 538 | Ga0373953_0144631 | 3300035117 | Bacteria | 1018 |
| 539 | Ga0373954_0004824 | 3300035118 | Bacteria | 5814 |
| 540 | Ga0373954_0011407 | 3300035118 | Bacteria | 3938 |
| 541 | Ga0373954_0020285 | 3300035118 | Bacteria | 3005 |
| 542 | Ga0373956_0000096 | 3300035119 | Bacteria | 29760 |
| 543 | Ga0373956_0014918 | 3300035119 | Bacteria | 3249 |
| 544 | Ga0373956_0034894 | 3300035119 | Bacteria | 2216 |
| 545 | Ga0373957_0000565 | 3300035120 | Bacteria | 9401 |
| 546 | Ga0373957_0003369 | 3300035120 | Bacteria | 4713 |
| 547 | Ga0373957_0005890 | 3300035120 | Bacteria | 3829 |
| 548 | Ga0373957_0013296 | 3300035120 | Bacteria | 2790 |
| 549 | Ga0373957_0036898 | 3300035120 | Bacteria | 1823 |
| 550 | Ga0373960_0025527 | 3300035121 | Bacteria | 1607 |
| 551 | Ga0373960_0035890 | 3300035121 | Bacteria | 1409 |
| 552 | Ga0373943_0000869 | 3300035170 | Bacteria | 13282 |
| 553 | Ga0373943_0222164 | 3300035170 | Bacteria | 1052 |
| 554 | Ga0373943_0292337 | 3300035170 | Bacteria | 923 |
| 555 | Ga0373943_0339857 | 3300035170 | Bacteria | 859 |
| 556 | Ga0373943_0413160 | 3300035170 | Bacteria | 780 |
| 557 | Ga0373943_0491204 | 3300035170 | Bacteria | 716 |
| 558 | Ga0373943_0497872 | 3300035170 | Unclassified | 712 |
| 559 | Ga0373943_0890847 | 3300035170 | Bacteria | 531 |
| 560 | Ga0373946_0002754 | 3300035171 | Bacteria | 6216 |
| 561 | Ga0373946_0005561 | 3300035171 | Bacteria | 4547 |
| 562 | Ga0373946_0051713 | 3300035171 | Bacteria | 1720 |
| 563 | Ga0373946_0233862 | 3300035171 | Bacteria | 891 |
| 564 | Ga0373946_0405003 | 3300035171 | Bacteria | 689 |
| 565 | Ga0373955_0000015 | 3300035172 | Bacteria | 72056 |
| 566 | Ga0373955_0014041 | 3300035172 | Bacteria | 3888 |
| 567 | Ga0373955_0032656 | 3300035172 | Bacteria | 2734 |
| 568 | Ga0373955_0222087 | 3300035172 | Unclassified | 1129 |
| 569 | Ga0373955_0247308 | 3300035172 | Bacteria | 1069 |
| 570 | Ga0373955_0745712 | 3300035172 | Bacteria | 601 |
| 571 | Ga0373955_0881183 | 3300035172 | Bacteria | 550 |
| 572 | Ga0373942_0048046 | 3300035207 | Bacteria | 1188 |
| 573 | Ga0373962_0041763 | 3300035242 | Bacteria | 1294 |
| 574 | Ga0373962_0084282 | 3300035242 | Bacteria | 969 |
| 575 | Ga0373924_0003840 | 3300035410 | Bacteria | 5199 |
| 576 | Ga0373924_0015260 | 3300035410 | Bacteria | 2918 |
| 577 | Ga0373924_0018110 | 3300035410 | Bacteria | 2711 |
| 578 | Ga0373924_0063887 | 3300035410 | Bacteria | 1544 |
| 579 | Ga0373924_0157661 | 3300035410 | Bacteria | 995 |
| 580 | Ga0373924_0308401 | 3300035410 | Unclassified | 703 |
| 581 | Ga0373931_0072221 | 3300035691 | Bacteria | 1886 |
| 582 | Ga0373931_1032602 | 3300035691 | Unclassified | 557 |
| 583 | Ga0373935_0002772 | 3300035692 | Bacteria | 10079 |
| 584 | Ga0373935_0019853 | 3300035692 | Bacteria | 4101 |
| 585 | Ga0373935_0041841 | 3300035692 | Bacteria | 2880 |
| 586 | Ga0373935_0074104 | 3300035692 | Bacteria | 2200 |
| 587 | Ga0373935_0285230 | 3300035692 | Bacteria | 1163 |
| 588 | Ga0373927_0005785 | 3300035695 | Bacteria | 8484 |
| 589 | Ga0373927_0182495 | 3300035695 | Bacteria | 1376 |
| 590 | Ga0373927_0291959 | 3300035695 | Bacteria | 1073 |
| 591 | Ga0373927_0331473 | 3300035695 | Bacteria | 1002 |
| 592 | Ga0373927_0462653 | 3300035695 | Bacteria | 838 |
| 593 | Ga0373927_0869913 | 3300035695 | Bacteria | 595 |
| 594 | Ga0373933_0000004 | 3300035724 | Bacteria | 143741 |
| 595 | Ga0373933_0012151 | 3300035724 | Bacteria | 4756 |
| 596 | Ga0373933_0016458 | 3300035724 | Bacteria | 4135 |
| 597 | Ga0373933_0066301 | 3300035724 | Bacteria | 2187 |
| 598 | Ga0373933_0069093 | 3300035724 | Bacteria | 2146 |
| 599 | Ga0373933_0081570 | 3300035724 | Bacteria | 1984 |
| 600 | Ga0373933_0200322 | 3300035724 | Bacteria | 1277 |
| 601 | Ga0373947_0002525 | 3300035725 | Bacteria | 10999 |
| 602 | Ga0373947_0036414 | 3300035725 | Bacteria | 2918 |
| 603 | Ga0373947_0068140 | 3300035725 | Bacteria | 2175 |
| 604 | Ga0373947_0211250 | 3300035725 | Bacteria | 1273 |
| 605 | Ga0373947_0214627 | 3300035725 | Bacteria | 1263 |
| 606 | Ga0373947_0442814 | 3300035725 | Bacteria | 879 |
| 607 | Ga0373947_0749792 | 3300035725 | Bacteria | 666 |
| 608 | Ga0373937_0000012 | 3300036401 | Bacteria | 159418 |
| 609 | Ga0373937_0016525 | 3300036401 | Bacteria | 6555 |
| 610 | Ga0373937_0023070 | 3300036401 | Bacteria | 5599 |
| 611 | Ga0373937_0035993 | 3300036401 | Bacteria | 4509 |
| 612 | Ga0373937_0065143 | 3300036401 | Bacteria | 3353 |
| 613 | Ga0373937_0128883 | 3300036401 | Bacteria | 2362 |
| 614 | Ga0373937_0194066 | 3300036401 | Bacteria | 1908 |
| 615 | Ga0373937_0581475 | 3300036401 | Bacteria | 1063 |
| 616 | Ga0373937_1168156 | 3300036401 | Bacteria | 718 |
| 617 | Ga0372808_018230 | 3300036459 | Bacteria | 1009 |
| 618 | Ga0310109_014140 | 3300036534 | Bacteria | 1083 |
| 619 | Ga0373925_0000021 | 3300037068 | Bacteria | 162277 |
| 620 | Ga0373925_0005148 | 3300037068 | Bacteria | 9798 |
| 621 | Ga0373925_0049126 | 3300037068 | Bacteria | 3144 |
| 622 | Ga0373925_0063191 | 3300037068 | Bacteria | 2785 |
| 623 | Ga0373925_0100426 | 3300037068 | Bacteria | 2223 |
| 624 | Ga0373925_0345450 | 3300037068 | Bacteria | 1207 |
| 625 | Ga0373925_0365597 | 3300037068 | Bacteria | 1173 |
| 626 | Ga0373925_0954490 | 3300037068 | Bacteria | 706 |
| 627 | Ga0395899_0004117 | 3300037312 | Bacteria | 11452 |
| 628 | Ga0395898_0023865 | 3300037466 | Bacteria | 6174 |
| 629 | Ga0395898_1008864 | 3300037466 | Bacteria | 768 |
| 630 | Ga0436364_0136351 | 3300037853 | Bacteria | 1650 |
| 631 | Ga0436364_0866950 | 3300037853 | Bacteria | 801 |
| 632 | Ga0436364_0989727 | 3300037853 | Bacteria | 883 |
| 633 | Ga0436364_1018157 | 3300037853 | Bacteria | 78603 |
| 634 | Ga0436364_1160722 | 3300037853 | Bacteria | 1722 |
| 635 | Ga0436364_1303572 | 3300037853 | Bacteria | 3726 |
| 636 | Ga0436364_1314967 | 3300037853 | Bacteria | 702 |
| 637 | Ga0436364_1427311 | 3300037853 | Bacteria | 97691 |
| 638 | Ga0436365_1301466 | 3300039437 | Bacteria | 589 |
| 639 | Ga0436363_0158367 | 3300039450 | Bacteria | 2547 |
| 640 | Ga0436363_0276775 | 3300039450 | Bacteria | 1111 |
| 641 | Ga0436363_1335153 | 3300039450 | Bacteria | 1907 |
| 642 | Ga0436363_1525360 | 3300039450 | Bacteria | 1293 |
| 643 | Ga0436362_0069517 | 3300039453 | Bacteria | 1041 |
| 644 | Ga0436362_1023179 | 3300039453 | Bacteria | 756 |
| 645 | Ga0451789_0954289 | 3300041443 | Bacteria | 1438 |
| 646 | Ga0451793_1539502 | 3300041452 | Bacteria | 1724 |
| 647 | Ga0466966_0019698 | 3300044684 | Bacteria | 4439 |
| 648 | Ga0466961_0040225 | 3300044693 | Bacteria | 2998 |
| 649 | Ga0466961_0082735 | 3300044693 | Bacteria | 2030 |
| 650 | Ga0466963_0405621 | 3300044694 | Bacteria | 961 |
| 651 | Ga0466971_0120291 | 3300044719 | Bacteria | 1215 |
| 652 | Ga0466968_0166062 | 3300044735 | Bacteria | 1021 |
| 653 | Ga0466968_0270693 | 3300044735 | Bacteria | 811 |
| 654 | Ga0466959_0190702 | 3300045049 | Bacteria | 1431 |
| 655 | Ga0466959_0192506 | 3300045049 | Bacteria | 1423 |
| 656 | Ga0466959_0221305 | 3300045049 | Bacteria | 1313 |
| 657 | Ga0466958_0110214 | 3300045836 | Bacteria | 1718 |
| 658 | Ga0466958_0427089 | 3300045836 | Unclassified | 857 |
| 659 | Ga0466967_0239113 | 3300045976 | Bacteria | 1732 |
| 660 | Ga0466967_0512969 | 3300045976 | Bacteria | 1177 |
| 661 | Ga0466967_0784508 | 3300045976 | Bacteria | 946 |
| 662 | Ga0466967_2410919 | 3300045976 | Bacteria | 521 |
| 663 | Ga0495592_0001038 | 3300046454 | Bacteria | 19287 |
| 664 | Ga0495592_0025030 | 3300046454 | Bacteria | 4533 |
| 665 | Ga0495592_0065020 | 3300046454 | Bacteria | 2671 |
| 666 | Ga0495592_0115181 | 3300046454 | Bacteria | 1898 |
| 667 | Ga0495592_0204941 | 3300046454 | Bacteria | 1328 |
| 668 | Ga0495592_0322135 | 3300046454 | Bacteria | 998 |
| 669 | Ga0495603_0085584 | 3300046455 | Bacteria | 1845 |
| 670 | Ga0495603_0120564 | 3300046455 | Bacteria | 1528 |
| 671 | Ga0495629_0001307 | 3300046459 | Bacteria | 19594 |
| 672 | Ga0495629_0050225 | 3300046459 | Bacteria | 2921 |
| 673 | Ga0495629_0105596 | 3300046459 | Bacteria | 1964 |
| 674 | Ga0495641_0003608 | 3300046461 | Bacteria | 11461 |
| 675 | Ga0495641_0020494 | 3300046461 | Bacteria | 3351 |
| 676 | Ga0495641_0023199 | 3300046461 | Bacteria | 3088 |
| 677 | Ga0495641_0073864 | 3300046461 | Bacteria | 1529 |
| 678 | Ga0495651_0000007 | 3300046462 | Bacteria | 158577 |
| 679 | Ga0495651_0004063 | 3300046462 | Bacteria | 11179 |
| 680 | Ga0495651_0014480 | 3300046462 | Bacteria | 6095 |
| 681 | Ga0495651_0016969 | 3300046462 | Bacteria | 5639 |
| 682 | Ga0495651_0019156 | 3300046462 | Bacteria | 5302 |
| 683 | Ga0495651_0371659 | 3300046462 | Bacteria | 940 |
| 684 | Ga0495651_0378679 | 3300046462 | Bacteria | 928 |
| 685 | Ga0495651_0630536 | 3300046462 | Bacteria | 673 |
| 686 | Ga0495653_0004863 | 3300046463 | Bacteria | 10899 |
| 687 | Ga0495653_0005400 | 3300046463 | Bacteria | 10403 |
| 688 | Ga0495653_0029402 | 3300046463 | Bacteria | 4386 |
| 689 | Ga0495653_0030612 | 3300046463 | Bacteria | 4284 |
| 690 | Ga0495653_0040372 | 3300046463 | Bacteria | 3647 |
| 691 | Ga0495653_0047918 | 3300046463 | Bacteria | 3302 |
| 692 | Ga0495653_0061892 | 3300046463 | Bacteria | 2829 |
| 693 | Ga0495653_0071907 | 3300046463 | Bacteria | 2584 |
| 694 | Ga0495580_0480138 | 3300046472 | Bacteria | 831 |
| 695 | Ga0495580_0749010 | 3300046472 | Bacteria | 636 |
| 696 | Ga0495582_0001211 | 3300046473 | Bacteria | 14514 |
| 697 | Ga0495582_0005652 | 3300046473 | Bacteria | 6961 |
| 698 | Ga0495582_0161218 | 3300046473 | Bacteria | 1275 |
| 699 | Ga0495582_0270248 | 3300046473 | Bacteria | 975 |
| 700 | Ga0495639_0010409 | 3300046475 | Bacteria | 4006 |
| 701 | Ga0495662_0012967 | 3300046476 | Bacteria | 4060 |
| 702 | Ga0495662_0024097 | 3300046476 | Bacteria | 2936 |
| 703 | Ga0495662_0159693 | 3300046476 | Bacteria | 1110 |
| 704 | Ga0495662_0407590 | 3300046476 | Bacteria | 667 |
| 705 | Ga0495664_0004193 | 3300046477 | Bacteria | 7873 |
| 706 | Ga0495664_0012427 | 3300046477 | Bacteria | 4823 |
| 707 | Ga0495664_0019880 | 3300046477 | Bacteria | 3867 |
| 708 | Ga0495664_0029664 | 3300046477 | Bacteria | 3200 |
| 709 | Ga0495664_0051898 | 3300046477 | Bacteria | 2435 |
| 710 | Ga0495608_0000015 | 3300046511 | Bacteria | 200266 |
| 711 | Ga0495608_0003113 | 3300046511 | Bacteria | 11853 |
| 712 | Ga0495608_0027673 | 3300046511 | Bacteria | 3856 |
| 713 | Ga0495608_0039886 | 3300046511 | Bacteria | 3146 |
| 714 | Ga0495608_0052193 | 3300046511 | Bacteria | 2707 |
| 715 | Ga0495608_0360469 | 3300046511 | Bacteria | 893 |
| 716 | Ga0495608_0504370 | 3300046511 | Bacteria | 732 |
| 717 | Ga0495608_0916610 | 3300046511 | Unclassified | 512 |
| 718 | Ga0495618_0007498 | 3300046514 | Bacteria | 6601 |
| 719 | Ga0495618_0019010 | 3300046514 | Bacteria | 4222 |
| 720 | Ga0495618_0025441 | 3300046514 | Bacteria | 3673 |
| 721 | Ga0495618_0098542 | 3300046514 | Bacteria | 1870 |
| 722 | Ga0495618_0119274 | 3300046514 | Bacteria | 1689 |
| 723 | Ga0495618_0125980 | 3300046514 | Bacteria | 1640 |
| 724 | Ga0495618_0127174 | 3300046514 | Bacteria | 1631 |
| 725 | Ga0495618_0237778 | 3300046514 | Bacteria | 1145 |
| 726 | Ga0495628_0000737 | 3300046516 | Bacteria | 30357 |
| 727 | Ga0495628_0017665 | 3300046516 | Bacteria | 5930 |
| 728 | Ga0495628_0084215 | 3300046516 | Bacteria | 2467 |
| 729 | Ga0495628_0085998 | 3300046516 | Bacteria | 2439 |
| 730 | Ga0495628_0336945 | 3300046516 | Bacteria | 1111 |
| 731 | Ga0495630_0018483 | 3300046517 | Bacteria | 5121 |
| 732 | Ga0495630_0041563 | 3300046517 | Bacteria | 3433 |
| 733 | Ga0495630_0058292 | 3300046517 | Bacteria | 2894 |
| 734 | Ga0495630_0086488 | 3300046517 | Bacteria | 2367 |
| 735 | Ga0495630_0204619 | 3300046517 | Bacteria | 1506 |
| 736 | Ga0495630_0212093 | 3300046517 | Bacteria | 1478 |
| 737 | Ga0495666_0185939 | 3300046526 | Bacteria | 958 |
| 738 | Ga0495652_0000074 | 3300046529 | Bacteria | 105662 |
| 739 | Ga0495652_0012772 | 3300046529 | Bacteria | 7567 |
| 740 | Ga0495652_0023128 | 3300046529 | Bacteria | 5510 |
| 741 | Ga0495652_0103996 | 3300046529 | Bacteria | 2297 |
| 742 | Ga0495652_0107955 | 3300046529 | Bacteria | 2244 |
| 743 | Ga0495652_0195934 | 3300046529 | Bacteria | 1537 |
| 744 | Ga0495652_0368490 | 3300046529 | Bacteria | 1024 |
| 745 | Ga0495652_0982404 | 3300046529 | Bacteria | 553 |
| 746 | Ga0495665_0005298 | 3300046531 | Bacteria | 6951 |
| 747 | Ga0495665_0005836 | 3300046531 | Bacteria | 6644 |
| 748 | Ga0495665_0005892 | 3300046531 | Bacteria | 6599 |
| 749 | Ga0495665_0020140 | 3300046531 | Bacteria | 3584 |
| 750 | Ga0495665_0123402 | 3300046531 | Bacteria | 1356 |
| 751 | Ga0495665_0262560 | 3300046531 | Bacteria | 888 |
| 752 | Ga0495640_0008749 | 3300046533 | Bacteria | 7930 |
| 753 | Ga0495640_0028840 | 3300046533 | Bacteria | 3991 |
| 754 | Ga0495640_0105248 | 3300046533 | Bacteria | 1848 |
| 755 | Ga0495640_0209627 | 3300046533 | Bacteria | 1232 |
| 756 | Ga0495640_0456209 | 3300046533 | Bacteria | 780 |
| 757 | Ga0495586_0010989 | 3300046535 | Bacteria | 4810 |
| 758 | Ga0495586_0012705 | 3300046535 | Bacteria | 4466 |
| 759 | Ga0495586_0141080 | 3300046535 | Bacteria | 1352 |
| 760 | Ga0495587_0000085 | 3300046536 | Bacteria | 72715 |
| 761 | Ga0495587_0003258 | 3300046536 | Bacteria | 10849 |
| 762 | Ga0495587_0010139 | 3300046536 | Bacteria | 6010 |
| 763 | Ga0495587_0056265 | 3300046536 | Bacteria | 2314 |
| 764 | Ga0495587_0173421 | 3300046536 | Bacteria | 1224 |
| 765 | Ga0495645_0030868 | 3300046543 | Bacteria | 3903 |
| 766 | Ga0495645_0035606 | 3300046543 | Bacteria | 3628 |
| 767 | Ga0495645_0074422 | 3300046543 | Bacteria | 2445 |
| 768 | Ga0495645_0089644 | 3300046543 | Bacteria | 2199 |
| 769 | Ga0495645_0102970 | 3300046543 | Bacteria | 2028 |
| 770 | Ga0495645_0346412 | 3300046543 | Bacteria | 958 |
| 771 | Ga0495667_0000033 | 3300046559 | Bacteria | 143083 |
| 772 | Ga0495667_0003641 | 3300046559 | Bacteria | 10369 |
| 773 | Ga0495667_0004750 | 3300046559 | Bacteria | 9187 |
| 774 | Ga0495667_0009929 | 3300046559 | Bacteria | 6448 |
| 775 | Ga0495667_0804607 | 3300046559 | Unclassified | 579 |
| 776 | Ga0495634_0004108 | 3300046642 | Bacteria | 11528 |
| 777 | Ga0495634_0023454 | 3300046642 | Bacteria | 4337 |
| 778 | Ga0495634_0028120 | 3300046642 | Bacteria | 3905 |
| 779 | Ga0495634_0098564 | 3300046642 | Bacteria | 1891 |
| 780 | Ga0495634_0129038 | 3300046642 | Bacteria | 1613 |
| 781 | Ga0495635_0003052 | 3300046663 | Bacteria | 11507 |
| 782 | Ga0495635_0011882 | 3300046663 | Bacteria | 6103 |
| 783 | Ga0495635_0042090 | 3300046663 | Bacteria | 3155 |
| 784 | Ga0495635_0049734 | 3300046663 | Bacteria | 2889 |
| 785 | Ga0495635_0057761 | 3300046663 | Bacteria | 2669 |
| 786 | Ga0495635_0067987 | 3300046663 | Bacteria | 2443 |
| 787 | Ga0495635_0236790 | 3300046663 | Bacteria | 1232 |
| 788 | Ga0495588_0480831 | 3300046674 | Bacteria | 651 |
| 789 | Ga0495657_0001345 | 3300046675 | Bacteria | 21381 |
| 790 | Ga0495657_0004406 | 3300046675 | Bacteria | 11239 |
| 791 | Ga0495657_0007140 | 3300046675 | Bacteria | 8665 |
| 792 | Ga0495657_0024425 | 3300046675 | Bacteria | 4305 |
| 793 | Ga0495657_0027020 | 3300046675 | Bacteria | 4056 |
| 794 | Ga0495657_0058343 | 3300046675 | Bacteria | 2563 |
| 795 | Ga0495657_0106458 | 3300046675 | Bacteria | 1780 |
| 796 | Ga0495599_0000018 | 3300046678 | Bacteria | 144334 |
| 797 | Ga0495599_0005426 | 3300046678 | Bacteria | 7620 |
| 798 | Ga0495599_0016500 | 3300046678 | Bacteria | 4585 |
| 799 | Ga0495599_0030374 | 3300046678 | Bacteria | 3390 |
| 800 | Ga0495599_0088154 | 3300046678 | Bacteria | 1937 |
| 801 | Ga0495599_0139626 | 3300046678 | Bacteria | 1503 |
| 802 | Ga0495599_0205349 | 3300046678 | Bacteria | 1209 |
| 803 | Ga0495599_0281206 | 3300046678 | Bacteria | 1008 |
| 804 | Ga0495623_0000075 | 3300046679 | Bacteria | 59383 |
| 805 | Ga0495623_0009174 | 3300046679 | Bacteria | 6417 |
| 806 | Ga0495623_0027076 | 3300046679 | Bacteria | 3687 |
| 807 | Ga0495623_0155803 | 3300046679 | Bacteria | 1346 |
| 808 | Ga0495623_0169115 | 3300046679 | Bacteria | 1278 |
| 809 | Ga0495646_0005199 | 3300046680 | Bacteria | 8208 |
| 810 | Ga0495646_0025764 | 3300046680 | Bacteria | 3697 |
| 811 | Ga0495646_0037718 | 3300046680 | Bacteria | 2988 |
| 812 | Ga0495646_0061783 | 3300046680 | Bacteria | 2229 |
| 813 | Ga0495646_0074293 | 3300046680 | Bacteria | 1995 |
| 814 | Ga0495646_0115853 | 3300046680 | Bacteria | 1521 |
| 815 | Ga0495646_0159912 | 3300046680 | Unclassified | 1248 |
| 816 | Ga0495646_0281571 | 3300046680 | Bacteria | 883 |
| 817 | Ga0495646_0388313 | 3300046680 | Bacteria | 727 |
| 818 | Ga0495647_0080114 | 3300046681 | Bacteria | 1323 |
| 819 | Ga0495658_0063337 | 3300046683 | Bacteria | 2127 |
| 820 | Ga0495658_0565057 | 3300046683 | Bacteria | 728 |
| 821 | Ga0495613_0005089 | 3300046689 | Bacteria | 9851 |
| 822 | Ga0495613_0005645 | 3300046689 | Bacteria | 9385 |
| 823 | Ga0495613_0085253 | 3300046689 | Bacteria | 2292 |
| 824 | Ga0495613_0094696 | 3300046689 | Bacteria | 2160 |
| 825 | Ga0495624_0007746 | 3300046690 | Bacteria | 7533 |
| 826 | Ga0495624_0011024 | 3300046690 | Bacteria | 6222 |
| 827 | Ga0495624_0343095 | 3300046690 | Bacteria | 898 |
| 828 | Ga0495624_0460696 | 3300046690 | Bacteria | 761 |
| 829 | Ga0495600_0003461 | 3300046809 | Bacteria | 9283 |
| 830 | Ga0495600_0004210 | 3300046809 | Bacteria | 8586 |
| 831 | Ga0495600_0018634 | 3300046809 | Bacteria | 4424 |
| 832 | Ga0495600_0035402 | 3300046809 | Bacteria | 3242 |
| 833 | Ga0495600_0163115 | 3300046809 | Bacteria | 1440 |
| 834 | Ga0495581_0002245 | 3300047315 | Bacteria | 10864 |
| 835 | Ga0495581_0004730 | 3300047315 | Bacteria | 7857 |
| 836 | Ga0495581_0080075 | 3300047315 | Bacteria | 1890 |
| 837 | Ga0495581_0093271 | 3300047315 | Bacteria | 1747 |
| 838 | Ga0495581_0505669 | 3300047315 | Bacteria | 702 |
| 839 | Ga0495604_0000025 | 3300047317 | Bacteria | 145481 |
| 840 | Ga0495604_0015271 | 3300047317 | Bacteria | 6131 |
| 841 | Ga0495604_0041000 | 3300047317 | Bacteria | 3632 |
| 842 | Ga0495604_0071431 | 3300047317 | Bacteria | 2625 |
| 843 | Ga0495604_0082497 | 3300047317 | Bacteria | 2404 |
| 844 | Ga0495604_0264199 | 3300047317 | Bacteria | 1169 |
| 845 | Ga0495674_0013169 | 3300047319 | Bacteria | 7775 |
| 846 | Ga0495674_0013242 | 3300047319 | Bacteria | 7754 |
| 847 | Ga0495674_0020722 | 3300047319 | Bacteria | 6087 |
| 848 | Ga0495674_0026819 | 3300047319 | Bacteria | 5269 |
| 849 | Ga0495674_0033400 | 3300047319 | Bacteria | 4661 |
| 850 | Ga0495674_0980895 | 3300047319 | Bacteria | 648 |
| 851 | Ga0495674_1377981 | 3300047319 | Bacteria | 526 |
| 852 | Ga0495676_0023696 | 3300047321 | Bacteria | 5322 |
| 853 | Ga0495676_0070119 | 3300047321 | Bacteria | 2701 |
| 854 | Ga0495676_0253490 | 3300047321 | Bacteria | 1199 |
| 855 | Ga0495676_0474429 | 3300047321 | Bacteria | 823 |
| 856 | Ga0495676_0600715 | 3300047321 | Bacteria | 716 |
| 857 | Ga0495676_0647148 | 3300047321 | Bacteria | 686 |
| 858 | Ga0495680_0000015 | 3300047322 | Bacteria | 131335 |
| 859 | Ga0495680_0011499 | 3300047322 | Bacteria | 7829 |
| 860 | Ga0495680_0019388 | 3300047322 | Bacteria | 5740 |
| 861 | Ga0495680_0024054 | 3300047322 | Bacteria | 5057 |
| 862 | Ga0495680_0028019 | 3300047322 | Bacteria | 4621 |
| 863 | Ga0495680_0037139 | 3300047322 | Bacteria | 3904 |
| 864 | Ga0495680_0044700 | 3300047322 | Bacteria | 3501 |
| 865 | Ga0495680_0047383 | 3300047322 | Bacteria | 3381 |
| 866 | Ga0495680_0061680 | 3300047322 | Bacteria | 2883 |
| 867 | Ga0495680_0221492 | 3300047322 | Bacteria | 1350 |
| 868 | Ga0495675_0000702 | 3300047444 | Bacteria | 20920 |
| 869 | Ga0495675_0012372 | 3300047444 | Bacteria | 5371 |
| 870 | Ga0495675_0018050 | 3300047444 | Bacteria | 4473 |
| 871 | Ga0495675_0086657 | 3300047444 | Bacteria | 1968 |
| 872 | Ga0495675_0220939 | 3300047444 | Bacteria | 1147 |
| 873 | Ga0495684_0004873 | 3300047471 | Bacteria | 10469 |
| 874 | Ga0495684_0053358 | 3300047471 | Bacteria | 3084 |
| 875 | Ga0495684_0064631 | 3300047471 | Bacteria | 2781 |
| 876 | Ga0495684_0093548 | 3300047471 | Bacteria | 2276 |
| 877 | Ga0495684_0300712 | 3300047471 | Bacteria | 1152 |
| 878 | Ga0495684_0650686 | 3300047471 | Bacteria | 705 |
| 879 | Ga0495684_0825416 | 3300047471 | Bacteria | 604 |
| 880 | Ga0495593_0003014 | 3300047673 | Bacteria | 10148 |
| 881 | Ga0495593_0020518 | 3300047673 | Bacteria | 3701 |
| 882 | Ga0495593_0065145 | 3300047673 | Bacteria | 1900 |
| 883 | Ga0495593_0164734 | 3300047673 | Bacteria | 1118 |
| 884 | Ga0495593_0182618 | 3300047673 | Bacteria | 1056 |
| 885 | Ga0495602_0000065 | 3300048088 | Bacteria | 104080 |
| 886 | Ga0495602_0011079 | 3300048088 | Bacteria | 9335 |
| 887 | Ga0495602_0027529 | 3300048088 | Bacteria | 5461 |
| 888 | Ga0495602_0039997 | 3300048088 | Bacteria | 4309 |
| 889 | Ga0495602_0083248 | 3300048088 | Bacteria | 2681 |
| 890 | Ga0495602_0222104 | 3300048088 | Bacteria | 1425 |
| 891 | Ga0495602_0446462 | 3300048088 | Bacteria | 914 |
| 892 | Ga0496100_0443258 | 3300048903 | Bacteria | 994 |
| 893 | Ga0496101_0611565 | 3300048904 | Bacteria | 861 |
| 894 | Ga0496102_0051607 | 3300048905 | Bacteria | 3747 |
| 895 | Ga0496102_0451162 | 3300048905 | Bacteria | 1206 |
| 896 | Ga0496102_0913326 | 3300048905 | Bacteria | 799 |
| 897 | Ga0496103_0053998 | 3300048906 | Bacteria | 2490 |
| 898 | Ga0496103_0402367 | 3300048906 | Unclassified | 879 |
| 899 | Ga0496104_0014773 | 3300048907 | Bacteria | 7056 |
| 900 | Ga0496104_0061932 | 3300048907 | Bacteria | 3547 |
| 901 | Ga0496104_0129945 | 3300048907 | Bacteria | 2419 |
| 902 | Ga0496105_0054363 | 3300048908 | Bacteria | 3305 |
| 903 | Ga0496105_0106953 | 3300048908 | Bacteria | 2309 |
| 904 | Ga0496106_0461084 | 3300048909 | Bacteria | 1021 |
| 905 | Ga0496107_0069211 | 3300048910 | Bacteria | 2561 |
| 906 | Ga0496107_0124441 | 3300048910 | Bacteria | 1901 |
| 907 | Ga0496107_0166482 | 3300048910 | Bacteria | 1634 |
| 908 | Ga0496108_0017599 | 3300048911 | Bacteria | 5847 |
| 909 | Ga0496108_0107297 | 3300048911 | Bacteria | 2384 |
| 910 | Ga0496108_1086089 | 3300048911 | Bacteria | 680 |
| 911 | Ga0496109_0014415 | 3300048912 | Bacteria | 6878 |
| 912 | Ga0496109_0179360 | 3300048912 | Bacteria | 1989 |
| 913 | Ga0496109_0246698 | 3300048912 | Bacteria | 1681 |
| 914 | Ga0496109_0998750 | 3300048912 | Bacteria | 774 |
| 915 | Ga0496110_0062954 | 3300048913 | Bacteria | 3277 |
| 916 | Ga0496110_1469677 | 3300048913 | Unclassified | 591 |
| 917 | Ga0496111_0088933 | 3300048914 | Bacteria | 2262 |
| 918 | Ga0496111_0125687 | 3300048914 | Bacteria | 1895 |
| 919 | Ga0496111_0595163 | 3300048914 | Bacteria | 810 |
| 920 | Ga0496112_0060441 | 3300048915 | Bacteria | 3734 |
| 921 | Ga0496112_0125224 | 3300048915 | Bacteria | 2541 |
| 922 | Ga0496113_0025110 | 3300048916 | Bacteria | 4244 |
| 923 | Ga0496113_0061466 | 3300048916 | Bacteria | 2834 |
| 924 | Ga0496113_0406899 | 3300048916 | Bacteria | 1092 |
| 925 | Ga0496114_0175872 | 3300048917 | Bacteria | 1868 |
| 926 | Ga0496114_1116797 | 3300048917 | Unclassified | 673 |
| 927 | Ga0496115_0008866 | 3300048918 | Bacteria | 7455 |
| 928 | Ga0496115_0051191 | 3300048918 | Bacteria | 3311 |
| 929 | Ga0496126_0042649 | 3300048929 | Bacteria | 4189 |
| 930 | Ga0496126_0043718 | 3300048929 | Bacteria | 4130 |
| 931 | Ga0496126_0564029 | 3300048929 | Bacteria | 902 |
| 932 | Ga0501034_0721819 | 3300049571 | Bacteria | 894 |
| 933 | Ga0501037_0014884 | 3300049573 | Bacteria | 5723 |
| 934 | Ga0501037_0153419 | 3300049573 | Bacteria | 1645 |
| 935 | Ga0501038_0111223 | 3300049574 | Bacteria | 2269 |
| 936 | Ga0501039_0057382 | 3300049575 | Bacteria | 3015 |
| 937 | Ga0501042_0005377 | 3300049578 | Bacteria | 8241 |
| 938 | Ga0501042_0008967 | 3300049578 | Bacteria | 6640 |
| 939 | Ga0501043_0011292 | 3300049579 | Bacteria | 6990 |
| 940 | Ga0501047_0046138 | 3300049581 | Bacteria | 4211 |
| 941 | Ga0501047_0084672 | 3300049581 | Bacteria | 3047 |
| 942 | Ga0501070_0948602 | 3300049586 | Bacteria | 669 |
| 943 | Ga0501074_0004998 | 3300049590 | Bacteria | 9516 |
| 944 | Ga0501077_0203751 | 3300049593 | Bacteria | 1257 |
| 945 | Ga0501044_0377778 | 3300049823 | Bacteria | 1332 |
| 946 | nmdc:mga05p37_35974_c2 | 3300050507 | Bacteria | 3241 |
| 947 | nmdc:mga0n895_111117_c1 | 3300050512 | Bacteria | 2757 |
| 948 | nmdc:mga0n895_379457_c1 | 3300050512 | Bacteria | 1431 |
| 949 | nmdc:mga0rr50_1087972_c1 | 3300050513 | Bacteria | 680 |
| 950 | nmdc:mga0rr50_112665_c1 | 3300050513 | Bacteria | 2155 |
| 951 | nmdc:mga0rr50_143507_c1 | 3300050513 | Bacteria | 1923 |
| 952 | nmdc:mga0rr50_255610_c1 | 3300050513 | Bacteria | 1456 |
| 953 | nmdc:mga0rr50_653046_c1 | 3300050513 | Bacteria | 898 |
| 954 | nmdc:mga0rr50_801608_c1 | 3300050513 | Bacteria | 804 |
| 955 | nmdc:mga08x19_161124_c1 | 3300050514 | Bacteria | 1524 |
| 956 | nmdc:mga08x19_293683_c1 | 3300050514 | Bacteria | 1128 |
| 957 | nmdc:mga08x19_469241_c1 | 3300050514 | Bacteria | 887 |
| 958 | nmdc:mga08x19_518876_c1 | 3300050514 | Bacteria | 842 |
| 959 | nmdc:mga08x19_59556_c1 | 3300050514 | Bacteria | 2472 |
| 960 | nmdc:mga0a205_126363_c1 | 3300050515 | Bacteria | 2457 |
| 961 | nmdc:mga0a205_194452_c1 | 3300050515 | Bacteria | 1920 |
| 962 | Ga0495601_0069529 | 3300053077 | Bacteria | 2246 |
| 963 | Ga0495601_0098757 | 3300053077 | Bacteria | 1884 |
| 964 | Ga0495601_0148954 | 3300053077 | Bacteria | 1527 |
| 965 | Ga0495601_0152021 | 3300053077 | Bacteria | 1511 |
| 966 | Ga0495601_0350914 | 3300053077 | Bacteria | 959 |
| 967 | Ga0495612_0003458 | 3300053078 | Bacteria | 6545 |
| 968 | Ga0495612_0007651 | 3300053078 | Bacteria | 4413 |
| 969 | Ga0495612_0008570 | 3300053078 | Bacteria | 4147 |
| 970 | Ga0495612_0044484 | 3300053078 | Bacteria | 1817 |
| 971 | Ga0495612_0085043 | 3300053078 | Bacteria | 1333 |
| 972 | Ga0495612_0086713 | 3300053078 | Bacteria | 1320 |
| 973 | Ga0495655_0232021 | 3300053083 | Unclassified | 615 |
| 974 | Ga0495595_0001179 | 3300053084 | Bacteria | 10154 |
| 975 | Ga0495595_0007432 | 3300053084 | Bacteria | 4486 |
| 976 | Ga0495595_0009129 | 3300053084 | Bacteria | 4096 |
| 977 | Ga0495595_0010655 | 3300053084 | Bacteria | 3827 |
| 978 | Ga0495595_0028051 | 3300053084 | Bacteria | 2512 |
| 979 | Ga0495619_0010762 | 3300053085 | Bacteria | 5756 |
| 980 | Ga0495619_0027610 | 3300053085 | Bacteria | 3657 |
| 981 | Ga0495619_0042518 | 3300053085 | Bacteria | 2976 |
| 982 | Ga0495619_0050933 | 3300053085 | Bacteria | 2735 |
| 983 | Ga0495619_0236489 | 3300053085 | Bacteria | 1266 |
| 984 | Ga0495619_0452760 | 3300053085 | Bacteria | 885 |
| 985 | Ga0495619_0710119 | 3300053085 | Bacteria | 683 |
| 986 | Ga0590075_038196 | 3300059424 | Bacteria | 1225 |
| 987 | Ga0587073_0150374 | 3300059492 | Bacteria | 658 |
| 988 | Ga0587077_049332 | 3300059493 | Bacteria | 875 |
| 989 | Ga0587088_023521 | 3300059508 | Bacteria | 1048 |
| 990 | Ga0587091_011184 | 3300059511 | Bacteria | 1394 |
| 991 | Ga0587092_016024 | 3300059512 | Bacteria | 1105 |
| 992 | Ga0587113_004762 | 3300059625 | Bacteria | 1094 |
| 993 | Ga0587115_008978 | 3300059626 | Bacteria | 1217 |
| 994 | Ga0587122_004286 | 3300059628 | Bacteria | 1146 |
| 995 | Ga0587069_014528 | 3300059642 | Bacteria | 1099 |
| 996 | Ga0587107_054003 | 3300059652 | Unclassified | 690 |
| 997 | 2676495095 | 2675903060 | Bacteria | 10051191 |
| 998 | 2856747335 | 2856741275 | Bacteria | 8096094 |
| 999 | 2873314959 | 2873314349 | Bacteria | 8512634 |
| 1000 | 2884694262 | 2884693830 | Bacteria | 11273186 |
| 1001 | 2891402545 | 2891395885 | Bacteria | 9251614 |
| 1002 | 2891554879 | 2891554331 | Bacteria | 8812224 |
| 1003 | 2891562812 | 2891562705 | Bacteria | 8039471 |
| 1004 | 2895435681 | 2895427314 | Bacteria | 13147766 |
| 1005 | 2895444702 | 2895442618 | Bacteria | 11027144 |
| 1006 | 3003006229 | 3002998708 | Bacteria | 11715108 |
| 1007 | 8053951850 | 8053945823 | Bacteria | 8962862 |
| 1008 | 8055072615 | 8055066027 | Bacteria | 9479577 |
| 1009 | 8055175750 | 8055172936 | Bacteria | 9305943 |
| 1010 | 8056060534 | 8056060235 | Bacteria | 7259403 |
| 1011 | Ga0213875_10001160 | |||
| 1012 | JGI25404J52841_10003762 | |||
| 1013 | Ga0070658_10284147 | |||
| 1014 | Ga0070683_100154698 | |||
| 1015 | Ga0070683_100710506 | |||
| 1016 | Ga0070690_100094826 | |||
| 1017 | Ga0070670_100812426 | |||
| 1018 | Ga0068869_100307235 | |||
| 1019 | Ga0070680_100196932 | |||
| 1020 | Ga0070682_100216137 | |||
| 1021 | Ga0070682_100357397 | |||
| 1022 | Ga0068868_100600223 | |||
| 1023 | Ga0068868_100719615 | |||
| 1024 | Ga0070660_100099506 | |||
| 1025 | Ga0070689_100207991 | |||
| 1026 | Ga0070689_100722283 | |||
| 1027 | Ga0070691_10076430 | |||
| 1028 | Ga0070661_100224898 | |||
| 1029 | Ga0070661_100276960 | |||
| 1030 | Ga0070692_10292496 | |||
| 1031 | Ga0070668_100144901 | |||
| 1032 | Ga0070669_100223061 | |||
| 1033 | Ga0070671_100119704 | |||
| 1034 | Ga0070671_100438242 | |||
| 1035 | Ga0070671_100479365 | |||
| 1036 | Ga0070673_100113602 | |||
| 1037 | Ga0070688_100363395 | |||
| 1038 | Ga0070659_100202729 | |||
| 1039 | Ga0070667_100456397 | |||
| 1040 | Ga0070703_10006853 | |||
| 1041 | Ga0070709_10000478 | |||
| 1042 | Ga0070709_10021259 | |||
| 1043 | Ga0070709_10071599 | |||
| 1044 | Ga0070709_10083502 | |||
| 1045 | Ga0070709_10164330 | |||
| 1046 | Ga0070709_10614025 | |||
| 1047 | Ga0070709_10718634 | |||
| 1048 | Ga0070709_11585718 | |||
| 1049 | Ga0070714_100002062 | |||
| 1050 | Ga0070714_100007589 | |||
| 1051 | Ga0070714_100016536 | |||
| 1052 | Ga0070714_100109366 | |||
| 1053 | Ga0070714_100112050 | |||
| 1054 | Ga0070714_100185883 | |||
| 1055 | Ga0070714_100220589 | |||
| 1056 | Ga0070714_100228724 | |||
| 1057 | Ga0070714_100277013 | |||
| 1058 | Ga0070714_100378322 | |||
| 1059 | Ga0070714_100423584 | |||
| 1060 | Ga0070714_100640804 | |||
| 1061 | Ga0070714_100652102 | |||
| 1062 | Ga0070714_101344698 | |||
| 1063 | Ga0070713_100010874 | |||
| 1064 | Ga0070713_100016958 | |||
| 1065 | Ga0070713_100126314 | |||
| 1066 | Ga0070713_100141140 | |||
| 1067 | Ga0070713_100228817 | |||
| 1068 | Ga0070713_100241708 | |||
| 1069 | Ga0070713_100259696 | |||
| 1070 | Ga0070713_100272128 | |||
| 1071 | Ga0070713_100283152 | |||
| 1072 | Ga0070713_100353127 | |||
| 1073 | Ga0070713_100594909 | |||
| 1074 | Ga0070713_100741177 | |||
| 1075 | Ga0070713_100804043 | |||
| 1076 | Ga0070713_100948755 | |||
| 1077 | Ga0070713_101241646 | |||
| 1078 | Ga0070710_10000218 | |||
| 1079 | Ga0070710_10026373 | |||
| 1080 | Ga0070710_10043894 | |||
| 1081 | Ga0070710_10049761 | |||
| 1082 | Ga0070710_10084656 | |||
| 1083 | Ga0070710_10099489 | |||
| 1084 | Ga0070710_10278556 | |||
| 1085 | Ga0070710_10294392 | |||
| 1086 | Ga0070710_10325408 | |||
| 1087 | Ga0070710_10511471 | |||
| 1088 | Ga0070710_11008735 | |||
| 1089 | Ga0070701_10073219 | |||
| 1090 | Ga0070711_100043962 | |||
| 1091 | Ga0070711_100139861 | |||
| 1092 | Ga0070711_100319795 | |||
| 1093 | Ga0070711_100629776 | |||
| 1094 | Ga0070705_100085548 | |||
| 1095 | Ga0070705_100134147 | |||
| 1096 | Ga0070705_100761545 | |||
| 1097 | Ga0070708_100038950 | |||
| 1098 | Ga0070708_100141416 | |||
| 1099 | Ga0070708_100470073 | |||
| 1100 | Ga0070708_100520054 | |||
| 1101 | Ga0070708_100791130 | |||
| 1102 | Ga0070708_100842242 | |||
| 1103 | Ga0070663_100224380 | |||
| 1104 | Ga0070663_100441960 | |||
| 1105 | Ga0070678_100070412 | |||
| 1106 | Ga0070678_100150114 | |||
| 1107 | Ga0070662_100091588 | |||
| 1108 | Ga0070681_10148159 | |||
| 1109 | Ga0070681_10381700 | |||
| 1110 | Ga0070681_11086708 | |||
| 1111 | Ga0068867_100173855 | |||
| 1112 | Ga0070706_100001339 | |||
| 1113 | Ga0070706_100003066 | |||
| 1114 | Ga0070706_100003951 | |||
| 1115 | Ga0070706_100011013 | |||
| 1116 | Ga0070706_100020290 | |||
| 1117 | Ga0070706_100092042 | |||
| 1118 | Ga0070706_100230597 | |||
| 1119 | Ga0070706_100311049 | |||
| 1120 | Ga0070706_100320556 | |||
| 1121 | Ga0070706_100342712 | |||
| 1122 | Ga0070706_101167113 | |||
| 1123 | Ga0070707_100001503 | |||
| 1124 | Ga0070707_100002309 | |||
| 1125 | Ga0070707_100049280 | |||
| 1126 | Ga0070707_100051048 | |||
| 1127 | Ga0070707_100098856 | |||
| 1128 | Ga0070707_100392986 | |||
| 1129 | Ga0070707_100555568 | |||
| 1130 | Ga0070707_100637878 | |||
| 1131 | Ga0070707_100694760 | |||
| 1132 | Ga0070707_100763163 | |||
| 1133 | Ga0070698_100000546 | |||
| 1134 | Ga0070698_100000665 | |||
| 1135 | Ga0070698_100005898 | |||
| 1136 | Ga0070698_100026037 | |||
| 1137 | Ga0070698_100042199 | |||
| 1138 | Ga0070698_100318507 | |||
| 1139 | Ga0070698_100882412 | |||
| 1140 | Ga0070699_100010962 | |||
| 1141 | Ga0070699_100321904 | |||
| 1142 | Ga0070699_101701285 | |||
| 1143 | Ga0070679_100104922 | |||
| 1144 | Ga0070679_101690239 | |||
| 1145 | Ga0070684_100266179 | |||
| 1146 | Ga0070684_100339750 | |||
| 1147 | Ga0070684_100802935 | |||
| 1148 | Ga0070697_100037989 | |||
| 1149 | Ga0070697_100085732 | |||
| 1150 | Ga0068853_100104187 | |||
| 1151 | Ga0070672_100458414 | |||
| 1152 | Ga0070686_100030161 | |||
| 1153 | Ga0070696_100255956 | |||
| 1154 | Ga0070665_100231408 | |||
| 1155 | Ga0070665_100535172 | |||
| 1156 | Ga0070704_100123917 | |||
| 1157 | Ga0068855_100164436 | |||
| 1158 | Ga0070664_100078162 | |||
| 1159 | Ga0070664_101066061 | |||
| 1160 | Ga0068857_100041418 | |||
| 1161 | Ga0068857_100532833 | |||
| 1162 | Ga0068856_100008941 | |||
| 1163 | Ga0068856_100081996 | |||
| 1164 | Ga0068856_100810969 | |||
| 1165 | Ga0070702_100075402 | |||
| 1166 | Ga0070702_100456884 | |||
| 1167 | Ga0068852_100934634 | |||
| 1168 | Ga0068864_100197116 | |||
| 1169 | Ga0068864_100411271 | |||
| 1170 | Ga0068866_10137407 | |||
| 1171 | Ga0068861_100260870 | |||
| 1172 | Ga0068863_100064425 | |||
| 1173 | Ga0068863_100265685 | |||
| 1174 | Ga0068858_101468641 | |||
| 1175 | Ga0081540_1000345 | |||
| 1176 | Ga0081540_1002862 | |||
| 1177 | Ga0070717_10001611 | |||
| 1178 | Ga0070717_10045967 | |||
| 1179 | Ga0070717_10097050 | |||
| 1180 | Ga0070717_10099155 | |||
| 1181 | Ga0070717_10133015 | |||
| 1182 | Ga0070717_10153160 | |||
| 1183 | Ga0070717_10243900 | |||
| 1184 | Ga0070717_10320531 | |||
| 1185 | Ga0070717_10323441 | |||
| 1186 | Ga0070717_10337377 | |||
| 1187 | Ga0070717_10517372 | |||
| 1188 | Ga0070717_10519169 | |||
| 1189 | Ga0070717_10621238 | |||
| 1190 | Ga0070717_11378659 | |||
| 1191 | Ga0070715_10001165 | |||
| 1192 | Ga0070715_10016810 | |||
| 1193 | Ga0070715_10085671 | |||
| 1194 | Ga0070716_100000108 | |||
| 1195 | Ga0070716_100001275 | |||
| 1196 | Ga0070716_100004463 | |||
| 1197 | Ga0070716_100016224 | |||
| 1198 | Ga0070716_100024749 | |||
| 1199 | Ga0070716_100276055 | |||
| 1200 | Ga0070716_100491260 | |||
| 1201 | Ga0070716_100570682 | |||
| 1202 | Ga0070712_100000686 | |||
| 1203 | Ga0070712_100003387 | |||
| 1204 | Ga0070712_100007538 | |||
| 1205 | Ga0070712_100030461 | |||
| 1206 | Ga0070712_100043680 | |||
| 1207 | Ga0070712_100083295 | |||
| 1208 | Ga0070712_100182981 | |||
| 1209 | Ga0070712_100253315 | |||
| 1210 | Ga0070712_100298903 | |||
| 1211 | Ga0070712_100420574 | |||
| 1212 | Ga0070712_100566534 | |||
| 1213 | Ga0070712_100710598 | |||
| 1214 | Ga0070712_100747826 | |||
| 1215 | Ga0070712_100842040 | |||
| 1216 | Ga0070712_100909025 | |||
| 1217 | Ga0070712_101202135 | |||
| 1218 | Ga0070712_101250169 | |||
| 1219 | Ga0097621_100063674 | |||
| 1220 | Ga0075433_10042000 | |||
| 1221 | Ga0075433_10153362 | |||
| 1222 | Ga0075433_10321934 | |||
| 1223 | Ga0075434_100018311 | |||
| 1224 | Ga0075434_100021691 | |||
| 1225 | Ga0075434_100056332 | |||
| 1226 | Ga0075434_100693747 | |||
| 1227 | Ga0068865_100079207 | |||
| 1228 | Ga0075436_100068189 | |||
| 1229 | Ga0075436_100147320 | |||
| 1230 | Ga0075436_100214019 | |||
| 1231 | Ga0075436_100307763 | |||
| 1232 | Ga0075436_100358679 | |||
| 1233 | Ga0075435_100013330 | |||
| 1234 | Ga0075435_100033580 | |||
| 1235 | Ga0075435_100185638 | |||
| 1236 | Ga0099794_10025796 | |||
| 1237 | Ga0099794_10153458 | |||
| 1238 | Ga0099795_10065815 | |||
| 1239 | Ga0105251_10024110 | |||
| 1240 | Ga0105250_10263711 | |||
| 1241 | Ga0105240_10275493 | |||
| 1242 | Ga0111539_10037919 | |||
| 1243 | Ga0105247_10101372 | |||
| 1244 | Ga0114129_10008379 | |||
| 1245 | Ga0114129_10279459 | |||
| 1246 | Ga0105241_10154259 | |||
| 1247 | Ga0105242_10074221 | |||
| 1248 | Ga0105248_10493613 | |||
| 1249 | Ga0105237_10987780 | |||
| 1250 | Ga0105238_10245644 | |||
| 1251 | Ga0105238_10282092 | |||
| 1252 | Ga0099796_10036400 | |||
| 1253 | Ga0099796_10167333 | |||
| 1254 | Ga0105246_10098480 | |||
| 1255 | Ga0157329_1000987 | |||
| 1256 | Ga0157341_1001858 | |||
| 1257 | Ga0157315_1003551 | |||
| 1258 | Ga0157338_1003156 | |||
| 1259 | Ga0154012_171739 | |||
| 1260 | Ga0157373_10149527 | |||
| 1261 | Ga0157371_10022428 | |||
| 1262 | Ga0157370_10432552 | |||
| 1263 | Ga0157369_10431851 | |||
| 1264 | Ga0157369_11132908 | |||
| 1265 | Ga0157374_10298902 | |||
| 1266 | Ga0157374_10664203 | |||
| 1267 | Ga0157374_11314565 | |||
| 1268 | Ga0157372_11870916 | |||
| 1269 | Ga0157375_10143340 | |||
| 1270 | Ga0163163_10748687 | |||
| 1271 | Ga0157380_10130229 | |||
| 1272 | Ga0157379_10164260 | |||
| 1273 | Ga0157376_11050093 | |||
| 1274 | Ga0157376_12845313 | |||
| 1275 | Ga0163161_10132536 | |||
| 1276 | Ga0184596_100859 | |||
| 1277 | Ga0197907_10094249 | |||
| 1278 | Ga0197907_10330890 | |||
| 1279 | Ga0197907_10856800 | |||
| 1280 | Ga0206356_10087393 | |||
| 1281 | Ga0206356_10126861 | |||
| 1282 | Ga0206356_10418263 | |||
| 1283 | Ga0206349_1383630 | |||
| 1284 | Ga0206349_1475694 | |||
| 1285 | Ga0206349_1940810 | |||
| 1286 | Ga0206355_1227789 | |||
| 1287 | Ga0206352_10009035 | |||
| 1288 | Ga0206352_10622047 | |||
| 1289 | Ga0206350_10153199 | |||
| 1290 | Ga0206350_10191192 | |||
| 1291 | Ga0206354_10444123 | |||
| 1292 | Ga0206354_10534952 | |||
| 1293 | Ga0206354_10765260 | |||
| 1294 | Ga0206353_10666110 | |||
| 1295 | Ga0206353_10731065 | |||
| 1296 | Ga0206353_11517539 | |||
| 1297 | Ga0206353_11921151 | |||
| 1298 | Ga0154015_1425898 | |||
| 1299 | Ga0213873_10161504 | |||
| 1300 | Ga0213875_10000363 | |||
| 1301 | Ga0213875_10108273 | |||
| 1302 | Ga0224712_10010529 | |||
| 1303 | Ga0224712_10133398 | |||
| 1304 | Ga0224712_10294026 | |||
| 1305 | Ga0224712_10300870 | |||
| 1306 | Ga0224712_10385772 | |||
| 1307 | Ga0247528_106423 | |||
| 1308 | Ga0224572_1023820 | |||
| 1309 | Ga0207656_10166207 | |||
| 1310 | Ga0207653_10012809 | |||
| 1311 | Ga0207692_10000147 | |||
| 1312 | Ga0207692_10005038 | |||
| 1313 | Ga0207692_10022809 | |||
| 1314 | Ga0207692_10023512 | |||
| 1315 | Ga0207692_10055962 | |||
| 1316 | Ga0207692_10111604 | |||
| 1317 | Ga0207692_10163826 | |||
| 1318 | Ga0207692_10178991 | |||
| 1319 | Ga0207692_10243710 | |||
| 1320 | Ga0207642_10018159 | |||
| 1321 | Ga0207710_10053403 | |||
| 1322 | Ga0207688_10062564 | |||
| 1323 | Ga0207647_10037539 | |||
| 1324 | Ga0207647_10238194 | |||
| 1325 | Ga0207685_10007363 | |||
| 1326 | Ga0207685_10096340 | |||
| 1327 | Ga0207699_10000291 | |||
| 1328 | Ga0207699_10003997 | |||
| 1329 | Ga0207699_10005864 | |||
| 1330 | Ga0207699_10057636 | |||
| 1331 | Ga0207699_10085697 | |||
| 1332 | Ga0207699_10144157 | |||
| 1333 | Ga0207699_10145888 | |||
| 1334 | Ga0207699_10199061 | |||
| 1335 | Ga0207699_10371758 | |||
| 1336 | Ga0207645_10210798 | |||
| 1337 | Ga0207643_10012094 | |||
| 1338 | Ga0207705_10191336 | |||
| 1339 | Ga0207684_10000323 | |||
| 1340 | Ga0207684_10003999 | |||
| 1341 | Ga0207684_10019980 | |||
| 1342 | Ga0207684_10020435 | |||
| 1343 | Ga0207684_10025297 | |||
| 1344 | Ga0207684_10100554 | |||
| 1345 | Ga0207684_10290158 | |||
| 1346 | Ga0207654_10140334 | |||
| 1347 | Ga0207654_10416163 | |||
| 1348 | Ga0207707_10001352 | |||
| 1349 | Ga0207707_10129156 | |||
| 1350 | Ga0207707_10217601 | |||
| 1351 | Ga0207707_10385518 | |||
| 1352 | Ga0207693_10003946 | |||
| 1353 | Ga0207693_10009037 | |||
| 1354 | Ga0207693_10025346 | |||
| 1355 | Ga0207693_10136892 | |||
| 1356 | Ga0207693_10171076 | |||
| 1357 | Ga0207693_10210364 | |||
| 1358 | Ga0207693_10213112 | |||
| 1359 | Ga0207693_10464740 | |||
| 1360 | Ga0207693_10584641 | |||
| 1361 | Ga0207693_10799546 | |||
| 1362 | Ga0207663_10032294 | |||
| 1363 | Ga0207663_10037969 | |||
| 1364 | Ga0207663_10038329 | |||
| 1365 | Ga0207663_10040069 | |||
| 1366 | Ga0207663_10111458 | |||
| 1367 | Ga0207663_10183244 | |||
| 1368 | Ga0207663_10196750 | |||
| 1369 | Ga0207663_10259957 | |||
| 1370 | Ga0207663_10271298 | |||
| 1371 | Ga0207660_10166316 | |||
| 1372 | Ga0207662_10010759 | |||
| 1373 | Ga0207657_10014600 | |||
| 1374 | Ga0207657_10046061 | |||
| 1375 | Ga0207649_10313302 | |||
| 1376 | Ga0207652_10827156 | |||
| 1377 | Ga0207652_11393918 | |||
| 1378 | Ga0207646_10000050 | |||
| 1379 | Ga0207646_10005341 | |||
| 1380 | Ga0207646_10009312 | |||
| 1381 | Ga0207646_10010964 | |||
| 1382 | Ga0207646_10049754 | |||
| 1383 | Ga0207646_10245815 | |||
| 1384 | Ga0207646_10460672 | |||
| 1385 | Ga0207687_11464673 | |||
| 1386 | Ga0207700_10000216 | |||
| 1387 | Ga0207700_10009909 | |||
| 1388 | Ga0207700_10014818 | |||
| 1389 | Ga0207700_10021282 | |||
| 1390 | Ga0207700_10049581 | |||
| 1391 | Ga0207700_10059951 | |||
| 1392 | Ga0207700_10128357 | |||
| 1393 | Ga0207700_10129475 | |||
| 1394 | Ga0207700_10131899 | |||
| 1395 | Ga0207700_10187336 | |||
| 1396 | Ga0207700_10282417 | |||
| 1397 | Ga0207700_10294442 | |||
| 1398 | Ga0207700_10556096 | |||
| 1399 | Ga0207700_11010361 | |||
| 1400 | Ga0207700_11545537 | |||
| 1401 | Ga0207664_10000379 | |||
| 1402 | Ga0207664_10002673 | |||
| 1403 | Ga0207664_10004775 | |||
| 1404 | Ga0207664_10011886 | |||
| 1405 | Ga0207664_10019743 | |||
| 1406 | Ga0207664_10020810 | |||
| 1407 | Ga0207664_10021804 | |||
| 1408 | Ga0207664_10031128 | |||
| 1409 | Ga0207664_10054930 | |||
| 1410 | Ga0207664_10098379 | |||
| 1411 | Ga0207664_10111576 | |||
| 1412 | Ga0207664_10209663 | |||
| 1413 | Ga0207664_10254304 | |||
| 1414 | Ga0207664_10277737 | |||
| 1415 | Ga0207664_10391758 | |||
| 1416 | Ga0207664_10411769 | |||
| 1417 | Ga0207664_10529653 | |||
| 1418 | Ga0207664_10559757 | |||
| 1419 | Ga0207664_11475265 | |||
| 1420 | Ga0207644_10176509 | |||
| 1421 | Ga0207644_10499891 | |||
| 1422 | Ga0207644_10520164 | |||
| 1423 | Ga0207690_10085785 | |||
| 1424 | Ga0207706_10007021 | |||
| 1425 | Ga0207665_10000785 | |||
| 1426 | Ga0207665_10001106 | |||
| 1427 | Ga0207665_10005661 | |||
| 1428 | Ga0207665_10008399 | |||
| 1429 | Ga0207665_10018898 | |||
| 1430 | Ga0207665_10350041 | |||
| 1431 | Ga0207665_10541641 | |||
| 1432 | Ga0207691_10064364 | |||
| 1433 | Ga0207689_10129846 | |||
| 1434 | Ga0207661_10059815 | |||
| 1435 | Ga0207661_10220843 | |||
| 1436 | Ga0207661_10295746 | |||
| 1437 | Ga0207679_10117036 | |||
| 1438 | Ga0207651_10465055 | |||
| 1439 | Ga0207712_10164479 | |||
| 1440 | Ga0207668_10385891 | |||
| 1441 | Ga0207640_10119910 | |||
| 1442 | Ga0207640_10371390 | |||
| 1443 | Ga0207658_10047012 | |||
| 1444 | Ga0207677_10556318 | |||
| 1445 | Ga0207703_10646367 | |||
| 1446 | Ga0207703_10896662 | |||
| 1447 | Ga0207639_10307058 | |||
| 1448 | Ga0207639_10486186 | |||
| 1449 | Ga0207678_10066516 | |||
| 1450 | Ga0207678_10122511 | |||
| 1451 | Ga0207678_10274302 | |||
| 1452 | Ga0207708_10097339 | |||
| 1453 | Ga0207702_10055808 | |||
| 1454 | Ga0207702_10096073 | |||
| 1455 | Ga0207702_10142508 | |||
| 1456 | Ga0207641_10098295 | |||
| 1457 | Ga0207641_10164144 | |||
| 1458 | Ga0207641_12168406 | |||
| 1459 | Ga0207676_10464554 | |||
| 1460 | Ga0207676_10823454 | |||
| 1461 | Ga0207674_10105189 | |||
| 1462 | Ga0207674_10228847 | |||
| 1463 | Ga0207674_10697502 | |||
| 1464 | Ga0207675_100010739 | |||
| 1465 | Ga0207683_10047963 | |||
| 1466 | Ga0207683_10141883 | |||
| 1467 | Ga0207698_12010292 | |||
| 1468 | Ga0268264_10213603 | |||
| 1469 | Ga0265337_1002783 | |||
| 1470 | Ga0265326_10004145 | |||
| 1471 | Ga0265319_1008471 | |||
| 1472 | Ga0265334_10000618 | |||
| 1473 | Ga0265318_10008064 | |||
| 1474 | Ga0265322_10012266 | |||
| 1475 | Ga0265336_10011453 | |||
| 1476 | Ga0265338_10001346 | |||
| 1477 | Ga0265338_10004892 | |||
| 1478 | Ga0265338_10006911 | |||
| 1479 | Ga0265338_10050905 | |||
| 1480 | Ga0265338_10322327 | |||
| 1481 | Ga0265324_10008253 | |||
| 1482 | Ga0265769_101534 | |||
| 1483 | Ga0265768_101823 | |||
| 1484 | Ga0265330_10036834 | |||
| 1485 | Ga0265332_10000905 | |||
| 1486 | Ga0265328_10241079 | |||
| 1487 | Ga0265320_10011279 | |||
| 1488 | Ga0265320_10078344 | |||
| 1489 | Ga0265325_10004585 | |||
| 1490 | Ga0265325_10181945 | |||
| 1491 | Ga0265329_10062314 | |||
| 1492 | Ga0265340_10004914 | |||
| 1493 | Ga0265339_10014972 | |||
| 1494 | Ga0265339_10045905 | |||
| 1495 | Ga0265316_10022565 | |||
| 1496 | Ga0265316_10540194 | |||
| 1497 | Ga0265313_10042257 | |||
| 1498 | Ga0265313_10154659 | |||
| 1499 | Ga0307508_10447104 | |||
| 1500 | Ga0310108_118602 | |||
| 1501 | Ga0310101_109030 | |||
| 1502 | Ga0265314_10015366 | |||
| 1503 | Ga0265314_10019718 | |||
| 1504 | Ga0265342_10016032 | |||
| 1505 | Ga0265342_10131296 | |||
| 1506 | Ga0316212_1004821 | |||
| 1507 | Ga0373930_0004163 | |||
| 1508 | Ga0373948_0001671 | |||
| 1509 | Ga0373938_0085554 | |||
| 1510 | Ga0373926_0004416 | |||
| 1511 | Ga0373926_0010520 | |||
| 1512 | Ga0373928_0013307 | |||
| 1513 | Ga0373928_0051135 | |||
| 1514 | Ga0373929_0021923 | |||
| 1515 | Ga0373934_0000032 | |||
| 1516 | Ga0373934_0004079 | |||
| 1517 | Ga0373934_0004937 | |||
| 1518 | Ga0373934_0009173 | |||
| 1519 | Ga0373934_0049378 | |||
| 1520 | Ga0373934_0429403 | |||
| 1521 | Ga0373940_0069054 | |||
| 1522 | Ga0373944_0012091 | |||
| 1523 | Ga0373944_0016653 | |||
| 1524 | Ga0373949_0021004 | |||
| 1525 | Ga0373949_0021772 | |||
| 1526 | Ga0373951_0017198 | |||
| 1527 | Ga0373923_0000472 | |||
| 1528 | Ga0373923_0008843 | |||
| 1529 | Ga0373923_0013796 | |||
| 1530 | Ga0373923_0105969 | |||
| 1531 | Ga0373923_0161999 | |||
| 1532 | Ga0373932_0013806 | |||
| 1533 | Ga0373936_0001930 | |||
| 1534 | Ga0373936_0006056 | |||
| 1535 | Ga0373936_0356643 | |||
| 1536 | Ga0373939_0025178 | |||
| 1537 | Ga0373945_0000693 | |||
| 1538 | Ga0373945_0003551 | |||
| 1539 | Ga0373945_0120835 | |||
| 1540 | Ga0373945_0186966 | |||
| 1541 | Ga0373945_0216534 | |||
| 1542 | Ga0373953_0000145 | |||
| 1543 | Ga0373953_0002637 | |||
| 1544 | Ga0373953_0009915 | |||
| 1545 | Ga0373953_0033681 | |||
| 1546 | Ga0373953_0045499 | |||
| 1547 | Ga0373953_0124333 | |||
| 1548 | Ga0373953_0144631 | |||
| 1549 | Ga0373954_0004824 | |||
| 1550 | Ga0373954_0011407 | |||
| 1551 | Ga0373954_0020285 | |||
| 1552 | Ga0373956_0000096 | |||
| 1553 | Ga0373956_0014918 | |||
| 1554 | Ga0373956_0034894 | |||
| 1555 | Ga0373957_0000565 | |||
| 1556 | Ga0373957_0003369 | |||
| 1557 | Ga0373957_0005890 | |||
| 1558 | Ga0373957_0013296 | |||
| 1559 | Ga0373957_0036898 | |||
| 1560 | Ga0373960_0025527 | |||
| 1561 | Ga0373960_0035890 | |||
| 1562 | Ga0373943_0000869 | |||
| 1563 | Ga0373943_0222164 | |||
| 1564 | Ga0373943_0292337 | |||
| 1565 | Ga0373943_0339857 | |||
| 1566 | Ga0373943_0413160 | |||
| 1567 | Ga0373943_0491204 | |||
| 1568 | Ga0373943_0497872 | |||
| 1569 | Ga0373943_0890847 | |||
| 1570 | Ga0373946_0002754 | |||
| 1571 | Ga0373946_0005561 | |||
| 1572 | Ga0373946_0051713 | |||
| 1573 | Ga0373946_0233862 | |||
| 1574 | Ga0373946_0405003 | |||
| 1575 | Ga0373955_0000015 | |||
| 1576 | Ga0373955_0014041 | |||
| 1577 | Ga0373955_0032656 | |||
| 1578 | Ga0373955_0222087 | |||
| 1579 | Ga0373955_0247308 | |||
| 1580 | Ga0373955_0745712 | |||
| 1581 | Ga0373955_0881183 | |||
| 1582 | Ga0373942_0048046 | |||
| 1583 | Ga0373962_0041763 | |||
| 1584 | Ga0373962_0084282 | |||
| 1585 | Ga0373924_0003840 | |||
| 1586 | Ga0373924_0015260 | |||
| 1587 | Ga0373924_0018110 | |||
| 1588 | Ga0373924_0063887 | |||
| 1589 | Ga0373924_0157661 | |||
| 1590 | Ga0373924_0308401 | |||
| 1591 | Ga0373931_0072221 | |||
| 1592 | Ga0373931_1032602 | |||
| 1593 | Ga0373935_0002772 | |||
| 1594 | Ga0373935_0019853 | |||
| 1595 | Ga0373935_0041841 | |||
| 1596 | Ga0373935_0074104 | |||
| 1597 | Ga0373935_0285230 | |||
| 1598 | Ga0373927_0005785 | |||
| 1599 | Ga0373927_0182495 | |||
| 1600 | Ga0373927_0291959 | |||
| 1601 | Ga0373927_0331473 | |||
| 1602 | Ga0373927_0462653 | |||
| 1603 | Ga0373927_0869913 | |||
| 1604 | Ga0373933_0000004 | |||
| 1605 | Ga0373933_0012151 | |||
| 1606 | Ga0373933_0016458 | |||
| 1607 | Ga0373933_0066301 | |||
| 1608 | Ga0373933_0069093 | |||
| 1609 | Ga0373933_0081570 | |||
| 1610 | Ga0373933_0200322 | |||
| 1611 | Ga0373947_0002525 | |||
| 1612 | Ga0373947_0036414 | |||
| 1613 | Ga0373947_0068140 | |||
| 1614 | Ga0373947_0211250 | |||
| 1615 | Ga0373947_0214627 | |||
| 1616 | Ga0373947_0442814 | |||
| 1617 | Ga0373947_0749792 | |||
| 1618 | Ga0373937_0000012 | |||
| 1619 | Ga0373937_0016525 | |||
| 1620 | Ga0373937_0023070 | |||
| 1621 | Ga0373937_0035993 | |||
| 1622 | Ga0373937_0065143 | |||
| 1623 | Ga0373937_0128883 | |||
| 1624 | Ga0373937_0194066 | |||
| 1625 | Ga0373937_0581475 | |||
| 1626 | Ga0373937_1168156 | |||
| 1627 | Ga0372808_018230 | |||
| 1628 | Ga0310109_014140 | |||
| 1629 | Ga0373925_0000021 | |||
| 1630 | Ga0373925_0005148 | |||
| 1631 | Ga0373925_0049126 | |||
| 1632 | Ga0373925_0063191 | |||
| 1633 | Ga0373925_0100426 | |||
| 1634 | Ga0373925_0345450 | |||
| 1635 | Ga0373925_0365597 | |||
| 1636 | Ga0373925_0954490 | |||
| 1637 | Ga0395899_0004117 | |||
| 1638 | Ga0395898_0023865 | |||
| 1639 | Ga0395898_1008864 | |||
| 1640 | Ga0436364_0136351 | |||
| 1641 | Ga0436364_0866950 | |||
| 1642 | Ga0436364_0989727 | |||
| 1643 | Ga0436364_1018157 | |||
| 1644 | Ga0436364_1160722 | |||
| 1645 | Ga0436364_1303572 | |||
| 1646 | Ga0436364_1314967 | |||
| 1647 | Ga0436364_1427311 | |||
| 1648 | Ga0436365_1301466 | |||
| 1649 | Ga0436363_0158367 | |||
| 1650 | Ga0436363_0276775 | |||
| 1651 | Ga0436363_1335153 | |||
| 1652 | Ga0436363_1525360 | |||
| 1653 | Ga0436362_0069517 | |||
| 1654 | Ga0436362_1023179 | |||
| 1655 | Ga0451789_0954289 | |||
| 1656 | Ga0451793_1539502 | |||
| 1657 | Ga0466966_0019698 | |||
| 1658 | Ga0466961_0040225 | |||
| 1659 | Ga0466961_0082735 | |||
| 1660 | Ga0466963_0405621 | |||
| 1661 | Ga0466971_0120291 | |||
| 1662 | Ga0466968_0166062 | |||
| 1663 | Ga0466968_0270693 | |||
| 1664 | Ga0466959_0190702 | |||
| 1665 | Ga0466959_0192506 | |||
| 1666 | Ga0466959_0221305 | |||
| 1667 | Ga0466958_0110214 | |||
| 1668 | Ga0466958_0427089 | |||
| 1669 | Ga0466967_0239113 | |||
| 1670 | Ga0466967_0512969 | |||
| 1671 | Ga0466967_0784508 | |||
| 1672 | Ga0466967_2410919 | |||
| 1673 | Ga0495592_0001038 | |||
| 1674 | Ga0495592_0025030 | |||
| 1675 | Ga0495592_0065020 | |||
| 1676 | Ga0495592_0115181 | |||
| 1677 | Ga0495592_0204941 | |||
| 1678 | Ga0495592_0322135 | |||
| 1679 | Ga0495603_0085584 | |||
| 1680 | Ga0495603_0120564 | |||
| 1681 | Ga0495629_0001307 | |||
| 1682 | Ga0495629_0050225 | |||
| 1683 | Ga0495629_0105596 | |||
| 1684 | Ga0495641_0003608 | |||
| 1685 | Ga0495641_0020494 | |||
| 1686 | Ga0495641_0023199 | |||
| 1687 | Ga0495641_0073864 | |||
| 1688 | Ga0495651_0000007 | |||
| 1689 | Ga0495651_0004063 | |||
| 1690 | Ga0495651_0014480 | |||
| 1691 | Ga0495651_0016969 | |||
| 1692 | Ga0495651_0019156 | |||
| 1693 | Ga0495651_0371659 | |||
| 1694 | Ga0495651_0378679 | |||
| 1695 | Ga0495651_0630536 | |||
| 1696 | Ga0495653_0004863 | |||
| 1697 | Ga0495653_0005400 | |||
| 1698 | Ga0495653_0029402 | |||
| 1699 | Ga0495653_0030612 | |||
| 1700 | Ga0495653_0040372 | |||
| 1701 | Ga0495653_0047918 | |||
| 1702 | Ga0495653_0061892 | |||
| 1703 | Ga0495653_0071907 | |||
| 1704 | Ga0495580_0480138 | |||
| 1705 | Ga0495580_0749010 | |||
| 1706 | Ga0495582_0001211 | |||
| 1707 | Ga0495582_0005652 | |||
| 1708 | Ga0495582_0161218 | |||
| 1709 | Ga0495582_0270248 | |||
| 1710 | Ga0495639_0010409 | |||
| 1711 | Ga0495662_0012967 | |||
| 1712 | Ga0495662_0024097 | |||
| 1713 | Ga0495662_0159693 | |||
| 1714 | Ga0495662_0407590 | |||
| 1715 | Ga0495664_0004193 | |||
| 1716 | Ga0495664_0012427 | |||
| 1717 | Ga0495664_0019880 | |||
| 1718 | Ga0495664_0029664 | |||
| 1719 | Ga0495664_0051898 | |||
| 1720 | Ga0495608_0000015 | |||
| 1721 | Ga0495608_0003113 | |||
| 1722 | Ga0495608_0027673 | |||
| 1723 | Ga0495608_0039886 | |||
| 1724 | Ga0495608_0052193 | |||
| 1725 | Ga0495608_0360469 | |||
| 1726 | Ga0495608_0504370 | |||
| 1727 | Ga0495608_0916610 | |||
| 1728 | Ga0495618_0007498 | |||
| 1729 | Ga0495618_0019010 | |||
| 1730 | Ga0495618_0025441 | |||
| 1731 | Ga0495618_0098542 | |||
| 1732 | Ga0495618_0119274 | |||
| 1733 | Ga0495618_0125980 | |||
| 1734 | Ga0495618_0127174 | |||
| 1735 | Ga0495618_0237778 | |||
| 1736 | Ga0495628_0000737 | |||
| 1737 | Ga0495628_0017665 | |||
| 1738 | Ga0495628_0084215 | |||
| 1739 | Ga0495628_0085998 | |||
| 1740 | Ga0495628_0336945 | |||
| 1741 | Ga0495630_0018483 | |||
| 1742 | Ga0495630_0041563 | |||
| 1743 | Ga0495630_0058292 | |||
| 1744 | Ga0495630_0086488 | |||
| 1745 | Ga0495630_0204619 | |||
| 1746 | Ga0495630_0212093 | |||
| 1747 | Ga0495666_0185939 | |||
| 1748 | Ga0495652_0000074 | |||
| 1749 | Ga0495652_0012772 | |||
| 1750 | Ga0495652_0023128 | |||
| 1751 | Ga0495652_0103996 | |||
| 1752 | Ga0495652_0107955 | |||
| 1753 | Ga0495652_0195934 | |||
| 1754 | Ga0495652_0368490 | |||
| 1755 | Ga0495652_0982404 | |||
| 1756 | Ga0495665_0005298 | |||
| 1757 | Ga0495665_0005836 | |||
| 1758 | Ga0495665_0005892 | |||
| 1759 | Ga0495665_0020140 | |||
| 1760 | Ga0495665_0123402 | |||
| 1761 | Ga0495665_0262560 | |||
| 1762 | Ga0495640_0008749 | |||
| 1763 | Ga0495640_0028840 | |||
| 1764 | Ga0495640_0105248 | |||
| 1765 | Ga0495640_0209627 | |||
| 1766 | Ga0495640_0456209 | |||
| 1767 | Ga0495586_0010989 | |||
| 1768 | Ga0495586_0012705 | |||
| 1769 | Ga0495586_0141080 | |||
| 1770 | Ga0495587_0000085 | |||
| 1771 | Ga0495587_0003258 | |||
| 1772 | Ga0495587_0010139 | |||
| 1773 | Ga0495587_0056265 | |||
| 1774 | Ga0495587_0173421 | |||
| 1775 | Ga0495645_0030868 | |||
| 1776 | Ga0495645_0035606 | |||
| 1777 | Ga0495645_0074422 | |||
| 1778 | Ga0495645_0089644 | |||
| 1779 | Ga0495645_0102970 | |||
| 1780 | Ga0495645_0346412 | |||
| 1781 | Ga0495667_0000033 | |||
| 1782 | Ga0495667_0003641 | |||
| 1783 | Ga0495667_0004750 | |||
| 1784 | Ga0495667_0009929 | |||
| 1785 | Ga0495667_0804607 | |||
| 1786 | Ga0495634_0004108 | |||
| 1787 | Ga0495634_0023454 | |||
| 1788 | Ga0495634_0028120 | |||
| 1789 | Ga0495634_0098564 | |||
| 1790 | Ga0495634_0129038 | |||
| 1791 | Ga0495635_0003052 | |||
| 1792 | Ga0495635_0011882 | |||
| 1793 | Ga0495635_0042090 | |||
| 1794 | Ga0495635_0049734 | |||
| 1795 | Ga0495635_0057761 | |||
| 1796 | Ga0495635_0067987 | |||
| 1797 | Ga0495635_0236790 | |||
| 1798 | Ga0495588_0480831 | |||
| 1799 | Ga0495657_0001345 | |||
| 1800 | Ga0495657_0004406 | |||
| 1801 | Ga0495657_0007140 | |||
| 1802 | Ga0495657_0024425 | |||
| 1803 | Ga0495657_0027020 | |||
| 1804 | Ga0495657_0058343 | |||
| 1805 | Ga0495657_0106458 | |||
| 1806 | Ga0495599_0000018 | |||
| 1807 | Ga0495599_0005426 | |||
| 1808 | Ga0495599_0016500 | |||
| 1809 | Ga0495599_0030374 | |||
| 1810 | Ga0495599_0088154 | |||
| 1811 | Ga0495599_0139626 | |||
| 1812 | Ga0495599_0205349 | |||
| 1813 | Ga0495599_0281206 | |||
| 1814 | Ga0495623_0000075 | |||
| 1815 | Ga0495623_0009174 | |||
| 1816 | Ga0495623_0027076 | |||
| 1817 | Ga0495623_0155803 | |||
| 1818 | Ga0495623_0169115 | |||
| 1819 | Ga0495646_0005199 | |||
| 1820 | Ga0495646_0025764 | |||
| 1821 | Ga0495646_0037718 | |||
| 1822 | Ga0495646_0061783 | |||
| 1823 | Ga0495646_0074293 | |||
| 1824 | Ga0495646_0115853 | |||
| 1825 | Ga0495646_0159912 | |||
| 1826 | Ga0495646_0281571 | |||
| 1827 | Ga0495646_0388313 | |||
| 1828 | Ga0495647_0080114 | |||
| 1829 | Ga0495658_0063337 | |||
| 1830 | Ga0495658_0565057 | |||
| 1831 | Ga0495613_0005089 | |||
| 1832 | Ga0495613_0005645 | |||
| 1833 | Ga0495613_0085253 | |||
| 1834 | Ga0495613_0094696 | |||
| 1835 | Ga0495624_0007746 | |||
| 1836 | Ga0495624_0011024 | |||
| 1837 | Ga0495624_0343095 | |||
| 1838 | Ga0495624_0460696 | |||
| 1839 | Ga0495600_0003461 | |||
| 1840 | Ga0495600_0004210 | |||
| 1841 | Ga0495600_0018634 | |||
| 1842 | Ga0495600_0035402 | |||
| 1843 | Ga0495600_0163115 | |||
| 1844 | Ga0495581_0002245 | |||
| 1845 | Ga0495581_0004730 | |||
| 1846 | Ga0495581_0080075 | |||
| 1847 | Ga0495581_0093271 | |||
| 1848 | Ga0495581_0505669 | |||
| 1849 | Ga0495604_0000025 | |||
| 1850 | Ga0495604_0015271 | |||
| 1851 | Ga0495604_0041000 | |||
| 1852 | Ga0495604_0071431 | |||
| 1853 | Ga0495604_0082497 | |||
| 1854 | Ga0495604_0264199 | |||
| 1855 | Ga0495674_0013169 | |||
| 1856 | Ga0495674_0013242 | |||
| 1857 | Ga0495674_0020722 | |||
| 1858 | Ga0495674_0026819 | |||
| 1859 | Ga0495674_0033400 | |||
| 1860 | Ga0495674_0980895 | |||
| 1861 | Ga0495674_1377981 | |||
| 1862 | Ga0495676_0023696 | |||
| 1863 | Ga0495676_0070119 | |||
| 1864 | Ga0495676_0253490 | |||
| 1865 | Ga0495676_0474429 | |||
| 1866 | Ga0495676_0600715 | |||
| 1867 | Ga0495676_0647148 | |||
| 1868 | Ga0495680_0000015 | |||
| 1869 | Ga0495680_0011499 | |||
| 1870 | Ga0495680_0019388 | |||
| 1871 | Ga0495680_0024054 | |||
| 1872 | Ga0495680_0028019 | |||
| 1873 | Ga0495680_0037139 | |||
| 1874 | Ga0495680_0044700 | |||
| 1875 | Ga0495680_0047383 | |||
| 1876 | Ga0495680_0061680 | |||
| 1877 | Ga0495680_0221492 | |||
| 1878 | Ga0495675_0000702 | |||
| 1879 | Ga0495675_0012372 | |||
| 1880 | Ga0495675_0018050 | |||
| 1881 | Ga0495675_0086657 | |||
| 1882 | Ga0495675_0220939 | |||
| 1883 | Ga0495684_0004873 | |||
| 1884 | Ga0495684_0053358 | |||
| 1885 | Ga0495684_0064631 | |||
| 1886 | Ga0495684_0093548 | |||
| 1887 | Ga0495684_0300712 | |||
| 1888 | Ga0495684_0650686 | |||
| 1889 | Ga0495684_0825416 | |||
| 1890 | Ga0495593_0003014 | |||
| 1891 | Ga0495593_0020518 | |||
| 1892 | Ga0495593_0065145 | |||
| 1893 | Ga0495593_0164734 | |||
| 1894 | Ga0495593_0182618 | |||
| 1895 | Ga0495602_0000065 | |||
| 1896 | Ga0495602_0011079 | |||
| 1897 | Ga0495602_0027529 | |||
| 1898 | Ga0495602_0039997 | |||
| 1899 | Ga0495602_0083248 | |||
| 1900 | Ga0495602_0222104 | |||
| 1901 | Ga0495602_0446462 | |||
| 1902 | Ga0496100_0443258 | |||
| 1903 | Ga0496101_0611565 | |||
| 1904 | Ga0496102_0051607 | |||
| 1905 | Ga0496102_0451162 | |||
| 1906 | Ga0496102_0913326 | |||
| 1907 | Ga0496103_0053998 | |||
| 1908 | Ga0496103_0402367 | |||
| 1909 | Ga0496104_0014773 | |||
| 1910 | Ga0496104_0061932 | |||
| 1911 | Ga0496104_0129945 | |||
| 1912 | Ga0496105_0054363 | |||
| 1913 | Ga0496105_0106953 | |||
| 1914 | Ga0496106_0461084 | |||
| 1915 | Ga0496107_0069211 | |||
| 1916 | Ga0496107_0124441 | |||
| 1917 | Ga0496107_0166482 | |||
| 1918 | Ga0496108_0017599 | |||
| 1919 | Ga0496108_0107297 | |||
| 1920 | Ga0496108_1086089 | |||
| 1921 | Ga0496109_0014415 | |||
| 1922 | Ga0496109_0179360 | |||
| 1923 | Ga0496109_0246698 | |||
| 1924 | Ga0496109_0998750 | |||
| 1925 | Ga0496110_0062954 | |||
| 1926 | Ga0496110_1469677 | |||
| 1927 | Ga0496111_0088933 | |||
| 1928 | Ga0496111_0125687 | |||
| 1929 | Ga0496111_0595163 | |||
| 1930 | Ga0496112_0060441 | |||
| 1931 | Ga0496112_0125224 | |||
| 1932 | Ga0496113_0025110 | |||
| 1933 | Ga0496113_0061466 | |||
| 1934 | Ga0496113_0406899 | |||
| 1935 | Ga0496114_0175872 | |||
| 1936 | Ga0496114_1116797 | |||
| 1937 | Ga0496115_0008866 | |||
| 1938 | Ga0496115_0051191 | |||
| 1939 | Ga0496126_0042649 | |||
| 1940 | Ga0496126_0043718 | |||
| 1941 | Ga0496126_0564029 | |||
| 1942 | Ga0501034_0721819 | |||
| 1943 | Ga0501037_0014884 | |||
| 1944 | Ga0501037_0153419 | |||
| 1945 | Ga0501038_0111223 | |||
| 1946 | Ga0501039_0057382 | |||
| 1947 | Ga0501042_0005377 | |||
| 1948 | Ga0501042_0008967 | |||
| 1949 | Ga0501043_0011292 | |||
| 1950 | Ga0501047_0046138 | |||
| 1951 | Ga0501047_0084672 | |||
| 1952 | Ga0501070_0948602 | |||
| 1953 | Ga0501074_0004998 | |||
| 1954 | Ga0501077_0203751 | |||
| 1955 | Ga0501044_0377778 | |||
| 1956 | nmdc:mga05p37_35974_c2 | |||
| 1957 | nmdc:mga0n895_111117_c1 | |||
| 1958 | nmdc:mga0n895_379457_c1 | |||
| 1959 | nmdc:mga0rr50_1087972_c1 | |||
| 1960 | nmdc:mga0rr50_112665_c1 | |||
| 1961 | nmdc:mga0rr50_143507_c1 | |||
| 1962 | nmdc:mga0rr50_255610_c1 | |||
| 1963 | nmdc:mga0rr50_653046_c1 | |||
| 1964 | nmdc:mga0rr50_801608_c1 | |||
| 1965 | nmdc:mga08x19_161124_c1 | |||
| 1966 | nmdc:mga08x19_293683_c1 | |||
| 1967 | nmdc:mga08x19_469241_c1 | |||
| 1968 | nmdc:mga08x19_518876_c1 | |||
| 1969 | nmdc:mga08x19_59556_c1 | |||
| 1970 | nmdc:mga0a205_126363_c1 | |||
| 1971 | nmdc:mga0a205_194452_c1 | |||
| 1972 | Ga0495601_0069529 | |||
| 1973 | Ga0495601_0098757 | |||
| 1974 | Ga0495601_0148954 | |||
| 1975 | Ga0495601_0152021 | |||
| 1976 | Ga0495601_0350914 | |||
| 1977 | Ga0495612_0003458 | |||
| 1978 | Ga0495612_0007651 | |||
| 1979 | Ga0495612_0008570 | |||
| 1980 | Ga0495612_0044484 | |||
| 1981 | Ga0495612_0085043 | |||
| 1982 | Ga0495612_0086713 | |||
| 1983 | Ga0495655_0232021 | |||
| 1984 | Ga0495595_0001179 | |||
| 1985 | Ga0495595_0007432 | |||
| 1986 | Ga0495595_0009129 | |||
| 1987 | Ga0495595_0010655 | |||
| 1988 | Ga0495595_0028051 | |||
| 1989 | Ga0495619_0010762 | |||
| 1990 | Ga0495619_0027610 | |||
| 1991 | Ga0495619_0042518 | |||
| 1992 | Ga0495619_0050933 | |||
| 1993 | Ga0495619_0236489 | |||
| 1994 | Ga0495619_0452760 | |||
| 1995 | Ga0495619_0710119 | |||
| 1996 | Ga0590075_038196 | |||
| 1997 | Ga0587073_0150374 | |||
| 1998 | Ga0587077_049332 | |||
| 1999 | Ga0587088_023521 | |||
| 2000 | Ga0587091_011184 | |||
| 2001 | Ga0587092_016024 | |||
| 2002 | Ga0587113_004762 | |||
| 2003 | Ga0587115_008978 | |||
| 2004 | Ga0587122_004286 | |||
| 2005 | Ga0587069_014528 | |||
| 2006 | Ga0587107_054003 | |||
| 2007 | 2676495095 | |||
| 2008 | 2856747335 | |||
| 2009 | 2873314959 | |||
| 2010 | 2884694262 | |||
| 2011 | 2891402545 | |||
| 2012 | 2891554879 | |||
| 2013 | 2891562812 | |||
| 2014 | 2895435681 | |||
| 2015 | 2895444702 | |||
| 2016 | 3003006229 | |||
| 2017 | 8053951850 | |||
| 2018 | 8055072615 | |||
| 2019 | 8055175750 | |||
| 2020 | 8056060534 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6m36-assembly2.cif.gz_K | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9363 | 2 | 145 |
| 6m36-assembly2.cif.gz_I | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9297 | 2 | 145 |
| 6m36-assembly1.cif.gz_E | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9287 | 2 | 146 |
| 6m36-assembly1.cif.gz_G | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9262 | 2 | 145 |
| 6m37-assembly1.cif.gz_A-2 | the crystal structure of b. subtilis rsbv/rsbw complex in the hexagonal crystal form | 0.9161 | 1 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLZ7_398_539_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.8535 | 1 | 143 | 3.30.565.10 |
| af_Q57727_14_160_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.8312 | 10 | 54 | 1.10.357.140 |
| af_P9WGX7_40_164_3.90.1100.10 | Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; | 0.8202 | 4 | 147 | 3.90.1100.10 |
| af_P9WGX7_40_164_3.90.1100.10 | Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; | 0.8082 | 4 | 147 | 3.90.1100.10 |
| 3ke6B02 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.7908 | 1 | 143 | 3.30.565.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1DPD3-F1-model_v4 | Anti-sigma regulatory factor | 0.9158 | 2 | 150 |
GO:0004674
|
| AF-A0A537YVJ7-F1-model_v4 | ATP-binding protein | 0.9108 | 4 | 146 |
GO:0004674
GO:0005524 |
| AF-A0A1W9WD54-F1-model_v4 | Histidine kinase/HSP90-like ATPase domain-containing protein | 0.8957 | 2 | 145 |
|
| AF-A0A537YVJ7-F1-model_v4 | ATP-binding protein | 0.8899 | 4 | 146 |
GO:0004674
GO:0005524 |
| AF-A0A125Q1H6-F1-model_v4 | deleted | 0.8818 | 4 | 147 |
|