F488107

General Info

Members Datasets Scaffolds Average Seq Length
1010 419 2020 170

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100022681|Ga0070667_1000226812
Length 183
Sequence MAAAAAHSAAPPGALRRSLDALYDGAAALAGVFMVLLLVMVLLSILGRQLHFNLPGVDAYAGYMMAGTGFLALAHTLKNGEHIRVTLLIGALKGGWKRGFEVWALFAASLLALLAAFYSCKLAWQSYTFHDISTSNDATPLWLPELTMAIGTVVLAIAFVDELVLEWRGERVVVTPEEASHNE

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
112 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
202 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
209 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
210 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
211 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
212 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
213 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
218 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
232 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
233 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
244 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
245 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
246 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
255 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
256 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
257 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
258 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
259 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
260 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
261 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
262 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
263 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
264 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
265 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
266 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
267 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
268 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
269 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
270 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
271 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
272 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
273 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
274 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
275 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
276 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
277 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
278 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
279 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
280 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
281 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
282 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
283 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
292 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
293 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
296 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
299 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
302 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
303 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
304 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
305 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
306 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
310 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
311 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
312 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
313 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
314 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
315 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
316 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
317 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
321 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
322 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
353 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
354 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
362 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
363 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
371 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
372 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
373 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
374 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
377 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
378 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
379 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
380 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
381 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
382 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
383 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
384 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
385 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
386 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
387 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
388 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
389 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
390 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
391 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
392 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
393 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
394 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
395 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
396 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
397 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
398 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
399 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
400 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
401 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
402 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
403 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
404 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
405 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
406 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
407 2643221672 Variovorax sp. Root434 Isolate Unclassified
408 2643221683 Variovorax sp. Root473 Isolate Unclassified
409 2842677519 Variovorax sp. R-72495 Isolate Unclassified
410 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
411 2885198086 Variovorax sp. 679 Isolate Unclassified
412 2885211737 Variovorax sp. 553 Isolate Unclassified
413 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
414 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
415 2904456579 Variovorax sp. 2002 Isolate Unclassified
416 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
417 2929520902 Variovorax beijingensis 502 Isolate Unclassified
418 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
419 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 0
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.62
Nodule 0.4
Rhizoplane 5.35
Rhizosphere 80.89
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100022681 3300005367 Bacteria 5205
2 JGI25151J46595_10104850 3300003187 Bacteria 752
3 rootL2_10065328 3300003322 Bacteria 1505
4 Ga0055537_1000011 3300003773 Bacteria 137556
5 Ga0055534_1000020 3300003784 Bacteria 137562
6 Ga0055528_1000523 3300003790 Bacteria 29840
7 Ga0055530_10010170 3300003791 Bacteria 3513
8 Ga0055530_10018936 3300003791 Bacteria 2103
9 Ga0055540_1002046 3300003792 Bacteria 11159
10 Ga0055540_1004422 3300003792 Bacteria 6347
11 Ga0055531_10006773 3300003794 Bacteria 6404
12 Ga0065165_1002674 3300005262 Bacteria 14381
13 Ga0070658_10614095 3300005327 Bacteria 943
14 Ga0070676_10009731 3300005328 Bacteria 5199
15 Ga0070683_100041198 3300005329 Bacteria 4247
16 Ga0070683_100634859 3300005329 Bacteria 1022
17 Ga0070690_100041746 3300005330 Bacteria 2904
18 Ga0070690_100786197 3300005330 Bacteria 737
19 Ga0070670_100001487 3300005331 Bacteria 18885
20 Ga0070670_100055083 3300005331 Bacteria 3413
21 Ga0070670_100089421 3300005331 Bacteria 2647
22 Ga0070670_100125593 3300005331 Bacteria 2214
23 Ga0070670_100127016 3300005331 Bacteria 2201
24 Ga0070670_100135869 3300005331 Bacteria 2125
25 Ga0070670_100189218 3300005331 Bacteria 1788
26 Ga0070670_100221409 3300005331 Bacteria 1646
27 Ga0070670_100489744 3300005331 Bacteria 1092
28 Ga0070670_100790512 3300005331 Bacteria 857
29 Ga0070677_10022459 3300005333 Bacteria 2324
30 Ga0070677_10143422 3300005333 Bacteria 1104
31 Ga0070677_10165531 3300005333 Bacteria 1041
32 Ga0070677_10172939 3300005333 Bacteria 1023
33 Ga0068869_100007361 3300005334 Bacteria 7026
34 Ga0068869_100039693 3300005334 Bacteria 3362
35 Ga0068869_100104752 3300005334 Bacteria 2144
36 Ga0068869_100471759 3300005334 Bacteria 1043
37 Ga0068869_100937843 3300005334 Bacteria 751
38 Ga0070666_10002463 3300005335 Bacteria 11197
39 Ga0070666_10022199 3300005335 Bacteria 4119
40 Ga0070666_10078188 3300005335 Bacteria 2258
41 Ga0070666_10304888 3300005335 Bacteria 1135
42 Ga0070682_100046022 3300005337 Bacteria 2707
43 Ga0068868_100012781 3300005338 Bacteria 6142
44 Ga0068868_100053419 3300005338 Bacteria 3183
45 Ga0068868_100060207 3300005338 Bacteria 3005
46 Ga0068868_100094600 3300005338 Bacteria 2411
47 Ga0068868_100163326 3300005338 Bacteria 1841
48 Ga0068868_100321783 3300005338 Bacteria 1318
49 Ga0068868_100786114 3300005338 Bacteria 858
50 Ga0068868_101399971 3300005338 Bacteria 652
51 Ga0070660_100027230 3300005339 Bacteria 4264
52 Ga0070660_100155198 3300005339 Bacteria 1842
53 Ga0070689_100001068 3300005340 Bacteria 17186
54 Ga0070689_100084179 3300005340 Bacteria 2499
55 Ga0070687_100026678 3300005343 Bacteria 2784
56 Ga0070687_100131028 3300005343 Bacteria 1448
57 Ga0070661_100046486 3300005344 Bacteria 3175
58 Ga0070661_100214944 3300005344 Bacteria 1473
59 Ga0070661_100676074 3300005344 Bacteria 840
60 Ga0070692_10380246 3300005345 Bacteria 886
61 Ga0070668_100255393 3300005347 Bacteria 1456
62 Ga0070669_100348521 3300005353 Bacteria 1201
63 Ga0070669_100468998 3300005353 Bacteria 1040
64 Ga0070675_100010343 3300005354 Bacteria 7286
65 Ga0070675_100016666 3300005354 Bacteria 5832
66 Ga0070675_100145213 3300005354 Bacteria 2031
67 Ga0070675_100271347 3300005354 Bacteria 1489
68 Ga0070675_100538419 3300005354 Bacteria 1055
69 Ga0070675_100783114 3300005354 Bacteria 871
70 Ga0070671_100010237 3300005355 Bacteria 7527
71 Ga0070671_100014699 3300005355 Bacteria 6327
72 Ga0070671_100036188 3300005355 Bacteria 4093
73 Ga0070671_100042544 3300005355 Bacteria 3776
74 Ga0070671_100111098 3300005355 Bacteria 2302
75 Ga0070671_100168621 3300005355 Bacteria 1851
76 Ga0070671_100206778 3300005355 Bacteria 1665
77 Ga0070671_100347147 3300005355 Bacteria 1266
78 Ga0070671_100940816 3300005355 Bacteria 756
79 Ga0070674_100670743 3300005356 Bacteria 883
80 Ga0070673_100003065 3300005364 Bacteria 10345
81 Ga0070673_100007094 3300005364 Bacteria 7359
82 Ga0070673_100016138 3300005364 Bacteria 5271
83 Ga0070673_100409978 3300005364 Bacteria 1213
84 Ga0070673_100430116 3300005364 Bacteria 1185
85 Ga0070673_100581874 3300005364 Bacteria 1019
86 Ga0070688_100011432 3300005365 Bacteria 4932
87 Ga0070688_100169151 3300005365 Bacteria 1507
88 Ga0070688_100191588 3300005365 Bacteria 1425
89 Ga0070659_100014648 3300005366 Bacteria 5863
90 Ga0070659_100563020 3300005366 Bacteria 977
91 Ga0070659_100568777 3300005366 Bacteria 972
92 Ga0070667_100010871 3300005367 Bacteria 7527
93 Ga0070667_100020888 3300005367 Bacteria 5438
94 Ga0070667_100037047 3300005367 Bacteria 4089
95 Ga0070667_100044596 3300005367 Bacteria 3725
96 Ga0070667_100582445 3300005367 Bacteria 1030
97 Ga0070667_100679138 3300005367 Bacteria 952
98 Ga0070667_100708390 3300005367 Bacteria 932
99 Ga0070667_101204759 3300005367 Bacteria 709
100 Ga0070703_10039761 3300005406 Bacteria 1459
101 Ga0070709_10027147 3300005434 Bacteria 3402
102 Ga0070709_10028305 3300005434 Bacteria 3341
103 Ga0070709_10219948 3300005434 Bacteria 1354
104 Ga0070713_100000045 3300005436 Bacteria 77398
105 Ga0070713_100001503 3300005436 Bacteria 14866
106 Ga0070713_100049974 3300005436 Bacteria 3451
107 Ga0070710_10052977 3300005437 Bacteria 2283
108 Ga0070710_10286235 3300005437 Bacteria 1071
109 Ga0070710_10535220 3300005437 Bacteria 807
110 Ga0070701_10210128 3300005438 Bacteria 1155
111 Ga0070711_100103371 3300005439 Bacteria 2076
112 Ga0070711_100578376 3300005439 Bacteria 935
113 Ga0070694_100005010 3300005444 Bacteria 7991
114 Ga0070663_100027741 3300005455 Bacteria 3849
115 Ga0070663_100186281 3300005455 Bacteria 1613
116 Ga0070678_100002879 3300005456 Bacteria 9527
117 Ga0070678_100009028 3300005456 Bacteria 6006
118 Ga0070678_100047655 3300005456 Bacteria 3081
119 Ga0070678_100075456 3300005456 Bacteria 2536
120 Ga0070678_100079341 3300005456 Bacteria 2482
121 Ga0070678_100140328 3300005456 Bacteria 1933
122 Ga0070678_100163370 3300005456 Bacteria 1806
123 Ga0070678_100253061 3300005456 Bacteria 1478
124 Ga0070678_100415136 3300005456 Bacteria 1172
125 Ga0070678_100701910 3300005456 Bacteria 911
126 Ga0070678_101184725 3300005456 Bacteria 708
127 Ga0070662_100008876 3300005457 Bacteria 6553
128 Ga0070662_100025218 3300005457 Bacteria 4104
129 Ga0070662_100031248 3300005457 Bacteria 3736
130 Ga0070662_100206289 3300005457 Bacteria 1562
131 Ga0070662_100319115 3300005457 Bacteria 1266
132 Ga0068867_100118121 3300005459 Bacteria 2045
133 Ga0068867_100368099 3300005459 Bacteria 1204
134 Ga0068867_100403351 3300005459 Bacteria 1154
135 Ga0070685_10067442 3300005466 Bacteria 2111
136 Ga0070685_10274666 3300005466 Bacteria 1126
137 Ga0070706_100047983 3300005467 Bacteria 3942
138 Ga0070706_100133028 3300005467 Bacteria 2321
139 Ga0070706_100281389 3300005467 Bacteria 1552
140 Ga0070707_100102012 3300005468 Bacteria 2780
141 Ga0070707_100377332 3300005468 Bacteria 1377
142 Ga0070707_101454537 3300005468 Bacteria 652
143 Ga0070698_100009638 3300005471 Bacteria 10332
144 Ga0070698_100116161 3300005471 Bacteria 2640
145 Ga0070699_100010642 3300005518 Bacteria 7962
146 Ga0070699_100407521 3300005518 Bacteria 1230
147 Ga0070699_100485405 3300005518 Bacteria 1122
148 Ga0070679_100126651 3300005530 Bacteria 2536
149 Ga0070679_100223861 3300005530 Bacteria 1842
150 Ga0070684_100098116 3300005535 Bacteria 2613
151 Ga0070684_100114171 3300005535 Bacteria 2424
152 Ga0070697_100042000 3300005536 Bacteria 3701
153 Ga0070697_100101353 3300005536 Bacteria 2392
154 Ga0070697_100102902 3300005536 Bacteria 2373
155 Ga0068853_100043659 3300005539 Bacteria 3835
156 Ga0070672_100011240 3300005543 Bacteria 6242
157 Ga0070672_100011563 3300005543 Bacteria 6158
158 Ga0070672_100027935 3300005543 Bacteria 4214
159 Ga0070672_100146776 3300005543 Bacteria 1949
160 Ga0070672_100159859 3300005543 Bacteria 1868
161 Ga0070672_100283535 3300005543 Bacteria 1401
162 Ga0070686_100129106 3300005544 Bacteria 1746
163 Ga0070695_100037561 3300005545 Bacteria 3053
164 Ga0070696_100393471 3300005546 Bacteria 1083
165 Ga0070696_101091103 3300005546 Bacteria 671
166 Ga0070693_100010511 3300005547 Bacteria 4640
167 Ga0070665_100016346 3300005548 Bacteria 7440
168 Ga0070704_100088429 3300005549 Bacteria 2302
169 Ga0070704_100157535 3300005549 Bacteria 1792
170 Ga0070704_100546163 3300005549 Bacteria 1012
171 Ga0068855_100297315 3300005563 Bacteria 1788
172 Ga0070664_100030558 3300005564 Bacteria 4495
173 Ga0070664_100161575 3300005564 Bacteria 1982
174 Ga0070664_100200654 3300005564 Bacteria 1780
175 Ga0070664_100327622 3300005564 Bacteria 1389
176 Ga0070664_100331493 3300005564 Bacteria 1381
177 Ga0070664_100409404 3300005564 Bacteria 1241
178 Ga0070664_100450448 3300005564 Bacteria 1182
179 Ga0068857_100141393 3300005577 Bacteria 2176
180 Ga0068857_100470352 3300005577 Bacteria 1177
181 Ga0068857_100783709 3300005577 Bacteria 909
182 Ga0068854_100024823 3300005578 Bacteria 4108
183 Ga0068854_100105433 3300005578 Bacteria 2119
184 Ga0068854_100294115 3300005578 Bacteria 1311
185 Ga0068854_101353521 3300005578 Bacteria 642
186 Ga0068856_100015296 3300005614 Bacteria 7414
187 Ga0068856_100043926 3300005614 Bacteria 4396
188 Ga0068856_100433020 3300005614 Bacteria 1335
189 Ga0070702_100028821 3300005615 Bacteria 3012
190 Ga0070702_100245778 3300005615 Bacteria 1210
191 Ga0068852_100037171 3300005616 Bacteria 4080
192 Ga0068852_100056346 3300005616 Bacteria 3396
193 Ga0068852_100389377 3300005616 Bacteria 1369
194 Ga0068852_100676677 3300005616 Bacteria 1041
195 Ga0068852_100730445 3300005616 Bacteria 1002
196 Ga0068859_100003878 3300005617 Bacteria 15277
197 Ga0068859_100023164 3300005617 Bacteria 6230
198 Ga0068859_100026347 3300005617 Bacteria 5829
199 Ga0068859_100161085 3300005617 Bacteria 2323
200 Ga0068864_100009333 3300005618 Bacteria 8092
201 Ga0068864_100022771 3300005618 Bacteria 5254
202 Ga0068864_100120311 3300005618 Bacteria 2347
203 Ga0068864_100168297 3300005618 Bacteria 1997
204 Ga0068864_100286921 3300005618 Bacteria 1538
205 Ga0068864_100473877 3300005618 Bacteria 1201
206 Ga0068864_100672271 3300005618 Bacteria 1010
207 Ga0068866_10149808 3300005718 Bacteria 1350
208 Ga0068861_100273062 3300005719 Bacteria 1452
209 Ga0068851_10015037 3300005834 Bacteria 3682
210 Ga0068851_10018571 3300005834 Bacteria 3350
211 Ga0068870_10255053 3300005840 Bacteria 1089
212 Ga0068870_10420219 3300005840 Bacteria 875
213 Ga0068863_100007859 3300005841 Bacteria 10428
214 Ga0068863_100020501 3300005841 Bacteria 6318
215 Ga0068863_100023505 3300005841 Bacteria 5885
216 Ga0068863_100113749 3300005841 Bacteria 2578
217 Ga0068863_100158513 3300005841 Bacteria 2167
218 Ga0068863_100333584 3300005841 Bacteria 1474
219 Ga0068863_101095580 3300005841 Bacteria 801
220 Ga0068863_101260554 3300005841 Bacteria 746
221 Ga0068858_100000917 3300005842 Bacteria 30566
222 Ga0068858_100002260 3300005842 Bacteria 19472
223 Ga0068858_100108964 3300005842 Bacteria 2585
224 Ga0068858_100912940 3300005842 Bacteria 859
225 Ga0068860_100018751 3300005843 Bacteria 6723
226 Ga0068860_100058802 3300005843 Bacteria 3655
227 Ga0068860_100146066 3300005843 Bacteria 2276
228 Ga0068860_100957543 3300005843 Bacteria 873
229 Ga0070717_10353149 3300006028 Bacteria 1315
230 Ga0075363_100308706 3300006048 Bacteria 919
231 Ga0075364_10132824 3300006051 Bacteria 1671
232 Ga0075364_10191424 3300006051 Bacteria 1385
233 Ga0070715_10195631 3300006163 Bacteria 1024
234 Ga0070716_100094909 3300006173 Bacteria 1814
235 Ga0070716_100318439 3300006173 Bacteria 1089
236 Ga0070712_100053214 3300006175 Bacteria 2826
237 Ga0070712_100643764 3300006175 Bacteria 900
238 Ga0075362_10017186 3300006177 Bacteria 2977
239 Ga0075369_10464518 3300006186 Bacteria 600
240 Ga0075366_10139536 3300006195 Bacteria 1465
241 Ga0075366_10322717 3300006195 Bacteria 946
242 Ga0097621_100012061 3300006237 Bacteria 6395
243 Ga0097621_100014611 3300006237 Bacteria 5883
244 Ga0097621_100039624 3300006237 Bacteria 3785
245 Ga0097621_100099472 3300006237 Bacteria 2444
246 Ga0097621_100182156 3300006237 Bacteria 1815
247 Ga0097621_100235601 3300006237 Bacteria 1599
248 Ga0075370_10003454 3300006353 Bacteria 7526
249 Ga0075370_10016959 3300006353 Bacteria 3928
250 Ga0075370_10077453 3300006353 Bacteria 1908
251 Ga0075370_10297344 3300006353 Bacteria 960
252 Ga0075370_10645882 3300006353 Bacteria 642
253 Ga0068871_100015636 3300006358 Bacteria 5687
254 Ga0068871_100070073 3300006358 Bacteria 2881
255 Ga0068871_100133265 3300006358 Bacteria 2108
256 Ga0068871_100180102 3300006358 Bacteria 1816
257 Ga0068871_100206978 3300006358 Bacteria 1696
258 Ga0068871_100584291 3300006358 Bacteria 1014
259 Ga0075433_10081389 3300006852 Bacteria 2855
260 Ga0075434_100223689 3300006871 Bacteria 1902
261 Ga0068865_100103119 3300006881 Bacteria 2092
262 Ga0068865_100395557 3300006881 Bacteria 1131
263 Ga0075436_100122970 3300006914 Bacteria 1817
264 Ga0075436_100194676 3300006914 Bacteria 1435
265 Ga0075436_100951784 3300006914 Bacteria 643
266 Ga0097620_100003877 3300006931 Bacteria 15277
267 Ga0097620_100023164 3300006931 Bacteria 6230
268 Ga0097620_100026347 3300006931 Bacteria 5829
269 Ga0097620_100161093 3300006931 Bacteria 2323
270 Ga0079104_1045477 3300006946 Bacteria 1002
271 Ga0099826_10000157 3300006948 Bacteria 28404
272 Ga0075435_100077307 3300007076 Bacteria 2729
273 Ga0075435_100092229 3300007076 Bacteria 2501
274 Ga0105240_10040469 3300009093 Bacteria 5959
275 Ga0111539_10657105 3300009094 Bacteria 1221
276 Ga0105245_10002930 3300009098 Bacteria 15318
277 Ga0105245_10015666 3300009098 Bacteria 6612
278 Ga0105245_10076351 3300009098 Bacteria 3052
279 Ga0105245_10096754 3300009098 Bacteria 2725
280 Ga0105245_10193688 3300009098 Bacteria 1949
281 Ga0105245_10878607 3300009098 Bacteria 937
282 Ga0105245_12512678 3300009098 Bacteria 568
283 Ga0105247_10047960 3300009101 Bacteria 2624
284 Ga0114129_10054987 3300009147 Bacteria 5579
285 Ga0114129_11326051 3300009147 Bacteria 891
286 Ga0105243_10012787 3300009148 Bacteria 6340
287 Ga0105243_10073714 3300009148 Bacteria 2767
288 Ga0105243_10646974 3300009148 Bacteria 1024
289 Ga0105243_11541047 3300009148 Bacteria 689
290 Ga0105241_10047855 3300009174 Bacteria 3253
291 Ga0105241_10290148 3300009174 Bacteria 1400
292 Ga0105241_10322420 3300009174 Bacteria 1333
293 Ga0105242_10175016 3300009176 Bacteria 1889
294 Ga0105242_10217425 3300009176 Bacteria 1706
295 Ga0105242_10474454 3300009176 Bacteria 1184
296 Ga0105248_10031634 3300009177 Bacteria 5911
297 Ga0105248_10125609 3300009177 Bacteria 2894
298 Ga0105248_10219924 3300009177 Bacteria 2138
299 Ga0105248_10596768 3300009177 Bacteria 1246
300 Ga0105248_10798034 3300009177 Bacteria 1065
301 Ga0105237_10697242 3300009545 Bacteria 1022
302 Ga0105238_10160530 3300009551 Bacteria 2223
303 Ga0105238_10219814 3300009551 Bacteria 1876
304 Ga0105238_10345899 3300009551 Bacteria 1475
305 Ga0105249_10039217 3300009553 Bacteria 4300
306 Ga0105239_10090555 3300010375 Bacteria 3375
307 Ga0105239_10314182 3300010375 Bacteria 1766
308 Ga0105239_10454872 3300010375 Bacteria 1453
309 Ga0105246_10024930 3300011119 Bacteria 3894
310 Ga0105246_10085345 3300011119 Bacteria 2261
311 Ga0105246_11632952 3300011119 Bacteria 610
312 Ga0157317_1003741 3300012475 Bacteria 962
313 Ga0157326_1038376 3300012513 Bacteria 663
314 Ga0157373_10074127 3300013100 Bacteria 2401
315 Ga0157373_10497420 3300013100 Bacteria 880
316 Ga0157370_10036088 3300013104 Bacteria 4800
317 Ga0157370_10334635 3300013104 Bacteria 1396
318 Ga0157369_10033694 3300013105 Bacteria 5627
319 Ga0157369_10572088 3300013105 Bacteria 1167
320 Ga0157369_10593050 3300013105 Bacteria 1144
321 Ga0157369_10973131 3300013105 Bacteria 869
322 Ga0157374_10000727 3300013296 Bacteria 28768
323 Ga0157374_10055413 3300013296 Bacteria 3700
324 Ga0157374_10634974 3300013296 Bacteria 1079
325 Ga0157374_12071866 3300013296 Bacteria 596
326 Ga0157378_10026558 3300013297 Bacteria 5104
327 Ga0157378_10085721 3300013297 Bacteria 2854
328 Ga0157378_10272705 3300013297 Bacteria 1628
329 Ga0163162_10020512 3300013306 Bacteria 6493
330 Ga0163162_10036973 3300013306 Bacteria 4870
331 Ga0163162_10056547 3300013306 Bacteria 3951
332 Ga0163162_10193077 3300013306 Bacteria 2164
333 Ga0163162_10263873 3300013306 Bacteria 1854
334 Ga0163162_10264379 3300013306 Bacteria 1852
335 Ga0163162_10549675 3300013306 Bacteria 1283
336 Ga0163162_11549939 3300013306 Bacteria 755
337 Ga0157372_10080327 3300013307 Bacteria 3689
338 Ga0157372_11192067 3300013307 Bacteria 880
339 Ga0157375_10024623 3300013308 Bacteria 5574
340 Ga0157375_10046902 3300013308 Bacteria 4216
341 Ga0157375_10113993 3300013308 Bacteria 2805
342 Ga0157375_10124563 3300013308 Bacteria 2691
343 Ga0157375_10154740 3300013308 Bacteria 2431
344 Ga0157375_10197305 3300013308 Bacteria 2168
345 Ga0157375_10480026 3300013308 Bacteria 1408
346 Ga0157375_10490971 3300013308 Bacteria 1392
347 Ga0157375_11677011 3300013308 Bacteria 752
348 Ga0163163_10001923 3300014325 Bacteria 17587
349 Ga0163163_10003856 3300014325 Bacteria 12771
350 Ga0163163_10094864 3300014325 Bacteria 3002
351 Ga0163163_10255192 3300014325 Bacteria 1804
352 Ga0163163_11001069 3300014325 Bacteria 899
353 Ga0163163_11162456 3300014325 Bacteria 834
354 Ga0163163_11264428 3300014325 Bacteria 800
355 Ga0157380_10275040 3300014326 Bacteria 1537
356 Ga0157380_10769688 3300014326 Bacteria 976
357 Ga0182008_10001113 3300014497 Bacteria 18484
358 Ga0182008_10003869 3300014497 Bacteria 8895
359 Ga0182008_10339390 3300014497 Bacteria 794
360 Ga0157377_10010573 3300014745 Bacteria 4568
361 Ga0157377_10192165 3300014745 Bacteria 1291
362 Ga0157379_10009923 3300014968 Bacteria 8294
363 Ga0157379_10019476 3300014968 Bacteria 5994
364 Ga0157379_10080360 3300014968 Bacteria 2920
365 Ga0157379_10086301 3300014968 Bacteria 2814
366 Ga0157379_10146617 3300014968 Bacteria 2128
367 Ga0157379_10290535 3300014968 Bacteria 1489
368 Ga0157379_10405281 3300014968 Bacteria 1254
369 Ga0157376_10014006 3300014969 Bacteria 6002
370 Ga0157376_10091714 3300014969 Bacteria 2632
371 Ga0157376_10093802 3300014969 Bacteria 2606
372 Ga0157376_10368241 3300014969 Bacteria 1380
373 Ga0157376_10677439 3300014969 Bacteria 1034
374 Ga0157376_11424590 3300014969 Bacteria 725
375 Ga0182006_1004133 3300015261 Bacteria 7210
376 Ga0182007_10002389 3300015262 Bacteria 9385
377 Ga0182007_10003841 3300015262 Bacteria 6985
378 Ga0182005_1107394 3300015265 Bacteria 786
379 Ga0163161_10008858 3300017792 Bacteria 6958
380 Ga0163161_10069257 3300017792 Bacteria 2579
381 Ga0163161_10147485 3300017792 Bacteria 1786
382 Ga0163161_10282753 3300017792 Bacteria 1302
383 Ga0209565_1000058 3300025263 Bacteria 194126
384 Ga0209673_1000053 3300025273 Bacteria 279449
385 Ga0209673_1001967 3300025273 Bacteria 16064
386 Ga0209675_1000010 3300025291 Bacteria 541927
387 Ga0209675_1001747 3300025291 Bacteria 11945
388 Ga0209676_1002070 3300025292 Bacteria 15585
389 Ga0209025_1008535 3300025294 Bacteria 7354
390 Ga0209025_1018183 3300025294 Bacteria 4008
391 Ga0209050_1000257 3300025298 Bacteria 114186
392 Ga0209050_1001209 3300025298 Bacteria 30287
393 Ga0209050_1012784 3300025298 Bacteria 3808
394 Ga0209051_1000145 3300025303 Bacteria 134807
395 Ga0209051_1009356 3300025303 Bacteria 5061
396 Ga0209051_1068542 3300025303 Bacteria 1079
397 Ga0209257_1000495 3300025304 Bacteria 70401
398 Ga0207656_10033651 3300025321 Bacteria 2136
399 Ga0207655_1011300 3300025728 Bacteria 5326
400 Ga0207682_10030129 3300025893 Bacteria 2172
401 Ga0207682_10057448 3300025893 Bacteria 1622
402 Ga0207692_10065458 3300025898 Bacteria 1896
403 Ga0207642_10097899 3300025899 Bacteria 1465
404 Ga0207642_10309601 3300025899 Bacteria 919
405 Ga0207710_10079400 3300025900 Bacteria 1520
406 Ga0207680_10069422 3300025903 Bacteria 2177
407 Ga0207680_10134889 3300025903 Bacteria 1630
408 Ga0207680_10146437 3300025903 Bacteria 1570
409 Ga0207680_10174967 3300025903 Bacteria 1448
410 Ga0207680_10548762 3300025903 Bacteria 825
411 Ga0207685_10057352 3300025905 Bacteria 1527
412 Ga0207645_10001304 3300025907 Bacteria 20534
413 Ga0207645_10017830 3300025907 Bacteria 4681
414 Ga0207643_10065954 3300025908 Bacteria 2075
415 Ga0207643_10097405 3300025908 Bacteria 1721
416 Ga0207643_10392591 3300025908 Bacteria 876
417 Ga0207705_10064577 3300025909 Bacteria 2645
418 Ga0207705_10489366 3300025909 Bacteria 955
419 Ga0207705_10587715 3300025909 Bacteria 866
420 Ga0207684_10039887 3300025910 Bacteria 3980
421 Ga0207684_10051148 3300025910 Bacteria 3505
422 Ga0207684_10053024 3300025910 Bacteria 3443
423 Ga0207684_11353897 3300025910 Bacteria 584
424 Ga0207654_10025788 3300025911 Bacteria 3176
425 Ga0207707_10340903 3300025912 Bacteria 1292
426 Ga0207671_10131192 3300025914 Bacteria 1923
427 Ga0207693_10000780 3300025915 Bacteria 28514
428 Ga0207693_10515811 3300025915 Bacteria 933
429 Ga0207663_10044198 3300025916 Bacteria 2733
430 Ga0207663_10490389 3300025916 Bacteria 953
431 Ga0207662_10086268 3300025918 Bacteria 1923
432 Ga0207662_10115686 3300025918 Bacteria 1676
433 Ga0207657_10004204 3300025919 Bacteria 15251
434 Ga0207657_10921345 3300025919 Bacteria 673
435 Ga0207649_10039911 3300025920 Bacteria 2849
436 Ga0207649_10189348 3300025920 Bacteria 1446
437 Ga0207652_10169933 3300025921 Bacteria 1956
438 Ga0207652_10186737 3300025921 Bacteria 1864
439 Ga0207646_10050206 3300025922 Bacteria 3734
440 Ga0207681_10212104 3300025923 Bacteria 1493
441 Ga0207694_10078082 3300025924 Bacteria 2595
442 Ga0207650_10010870 3300025925 Bacteria 6254
443 Ga0207650_10072294 3300025925 Bacteria 2596
444 Ga0207650_10075107 3300025925 Bacteria 2550
445 Ga0207650_10101014 3300025925 Bacteria 2220
446 Ga0207650_10115048 3300025925 Bacteria 2087
447 Ga0207650_10123743 3300025925 Bacteria 2016
448 Ga0207650_10157624 3300025925 Bacteria 1796
449 Ga0207650_10166746 3300025925 Bacteria 1748
450 Ga0207659_10010811 3300025926 Bacteria 5746
451 Ga0207659_10011107 3300025926 Bacteria 5681
452 Ga0207659_10021252 3300025926 Bacteria 4304
453 Ga0207659_10030025 3300025926 Bacteria 3710
454 Ga0207659_10040044 3300025926 Bacteria 3274
455 Ga0207659_10264766 3300025926 Bacteria 1400
456 Ga0207659_10934099 3300025926 Bacteria 746
457 Ga0207687_10007028 3300025927 Bacteria 7421
458 Ga0207687_10007672 3300025927 Bacteria 7088
459 Ga0207687_10010416 3300025927 Bacteria 6075
460 Ga0207687_10161223 3300025927 Bacteria 1721
461 Ga0207700_10000051 3300025928 Bacteria 77057
462 Ga0207700_10025874 3300025928 Bacteria 4083
463 Ga0207700_10761846 3300025928 Bacteria 865
464 Ga0207664_10034832 3300025929 Bacteria 3880
465 Ga0207644_10000306 3300025931 Bacteria 31833
466 Ga0207644_10002436 3300025931 Bacteria 11995
467 Ga0207644_10020223 3300025931 Bacteria 4524
468 Ga0207644_10090539 3300025931 Bacteria 2279
469 Ga0207644_10180175 3300025931 Bacteria 1655
470 Ga0207644_10328725 3300025931 Bacteria 1237
471 Ga0207644_10399384 3300025931 Bacteria 1123
472 Ga0207644_10842618 3300025931 Bacteria 767
473 Ga0207690_10435194 3300025932 Bacteria 1052
474 Ga0207706_10016770 3300025933 Bacteria 6611
475 Ga0207706_10026591 3300025933 Bacteria 5179
476 Ga0207706_10035763 3300025933 Bacteria 4413
477 Ga0207706_10037099 3300025933 Bacteria 4328
478 Ga0207706_10209178 3300025933 Bacteria 1710
479 Ga0207686_10375140 3300025934 Bacteria 1077
480 Ga0207709_10004174 3300025935 Bacteria 8400
481 Ga0207709_10268765 3300025935 Bacteria 1254
482 Ga0207709_10288863 3300025935 Bacteria 1214
483 Ga0207670_10002570 3300025936 Bacteria 9545
484 Ga0207670_10042168 3300025936 Bacteria 3005
485 Ga0207669_10230371 3300025937 Bacteria 1366
486 Ga0207704_10390784 3300025938 Bacteria 1095
487 Ga0207665_10009352 3300025939 Bacteria 6433
488 Ga0207665_10015629 3300025939 Bacteria 4982
489 Ga0207665_10162931 3300025939 Bacteria 1605
490 Ga0207665_10226437 3300025939 Bacteria 1373
491 Ga0207691_10009574 3300025940 Bacteria 9300
492 Ga0207691_10014086 3300025940 Bacteria 7631
493 Ga0207691_10050735 3300025940 Bacteria 3797
494 Ga0207691_10099690 3300025940 Bacteria 2594
495 Ga0207691_10149247 3300025940 Bacteria 2056
496 Ga0207691_10348705 3300025940 Bacteria 1267
497 Ga0207691_10385087 3300025940 Bacteria 1197
498 Ga0207691_10488151 3300025940 Bacteria 1046
499 Ga0207691_10589815 3300025940 Bacteria 941
500 Ga0207711_10002784 3300025941 Bacteria 15381
501 Ga0207711_10005620 3300025941 Bacteria 10602
502 Ga0207711_10009978 3300025941 Bacteria 7892
503 Ga0207711_10150184 3300025941 Bacteria 2102
504 Ga0207711_10361745 3300025941 Bacteria 1344
505 Ga0207711_10896181 3300025941 Bacteria 825
506 Ga0207689_10052134 3300025942 Bacteria 3372
507 Ga0207689_10087648 3300025942 Bacteria 2557
508 Ga0207689_10114270 3300025942 Bacteria 2219
509 Ga0207661_10082073 3300025944 Bacteria 2664
510 Ga0207679_10009947 3300025945 Bacteria 6108
511 Ga0207679_10027736 3300025945 Bacteria 3920
512 Ga0207679_10157656 3300025945 Bacteria 1855
513 Ga0207679_10271834 3300025945 Bacteria 1450
514 Ga0207679_10659290 3300025945 Bacteria 947
515 Ga0207679_10892205 3300025945 Bacteria 813
516 Ga0207667_10243480 3300025949 Bacteria 1840
517 Ga0207667_10605306 3300025949 Bacteria 1105
518 Ga0207651_10000147 3300025960 Bacteria 30931
519 Ga0207651_10057727 3300025960 Bacteria 2679
520 Ga0207651_10064602 3300025960 Bacteria 2562
521 Ga0207651_10069340 3300025960 Bacteria 2489
522 Ga0207651_10157631 3300025960 Bacteria 1776
523 Ga0207651_10165054 3300025960 Bacteria 1740
524 Ga0207651_10352182 3300025960 Bacteria 1240
525 Ga0207651_10628336 3300025960 Bacteria 941
526 Ga0207712_10214613 3300025961 Bacteria 1535
527 Ga0207668_10333267 3300025972 Bacteria 1263
528 Ga0207640_10020071 3300025981 Bacteria 3961
529 Ga0207640_10094750 3300025981 Bacteria 2077
530 Ga0207640_10113018 3300025981 Bacteria 1929
531 Ga0207640_10203115 3300025981 Bacteria 1503
532 Ga0207640_10402102 3300025981 Bacteria 1116
533 Ga0207640_10724275 3300025981 Bacteria 855
534 Ga0207640_10787507 3300025981 Bacteria 823
535 Ga0207658_10020384 3300025986 Bacteria 4591
536 Ga0207658_10028137 3300025986 Bacteria 3956
537 Ga0207658_10032922 3300025986 Bacteria 3694
538 Ga0207658_10049901 3300025986 Bacteria 3077
539 Ga0207658_10056923 3300025986 Bacteria 2903
540 Ga0207658_10095017 3300025986 Bacteria 2321
541 Ga0207658_10101005 3300025986 Bacteria 2259
542 Ga0207658_10209904 3300025986 Bacteria 1631
543 Ga0207658_11073363 3300025986 Bacteria 735
544 Ga0207677_10000259 3300026023 Bacteria 40630
545 Ga0207677_10002328 3300026023 Bacteria 9969
546 Ga0207677_10074113 3300026023 Bacteria 2414
547 Ga0207677_10096469 3300026023 Bacteria 2163
548 Ga0207677_10307282 3300026023 Bacteria 1312
549 Ga0207677_10956141 3300026023 Bacteria 775
550 Ga0207703_10002244 3300026035 Bacteria 16902
551 Ga0207703_10010895 3300026035 Bacteria 7089
552 Ga0207703_10054103 3300026035 Bacteria 3263
553 Ga0207703_10666665 3300026035 Bacteria 988
554 Ga0207639_10073000 3300026041 Bacteria 2688
555 Ga0207639_10156457 3300026041 Bacteria 1915
556 Ga0207639_10269627 3300026041 Bacteria 1492
557 Ga0207639_10501062 3300026041 Bacteria 1109
558 Ga0207678_10031930 3300026067 Bacteria 4591
559 Ga0207678_10136137 3300026067 Bacteria 2096
560 Ga0207678_10197326 3300026067 Bacteria 1720
561 Ga0207678_10254878 3300026067 Bacteria 1503
562 Ga0207708_11672814 3300026075 Unclassified 559
563 Ga0207702_10035579 3300026078 Bacteria 4164
564 Ga0207702_10041335 3300026078 Bacteria 3866
565 Ga0207702_10085468 3300026078 Bacteria 2749
566 Ga0207702_11256887 3300026078 Unclassified 735
567 Ga0207641_10011649 3300026088 Bacteria 7221
568 Ga0207641_10042940 3300026088 Bacteria 3794
569 Ga0207641_10061297 3300026088 Bacteria 3208
570 Ga0207641_10102982 3300026088 Bacteria 2518
571 Ga0207641_10165690 3300026088 Bacteria 2012
572 Ga0207641_10262007 3300026088 Bacteria 1619
573 Ga0207641_11003754 3300026088 Bacteria 831
574 Ga0207648_10002312 3300026089 Bacteria 20575
575 Ga0207648_10073241 3300026089 Bacteria 2986
576 Ga0207648_10130960 3300026089 Bacteria 2208
577 Ga0207648_10148919 3300026089 Bacteria 2065
578 Ga0207648_10637109 3300026089 Bacteria 984
579 Ga0207676_10000224 3300026095 Bacteria 48921
580 Ga0207676_10020243 3300026095 Bacteria 4864
581 Ga0207676_10054790 3300026095 Bacteria 3126
582 Ga0207676_10092258 3300026095 Bacteria 2490
583 Ga0207676_10112987 3300026095 Bacteria 2276
584 Ga0207676_10126585 3300026095 Bacteria 2164
585 Ga0207676_10248005 3300026095 Bacteria 1601
586 Ga0207676_10589466 3300026095 Bacteria 1066
587 Ga0207676_10723514 3300026095 Bacteria 966
588 Ga0207674_10035125 3300026116 Bacteria 5233
589 Ga0207674_10054595 3300026116 Bacteria 4067
590 Ga0207674_10069225 3300026116 Bacteria 3550
591 Ga0207674_10269709 3300026116 Bacteria 1649
592 Ga0207675_100170665 3300026118 Bacteria 2079
593 Ga0207675_100409004 3300026118 Bacteria 1338
594 Ga0207675_100608467 3300026118 Bacteria 1096
595 Ga0207683_10000817 3300026121 Bacteria 28494
596 Ga0207683_10026644 3300026121 Bacteria 4992
597 Ga0207683_10046196 3300026121 Bacteria 3810
598 Ga0207683_10051245 3300026121 Bacteria 3616
599 Ga0207683_10069610 3300026121 Bacteria 3108
600 Ga0207683_10071175 3300026121 Bacteria 3074
601 Ga0207683_10121829 3300026121 Bacteria 2342
602 Ga0207683_10265332 3300026121 Bacteria 1568
603 Ga0207683_10394228 3300026121 Bacteria 1273
604 Ga0207683_10534236 3300026121 Bacteria 1084
605 Ga0207683_10710537 3300026121 Bacteria 932
606 Ga0207683_10779907 3300026121 Bacteria 887
607 Ga0207698_10018116 3300026142 Bacteria 4792
608 Ga0207698_10057622 3300026142 Bacteria 3007
609 Ga0207698_10064697 3300026142 Bacteria 2868
610 Ga0207698_10482893 3300026142 Bacteria 1202
611 Ga0207698_10700729 3300026142 Bacteria 1008
612 Ga0207698_10766644 3300026142 Bacteria 965
613 Ga0209282_1000879 3300027666 Bacteria 15586
614 Ga0209998_10026790 3300027717 Bacteria 1261
615 Ga0268266_10005421 3300028379 Bacteria 11897
616 Ga0268266_11448733 3300028379 Bacteria 662
617 Ga0268265_10601947 3300028380 Bacteria 1050
618 Ga0268264_10020524 3300028381 Bacteria 5398
619 Ga0268264_10036216 3300028381 Bacteria 4064
620 Ga0268264_10122101 3300028381 Bacteria 2297
621 Ga0268264_10478874 3300028381 Bacteria 1210
622 Ga0268264_10737764 3300028381 Bacteria 980
623 Ga0268264_10865587 3300028381 Bacteria 906
624 Ga0268264_11084900 3300028381 Bacteria 809
625 Ga0307517_10419102 3300028786 Bacteria 703
626 Ga0307515_10037079 3300028794 Bacteria 7856
627 Ga0307512_10047332 3300030522 Bacteria 3496
628 Ga0316177_1108907 3300030731 Bacteria 2943
629 Ga0316178_1161297 3300030735 Bacteria 1249
630 Ga0316183_1077822 3300030742 Bacteria 7951
631 Ga0316181_1283039 3300030744 Bacteria 1507
632 Ga0265327_10009017 3300031251 Bacteria 7298
633 Ga0265327_10206103 3300031251 Bacteria 889
634 Ga0307513_10036111 3300031456 Bacteria 5520
635 Ga0307509_10006929 3300031507 Bacteria 15037
636 Ga0307509_10040010 3300031507 Bacteria 5101
637 Ga0307509_10048217 3300031507 Bacteria 4576
638 Ga0307509_10055748 3300031507 Bacteria 4198
639 Ga0307509_10169015 3300031507 Bacteria 2069
640 Ga0307509_10204162 3300031507 Bacteria 1809
641 Ga0307509_10440007 3300031507 Bacteria 1000
642 Ga0307408_100058784 3300031548 Bacteria 2796
643 Ga0307408_100142859 3300031548 Bacteria 1880
644 Ga0307408_100170459 3300031548 Bacteria 1737
645 Ga0307408_100240492 3300031548 Bacteria 1487
646 Ga0307408_100411058 3300031548 Bacteria 1164
647 Ga0307408_100720503 3300031548 Bacteria 898
648 Ga0307508_10001847 3300031616 Bacteria 23394
649 Ga0307508_10003921 3300031616 Bacteria 14763
650 Ga0307508_10256631 3300031616 Bacteria 1343
651 Ga0307514_10101368 3300031649 Bacteria 2066
652 Ga0307514_10315492 3300031649 Bacteria 863
653 Ga0307516_10014389 3300031730 Bacteria 8372
654 Ga0307516_10019586 3300031730 Bacteria 7006
655 Ga0307516_10402332 3300031730 Bacteria 1028
656 Ga0307405_10014627 3300031731 Bacteria 4226
657 Ga0307405_10077571 3300031731 Bacteria 2159
658 Ga0307405_10186570 3300031731 Bacteria 1493
659 Ga0307405_10214880 3300031731 Bacteria 1407
660 Ga0307405_10406792 3300031731 Bacteria 1067
661 Ga0307413_10028093 3300031824 Bacteria 3127
662 Ga0307413_10402923 3300031824 Bacteria 1072
663 Ga0307413_10564725 3300031824 Bacteria 925
664 Ga0307410_10040149 3300031852 Bacteria 3078
665 Ga0307410_11413121 3300031852 Bacteria 611
666 Ga0307406_10006613 3300031901 Bacteria 6407
667 Ga0307406_10017377 3300031901 Bacteria 4186
668 Ga0307406_10080974 3300031901 Bacteria 2158
669 Ga0307406_10212251 3300031901 Bacteria 1433
670 Ga0307407_10049890 3300031903 Bacteria 2391
671 Ga0307407_10321590 3300031903 Bacteria 1086
672 Ga0307407_11056417 3300031903 Bacteria 630
673 Ga0307412_10036449 3300031911 Bacteria 3151
674 Ga0307412_10083326 3300031911 Bacteria 2217
675 Ga0307412_10359815 3300031911 Bacteria 1171
676 Ga0307412_11255747 3300031911 Bacteria 665
677 Ga0307412_11328922 3300031911 Bacteria 648
678 Ga0307409_100039276 3300031995 Bacteria 3510
679 Ga0307409_100089816 3300031995 Bacteria 2513
680 Ga0307409_100401936 3300031995 Bacteria 1309
681 Ga0307416_100021496 3300032002 Bacteria 4634
682 Ga0307416_100162141 3300032002 Bacteria 2068
683 Ga0307416_100181705 3300032002 Bacteria 1972
684 Ga0307416_100298010 3300032002 Bacteria 1601
685 Ga0307416_100447062 3300032002 Bacteria 1344
686 Ga0307416_101270474 3300032002 Bacteria 842
687 Ga0307416_101430846 3300032002 Bacteria 797
688 Ga0307414_10047523 3300032004 Bacteria 2954
689 Ga0307414_10119020 3300032004 Bacteria 2027
690 Ga0307414_10199649 3300032004 Bacteria 1625
691 Ga0307414_10296164 3300032004 Bacteria 1366
692 Ga0307414_10558002 3300032004 Bacteria 1022
693 Ga0307411_10045891 3300032005 Bacteria 2813
694 Ga0307411_10294547 3300032005 Bacteria 1298
695 Ga0307415_100656958 3300032126 Bacteria 941
696 Ga0307507_10223120 3300033179 Bacteria 1263
697 Ga0307507_10303508 3300033179 Bacteria 976
698 Ga0307510_10003542 3300033180 Bacteria 18212
699 Ga0307510_10047315 3300033180 Bacteria 4611
700 Ga0307510_10079368 3300033180 Bacteria 3201
701 Ga0307510_10204680 3300033180 Bacteria 1503
702 Ga0373950_0029196 3300034818 Bacteria 1014
703 Ga0373926_0061259 3300035083 Bacteria 1372
704 Ga0373926_0125514 3300035083 Bacteria 969
705 Ga0373934_0001944 3300035086 Bacteria 7576
706 Ga0373934_0111782 3300035086 Bacteria 1108
707 Ga0373944_0042467 3300035089 Bacteria 1410
708 Ga0373944_0067651 3300035089 Bacteria 1158
709 Ga0373923_0014386 3300035111 Bacteria 2971
710 Ga0373923_0127939 3300035111 Bacteria 1139
711 Ga0373945_0035307 3300035116 Bacteria 1786
712 Ga0373945_0035348 3300035116 Bacteria 1785
713 Ga0373953_0002425 3300035117 Bacteria 5634
714 Ga0373953_0123953 3300035117 Bacteria 1099
715 Ga0373954_0083455 3300035118 Bacteria 1529
716 Ga0373954_0090801 3300035118 Bacteria 1467
717 Ga0373956_0013642 3300035119 Bacteria 3382
718 Ga0373956_0040515 3300035119 Bacteria 2066
719 Ga0373957_0121707 3300035120 Bacteria 1057
720 Ga0373943_0011441 3300035170 Bacteria 3993
721 Ga0373943_0029843 3300035170 Bacteria 2578
722 Ga0373943_0068861 3300035170 Bacteria 1788
723 Ga0373946_0235798 3300035171 Bacteria 888
724 Ga0373955_0106284 3300035172 Bacteria 1618
725 Ga0373955_0552309 3300035172 Bacteria 704
726 Ga0373962_0065095 3300035242 Bacteria 1078
727 Ga0373931_0009901 3300035691 Bacteria 4566
728 Ga0373931_0116490 3300035691 Bacteria 1522
729 Ga0373935_0050688 3300035692 Bacteria 2635
730 Ga0373927_0035225 3300035695 Bacteria 3255
731 Ga0373927_0302084 3300035695 Bacteria 1053
732 Ga0373933_0044922 3300035724 Bacteria 2618
733 Ga0373933_0062359 3300035724 Bacteria 2251
734 Ga0373933_0092523 3300035724 Bacteria 1867
735 Ga0373933_0237657 3300035724 Bacteria 1171
736 Ga0373947_0011021 3300035725 Bacteria 5187
737 Ga0373947_0034480 3300035725 Bacteria 2993
738 Ga0373947_0191593 3300035725 Bacteria 1334
739 Ga0373937_0012463 3300036401 Bacteria 7480
740 Ga0373937_0050109 3300036401 Bacteria 3824
741 Ga0373937_0056460 3300036401 Bacteria 3606
742 Ga0373937_0092168 3300036401 Bacteria 2808
743 Ga0373937_0312952 3300036401 Bacteria 1485
744 Ga0373937_0347217 3300036401 Bacteria 1405
745 Ga0373937_1153671 3300036401 Bacteria 723
746 Ga0373925_0024901 3300037068 Bacteria 4371
747 Ga0373925_0031882 3300037068 Bacteria 3877
748 Ga0373925_0048465 3300037068 Bacteria 3165
749 Ga0373925_0048913 3300037068 Bacteria 3151
750 Ga0373925_0075762 3300037068 Bacteria 2550
751 Ga0373925_0508910 3300037068 Bacteria 989
752 Ga0373925_0560284 3300037068 Bacteria 940
753 Ga0373925_0782778 3300037068 Bacteria 786
754 Ga0373925_0836834 3300037068 Bacteria 758
755 Ga0439436_0000592 3300041404 Bacteria 9612
756 Ga0439447_041199 3300041407 Bacteria 1125
757 Ga0439466_0006056 3300041411 Bacteria 4604
758 Ga0439465_0000761 3300041413 Bacteria 9995
759 Ga0451789_0309580 3300041443 Bacteria 567
760 Ga0451789_0336218 3300041443 Bacteria 1704
761 Ga0451789_0447876 3300041443 Bacteria 919
762 Ga0451789_0839090 3300041443 Bacteria 817
763 Ga0451793_0508741 3300041452 Bacteria 2127
764 Ga0451793_0660801 3300041452 Bacteria 664
765 Ga0451795_0895049 3300041456 Bacteria 1002
766 Ga0451798_0874042 3300041458 Bacteria 925
767 Ga0451800_0879857 3300041459 Bacteria 2460
768 Ga0451802_0480397 3300041460 Bacteria 2377
769 Ga0451804_1035411 3300041463 Bacteria 2196
770 Ga0451807_0573351 3300041486 Bacteria 1225
771 Ga0451833_0538022 3300041491 Bacteria 613
772 Ga0451837_1849440 3300041494 Bacteria 888
773 Ga0451849_1545266 3300041505 Bacteria 604
774 Ga0451843_0021787 3300041509 Bacteria 719
775 Ga0451853_0118375 3300041512 Bacteria 759
776 Ga0451853_0455726 3300041512 Bacteria 1238
777 Ga0451853_1347476 3300041512 Bacteria 797
778 Ga0451853_1937945 3300041512 Bacteria 2447
779 Ga0451853_3168548 3300041512 Bacteria 1285
780 Ga0439431_0001225 3300041997 Bacteria 5612
781 Ga0439431_0114009 3300041997 Bacteria 750
782 Ga0439433_0000449 3300041999 Bacteria 7568
783 Ga0439433_0025632 3300041999 Bacteria 1333
784 Ga0439442_002094 3300042002 Bacteria 3923
785 Ga0439448_0237542 3300042005 Bacteria 642
786 Ga0439432_000470 3300042006 Bacteria 15098
787 Ga0439449_0000890 3300042007 Bacteria 11651
788 Ga0439449_0054131 3300042007 Bacteria 1483
789 Ga0439452_000804 3300042010 Bacteria 14812
790 Ga0439457_005079 3300042014 Bacteria 3353
791 Ga0439462_0004541 3300042015 Bacteria 3396
792 Ga0450906_009092 3300042145 Bacteria 1903
793 Ga0439446_0001717 3300042156 Bacteria 5086
794 Ga0439464_0014380 3300042439 Bacteria 2127
795 Ga0453684_0001928 3300044712 Bacteria 53626
796 Ga0453684_0414336 3300044712 Bacteria 1506
797 Ga0451576_0151313 3300045051 Bacteria 2420
798 Ga0451576_0324954 3300045051 Bacteria 1610
799 Ga0495617_063032 3300046452 Bacteria 1225
800 Ga0495592_0000237 3300046454 Bacteria 47510
801 Ga0495603_0186978 3300046455 Bacteria 1198
802 Ga0495629_0356138 3300046459 Bacteria 998
803 Ga0495629_0862694 3300046459 Bacteria 595
804 Ga0495638_0081185 3300046460 Bacteria 1969
805 Ga0495653_0303809 3300046463 Bacteria 1040
806 Ga0495650_0052945 3300046471 Bacteria 1664
807 Ga0495580_0028788 3300046472 Bacteria 4036
808 Ga0495580_0100322 3300046472 Bacteria 2014
809 Ga0495582_0263663 3300046473 Bacteria 988
810 Ga0495639_0037083 3300046475 Bacteria 2185
811 Ga0495639_0232973 3300046475 Bacteria 907
812 Ga0495662_0043669 3300046476 Bacteria 2164
813 Ga0495662_0109570 3300046476 Bacteria 1353
814 Ga0495606_0220459 3300046507 Bacteria 1069
815 Ga0495608_0394374 3300046511 Bacteria 847
816 Ga0495610_0033947 3300046512 Bacteria 2632
817 Ga0495620_0133392 3300046515 Bacteria 974
818 Ga0495620_0215403 3300046515 Bacteria 736
819 Ga0495628_0546241 3300046516 Bacteria 832
820 Ga0495632_0004239 3300046519 Bacteria 9798
821 Ga0495632_0015113 3300046519 Bacteria 4340
822 Ga0495632_0155475 3300046519 Bacteria 1055
823 Ga0495637_0028720 3300046520 Bacteria 2481
824 Ga0495643_0027856 3300046522 Bacteria 3171
825 Ga0495648_0052752 3300046524 Bacteria 2468
826 Ga0495666_0071749 3300046526 Bacteria 1646
827 Ga0495666_0203785 3300046526 Bacteria 909
828 Ga0495642_0048223 3300046528 Bacteria 1746
829 Ga0495642_0066155 3300046528 Bacteria 1506
830 Ga0495665_0185392 3300046531 Bacteria 1080
831 Ga0495640_0384680 3300046533 Bacteria 863
832 Ga0495640_0443414 3300046533 Bacteria 794
833 Ga0495586_0110782 3300046535 Bacteria 1528
834 Ga0495586_0247947 3300046535 Bacteria 1016
835 Ga0495587_0413393 3300046536 Bacteria 749
836 Ga0495598_0022132 3300046537 Bacteria 1698
837 Ga0495598_0029268 3300046537 Bacteria 1534
838 Ga0495621_0078638 3300046539 Bacteria 1227
839 Ga0495621_0120558 3300046539 Bacteria 1013
840 Ga0495621_0132333 3300046539 Bacteria 971
841 Ga0495597_0244212 3300046542 Bacteria 707
842 Ga0495645_0040954 3300046543 Bacteria 3378
843 Ga0495633_0270483 3300046558 Bacteria 774
844 Ga0495667_0081112 3300046559 Bacteria 2109
845 Ga0495667_0154727 3300046559 Bacteria 1476
846 Ga0495634_0173094 3300046642 Bacteria 1356
847 Ga0495625_0000250 3300046660 Bacteria 84096
848 Ga0495625_0002839 3300046660 Bacteria 18202
849 Ga0495625_0033710 3300046660 Bacteria 3783
850 Ga0495635_0024341 3300046663 Bacteria 4220
851 Ga0495635_0039339 3300046663 Bacteria 3271
852 Ga0495635_0168591 3300046663 Bacteria 1489
853 Ga0495659_0015569 3300046664 Bacteria 2502
854 Ga0495661_0371687 3300046665 Bacteria 700
855 Ga0495588_0280947 3300046674 Bacteria 877
856 Ga0495623_0356522 3300046679 Bacteria 796
857 Ga0495646_0110692 3300046680 Bacteria 1564
858 Ga0495646_0116877 3300046680 Bacteria 1513
859 Ga0495647_0018159 3300046681 Bacteria 2499
860 Ga0495647_0132230 3300046681 Bacteria 1058
861 Ga0495647_0200505 3300046681 Bacteria 875
862 Ga0495658_0008454 3300046683 Bacteria 5100
863 Ga0495658_0031936 3300046683 Bacteria 2872
864 Ga0495658_0140345 3300046683 Bacteria 1477
865 Ga0495658_0239986 3300046683 Bacteria 1138
866 Ga0495613_0079797 3300046689 Bacteria 2379
867 Ga0495613_0552100 3300046689 Bacteria 771
868 Ga0495600_0142576 3300046809 Bacteria 1554
869 Ga0495600_0621364 3300046809 Bacteria 655
870 Ga0495660_0112047 3300046810 Bacteria 1391
871 Ga0495581_0034926 3300047315 Bacteria 2909
872 Ga0495636_0462665 3300047318 Bacteria 610
873 Ga0495674_0229393 3300047319 Bacteria 1533
874 Ga0495681_0256219 3300047470 Bacteria 689
875 Ga0495684_0048192 3300047471 Bacteria 3258
876 Ga0495684_0084397 3300047471 Bacteria 2409
877 Ga0495684_0759639 3300047471 Bacteria 637
878 Ga0495686_0150608 3300047472 Bacteria 1366
879 Ga0495602_0326662 3300048088 Bacteria 1114
880 Ga0495602_0638677 3300048088 Bacteria 728
881 Ga0495614_0123573 3300048089 Bacteria 1142
882 Ga0495614_0253342 3300048089 Bacteria 806
883 Ga0496100_0001162 3300048903 Bacteria 12807
884 Ga0496101_0020120 3300048904 Bacteria 4564
885 Ga0496102_0029174 3300048905 Bacteria 4934
886 Ga0496102_0080501 3300048905 Bacteria 3001
887 Ga0496102_0210901 3300048905 Bacteria 1831
888 Ga0496102_1712625 3300048905 Bacteria 546
889 Ga0496103_0005038 3300048906 Bacteria 7969
890 Ga0496103_0414978 3300048906 Bacteria 864
891 Ga0496104_0003675 3300048907 Bacteria 13249
892 Ga0496104_0035846 3300048907 Bacteria 4634
893 Ga0496104_0038441 3300048907 Bacteria 4478
894 Ga0496104_0721842 3300048907 Bacteria 904
895 Ga0496105_0002647 3300048908 Bacteria 13035
896 Ga0496105_0037483 3300048908 Bacteria 3992
897 Ga0496105_0089552 3300048908 Bacteria 2542
898 Ga0496106_0032767 3300048909 Bacteria 3875
899 Ga0496106_0106134 3300048909 Bacteria 2183
900 Ga0496106_0134457 3300048909 Bacteria 1941
901 Ga0496106_0311310 3300048909 Bacteria 1263
902 Ga0496107_0079063 3300048910 Bacteria 2397
903 Ga0496107_0079311 3300048910 Bacteria 2393
904 Ga0496108_0180201 3300048911 Bacteria 1829
905 Ga0496108_0209180 3300048911 Bacteria 1693
906 Ga0496108_0260481 3300048911 Bacteria 1509
907 Ga0496108_0409089 3300048911 Bacteria 1185
908 Ga0496108_0520621 3300048911 Bacteria 1038
909 Ga0496109_0008486 3300048912 Bacteria 8734
910 Ga0496109_0126638 3300048912 Bacteria 2382
911 Ga0496109_0303394 3300048912 Bacteria 1506
912 Ga0496109_0432002 3300048912 Bacteria 1244
913 Ga0496109_0912162 3300048912 Bacteria 817
914 Ga0496110_0052513 3300048913 Bacteria 3581
915 Ga0496110_0197732 3300048913 Bacteria 1826
916 Ga0496110_0299903 3300048913 Bacteria 1464
917 Ga0496110_1046320 3300048913 Bacteria 724
918 Ga0496110_1140457 3300048913 Bacteria 688
919 Ga0496111_0058232 3300048914 Bacteria 2797
920 Ga0496113_0753119 3300048916 Bacteria 775
921 Ga0496113_0769547 3300048916 Bacteria 766
922 Ga0496114_0014319 3300048917 Bacteria 6363
923 Ga0496114_0067881 3300048917 Bacteria 2992
924 Ga0496114_0292396 3300048917 Bacteria 1437
925 Ga0496116_0074249 3300048919 Bacteria 2140
926 Ga0496116_0135938 3300048919 Bacteria 1392
927 Ga0496117_0037929 3300048920 Bacteria 3582
928 Ga0496117_0059893 3300048920 Bacteria 2627
929 Ga0496118_0022064 3300048921 Bacteria 5581
930 Ga0496118_0258762 3300048921 Bacteria 984
931 Ga0496121_0034238 3300048924 Bacteria 4575
932 Ga0496121_0063784 3300048924 Bacteria 3007
933 Ga0496123_0048613 3300048926 Bacteria 2852
934 Ga0496123_0378850 3300048926 Bacteria 650
935 Ga0496124_0082228 3300048927 Bacteria 2644
936 Ga0496125_0023431 3300048928 Bacteria 5698
937 Ga0501034_0192997 3300049571 Bacteria 1998
938 Ga0501037_0277123 3300049573 Bacteria 1169
939 Ga0501068_0450524 3300049584 Bacteria 832
940 Ga0501249_001622 3300049679 Bacteria 4597
941 Ga0501262_000374 3300049759 Bacteria 5421
942 Ga0501044_1010103 3300049823 Bacteria 703
943 nmdc:mga0k408_138699_c1 3300050493 Bacteria 1446
944 nmdc:mga07m45_15933_c1 3300050496 Bacteria 4020
945 nmdc:mga07m45_294038_c1 3300050496 Bacteria 945
946 nmdc:mga07m45_93090_c1 3300050496 Bacteria 1728
947 nmdc:mga05p37_87180_c1 3300050507 Bacteria 3847
948 nmdc:mga0n895_161078_c1 3300050512 Bacteria 2275
949 nmdc:mga0n895_696389_c1 3300050512 Bacteria 1012
950 nmdc:mga0rr50_351399_c1 3300050513 Bacteria 1240
951 nmdc:mga0rr50_437703_c1 3300050513 Bacteria 1107
952 nmdc:mga08x19_48212_c1 3300050514 Bacteria 2728
953 nmdc:mga0a205_74496_c1 3300050515 Bacteria 3280
954 Ga0500610_0002609 3300053079 Bacteria 6694
955 Ga0500635_0269197 3300053080 Bacteria 670
956 Ga0495595_0038728 3300053084 Bacteria 2173
957 Ga0495619_0039996 3300053085 Bacteria 3063
958 Ga0500643_092695 3300053087 Bacteria 823
959 Ga0500644_0001746 3300053088 Bacteria 5626
960 Ga0500644_0132395 3300053088 Bacteria 983
961 Ga0500646_0037551 3300053090 Bacteria 1353
962 Ga0500646_0158474 3300053090 Bacteria 754
963 Ga0500583_0260407 3300053092 Bacteria 855
964 Ga0500651_0072961 3300053093 Bacteria 2133
965 Ga0500651_0145730 3300053093 Bacteria 1424
966 Ga0500562_058494 3300053108 Bacteria 1035
967 Ga0500569_045660 3300053109 Bacteria 1302
968 Ga0500594_0001437 3300053118 Bacteria 5165
969 Ga0500607_007465 3300053121 Bacteria 6754
970 Ga0500607_118496 3300053121 Bacteria 1285
971 Ga0500614_129267 3300053123 Bacteria 749
972 Ga0500623_205832 3300053127 Bacteria 719
973 Ga0500642_0185573 3300053130 Bacteria 971
974 Ga0500652_000312 3300053131 Bacteria 17547
975 Ga0500655_029829 3300053133 Bacteria 1047
976 Ga0500658_0021735 3300053134 Bacteria 2432
977 Ga0500559_0000602 3300053136 Bacteria 24517
978 Ga0500559_0008733 3300053136 Bacteria 4420
979 Ga0500564_170922 3300053138 Bacteria 913
980 Ga0500568_0018889 3300053139 Bacteria 3007
981 Ga0500568_0090790 3300053139 Bacteria 1152
982 Ga0500573_0157148 3300053140 Bacteria 1240
983 Ga0500577_0065142 3300053142 Bacteria 1413
984 Ga0500622_0000164 3300053156 Bacteria 70630
985 Ga0500622_0017664 3300053156 Bacteria 3796
986 Ga0500622_0096673 3300053156 Bacteria 1459
987 Ga0500636_0232308 3300053177 Bacteria 953
988 Ga0500636_0376878 3300053177 Bacteria 667
989 Ga0500625_058055 3300053729 Bacteria 1766
990 Ga0500596_015338 3300053735 Bacteria 1151
991 Ga0500587_032142 3300053739 Bacteria 724
992 2587730116 2585428057 Bacteria 6737412
993 2588293191 2588253510 Bacteria 6901809
994 2643968425 2643221592 Bacteria 6608788
995 2644141783 2643221625 Bacteria 6512927
996 2644272547 2643221648 Bacteria 6521465
997 2644302706 2643221654 Bacteria 5273570
998 2644396627 2643221672 Bacteria 6322190
999 2644468875 2643221683 Bacteria 5749203
1000 2842678032 2842677519 Bacteria 5615038
1001 2885195385 2885192300 Bacteria 5882526
1002 2885200464 2885198086 Bacteria 7212419
1003 2885214753 2885211737 Bacteria 7212420
1004 2894026022 2894023352 Bacteria 5167372
1005 2904450309 2904449895 Bacteria 6927402
1006 2904456869 2904456579 Bacteria 6819253
1007 2928120402 2928115317 Bacteria 6477646
1008 2929521013 2929520902 Bacteria 6765052
1009 2945913416 2945909444 Bacteria 7065066
1010 2954773096 2954767861 Bacteria 5535784
1011 Ga0070667_100022681
1012 JGI25151J46595_10104850
1013 rootL2_10065328
1014 Ga0055537_1000011
1015 Ga0055534_1000020
1016 Ga0055528_1000523
1017 Ga0055530_10010170
1018 Ga0055530_10018936
1019 Ga0055540_1002046
1020 Ga0055540_1004422
1021 Ga0055531_10006773
1022 Ga0065165_1002674
1023 Ga0070658_10614095
1024 Ga0070676_10009731
1025 Ga0070683_100041198
1026 Ga0070683_100634859
1027 Ga0070690_100041746
1028 Ga0070690_100786197
1029 Ga0070670_100001487
1030 Ga0070670_100055083
1031 Ga0070670_100089421
1032 Ga0070670_100125593
1033 Ga0070670_100127016
1034 Ga0070670_100135869
1035 Ga0070670_100189218
1036 Ga0070670_100221409
1037 Ga0070670_100489744
1038 Ga0070670_100790512
1039 Ga0070677_10022459
1040 Ga0070677_10143422
1041 Ga0070677_10165531
1042 Ga0070677_10172939
1043 Ga0068869_100007361
1044 Ga0068869_100039693
1045 Ga0068869_100104752
1046 Ga0068869_100471759
1047 Ga0068869_100937843
1048 Ga0070666_10002463
1049 Ga0070666_10022199
1050 Ga0070666_10078188
1051 Ga0070666_10304888
1052 Ga0070682_100046022
1053 Ga0068868_100012781
1054 Ga0068868_100053419
1055 Ga0068868_100060207
1056 Ga0068868_100094600
1057 Ga0068868_100163326
1058 Ga0068868_100321783
1059 Ga0068868_100786114
1060 Ga0068868_101399971
1061 Ga0070660_100027230
1062 Ga0070660_100155198
1063 Ga0070689_100001068
1064 Ga0070689_100084179
1065 Ga0070687_100026678
1066 Ga0070687_100131028
1067 Ga0070661_100046486
1068 Ga0070661_100214944
1069 Ga0070661_100676074
1070 Ga0070692_10380246
1071 Ga0070668_100255393
1072 Ga0070669_100348521
1073 Ga0070669_100468998
1074 Ga0070675_100010343
1075 Ga0070675_100016666
1076 Ga0070675_100145213
1077 Ga0070675_100271347
1078 Ga0070675_100538419
1079 Ga0070675_100783114
1080 Ga0070671_100010237
1081 Ga0070671_100014699
1082 Ga0070671_100036188
1083 Ga0070671_100042544
1084 Ga0070671_100111098
1085 Ga0070671_100168621
1086 Ga0070671_100206778
1087 Ga0070671_100347147
1088 Ga0070671_100940816
1089 Ga0070674_100670743
1090 Ga0070673_100003065
1091 Ga0070673_100007094
1092 Ga0070673_100016138
1093 Ga0070673_100409978
1094 Ga0070673_100430116
1095 Ga0070673_100581874
1096 Ga0070688_100011432
1097 Ga0070688_100169151
1098 Ga0070688_100191588
1099 Ga0070659_100014648
1100 Ga0070659_100563020
1101 Ga0070659_100568777
1102 Ga0070667_100010871
1103 Ga0070667_100020888
1104 Ga0070667_100037047
1105 Ga0070667_100044596
1106 Ga0070667_100582445
1107 Ga0070667_100679138
1108 Ga0070667_100708390
1109 Ga0070667_101204759
1110 Ga0070703_10039761
1111 Ga0070709_10027147
1112 Ga0070709_10028305
1113 Ga0070709_10219948
1114 Ga0070713_100000045
1115 Ga0070713_100001503
1116 Ga0070713_100049974
1117 Ga0070710_10052977
1118 Ga0070710_10286235
1119 Ga0070710_10535220
1120 Ga0070701_10210128
1121 Ga0070711_100103371
1122 Ga0070711_100578376
1123 Ga0070694_100005010
1124 Ga0070663_100027741
1125 Ga0070663_100186281
1126 Ga0070678_100002879
1127 Ga0070678_100009028
1128 Ga0070678_100047655
1129 Ga0070678_100075456
1130 Ga0070678_100079341
1131 Ga0070678_100140328
1132 Ga0070678_100163370
1133 Ga0070678_100253061
1134 Ga0070678_100415136
1135 Ga0070678_100701910
1136 Ga0070678_101184725
1137 Ga0070662_100008876
1138 Ga0070662_100025218
1139 Ga0070662_100031248
1140 Ga0070662_100206289
1141 Ga0070662_100319115
1142 Ga0068867_100118121
1143 Ga0068867_100368099
1144 Ga0068867_100403351
1145 Ga0070685_10067442
1146 Ga0070685_10274666
1147 Ga0070706_100047983
1148 Ga0070706_100133028
1149 Ga0070706_100281389
1150 Ga0070707_100102012
1151 Ga0070707_100377332
1152 Ga0070707_101454537
1153 Ga0070698_100009638
1154 Ga0070698_100116161
1155 Ga0070699_100010642
1156 Ga0070699_100407521
1157 Ga0070699_100485405
1158 Ga0070679_100126651
1159 Ga0070679_100223861
1160 Ga0070684_100098116
1161 Ga0070684_100114171
1162 Ga0070697_100042000
1163 Ga0070697_100101353
1164 Ga0070697_100102902
1165 Ga0068853_100043659
1166 Ga0070672_100011240
1167 Ga0070672_100011563
1168 Ga0070672_100027935
1169 Ga0070672_100146776
1170 Ga0070672_100159859
1171 Ga0070672_100283535
1172 Ga0070686_100129106
1173 Ga0070695_100037561
1174 Ga0070696_100393471
1175 Ga0070696_101091103
1176 Ga0070693_100010511
1177 Ga0070665_100016346
1178 Ga0070704_100088429
1179 Ga0070704_100157535
1180 Ga0070704_100546163
1181 Ga0068855_100297315
1182 Ga0070664_100030558
1183 Ga0070664_100161575
1184 Ga0070664_100200654
1185 Ga0070664_100327622
1186 Ga0070664_100331493
1187 Ga0070664_100409404
1188 Ga0070664_100450448
1189 Ga0068857_100141393
1190 Ga0068857_100470352
1191 Ga0068857_100783709
1192 Ga0068854_100024823
1193 Ga0068854_100105433
1194 Ga0068854_100294115
1195 Ga0068854_101353521
1196 Ga0068856_100015296
1197 Ga0068856_100043926
1198 Ga0068856_100433020
1199 Ga0070702_100028821
1200 Ga0070702_100245778
1201 Ga0068852_100037171
1202 Ga0068852_100056346
1203 Ga0068852_100389377
1204 Ga0068852_100676677
1205 Ga0068852_100730445
1206 Ga0068859_100003878
1207 Ga0068859_100023164
1208 Ga0068859_100026347
1209 Ga0068859_100161085
1210 Ga0068864_100009333
1211 Ga0068864_100022771
1212 Ga0068864_100120311
1213 Ga0068864_100168297
1214 Ga0068864_100286921
1215 Ga0068864_100473877
1216 Ga0068864_100672271
1217 Ga0068866_10149808
1218 Ga0068861_100273062
1219 Ga0068851_10015037
1220 Ga0068851_10018571
1221 Ga0068870_10255053
1222 Ga0068870_10420219
1223 Ga0068863_100007859
1224 Ga0068863_100020501
1225 Ga0068863_100023505
1226 Ga0068863_100113749
1227 Ga0068863_100158513
1228 Ga0068863_100333584
1229 Ga0068863_101095580
1230 Ga0068863_101260554
1231 Ga0068858_100000917
1232 Ga0068858_100002260
1233 Ga0068858_100108964
1234 Ga0068858_100912940
1235 Ga0068860_100018751
1236 Ga0068860_100058802
1237 Ga0068860_100146066
1238 Ga0068860_100957543
1239 Ga0070717_10353149
1240 Ga0075363_100308706
1241 Ga0075364_10132824
1242 Ga0075364_10191424
1243 Ga0070715_10195631
1244 Ga0070716_100094909
1245 Ga0070716_100318439
1246 Ga0070712_100053214
1247 Ga0070712_100643764
1248 Ga0075362_10017186
1249 Ga0075369_10464518
1250 Ga0075366_10139536
1251 Ga0075366_10322717
1252 Ga0097621_100012061
1253 Ga0097621_100014611
1254 Ga0097621_100039624
1255 Ga0097621_100099472
1256 Ga0097621_100182156
1257 Ga0097621_100235601
1258 Ga0075370_10003454
1259 Ga0075370_10016959
1260 Ga0075370_10077453
1261 Ga0075370_10297344
1262 Ga0075370_10645882
1263 Ga0068871_100015636
1264 Ga0068871_100070073
1265 Ga0068871_100133265
1266 Ga0068871_100180102
1267 Ga0068871_100206978
1268 Ga0068871_100584291
1269 Ga0075433_10081389
1270 Ga0075434_100223689
1271 Ga0068865_100103119
1272 Ga0068865_100395557
1273 Ga0075436_100122970
1274 Ga0075436_100194676
1275 Ga0075436_100951784
1276 Ga0097620_100003877
1277 Ga0097620_100023164
1278 Ga0097620_100026347
1279 Ga0097620_100161093
1280 Ga0079104_1045477
1281 Ga0099826_10000157
1282 Ga0075435_100077307
1283 Ga0075435_100092229
1284 Ga0105240_10040469
1285 Ga0111539_10657105
1286 Ga0105245_10002930
1287 Ga0105245_10015666
1288 Ga0105245_10076351
1289 Ga0105245_10096754
1290 Ga0105245_10193688
1291 Ga0105245_10878607
1292 Ga0105245_12512678
1293 Ga0105247_10047960
1294 Ga0114129_10054987
1295 Ga0114129_11326051
1296 Ga0105243_10012787
1297 Ga0105243_10073714
1298 Ga0105243_10646974
1299 Ga0105243_11541047
1300 Ga0105241_10047855
1301 Ga0105241_10290148
1302 Ga0105241_10322420
1303 Ga0105242_10175016
1304 Ga0105242_10217425
1305 Ga0105242_10474454
1306 Ga0105248_10031634
1307 Ga0105248_10125609
1308 Ga0105248_10219924
1309 Ga0105248_10596768
1310 Ga0105248_10798034
1311 Ga0105237_10697242
1312 Ga0105238_10160530
1313 Ga0105238_10219814
1314 Ga0105238_10345899
1315 Ga0105249_10039217
1316 Ga0105239_10090555
1317 Ga0105239_10314182
1318 Ga0105239_10454872
1319 Ga0105246_10024930
1320 Ga0105246_10085345
1321 Ga0105246_11632952
1322 Ga0157317_1003741
1323 Ga0157326_1038376
1324 Ga0157373_10074127
1325 Ga0157373_10497420
1326 Ga0157370_10036088
1327 Ga0157370_10334635
1328 Ga0157369_10033694
1329 Ga0157369_10572088
1330 Ga0157369_10593050
1331 Ga0157369_10973131
1332 Ga0157374_10000727
1333 Ga0157374_10055413
1334 Ga0157374_10634974
1335 Ga0157374_12071866
1336 Ga0157378_10026558
1337 Ga0157378_10085721
1338 Ga0157378_10272705
1339 Ga0163162_10020512
1340 Ga0163162_10036973
1341 Ga0163162_10056547
1342 Ga0163162_10193077
1343 Ga0163162_10263873
1344 Ga0163162_10264379
1345 Ga0163162_10549675
1346 Ga0163162_11549939
1347 Ga0157372_10080327
1348 Ga0157372_11192067
1349 Ga0157375_10024623
1350 Ga0157375_10046902
1351 Ga0157375_10113993
1352 Ga0157375_10124563
1353 Ga0157375_10154740
1354 Ga0157375_10197305
1355 Ga0157375_10480026
1356 Ga0157375_10490971
1357 Ga0157375_11677011
1358 Ga0163163_10001923
1359 Ga0163163_10003856
1360 Ga0163163_10094864
1361 Ga0163163_10255192
1362 Ga0163163_11001069
1363 Ga0163163_11162456
1364 Ga0163163_11264428
1365 Ga0157380_10275040
1366 Ga0157380_10769688
1367 Ga0182008_10001113
1368 Ga0182008_10003869
1369 Ga0182008_10339390
1370 Ga0157377_10010573
1371 Ga0157377_10192165
1372 Ga0157379_10009923
1373 Ga0157379_10019476
1374 Ga0157379_10080360
1375 Ga0157379_10086301
1376 Ga0157379_10146617
1377 Ga0157379_10290535
1378 Ga0157379_10405281
1379 Ga0157376_10014006
1380 Ga0157376_10091714
1381 Ga0157376_10093802
1382 Ga0157376_10368241
1383 Ga0157376_10677439
1384 Ga0157376_11424590
1385 Ga0182006_1004133
1386 Ga0182007_10002389
1387 Ga0182007_10003841
1388 Ga0182005_1107394
1389 Ga0163161_10008858
1390 Ga0163161_10069257
1391 Ga0163161_10147485
1392 Ga0163161_10282753
1393 Ga0209565_1000058
1394 Ga0209673_1000053
1395 Ga0209673_1001967
1396 Ga0209675_1000010
1397 Ga0209675_1001747
1398 Ga0209676_1002070
1399 Ga0209025_1008535
1400 Ga0209025_1018183
1401 Ga0209050_1000257
1402 Ga0209050_1001209
1403 Ga0209050_1012784
1404 Ga0209051_1000145
1405 Ga0209051_1009356
1406 Ga0209051_1068542
1407 Ga0209257_1000495
1408 Ga0207656_10033651
1409 Ga0207655_1011300
1410 Ga0207682_10030129
1411 Ga0207682_10057448
1412 Ga0207692_10065458
1413 Ga0207642_10097899
1414 Ga0207642_10309601
1415 Ga0207710_10079400
1416 Ga0207680_10069422
1417 Ga0207680_10134889
1418 Ga0207680_10146437
1419 Ga0207680_10174967
1420 Ga0207680_10548762
1421 Ga0207685_10057352
1422 Ga0207645_10001304
1423 Ga0207645_10017830
1424 Ga0207643_10065954
1425 Ga0207643_10097405
1426 Ga0207643_10392591
1427 Ga0207705_10064577
1428 Ga0207705_10489366
1429 Ga0207705_10587715
1430 Ga0207684_10039887
1431 Ga0207684_10051148
1432 Ga0207684_10053024
1433 Ga0207684_11353897
1434 Ga0207654_10025788
1435 Ga0207707_10340903
1436 Ga0207671_10131192
1437 Ga0207693_10000780
1438 Ga0207693_10515811
1439 Ga0207663_10044198
1440 Ga0207663_10490389
1441 Ga0207662_10086268
1442 Ga0207662_10115686
1443 Ga0207657_10004204
1444 Ga0207657_10921345
1445 Ga0207649_10039911
1446 Ga0207649_10189348
1447 Ga0207652_10169933
1448 Ga0207652_10186737
1449 Ga0207646_10050206
1450 Ga0207681_10212104
1451 Ga0207694_10078082
1452 Ga0207650_10010870
1453 Ga0207650_10072294
1454 Ga0207650_10075107
1455 Ga0207650_10101014
1456 Ga0207650_10115048
1457 Ga0207650_10123743
1458 Ga0207650_10157624
1459 Ga0207650_10166746
1460 Ga0207659_10010811
1461 Ga0207659_10011107
1462 Ga0207659_10021252
1463 Ga0207659_10030025
1464 Ga0207659_10040044
1465 Ga0207659_10264766
1466 Ga0207659_10934099
1467 Ga0207687_10007028
1468 Ga0207687_10007672
1469 Ga0207687_10010416
1470 Ga0207687_10161223
1471 Ga0207700_10000051
1472 Ga0207700_10025874
1473 Ga0207700_10761846
1474 Ga0207664_10034832
1475 Ga0207644_10000306
1476 Ga0207644_10002436
1477 Ga0207644_10020223
1478 Ga0207644_10090539
1479 Ga0207644_10180175
1480 Ga0207644_10328725
1481 Ga0207644_10399384
1482 Ga0207644_10842618
1483 Ga0207690_10435194
1484 Ga0207706_10016770
1485 Ga0207706_10026591
1486 Ga0207706_10035763
1487 Ga0207706_10037099
1488 Ga0207706_10209178
1489 Ga0207686_10375140
1490 Ga0207709_10004174
1491 Ga0207709_10268765
1492 Ga0207709_10288863
1493 Ga0207670_10002570
1494 Ga0207670_10042168
1495 Ga0207669_10230371
1496 Ga0207704_10390784
1497 Ga0207665_10009352
1498 Ga0207665_10015629
1499 Ga0207665_10162931
1500 Ga0207665_10226437
1501 Ga0207691_10009574
1502 Ga0207691_10014086
1503 Ga0207691_10050735
1504 Ga0207691_10099690
1505 Ga0207691_10149247
1506 Ga0207691_10348705
1507 Ga0207691_10385087
1508 Ga0207691_10488151
1509 Ga0207691_10589815
1510 Ga0207711_10002784
1511 Ga0207711_10005620
1512 Ga0207711_10009978
1513 Ga0207711_10150184
1514 Ga0207711_10361745
1515 Ga0207711_10896181
1516 Ga0207689_10052134
1517 Ga0207689_10087648
1518 Ga0207689_10114270
1519 Ga0207661_10082073
1520 Ga0207679_10009947
1521 Ga0207679_10027736
1522 Ga0207679_10157656
1523 Ga0207679_10271834
1524 Ga0207679_10659290
1525 Ga0207679_10892205
1526 Ga0207667_10243480
1527 Ga0207667_10605306
1528 Ga0207651_10000147
1529 Ga0207651_10057727
1530 Ga0207651_10064602
1531 Ga0207651_10069340
1532 Ga0207651_10157631
1533 Ga0207651_10165054
1534 Ga0207651_10352182
1535 Ga0207651_10628336
1536 Ga0207712_10214613
1537 Ga0207668_10333267
1538 Ga0207640_10020071
1539 Ga0207640_10094750
1540 Ga0207640_10113018
1541 Ga0207640_10203115
1542 Ga0207640_10402102
1543 Ga0207640_10724275
1544 Ga0207640_10787507
1545 Ga0207658_10020384
1546 Ga0207658_10028137
1547 Ga0207658_10032922
1548 Ga0207658_10049901
1549 Ga0207658_10056923
1550 Ga0207658_10095017
1551 Ga0207658_10101005
1552 Ga0207658_10209904
1553 Ga0207658_11073363
1554 Ga0207677_10000259
1555 Ga0207677_10002328
1556 Ga0207677_10074113
1557 Ga0207677_10096469
1558 Ga0207677_10307282
1559 Ga0207677_10956141
1560 Ga0207703_10002244
1561 Ga0207703_10010895
1562 Ga0207703_10054103
1563 Ga0207703_10666665
1564 Ga0207639_10073000
1565 Ga0207639_10156457
1566 Ga0207639_10269627
1567 Ga0207639_10501062
1568 Ga0207678_10031930
1569 Ga0207678_10136137
1570 Ga0207678_10197326
1571 Ga0207678_10254878
1572 Ga0207708_11672814
1573 Ga0207702_10035579
1574 Ga0207702_10041335
1575 Ga0207702_10085468
1576 Ga0207702_11256887
1577 Ga0207641_10011649
1578 Ga0207641_10042940
1579 Ga0207641_10061297
1580 Ga0207641_10102982
1581 Ga0207641_10165690
1582 Ga0207641_10262007
1583 Ga0207641_11003754
1584 Ga0207648_10002312
1585 Ga0207648_10073241
1586 Ga0207648_10130960
1587 Ga0207648_10148919
1588 Ga0207648_10637109
1589 Ga0207676_10000224
1590 Ga0207676_10020243
1591 Ga0207676_10054790
1592 Ga0207676_10092258
1593 Ga0207676_10112987
1594 Ga0207676_10126585
1595 Ga0207676_10248005
1596 Ga0207676_10589466
1597 Ga0207676_10723514
1598 Ga0207674_10035125
1599 Ga0207674_10054595
1600 Ga0207674_10069225
1601 Ga0207674_10269709
1602 Ga0207675_100170665
1603 Ga0207675_100409004
1604 Ga0207675_100608467
1605 Ga0207683_10000817
1606 Ga0207683_10026644
1607 Ga0207683_10046196
1608 Ga0207683_10051245
1609 Ga0207683_10069610
1610 Ga0207683_10071175
1611 Ga0207683_10121829
1612 Ga0207683_10265332
1613 Ga0207683_10394228
1614 Ga0207683_10534236
1615 Ga0207683_10710537
1616 Ga0207683_10779907
1617 Ga0207698_10018116
1618 Ga0207698_10057622
1619 Ga0207698_10064697
1620 Ga0207698_10482893
1621 Ga0207698_10700729
1622 Ga0207698_10766644
1623 Ga0209282_1000879
1624 Ga0209998_10026790
1625 Ga0268266_10005421
1626 Ga0268266_11448733
1627 Ga0268265_10601947
1628 Ga0268264_10020524
1629 Ga0268264_10036216
1630 Ga0268264_10122101
1631 Ga0268264_10478874
1632 Ga0268264_10737764
1633 Ga0268264_10865587
1634 Ga0268264_11084900
1635 Ga0307517_10419102
1636 Ga0307515_10037079
1637 Ga0307512_10047332
1638 Ga0316177_1108907
1639 Ga0316178_1161297
1640 Ga0316183_1077822
1641 Ga0316181_1283039
1642 Ga0265327_10009017
1643 Ga0265327_10206103
1644 Ga0307513_10036111
1645 Ga0307509_10006929
1646 Ga0307509_10040010
1647 Ga0307509_10048217
1648 Ga0307509_10055748
1649 Ga0307509_10169015
1650 Ga0307509_10204162
1651 Ga0307509_10440007
1652 Ga0307408_100058784
1653 Ga0307408_100142859
1654 Ga0307408_100170459
1655 Ga0307408_100240492
1656 Ga0307408_100411058
1657 Ga0307408_100720503
1658 Ga0307508_10001847
1659 Ga0307508_10003921
1660 Ga0307508_10256631
1661 Ga0307514_10101368
1662 Ga0307514_10315492
1663 Ga0307516_10014389
1664 Ga0307516_10019586
1665 Ga0307516_10402332
1666 Ga0307405_10014627
1667 Ga0307405_10077571
1668 Ga0307405_10186570
1669 Ga0307405_10214880
1670 Ga0307405_10406792
1671 Ga0307413_10028093
1672 Ga0307413_10402923
1673 Ga0307413_10564725
1674 Ga0307410_10040149
1675 Ga0307410_11413121
1676 Ga0307406_10006613
1677 Ga0307406_10017377
1678 Ga0307406_10080974
1679 Ga0307406_10212251
1680 Ga0307407_10049890
1681 Ga0307407_10321590
1682 Ga0307407_11056417
1683 Ga0307412_10036449
1684 Ga0307412_10083326
1685 Ga0307412_10359815
1686 Ga0307412_11255747
1687 Ga0307412_11328922
1688 Ga0307409_100039276
1689 Ga0307409_100089816
1690 Ga0307409_100401936
1691 Ga0307416_100021496
1692 Ga0307416_100162141
1693 Ga0307416_100181705
1694 Ga0307416_100298010
1695 Ga0307416_100447062
1696 Ga0307416_101270474
1697 Ga0307416_101430846
1698 Ga0307414_10047523
1699 Ga0307414_10119020
1700 Ga0307414_10199649
1701 Ga0307414_10296164
1702 Ga0307414_10558002
1703 Ga0307411_10045891
1704 Ga0307411_10294547
1705 Ga0307415_100656958
1706 Ga0307507_10223120
1707 Ga0307507_10303508
1708 Ga0307510_10003542
1709 Ga0307510_10047315
1710 Ga0307510_10079368
1711 Ga0307510_10204680
1712 Ga0373950_0029196
1713 Ga0373926_0061259
1714 Ga0373926_0125514
1715 Ga0373934_0001944
1716 Ga0373934_0111782
1717 Ga0373944_0042467
1718 Ga0373944_0067651
1719 Ga0373923_0014386
1720 Ga0373923_0127939
1721 Ga0373945_0035307
1722 Ga0373945_0035348
1723 Ga0373953_0002425
1724 Ga0373953_0123953
1725 Ga0373954_0083455
1726 Ga0373954_0090801
1727 Ga0373956_0013642
1728 Ga0373956_0040515
1729 Ga0373957_0121707
1730 Ga0373943_0011441
1731 Ga0373943_0029843
1732 Ga0373943_0068861
1733 Ga0373946_0235798
1734 Ga0373955_0106284
1735 Ga0373955_0552309
1736 Ga0373962_0065095
1737 Ga0373931_0009901
1738 Ga0373931_0116490
1739 Ga0373935_0050688
1740 Ga0373927_0035225
1741 Ga0373927_0302084
1742 Ga0373933_0044922
1743 Ga0373933_0062359
1744 Ga0373933_0092523
1745 Ga0373933_0237657
1746 Ga0373947_0011021
1747 Ga0373947_0034480
1748 Ga0373947_0191593
1749 Ga0373937_0012463
1750 Ga0373937_0050109
1751 Ga0373937_0056460
1752 Ga0373937_0092168
1753 Ga0373937_0312952
1754 Ga0373937_0347217
1755 Ga0373937_1153671
1756 Ga0373925_0024901
1757 Ga0373925_0031882
1758 Ga0373925_0048465
1759 Ga0373925_0048913
1760 Ga0373925_0075762
1761 Ga0373925_0508910
1762 Ga0373925_0560284
1763 Ga0373925_0782778
1764 Ga0373925_0836834
1765 Ga0439436_0000592
1766 Ga0439447_041199
1767 Ga0439466_0006056
1768 Ga0439465_0000761
1769 Ga0451789_0309580
1770 Ga0451789_0336218
1771 Ga0451789_0447876
1772 Ga0451789_0839090
1773 Ga0451793_0508741
1774 Ga0451793_0660801
1775 Ga0451795_0895049
1776 Ga0451798_0874042
1777 Ga0451800_0879857
1778 Ga0451802_0480397
1779 Ga0451804_1035411
1780 Ga0451807_0573351
1781 Ga0451833_0538022
1782 Ga0451837_1849440
1783 Ga0451849_1545266
1784 Ga0451843_0021787
1785 Ga0451853_0118375
1786 Ga0451853_0455726
1787 Ga0451853_1347476
1788 Ga0451853_1937945
1789 Ga0451853_3168548
1790 Ga0439431_0001225
1791 Ga0439431_0114009
1792 Ga0439433_0000449
1793 Ga0439433_0025632
1794 Ga0439442_002094
1795 Ga0439448_0237542
1796 Ga0439432_000470
1797 Ga0439449_0000890
1798 Ga0439449_0054131
1799 Ga0439452_000804
1800 Ga0439457_005079
1801 Ga0439462_0004541
1802 Ga0450906_009092
1803 Ga0439446_0001717
1804 Ga0439464_0014380
1805 Ga0453684_0001928
1806 Ga0453684_0414336
1807 Ga0451576_0151313
1808 Ga0451576_0324954
1809 Ga0495617_063032
1810 Ga0495592_0000237
1811 Ga0495603_0186978
1812 Ga0495629_0356138
1813 Ga0495629_0862694
1814 Ga0495638_0081185
1815 Ga0495653_0303809
1816 Ga0495650_0052945
1817 Ga0495580_0028788
1818 Ga0495580_0100322
1819 Ga0495582_0263663
1820 Ga0495639_0037083
1821 Ga0495639_0232973
1822 Ga0495662_0043669
1823 Ga0495662_0109570
1824 Ga0495606_0220459
1825 Ga0495608_0394374
1826 Ga0495610_0033947
1827 Ga0495620_0133392
1828 Ga0495620_0215403
1829 Ga0495628_0546241
1830 Ga0495632_0004239
1831 Ga0495632_0015113
1832 Ga0495632_0155475
1833 Ga0495637_0028720
1834 Ga0495643_0027856
1835 Ga0495648_0052752
1836 Ga0495666_0071749
1837 Ga0495666_0203785
1838 Ga0495642_0048223
1839 Ga0495642_0066155
1840 Ga0495665_0185392
1841 Ga0495640_0384680
1842 Ga0495640_0443414
1843 Ga0495586_0110782
1844 Ga0495586_0247947
1845 Ga0495587_0413393
1846 Ga0495598_0022132
1847 Ga0495598_0029268
1848 Ga0495621_0078638
1849 Ga0495621_0120558
1850 Ga0495621_0132333
1851 Ga0495597_0244212
1852 Ga0495645_0040954
1853 Ga0495633_0270483
1854 Ga0495667_0081112
1855 Ga0495667_0154727
1856 Ga0495634_0173094
1857 Ga0495625_0000250
1858 Ga0495625_0002839
1859 Ga0495625_0033710
1860 Ga0495635_0024341
1861 Ga0495635_0039339
1862 Ga0495635_0168591
1863 Ga0495659_0015569
1864 Ga0495661_0371687
1865 Ga0495588_0280947
1866 Ga0495623_0356522
1867 Ga0495646_0110692
1868 Ga0495646_0116877
1869 Ga0495647_0018159
1870 Ga0495647_0132230
1871 Ga0495647_0200505
1872 Ga0495658_0008454
1873 Ga0495658_0031936
1874 Ga0495658_0140345
1875 Ga0495658_0239986
1876 Ga0495613_0079797
1877 Ga0495613_0552100
1878 Ga0495600_0142576
1879 Ga0495600_0621364
1880 Ga0495660_0112047
1881 Ga0495581_0034926
1882 Ga0495636_0462665
1883 Ga0495674_0229393
1884 Ga0495681_0256219
1885 Ga0495684_0048192
1886 Ga0495684_0084397
1887 Ga0495684_0759639
1888 Ga0495686_0150608
1889 Ga0495602_0326662
1890 Ga0495602_0638677
1891 Ga0495614_0123573
1892 Ga0495614_0253342
1893 Ga0496100_0001162
1894 Ga0496101_0020120
1895 Ga0496102_0029174
1896 Ga0496102_0080501
1897 Ga0496102_0210901
1898 Ga0496102_1712625
1899 Ga0496103_0005038
1900 Ga0496103_0414978
1901 Ga0496104_0003675
1902 Ga0496104_0035846
1903 Ga0496104_0038441
1904 Ga0496104_0721842
1905 Ga0496105_0002647
1906 Ga0496105_0037483
1907 Ga0496105_0089552
1908 Ga0496106_0032767
1909 Ga0496106_0106134
1910 Ga0496106_0134457
1911 Ga0496106_0311310
1912 Ga0496107_0079063
1913 Ga0496107_0079311
1914 Ga0496108_0180201
1915 Ga0496108_0209180
1916 Ga0496108_0260481
1917 Ga0496108_0409089
1918 Ga0496108_0520621
1919 Ga0496109_0008486
1920 Ga0496109_0126638
1921 Ga0496109_0303394
1922 Ga0496109_0432002
1923 Ga0496109_0912162
1924 Ga0496110_0052513
1925 Ga0496110_0197732
1926 Ga0496110_0299903
1927 Ga0496110_1046320
1928 Ga0496110_1140457
1929 Ga0496111_0058232
1930 Ga0496113_0753119
1931 Ga0496113_0769547
1932 Ga0496114_0014319
1933 Ga0496114_0067881
1934 Ga0496114_0292396
1935 Ga0496116_0074249
1936 Ga0496116_0135938
1937 Ga0496117_0037929
1938 Ga0496117_0059893
1939 Ga0496118_0022064
1940 Ga0496118_0258762
1941 Ga0496121_0034238
1942 Ga0496121_0063784
1943 Ga0496123_0048613
1944 Ga0496123_0378850
1945 Ga0496124_0082228
1946 Ga0496125_0023431
1947 Ga0501034_0192997
1948 Ga0501037_0277123
1949 Ga0501068_0450524
1950 Ga0501249_001622
1951 Ga0501262_000374
1952 Ga0501044_1010103
1953 nmdc:mga0k408_138699_c1
1954 nmdc:mga07m45_15933_c1
1955 nmdc:mga07m45_294038_c1
1956 nmdc:mga07m45_93090_c1
1957 nmdc:mga05p37_87180_c1
1958 nmdc:mga0n895_161078_c1
1959 nmdc:mga0n895_696389_c1
1960 nmdc:mga0rr50_351399_c1
1961 nmdc:mga0rr50_437703_c1
1962 nmdc:mga08x19_48212_c1
1963 nmdc:mga0a205_74496_c1
1964 Ga0500610_0002609
1965 Ga0500635_0269197
1966 Ga0495595_0038728
1967 Ga0495619_0039996
1968 Ga0500643_092695
1969 Ga0500644_0001746
1970 Ga0500644_0132395
1971 Ga0500646_0037551
1972 Ga0500646_0158474
1973 Ga0500583_0260407
1974 Ga0500651_0072961
1975 Ga0500651_0145730
1976 Ga0500562_058494
1977 Ga0500569_045660
1978 Ga0500594_0001437
1979 Ga0500607_007465
1980 Ga0500607_118496
1981 Ga0500614_129267
1982 Ga0500623_205832
1983 Ga0500642_0185573
1984 Ga0500652_000312
1985 Ga0500655_029829
1986 Ga0500658_0021735
1987 Ga0500559_0000602
1988 Ga0500559_0008733
1989 Ga0500564_170922
1990 Ga0500568_0018889
1991 Ga0500568_0090790
1992 Ga0500573_0157148
1993 Ga0500577_0065142
1994 Ga0500622_0000164
1995 Ga0500622_0017664
1996 Ga0500622_0096673
1997 Ga0500636_0232308
1998 Ga0500636_0376878
1999 Ga0500625_058055
2000 Ga0500596_015338
2001 Ga0500587_032142
2002 2587730116
2003 2588293191
2004 2643968425
2005 2644141783
2006 2644272547
2007 2644302706
2008 2644396627
2009 2644468875
2010 2842678032
2011 2885195385
2012 2885200464
2013 2885214753
2014 2894026022
2015 2904450309
2016 2904456869
2017 2928120402
2018 2929521013
2019 2945913416
2020 2954773096

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

37

169

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cok-assembly1.cif.gz_A structural analysis of ing3 protein and its binding to histone h3 0.7828 74 154
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7276 2 154
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7047 2 154
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.6501 1 154
8cok-assembly1.cif.gz_A structural analysis of ing3 protein and its binding to histone h3 0.6095 74 154
ID Description Score Start End Superfamily
af_C4J9H4_130_217_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7511 42 154 1.20.1280.290
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7329 26 154 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7106 26 154 1.20.120.550
af_C4J9H4_130_217_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6929 42 154 1.20.1280.290
af_Q9ZV02_127_216_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6723 42 155 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A521QWN6-F1-model_v4 TRAP transporter small permease protein 0.9389 3 157 GO:0005886
GO:0015740
GO:0022857
AF-A0A2E2KVI2-F1-model_v4 TRAP transporter small permease protein 0.9274 1 156 GO:0005886
GO:0015740
GO:0022857
AF-A0A327M6J7-F1-model_v4 TRAP transporter small permease protein 0.9241 1 156 GO:0005886
GO:0015740
GO:0022857
AF-A0A432IXI5-F1-model_v4 TRAP transporter small permease protein 0.9139 30 156 GO:0005886
GO:0015740
GO:0022857
AF-A0A4Q5VS17-F1-model_v4 deleted 0.9102 1 156

Map