F488107
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1010 | 419 | 2020 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300005367|Ga0070667_100022681|Ga0070667_1000226812 |
| Length | 183 |
| Sequence | MAAAAAHSAAPPGALRRSLDALYDGAAALAGVFMVLLLVMVLLSILGRQLHFNLPGVDAYAGYMMAGTGFLALAHTLKNGEHIRVTLLIGALKGGWKRGFEVWALFAASLLALLAAFYSCKLAWQSYTFHDISTSNDATPLWLPELTMAIGTVVLAIAFVDELVLEWRGERVVVTPEEASHNE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 5 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 95 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 112 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 207 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 208 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 209 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 210 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 211 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 212 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 213 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 218 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 232 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 233 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 235 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 243 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 255 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 256 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 257 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 258 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 267 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 268 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 269 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 270 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 271 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 272 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 273 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 274 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 275 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 276 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 277 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 278 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 279 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 280 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 281 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 282 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 283 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 284 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 285 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 341 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 342 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 343 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 344 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 345 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 346 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 353 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 354 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 355 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 356 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 357 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 358 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 363 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 366 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 374 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 377 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 379 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 380 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 381 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 382 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 383 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 384 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 385 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 386 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 387 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 388 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 389 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 390 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 392 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 394 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 395 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 396 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 397 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 399 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 400 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 401 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 402 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 403 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 404 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 405 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 406 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 407 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 408 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 409 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 410 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 411 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 412 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 413 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 414 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 415 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 416 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 417 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 418 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 419 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.12 |
| Metatranscriptomes | 0 |
| Isolates | 1.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.62 |
| Nodule | 0.4 |
| Rhizoplane | 5.35 |
| Rhizosphere | 80.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070667_100022681 | 3300005367 | Bacteria | 5205 |
| 2 | JGI25151J46595_10104850 | 3300003187 | Bacteria | 752 |
| 3 | rootL2_10065328 | 3300003322 | Bacteria | 1505 |
| 4 | Ga0055537_1000011 | 3300003773 | Bacteria | 137556 |
| 5 | Ga0055534_1000020 | 3300003784 | Bacteria | 137562 |
| 6 | Ga0055528_1000523 | 3300003790 | Bacteria | 29840 |
| 7 | Ga0055530_10010170 | 3300003791 | Bacteria | 3513 |
| 8 | Ga0055530_10018936 | 3300003791 | Bacteria | 2103 |
| 9 | Ga0055540_1002046 | 3300003792 | Bacteria | 11159 |
| 10 | Ga0055540_1004422 | 3300003792 | Bacteria | 6347 |
| 11 | Ga0055531_10006773 | 3300003794 | Bacteria | 6404 |
| 12 | Ga0065165_1002674 | 3300005262 | Bacteria | 14381 |
| 13 | Ga0070658_10614095 | 3300005327 | Bacteria | 943 |
| 14 | Ga0070676_10009731 | 3300005328 | Bacteria | 5199 |
| 15 | Ga0070683_100041198 | 3300005329 | Bacteria | 4247 |
| 16 | Ga0070683_100634859 | 3300005329 | Bacteria | 1022 |
| 17 | Ga0070690_100041746 | 3300005330 | Bacteria | 2904 |
| 18 | Ga0070690_100786197 | 3300005330 | Bacteria | 737 |
| 19 | Ga0070670_100001487 | 3300005331 | Bacteria | 18885 |
| 20 | Ga0070670_100055083 | 3300005331 | Bacteria | 3413 |
| 21 | Ga0070670_100089421 | 3300005331 | Bacteria | 2647 |
| 22 | Ga0070670_100125593 | 3300005331 | Bacteria | 2214 |
| 23 | Ga0070670_100127016 | 3300005331 | Bacteria | 2201 |
| 24 | Ga0070670_100135869 | 3300005331 | Bacteria | 2125 |
| 25 | Ga0070670_100189218 | 3300005331 | Bacteria | 1788 |
| 26 | Ga0070670_100221409 | 3300005331 | Bacteria | 1646 |
| 27 | Ga0070670_100489744 | 3300005331 | Bacteria | 1092 |
| 28 | Ga0070670_100790512 | 3300005331 | Bacteria | 857 |
| 29 | Ga0070677_10022459 | 3300005333 | Bacteria | 2324 |
| 30 | Ga0070677_10143422 | 3300005333 | Bacteria | 1104 |
| 31 | Ga0070677_10165531 | 3300005333 | Bacteria | 1041 |
| 32 | Ga0070677_10172939 | 3300005333 | Bacteria | 1023 |
| 33 | Ga0068869_100007361 | 3300005334 | Bacteria | 7026 |
| 34 | Ga0068869_100039693 | 3300005334 | Bacteria | 3362 |
| 35 | Ga0068869_100104752 | 3300005334 | Bacteria | 2144 |
| 36 | Ga0068869_100471759 | 3300005334 | Bacteria | 1043 |
| 37 | Ga0068869_100937843 | 3300005334 | Bacteria | 751 |
| 38 | Ga0070666_10002463 | 3300005335 | Bacteria | 11197 |
| 39 | Ga0070666_10022199 | 3300005335 | Bacteria | 4119 |
| 40 | Ga0070666_10078188 | 3300005335 | Bacteria | 2258 |
| 41 | Ga0070666_10304888 | 3300005335 | Bacteria | 1135 |
| 42 | Ga0070682_100046022 | 3300005337 | Bacteria | 2707 |
| 43 | Ga0068868_100012781 | 3300005338 | Bacteria | 6142 |
| 44 | Ga0068868_100053419 | 3300005338 | Bacteria | 3183 |
| 45 | Ga0068868_100060207 | 3300005338 | Bacteria | 3005 |
| 46 | Ga0068868_100094600 | 3300005338 | Bacteria | 2411 |
| 47 | Ga0068868_100163326 | 3300005338 | Bacteria | 1841 |
| 48 | Ga0068868_100321783 | 3300005338 | Bacteria | 1318 |
| 49 | Ga0068868_100786114 | 3300005338 | Bacteria | 858 |
| 50 | Ga0068868_101399971 | 3300005338 | Bacteria | 652 |
| 51 | Ga0070660_100027230 | 3300005339 | Bacteria | 4264 |
| 52 | Ga0070660_100155198 | 3300005339 | Bacteria | 1842 |
| 53 | Ga0070689_100001068 | 3300005340 | Bacteria | 17186 |
| 54 | Ga0070689_100084179 | 3300005340 | Bacteria | 2499 |
| 55 | Ga0070687_100026678 | 3300005343 | Bacteria | 2784 |
| 56 | Ga0070687_100131028 | 3300005343 | Bacteria | 1448 |
| 57 | Ga0070661_100046486 | 3300005344 | Bacteria | 3175 |
| 58 | Ga0070661_100214944 | 3300005344 | Bacteria | 1473 |
| 59 | Ga0070661_100676074 | 3300005344 | Bacteria | 840 |
| 60 | Ga0070692_10380246 | 3300005345 | Bacteria | 886 |
| 61 | Ga0070668_100255393 | 3300005347 | Bacteria | 1456 |
| 62 | Ga0070669_100348521 | 3300005353 | Bacteria | 1201 |
| 63 | Ga0070669_100468998 | 3300005353 | Bacteria | 1040 |
| 64 | Ga0070675_100010343 | 3300005354 | Bacteria | 7286 |
| 65 | Ga0070675_100016666 | 3300005354 | Bacteria | 5832 |
| 66 | Ga0070675_100145213 | 3300005354 | Bacteria | 2031 |
| 67 | Ga0070675_100271347 | 3300005354 | Bacteria | 1489 |
| 68 | Ga0070675_100538419 | 3300005354 | Bacteria | 1055 |
| 69 | Ga0070675_100783114 | 3300005354 | Bacteria | 871 |
| 70 | Ga0070671_100010237 | 3300005355 | Bacteria | 7527 |
| 71 | Ga0070671_100014699 | 3300005355 | Bacteria | 6327 |
| 72 | Ga0070671_100036188 | 3300005355 | Bacteria | 4093 |
| 73 | Ga0070671_100042544 | 3300005355 | Bacteria | 3776 |
| 74 | Ga0070671_100111098 | 3300005355 | Bacteria | 2302 |
| 75 | Ga0070671_100168621 | 3300005355 | Bacteria | 1851 |
| 76 | Ga0070671_100206778 | 3300005355 | Bacteria | 1665 |
| 77 | Ga0070671_100347147 | 3300005355 | Bacteria | 1266 |
| 78 | Ga0070671_100940816 | 3300005355 | Bacteria | 756 |
| 79 | Ga0070674_100670743 | 3300005356 | Bacteria | 883 |
| 80 | Ga0070673_100003065 | 3300005364 | Bacteria | 10345 |
| 81 | Ga0070673_100007094 | 3300005364 | Bacteria | 7359 |
| 82 | Ga0070673_100016138 | 3300005364 | Bacteria | 5271 |
| 83 | Ga0070673_100409978 | 3300005364 | Bacteria | 1213 |
| 84 | Ga0070673_100430116 | 3300005364 | Bacteria | 1185 |
| 85 | Ga0070673_100581874 | 3300005364 | Bacteria | 1019 |
| 86 | Ga0070688_100011432 | 3300005365 | Bacteria | 4932 |
| 87 | Ga0070688_100169151 | 3300005365 | Bacteria | 1507 |
| 88 | Ga0070688_100191588 | 3300005365 | Bacteria | 1425 |
| 89 | Ga0070659_100014648 | 3300005366 | Bacteria | 5863 |
| 90 | Ga0070659_100563020 | 3300005366 | Bacteria | 977 |
| 91 | Ga0070659_100568777 | 3300005366 | Bacteria | 972 |
| 92 | Ga0070667_100010871 | 3300005367 | Bacteria | 7527 |
| 93 | Ga0070667_100020888 | 3300005367 | Bacteria | 5438 |
| 94 | Ga0070667_100037047 | 3300005367 | Bacteria | 4089 |
| 95 | Ga0070667_100044596 | 3300005367 | Bacteria | 3725 |
| 96 | Ga0070667_100582445 | 3300005367 | Bacteria | 1030 |
| 97 | Ga0070667_100679138 | 3300005367 | Bacteria | 952 |
| 98 | Ga0070667_100708390 | 3300005367 | Bacteria | 932 |
| 99 | Ga0070667_101204759 | 3300005367 | Bacteria | 709 |
| 100 | Ga0070703_10039761 | 3300005406 | Bacteria | 1459 |
| 101 | Ga0070709_10027147 | 3300005434 | Bacteria | 3402 |
| 102 | Ga0070709_10028305 | 3300005434 | Bacteria | 3341 |
| 103 | Ga0070709_10219948 | 3300005434 | Bacteria | 1354 |
| 104 | Ga0070713_100000045 | 3300005436 | Bacteria | 77398 |
| 105 | Ga0070713_100001503 | 3300005436 | Bacteria | 14866 |
| 106 | Ga0070713_100049974 | 3300005436 | Bacteria | 3451 |
| 107 | Ga0070710_10052977 | 3300005437 | Bacteria | 2283 |
| 108 | Ga0070710_10286235 | 3300005437 | Bacteria | 1071 |
| 109 | Ga0070710_10535220 | 3300005437 | Bacteria | 807 |
| 110 | Ga0070701_10210128 | 3300005438 | Bacteria | 1155 |
| 111 | Ga0070711_100103371 | 3300005439 | Bacteria | 2076 |
| 112 | Ga0070711_100578376 | 3300005439 | Bacteria | 935 |
| 113 | Ga0070694_100005010 | 3300005444 | Bacteria | 7991 |
| 114 | Ga0070663_100027741 | 3300005455 | Bacteria | 3849 |
| 115 | Ga0070663_100186281 | 3300005455 | Bacteria | 1613 |
| 116 | Ga0070678_100002879 | 3300005456 | Bacteria | 9527 |
| 117 | Ga0070678_100009028 | 3300005456 | Bacteria | 6006 |
| 118 | Ga0070678_100047655 | 3300005456 | Bacteria | 3081 |
| 119 | Ga0070678_100075456 | 3300005456 | Bacteria | 2536 |
| 120 | Ga0070678_100079341 | 3300005456 | Bacteria | 2482 |
| 121 | Ga0070678_100140328 | 3300005456 | Bacteria | 1933 |
| 122 | Ga0070678_100163370 | 3300005456 | Bacteria | 1806 |
| 123 | Ga0070678_100253061 | 3300005456 | Bacteria | 1478 |
| 124 | Ga0070678_100415136 | 3300005456 | Bacteria | 1172 |
| 125 | Ga0070678_100701910 | 3300005456 | Bacteria | 911 |
| 126 | Ga0070678_101184725 | 3300005456 | Bacteria | 708 |
| 127 | Ga0070662_100008876 | 3300005457 | Bacteria | 6553 |
| 128 | Ga0070662_100025218 | 3300005457 | Bacteria | 4104 |
| 129 | Ga0070662_100031248 | 3300005457 | Bacteria | 3736 |
| 130 | Ga0070662_100206289 | 3300005457 | Bacteria | 1562 |
| 131 | Ga0070662_100319115 | 3300005457 | Bacteria | 1266 |
| 132 | Ga0068867_100118121 | 3300005459 | Bacteria | 2045 |
| 133 | Ga0068867_100368099 | 3300005459 | Bacteria | 1204 |
| 134 | Ga0068867_100403351 | 3300005459 | Bacteria | 1154 |
| 135 | Ga0070685_10067442 | 3300005466 | Bacteria | 2111 |
| 136 | Ga0070685_10274666 | 3300005466 | Bacteria | 1126 |
| 137 | Ga0070706_100047983 | 3300005467 | Bacteria | 3942 |
| 138 | Ga0070706_100133028 | 3300005467 | Bacteria | 2321 |
| 139 | Ga0070706_100281389 | 3300005467 | Bacteria | 1552 |
| 140 | Ga0070707_100102012 | 3300005468 | Bacteria | 2780 |
| 141 | Ga0070707_100377332 | 3300005468 | Bacteria | 1377 |
| 142 | Ga0070707_101454537 | 3300005468 | Bacteria | 652 |
| 143 | Ga0070698_100009638 | 3300005471 | Bacteria | 10332 |
| 144 | Ga0070698_100116161 | 3300005471 | Bacteria | 2640 |
| 145 | Ga0070699_100010642 | 3300005518 | Bacteria | 7962 |
| 146 | Ga0070699_100407521 | 3300005518 | Bacteria | 1230 |
| 147 | Ga0070699_100485405 | 3300005518 | Bacteria | 1122 |
| 148 | Ga0070679_100126651 | 3300005530 | Bacteria | 2536 |
| 149 | Ga0070679_100223861 | 3300005530 | Bacteria | 1842 |
| 150 | Ga0070684_100098116 | 3300005535 | Bacteria | 2613 |
| 151 | Ga0070684_100114171 | 3300005535 | Bacteria | 2424 |
| 152 | Ga0070697_100042000 | 3300005536 | Bacteria | 3701 |
| 153 | Ga0070697_100101353 | 3300005536 | Bacteria | 2392 |
| 154 | Ga0070697_100102902 | 3300005536 | Bacteria | 2373 |
| 155 | Ga0068853_100043659 | 3300005539 | Bacteria | 3835 |
| 156 | Ga0070672_100011240 | 3300005543 | Bacteria | 6242 |
| 157 | Ga0070672_100011563 | 3300005543 | Bacteria | 6158 |
| 158 | Ga0070672_100027935 | 3300005543 | Bacteria | 4214 |
| 159 | Ga0070672_100146776 | 3300005543 | Bacteria | 1949 |
| 160 | Ga0070672_100159859 | 3300005543 | Bacteria | 1868 |
| 161 | Ga0070672_100283535 | 3300005543 | Bacteria | 1401 |
| 162 | Ga0070686_100129106 | 3300005544 | Bacteria | 1746 |
| 163 | Ga0070695_100037561 | 3300005545 | Bacteria | 3053 |
| 164 | Ga0070696_100393471 | 3300005546 | Bacteria | 1083 |
| 165 | Ga0070696_101091103 | 3300005546 | Bacteria | 671 |
| 166 | Ga0070693_100010511 | 3300005547 | Bacteria | 4640 |
| 167 | Ga0070665_100016346 | 3300005548 | Bacteria | 7440 |
| 168 | Ga0070704_100088429 | 3300005549 | Bacteria | 2302 |
| 169 | Ga0070704_100157535 | 3300005549 | Bacteria | 1792 |
| 170 | Ga0070704_100546163 | 3300005549 | Bacteria | 1012 |
| 171 | Ga0068855_100297315 | 3300005563 | Bacteria | 1788 |
| 172 | Ga0070664_100030558 | 3300005564 | Bacteria | 4495 |
| 173 | Ga0070664_100161575 | 3300005564 | Bacteria | 1982 |
| 174 | Ga0070664_100200654 | 3300005564 | Bacteria | 1780 |
| 175 | Ga0070664_100327622 | 3300005564 | Bacteria | 1389 |
| 176 | Ga0070664_100331493 | 3300005564 | Bacteria | 1381 |
| 177 | Ga0070664_100409404 | 3300005564 | Bacteria | 1241 |
| 178 | Ga0070664_100450448 | 3300005564 | Bacteria | 1182 |
| 179 | Ga0068857_100141393 | 3300005577 | Bacteria | 2176 |
| 180 | Ga0068857_100470352 | 3300005577 | Bacteria | 1177 |
| 181 | Ga0068857_100783709 | 3300005577 | Bacteria | 909 |
| 182 | Ga0068854_100024823 | 3300005578 | Bacteria | 4108 |
| 183 | Ga0068854_100105433 | 3300005578 | Bacteria | 2119 |
| 184 | Ga0068854_100294115 | 3300005578 | Bacteria | 1311 |
| 185 | Ga0068854_101353521 | 3300005578 | Bacteria | 642 |
| 186 | Ga0068856_100015296 | 3300005614 | Bacteria | 7414 |
| 187 | Ga0068856_100043926 | 3300005614 | Bacteria | 4396 |
| 188 | Ga0068856_100433020 | 3300005614 | Bacteria | 1335 |
| 189 | Ga0070702_100028821 | 3300005615 | Bacteria | 3012 |
| 190 | Ga0070702_100245778 | 3300005615 | Bacteria | 1210 |
| 191 | Ga0068852_100037171 | 3300005616 | Bacteria | 4080 |
| 192 | Ga0068852_100056346 | 3300005616 | Bacteria | 3396 |
| 193 | Ga0068852_100389377 | 3300005616 | Bacteria | 1369 |
| 194 | Ga0068852_100676677 | 3300005616 | Bacteria | 1041 |
| 195 | Ga0068852_100730445 | 3300005616 | Bacteria | 1002 |
| 196 | Ga0068859_100003878 | 3300005617 | Bacteria | 15277 |
| 197 | Ga0068859_100023164 | 3300005617 | Bacteria | 6230 |
| 198 | Ga0068859_100026347 | 3300005617 | Bacteria | 5829 |
| 199 | Ga0068859_100161085 | 3300005617 | Bacteria | 2323 |
| 200 | Ga0068864_100009333 | 3300005618 | Bacteria | 8092 |
| 201 | Ga0068864_100022771 | 3300005618 | Bacteria | 5254 |
| 202 | Ga0068864_100120311 | 3300005618 | Bacteria | 2347 |
| 203 | Ga0068864_100168297 | 3300005618 | Bacteria | 1997 |
| 204 | Ga0068864_100286921 | 3300005618 | Bacteria | 1538 |
| 205 | Ga0068864_100473877 | 3300005618 | Bacteria | 1201 |
| 206 | Ga0068864_100672271 | 3300005618 | Bacteria | 1010 |
| 207 | Ga0068866_10149808 | 3300005718 | Bacteria | 1350 |
| 208 | Ga0068861_100273062 | 3300005719 | Bacteria | 1452 |
| 209 | Ga0068851_10015037 | 3300005834 | Bacteria | 3682 |
| 210 | Ga0068851_10018571 | 3300005834 | Bacteria | 3350 |
| 211 | Ga0068870_10255053 | 3300005840 | Bacteria | 1089 |
| 212 | Ga0068870_10420219 | 3300005840 | Bacteria | 875 |
| 213 | Ga0068863_100007859 | 3300005841 | Bacteria | 10428 |
| 214 | Ga0068863_100020501 | 3300005841 | Bacteria | 6318 |
| 215 | Ga0068863_100023505 | 3300005841 | Bacteria | 5885 |
| 216 | Ga0068863_100113749 | 3300005841 | Bacteria | 2578 |
| 217 | Ga0068863_100158513 | 3300005841 | Bacteria | 2167 |
| 218 | Ga0068863_100333584 | 3300005841 | Bacteria | 1474 |
| 219 | Ga0068863_101095580 | 3300005841 | Bacteria | 801 |
| 220 | Ga0068863_101260554 | 3300005841 | Bacteria | 746 |
| 221 | Ga0068858_100000917 | 3300005842 | Bacteria | 30566 |
| 222 | Ga0068858_100002260 | 3300005842 | Bacteria | 19472 |
| 223 | Ga0068858_100108964 | 3300005842 | Bacteria | 2585 |
| 224 | Ga0068858_100912940 | 3300005842 | Bacteria | 859 |
| 225 | Ga0068860_100018751 | 3300005843 | Bacteria | 6723 |
| 226 | Ga0068860_100058802 | 3300005843 | Bacteria | 3655 |
| 227 | Ga0068860_100146066 | 3300005843 | Bacteria | 2276 |
| 228 | Ga0068860_100957543 | 3300005843 | Bacteria | 873 |
| 229 | Ga0070717_10353149 | 3300006028 | Bacteria | 1315 |
| 230 | Ga0075363_100308706 | 3300006048 | Bacteria | 919 |
| 231 | Ga0075364_10132824 | 3300006051 | Bacteria | 1671 |
| 232 | Ga0075364_10191424 | 3300006051 | Bacteria | 1385 |
| 233 | Ga0070715_10195631 | 3300006163 | Bacteria | 1024 |
| 234 | Ga0070716_100094909 | 3300006173 | Bacteria | 1814 |
| 235 | Ga0070716_100318439 | 3300006173 | Bacteria | 1089 |
| 236 | Ga0070712_100053214 | 3300006175 | Bacteria | 2826 |
| 237 | Ga0070712_100643764 | 3300006175 | Bacteria | 900 |
| 238 | Ga0075362_10017186 | 3300006177 | Bacteria | 2977 |
| 239 | Ga0075369_10464518 | 3300006186 | Bacteria | 600 |
| 240 | Ga0075366_10139536 | 3300006195 | Bacteria | 1465 |
| 241 | Ga0075366_10322717 | 3300006195 | Bacteria | 946 |
| 242 | Ga0097621_100012061 | 3300006237 | Bacteria | 6395 |
| 243 | Ga0097621_100014611 | 3300006237 | Bacteria | 5883 |
| 244 | Ga0097621_100039624 | 3300006237 | Bacteria | 3785 |
| 245 | Ga0097621_100099472 | 3300006237 | Bacteria | 2444 |
| 246 | Ga0097621_100182156 | 3300006237 | Bacteria | 1815 |
| 247 | Ga0097621_100235601 | 3300006237 | Bacteria | 1599 |
| 248 | Ga0075370_10003454 | 3300006353 | Bacteria | 7526 |
| 249 | Ga0075370_10016959 | 3300006353 | Bacteria | 3928 |
| 250 | Ga0075370_10077453 | 3300006353 | Bacteria | 1908 |
| 251 | Ga0075370_10297344 | 3300006353 | Bacteria | 960 |
| 252 | Ga0075370_10645882 | 3300006353 | Bacteria | 642 |
| 253 | Ga0068871_100015636 | 3300006358 | Bacteria | 5687 |
| 254 | Ga0068871_100070073 | 3300006358 | Bacteria | 2881 |
| 255 | Ga0068871_100133265 | 3300006358 | Bacteria | 2108 |
| 256 | Ga0068871_100180102 | 3300006358 | Bacteria | 1816 |
| 257 | Ga0068871_100206978 | 3300006358 | Bacteria | 1696 |
| 258 | Ga0068871_100584291 | 3300006358 | Bacteria | 1014 |
| 259 | Ga0075433_10081389 | 3300006852 | Bacteria | 2855 |
| 260 | Ga0075434_100223689 | 3300006871 | Bacteria | 1902 |
| 261 | Ga0068865_100103119 | 3300006881 | Bacteria | 2092 |
| 262 | Ga0068865_100395557 | 3300006881 | Bacteria | 1131 |
| 263 | Ga0075436_100122970 | 3300006914 | Bacteria | 1817 |
| 264 | Ga0075436_100194676 | 3300006914 | Bacteria | 1435 |
| 265 | Ga0075436_100951784 | 3300006914 | Bacteria | 643 |
| 266 | Ga0097620_100003877 | 3300006931 | Bacteria | 15277 |
| 267 | Ga0097620_100023164 | 3300006931 | Bacteria | 6230 |
| 268 | Ga0097620_100026347 | 3300006931 | Bacteria | 5829 |
| 269 | Ga0097620_100161093 | 3300006931 | Bacteria | 2323 |
| 270 | Ga0079104_1045477 | 3300006946 | Bacteria | 1002 |
| 271 | Ga0099826_10000157 | 3300006948 | Bacteria | 28404 |
| 272 | Ga0075435_100077307 | 3300007076 | Bacteria | 2729 |
| 273 | Ga0075435_100092229 | 3300007076 | Bacteria | 2501 |
| 274 | Ga0105240_10040469 | 3300009093 | Bacteria | 5959 |
| 275 | Ga0111539_10657105 | 3300009094 | Bacteria | 1221 |
| 276 | Ga0105245_10002930 | 3300009098 | Bacteria | 15318 |
| 277 | Ga0105245_10015666 | 3300009098 | Bacteria | 6612 |
| 278 | Ga0105245_10076351 | 3300009098 | Bacteria | 3052 |
| 279 | Ga0105245_10096754 | 3300009098 | Bacteria | 2725 |
| 280 | Ga0105245_10193688 | 3300009098 | Bacteria | 1949 |
| 281 | Ga0105245_10878607 | 3300009098 | Bacteria | 937 |
| 282 | Ga0105245_12512678 | 3300009098 | Bacteria | 568 |
| 283 | Ga0105247_10047960 | 3300009101 | Bacteria | 2624 |
| 284 | Ga0114129_10054987 | 3300009147 | Bacteria | 5579 |
| 285 | Ga0114129_11326051 | 3300009147 | Bacteria | 891 |
| 286 | Ga0105243_10012787 | 3300009148 | Bacteria | 6340 |
| 287 | Ga0105243_10073714 | 3300009148 | Bacteria | 2767 |
| 288 | Ga0105243_10646974 | 3300009148 | Bacteria | 1024 |
| 289 | Ga0105243_11541047 | 3300009148 | Bacteria | 689 |
| 290 | Ga0105241_10047855 | 3300009174 | Bacteria | 3253 |
| 291 | Ga0105241_10290148 | 3300009174 | Bacteria | 1400 |
| 292 | Ga0105241_10322420 | 3300009174 | Bacteria | 1333 |
| 293 | Ga0105242_10175016 | 3300009176 | Bacteria | 1889 |
| 294 | Ga0105242_10217425 | 3300009176 | Bacteria | 1706 |
| 295 | Ga0105242_10474454 | 3300009176 | Bacteria | 1184 |
| 296 | Ga0105248_10031634 | 3300009177 | Bacteria | 5911 |
| 297 | Ga0105248_10125609 | 3300009177 | Bacteria | 2894 |
| 298 | Ga0105248_10219924 | 3300009177 | Bacteria | 2138 |
| 299 | Ga0105248_10596768 | 3300009177 | Bacteria | 1246 |
| 300 | Ga0105248_10798034 | 3300009177 | Bacteria | 1065 |
| 301 | Ga0105237_10697242 | 3300009545 | Bacteria | 1022 |
| 302 | Ga0105238_10160530 | 3300009551 | Bacteria | 2223 |
| 303 | Ga0105238_10219814 | 3300009551 | Bacteria | 1876 |
| 304 | Ga0105238_10345899 | 3300009551 | Bacteria | 1475 |
| 305 | Ga0105249_10039217 | 3300009553 | Bacteria | 4300 |
| 306 | Ga0105239_10090555 | 3300010375 | Bacteria | 3375 |
| 307 | Ga0105239_10314182 | 3300010375 | Bacteria | 1766 |
| 308 | Ga0105239_10454872 | 3300010375 | Bacteria | 1453 |
| 309 | Ga0105246_10024930 | 3300011119 | Bacteria | 3894 |
| 310 | Ga0105246_10085345 | 3300011119 | Bacteria | 2261 |
| 311 | Ga0105246_11632952 | 3300011119 | Bacteria | 610 |
| 312 | Ga0157317_1003741 | 3300012475 | Bacteria | 962 |
| 313 | Ga0157326_1038376 | 3300012513 | Bacteria | 663 |
| 314 | Ga0157373_10074127 | 3300013100 | Bacteria | 2401 |
| 315 | Ga0157373_10497420 | 3300013100 | Bacteria | 880 |
| 316 | Ga0157370_10036088 | 3300013104 | Bacteria | 4800 |
| 317 | Ga0157370_10334635 | 3300013104 | Bacteria | 1396 |
| 318 | Ga0157369_10033694 | 3300013105 | Bacteria | 5627 |
| 319 | Ga0157369_10572088 | 3300013105 | Bacteria | 1167 |
| 320 | Ga0157369_10593050 | 3300013105 | Bacteria | 1144 |
| 321 | Ga0157369_10973131 | 3300013105 | Bacteria | 869 |
| 322 | Ga0157374_10000727 | 3300013296 | Bacteria | 28768 |
| 323 | Ga0157374_10055413 | 3300013296 | Bacteria | 3700 |
| 324 | Ga0157374_10634974 | 3300013296 | Bacteria | 1079 |
| 325 | Ga0157374_12071866 | 3300013296 | Bacteria | 596 |
| 326 | Ga0157378_10026558 | 3300013297 | Bacteria | 5104 |
| 327 | Ga0157378_10085721 | 3300013297 | Bacteria | 2854 |
| 328 | Ga0157378_10272705 | 3300013297 | Bacteria | 1628 |
| 329 | Ga0163162_10020512 | 3300013306 | Bacteria | 6493 |
| 330 | Ga0163162_10036973 | 3300013306 | Bacteria | 4870 |
| 331 | Ga0163162_10056547 | 3300013306 | Bacteria | 3951 |
| 332 | Ga0163162_10193077 | 3300013306 | Bacteria | 2164 |
| 333 | Ga0163162_10263873 | 3300013306 | Bacteria | 1854 |
| 334 | Ga0163162_10264379 | 3300013306 | Bacteria | 1852 |
| 335 | Ga0163162_10549675 | 3300013306 | Bacteria | 1283 |
| 336 | Ga0163162_11549939 | 3300013306 | Bacteria | 755 |
| 337 | Ga0157372_10080327 | 3300013307 | Bacteria | 3689 |
| 338 | Ga0157372_11192067 | 3300013307 | Bacteria | 880 |
| 339 | Ga0157375_10024623 | 3300013308 | Bacteria | 5574 |
| 340 | Ga0157375_10046902 | 3300013308 | Bacteria | 4216 |
| 341 | Ga0157375_10113993 | 3300013308 | Bacteria | 2805 |
| 342 | Ga0157375_10124563 | 3300013308 | Bacteria | 2691 |
| 343 | Ga0157375_10154740 | 3300013308 | Bacteria | 2431 |
| 344 | Ga0157375_10197305 | 3300013308 | Bacteria | 2168 |
| 345 | Ga0157375_10480026 | 3300013308 | Bacteria | 1408 |
| 346 | Ga0157375_10490971 | 3300013308 | Bacteria | 1392 |
| 347 | Ga0157375_11677011 | 3300013308 | Bacteria | 752 |
| 348 | Ga0163163_10001923 | 3300014325 | Bacteria | 17587 |
| 349 | Ga0163163_10003856 | 3300014325 | Bacteria | 12771 |
| 350 | Ga0163163_10094864 | 3300014325 | Bacteria | 3002 |
| 351 | Ga0163163_10255192 | 3300014325 | Bacteria | 1804 |
| 352 | Ga0163163_11001069 | 3300014325 | Bacteria | 899 |
| 353 | Ga0163163_11162456 | 3300014325 | Bacteria | 834 |
| 354 | Ga0163163_11264428 | 3300014325 | Bacteria | 800 |
| 355 | Ga0157380_10275040 | 3300014326 | Bacteria | 1537 |
| 356 | Ga0157380_10769688 | 3300014326 | Bacteria | 976 |
| 357 | Ga0182008_10001113 | 3300014497 | Bacteria | 18484 |
| 358 | Ga0182008_10003869 | 3300014497 | Bacteria | 8895 |
| 359 | Ga0182008_10339390 | 3300014497 | Bacteria | 794 |
| 360 | Ga0157377_10010573 | 3300014745 | Bacteria | 4568 |
| 361 | Ga0157377_10192165 | 3300014745 | Bacteria | 1291 |
| 362 | Ga0157379_10009923 | 3300014968 | Bacteria | 8294 |
| 363 | Ga0157379_10019476 | 3300014968 | Bacteria | 5994 |
| 364 | Ga0157379_10080360 | 3300014968 | Bacteria | 2920 |
| 365 | Ga0157379_10086301 | 3300014968 | Bacteria | 2814 |
| 366 | Ga0157379_10146617 | 3300014968 | Bacteria | 2128 |
| 367 | Ga0157379_10290535 | 3300014968 | Bacteria | 1489 |
| 368 | Ga0157379_10405281 | 3300014968 | Bacteria | 1254 |
| 369 | Ga0157376_10014006 | 3300014969 | Bacteria | 6002 |
| 370 | Ga0157376_10091714 | 3300014969 | Bacteria | 2632 |
| 371 | Ga0157376_10093802 | 3300014969 | Bacteria | 2606 |
| 372 | Ga0157376_10368241 | 3300014969 | Bacteria | 1380 |
| 373 | Ga0157376_10677439 | 3300014969 | Bacteria | 1034 |
| 374 | Ga0157376_11424590 | 3300014969 | Bacteria | 725 |
| 375 | Ga0182006_1004133 | 3300015261 | Bacteria | 7210 |
| 376 | Ga0182007_10002389 | 3300015262 | Bacteria | 9385 |
| 377 | Ga0182007_10003841 | 3300015262 | Bacteria | 6985 |
| 378 | Ga0182005_1107394 | 3300015265 | Bacteria | 786 |
| 379 | Ga0163161_10008858 | 3300017792 | Bacteria | 6958 |
| 380 | Ga0163161_10069257 | 3300017792 | Bacteria | 2579 |
| 381 | Ga0163161_10147485 | 3300017792 | Bacteria | 1786 |
| 382 | Ga0163161_10282753 | 3300017792 | Bacteria | 1302 |
| 383 | Ga0209565_1000058 | 3300025263 | Bacteria | 194126 |
| 384 | Ga0209673_1000053 | 3300025273 | Bacteria | 279449 |
| 385 | Ga0209673_1001967 | 3300025273 | Bacteria | 16064 |
| 386 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 387 | Ga0209675_1001747 | 3300025291 | Bacteria | 11945 |
| 388 | Ga0209676_1002070 | 3300025292 | Bacteria | 15585 |
| 389 | Ga0209025_1008535 | 3300025294 | Bacteria | 7354 |
| 390 | Ga0209025_1018183 | 3300025294 | Bacteria | 4008 |
| 391 | Ga0209050_1000257 | 3300025298 | Bacteria | 114186 |
| 392 | Ga0209050_1001209 | 3300025298 | Bacteria | 30287 |
| 393 | Ga0209050_1012784 | 3300025298 | Bacteria | 3808 |
| 394 | Ga0209051_1000145 | 3300025303 | Bacteria | 134807 |
| 395 | Ga0209051_1009356 | 3300025303 | Bacteria | 5061 |
| 396 | Ga0209051_1068542 | 3300025303 | Bacteria | 1079 |
| 397 | Ga0209257_1000495 | 3300025304 | Bacteria | 70401 |
| 398 | Ga0207656_10033651 | 3300025321 | Bacteria | 2136 |
| 399 | Ga0207655_1011300 | 3300025728 | Bacteria | 5326 |
| 400 | Ga0207682_10030129 | 3300025893 | Bacteria | 2172 |
| 401 | Ga0207682_10057448 | 3300025893 | Bacteria | 1622 |
| 402 | Ga0207692_10065458 | 3300025898 | Bacteria | 1896 |
| 403 | Ga0207642_10097899 | 3300025899 | Bacteria | 1465 |
| 404 | Ga0207642_10309601 | 3300025899 | Bacteria | 919 |
| 405 | Ga0207710_10079400 | 3300025900 | Bacteria | 1520 |
| 406 | Ga0207680_10069422 | 3300025903 | Bacteria | 2177 |
| 407 | Ga0207680_10134889 | 3300025903 | Bacteria | 1630 |
| 408 | Ga0207680_10146437 | 3300025903 | Bacteria | 1570 |
| 409 | Ga0207680_10174967 | 3300025903 | Bacteria | 1448 |
| 410 | Ga0207680_10548762 | 3300025903 | Bacteria | 825 |
| 411 | Ga0207685_10057352 | 3300025905 | Bacteria | 1527 |
| 412 | Ga0207645_10001304 | 3300025907 | Bacteria | 20534 |
| 413 | Ga0207645_10017830 | 3300025907 | Bacteria | 4681 |
| 414 | Ga0207643_10065954 | 3300025908 | Bacteria | 2075 |
| 415 | Ga0207643_10097405 | 3300025908 | Bacteria | 1721 |
| 416 | Ga0207643_10392591 | 3300025908 | Bacteria | 876 |
| 417 | Ga0207705_10064577 | 3300025909 | Bacteria | 2645 |
| 418 | Ga0207705_10489366 | 3300025909 | Bacteria | 955 |
| 419 | Ga0207705_10587715 | 3300025909 | Bacteria | 866 |
| 420 | Ga0207684_10039887 | 3300025910 | Bacteria | 3980 |
| 421 | Ga0207684_10051148 | 3300025910 | Bacteria | 3505 |
| 422 | Ga0207684_10053024 | 3300025910 | Bacteria | 3443 |
| 423 | Ga0207684_11353897 | 3300025910 | Bacteria | 584 |
| 424 | Ga0207654_10025788 | 3300025911 | Bacteria | 3176 |
| 425 | Ga0207707_10340903 | 3300025912 | Bacteria | 1292 |
| 426 | Ga0207671_10131192 | 3300025914 | Bacteria | 1923 |
| 427 | Ga0207693_10000780 | 3300025915 | Bacteria | 28514 |
| 428 | Ga0207693_10515811 | 3300025915 | Bacteria | 933 |
| 429 | Ga0207663_10044198 | 3300025916 | Bacteria | 2733 |
| 430 | Ga0207663_10490389 | 3300025916 | Bacteria | 953 |
| 431 | Ga0207662_10086268 | 3300025918 | Bacteria | 1923 |
| 432 | Ga0207662_10115686 | 3300025918 | Bacteria | 1676 |
| 433 | Ga0207657_10004204 | 3300025919 | Bacteria | 15251 |
| 434 | Ga0207657_10921345 | 3300025919 | Bacteria | 673 |
| 435 | Ga0207649_10039911 | 3300025920 | Bacteria | 2849 |
| 436 | Ga0207649_10189348 | 3300025920 | Bacteria | 1446 |
| 437 | Ga0207652_10169933 | 3300025921 | Bacteria | 1956 |
| 438 | Ga0207652_10186737 | 3300025921 | Bacteria | 1864 |
| 439 | Ga0207646_10050206 | 3300025922 | Bacteria | 3734 |
| 440 | Ga0207681_10212104 | 3300025923 | Bacteria | 1493 |
| 441 | Ga0207694_10078082 | 3300025924 | Bacteria | 2595 |
| 442 | Ga0207650_10010870 | 3300025925 | Bacteria | 6254 |
| 443 | Ga0207650_10072294 | 3300025925 | Bacteria | 2596 |
| 444 | Ga0207650_10075107 | 3300025925 | Bacteria | 2550 |
| 445 | Ga0207650_10101014 | 3300025925 | Bacteria | 2220 |
| 446 | Ga0207650_10115048 | 3300025925 | Bacteria | 2087 |
| 447 | Ga0207650_10123743 | 3300025925 | Bacteria | 2016 |
| 448 | Ga0207650_10157624 | 3300025925 | Bacteria | 1796 |
| 449 | Ga0207650_10166746 | 3300025925 | Bacteria | 1748 |
| 450 | Ga0207659_10010811 | 3300025926 | Bacteria | 5746 |
| 451 | Ga0207659_10011107 | 3300025926 | Bacteria | 5681 |
| 452 | Ga0207659_10021252 | 3300025926 | Bacteria | 4304 |
| 453 | Ga0207659_10030025 | 3300025926 | Bacteria | 3710 |
| 454 | Ga0207659_10040044 | 3300025926 | Bacteria | 3274 |
| 455 | Ga0207659_10264766 | 3300025926 | Bacteria | 1400 |
| 456 | Ga0207659_10934099 | 3300025926 | Bacteria | 746 |
| 457 | Ga0207687_10007028 | 3300025927 | Bacteria | 7421 |
| 458 | Ga0207687_10007672 | 3300025927 | Bacteria | 7088 |
| 459 | Ga0207687_10010416 | 3300025927 | Bacteria | 6075 |
| 460 | Ga0207687_10161223 | 3300025927 | Bacteria | 1721 |
| 461 | Ga0207700_10000051 | 3300025928 | Bacteria | 77057 |
| 462 | Ga0207700_10025874 | 3300025928 | Bacteria | 4083 |
| 463 | Ga0207700_10761846 | 3300025928 | Bacteria | 865 |
| 464 | Ga0207664_10034832 | 3300025929 | Bacteria | 3880 |
| 465 | Ga0207644_10000306 | 3300025931 | Bacteria | 31833 |
| 466 | Ga0207644_10002436 | 3300025931 | Bacteria | 11995 |
| 467 | Ga0207644_10020223 | 3300025931 | Bacteria | 4524 |
| 468 | Ga0207644_10090539 | 3300025931 | Bacteria | 2279 |
| 469 | Ga0207644_10180175 | 3300025931 | Bacteria | 1655 |
| 470 | Ga0207644_10328725 | 3300025931 | Bacteria | 1237 |
| 471 | Ga0207644_10399384 | 3300025931 | Bacteria | 1123 |
| 472 | Ga0207644_10842618 | 3300025931 | Bacteria | 767 |
| 473 | Ga0207690_10435194 | 3300025932 | Bacteria | 1052 |
| 474 | Ga0207706_10016770 | 3300025933 | Bacteria | 6611 |
| 475 | Ga0207706_10026591 | 3300025933 | Bacteria | 5179 |
| 476 | Ga0207706_10035763 | 3300025933 | Bacteria | 4413 |
| 477 | Ga0207706_10037099 | 3300025933 | Bacteria | 4328 |
| 478 | Ga0207706_10209178 | 3300025933 | Bacteria | 1710 |
| 479 | Ga0207686_10375140 | 3300025934 | Bacteria | 1077 |
| 480 | Ga0207709_10004174 | 3300025935 | Bacteria | 8400 |
| 481 | Ga0207709_10268765 | 3300025935 | Bacteria | 1254 |
| 482 | Ga0207709_10288863 | 3300025935 | Bacteria | 1214 |
| 483 | Ga0207670_10002570 | 3300025936 | Bacteria | 9545 |
| 484 | Ga0207670_10042168 | 3300025936 | Bacteria | 3005 |
| 485 | Ga0207669_10230371 | 3300025937 | Bacteria | 1366 |
| 486 | Ga0207704_10390784 | 3300025938 | Bacteria | 1095 |
| 487 | Ga0207665_10009352 | 3300025939 | Bacteria | 6433 |
| 488 | Ga0207665_10015629 | 3300025939 | Bacteria | 4982 |
| 489 | Ga0207665_10162931 | 3300025939 | Bacteria | 1605 |
| 490 | Ga0207665_10226437 | 3300025939 | Bacteria | 1373 |
| 491 | Ga0207691_10009574 | 3300025940 | Bacteria | 9300 |
| 492 | Ga0207691_10014086 | 3300025940 | Bacteria | 7631 |
| 493 | Ga0207691_10050735 | 3300025940 | Bacteria | 3797 |
| 494 | Ga0207691_10099690 | 3300025940 | Bacteria | 2594 |
| 495 | Ga0207691_10149247 | 3300025940 | Bacteria | 2056 |
| 496 | Ga0207691_10348705 | 3300025940 | Bacteria | 1267 |
| 497 | Ga0207691_10385087 | 3300025940 | Bacteria | 1197 |
| 498 | Ga0207691_10488151 | 3300025940 | Bacteria | 1046 |
| 499 | Ga0207691_10589815 | 3300025940 | Bacteria | 941 |
| 500 | Ga0207711_10002784 | 3300025941 | Bacteria | 15381 |
| 501 | Ga0207711_10005620 | 3300025941 | Bacteria | 10602 |
| 502 | Ga0207711_10009978 | 3300025941 | Bacteria | 7892 |
| 503 | Ga0207711_10150184 | 3300025941 | Bacteria | 2102 |
| 504 | Ga0207711_10361745 | 3300025941 | Bacteria | 1344 |
| 505 | Ga0207711_10896181 | 3300025941 | Bacteria | 825 |
| 506 | Ga0207689_10052134 | 3300025942 | Bacteria | 3372 |
| 507 | Ga0207689_10087648 | 3300025942 | Bacteria | 2557 |
| 508 | Ga0207689_10114270 | 3300025942 | Bacteria | 2219 |
| 509 | Ga0207661_10082073 | 3300025944 | Bacteria | 2664 |
| 510 | Ga0207679_10009947 | 3300025945 | Bacteria | 6108 |
| 511 | Ga0207679_10027736 | 3300025945 | Bacteria | 3920 |
| 512 | Ga0207679_10157656 | 3300025945 | Bacteria | 1855 |
| 513 | Ga0207679_10271834 | 3300025945 | Bacteria | 1450 |
| 514 | Ga0207679_10659290 | 3300025945 | Bacteria | 947 |
| 515 | Ga0207679_10892205 | 3300025945 | Bacteria | 813 |
| 516 | Ga0207667_10243480 | 3300025949 | Bacteria | 1840 |
| 517 | Ga0207667_10605306 | 3300025949 | Bacteria | 1105 |
| 518 | Ga0207651_10000147 | 3300025960 | Bacteria | 30931 |
| 519 | Ga0207651_10057727 | 3300025960 | Bacteria | 2679 |
| 520 | Ga0207651_10064602 | 3300025960 | Bacteria | 2562 |
| 521 | Ga0207651_10069340 | 3300025960 | Bacteria | 2489 |
| 522 | Ga0207651_10157631 | 3300025960 | Bacteria | 1776 |
| 523 | Ga0207651_10165054 | 3300025960 | Bacteria | 1740 |
| 524 | Ga0207651_10352182 | 3300025960 | Bacteria | 1240 |
| 525 | Ga0207651_10628336 | 3300025960 | Bacteria | 941 |
| 526 | Ga0207712_10214613 | 3300025961 | Bacteria | 1535 |
| 527 | Ga0207668_10333267 | 3300025972 | Bacteria | 1263 |
| 528 | Ga0207640_10020071 | 3300025981 | Bacteria | 3961 |
| 529 | Ga0207640_10094750 | 3300025981 | Bacteria | 2077 |
| 530 | Ga0207640_10113018 | 3300025981 | Bacteria | 1929 |
| 531 | Ga0207640_10203115 | 3300025981 | Bacteria | 1503 |
| 532 | Ga0207640_10402102 | 3300025981 | Bacteria | 1116 |
| 533 | Ga0207640_10724275 | 3300025981 | Bacteria | 855 |
| 534 | Ga0207640_10787507 | 3300025981 | Bacteria | 823 |
| 535 | Ga0207658_10020384 | 3300025986 | Bacteria | 4591 |
| 536 | Ga0207658_10028137 | 3300025986 | Bacteria | 3956 |
| 537 | Ga0207658_10032922 | 3300025986 | Bacteria | 3694 |
| 538 | Ga0207658_10049901 | 3300025986 | Bacteria | 3077 |
| 539 | Ga0207658_10056923 | 3300025986 | Bacteria | 2903 |
| 540 | Ga0207658_10095017 | 3300025986 | Bacteria | 2321 |
| 541 | Ga0207658_10101005 | 3300025986 | Bacteria | 2259 |
| 542 | Ga0207658_10209904 | 3300025986 | Bacteria | 1631 |
| 543 | Ga0207658_11073363 | 3300025986 | Bacteria | 735 |
| 544 | Ga0207677_10000259 | 3300026023 | Bacteria | 40630 |
| 545 | Ga0207677_10002328 | 3300026023 | Bacteria | 9969 |
| 546 | Ga0207677_10074113 | 3300026023 | Bacteria | 2414 |
| 547 | Ga0207677_10096469 | 3300026023 | Bacteria | 2163 |
| 548 | Ga0207677_10307282 | 3300026023 | Bacteria | 1312 |
| 549 | Ga0207677_10956141 | 3300026023 | Bacteria | 775 |
| 550 | Ga0207703_10002244 | 3300026035 | Bacteria | 16902 |
| 551 | Ga0207703_10010895 | 3300026035 | Bacteria | 7089 |
| 552 | Ga0207703_10054103 | 3300026035 | Bacteria | 3263 |
| 553 | Ga0207703_10666665 | 3300026035 | Bacteria | 988 |
| 554 | Ga0207639_10073000 | 3300026041 | Bacteria | 2688 |
| 555 | Ga0207639_10156457 | 3300026041 | Bacteria | 1915 |
| 556 | Ga0207639_10269627 | 3300026041 | Bacteria | 1492 |
| 557 | Ga0207639_10501062 | 3300026041 | Bacteria | 1109 |
| 558 | Ga0207678_10031930 | 3300026067 | Bacteria | 4591 |
| 559 | Ga0207678_10136137 | 3300026067 | Bacteria | 2096 |
| 560 | Ga0207678_10197326 | 3300026067 | Bacteria | 1720 |
| 561 | Ga0207678_10254878 | 3300026067 | Bacteria | 1503 |
| 562 | Ga0207708_11672814 | 3300026075 | Unclassified | 559 |
| 563 | Ga0207702_10035579 | 3300026078 | Bacteria | 4164 |
| 564 | Ga0207702_10041335 | 3300026078 | Bacteria | 3866 |
| 565 | Ga0207702_10085468 | 3300026078 | Bacteria | 2749 |
| 566 | Ga0207702_11256887 | 3300026078 | Unclassified | 735 |
| 567 | Ga0207641_10011649 | 3300026088 | Bacteria | 7221 |
| 568 | Ga0207641_10042940 | 3300026088 | Bacteria | 3794 |
| 569 | Ga0207641_10061297 | 3300026088 | Bacteria | 3208 |
| 570 | Ga0207641_10102982 | 3300026088 | Bacteria | 2518 |
| 571 | Ga0207641_10165690 | 3300026088 | Bacteria | 2012 |
| 572 | Ga0207641_10262007 | 3300026088 | Bacteria | 1619 |
| 573 | Ga0207641_11003754 | 3300026088 | Bacteria | 831 |
| 574 | Ga0207648_10002312 | 3300026089 | Bacteria | 20575 |
| 575 | Ga0207648_10073241 | 3300026089 | Bacteria | 2986 |
| 576 | Ga0207648_10130960 | 3300026089 | Bacteria | 2208 |
| 577 | Ga0207648_10148919 | 3300026089 | Bacteria | 2065 |
| 578 | Ga0207648_10637109 | 3300026089 | Bacteria | 984 |
| 579 | Ga0207676_10000224 | 3300026095 | Bacteria | 48921 |
| 580 | Ga0207676_10020243 | 3300026095 | Bacteria | 4864 |
| 581 | Ga0207676_10054790 | 3300026095 | Bacteria | 3126 |
| 582 | Ga0207676_10092258 | 3300026095 | Bacteria | 2490 |
| 583 | Ga0207676_10112987 | 3300026095 | Bacteria | 2276 |
| 584 | Ga0207676_10126585 | 3300026095 | Bacteria | 2164 |
| 585 | Ga0207676_10248005 | 3300026095 | Bacteria | 1601 |
| 586 | Ga0207676_10589466 | 3300026095 | Bacteria | 1066 |
| 587 | Ga0207676_10723514 | 3300026095 | Bacteria | 966 |
| 588 | Ga0207674_10035125 | 3300026116 | Bacteria | 5233 |
| 589 | Ga0207674_10054595 | 3300026116 | Bacteria | 4067 |
| 590 | Ga0207674_10069225 | 3300026116 | Bacteria | 3550 |
| 591 | Ga0207674_10269709 | 3300026116 | Bacteria | 1649 |
| 592 | Ga0207675_100170665 | 3300026118 | Bacteria | 2079 |
| 593 | Ga0207675_100409004 | 3300026118 | Bacteria | 1338 |
| 594 | Ga0207675_100608467 | 3300026118 | Bacteria | 1096 |
| 595 | Ga0207683_10000817 | 3300026121 | Bacteria | 28494 |
| 596 | Ga0207683_10026644 | 3300026121 | Bacteria | 4992 |
| 597 | Ga0207683_10046196 | 3300026121 | Bacteria | 3810 |
| 598 | Ga0207683_10051245 | 3300026121 | Bacteria | 3616 |
| 599 | Ga0207683_10069610 | 3300026121 | Bacteria | 3108 |
| 600 | Ga0207683_10071175 | 3300026121 | Bacteria | 3074 |
| 601 | Ga0207683_10121829 | 3300026121 | Bacteria | 2342 |
| 602 | Ga0207683_10265332 | 3300026121 | Bacteria | 1568 |
| 603 | Ga0207683_10394228 | 3300026121 | Bacteria | 1273 |
| 604 | Ga0207683_10534236 | 3300026121 | Bacteria | 1084 |
| 605 | Ga0207683_10710537 | 3300026121 | Bacteria | 932 |
| 606 | Ga0207683_10779907 | 3300026121 | Bacteria | 887 |
| 607 | Ga0207698_10018116 | 3300026142 | Bacteria | 4792 |
| 608 | Ga0207698_10057622 | 3300026142 | Bacteria | 3007 |
| 609 | Ga0207698_10064697 | 3300026142 | Bacteria | 2868 |
| 610 | Ga0207698_10482893 | 3300026142 | Bacteria | 1202 |
| 611 | Ga0207698_10700729 | 3300026142 | Bacteria | 1008 |
| 612 | Ga0207698_10766644 | 3300026142 | Bacteria | 965 |
| 613 | Ga0209282_1000879 | 3300027666 | Bacteria | 15586 |
| 614 | Ga0209998_10026790 | 3300027717 | Bacteria | 1261 |
| 615 | Ga0268266_10005421 | 3300028379 | Bacteria | 11897 |
| 616 | Ga0268266_11448733 | 3300028379 | Bacteria | 662 |
| 617 | Ga0268265_10601947 | 3300028380 | Bacteria | 1050 |
| 618 | Ga0268264_10020524 | 3300028381 | Bacteria | 5398 |
| 619 | Ga0268264_10036216 | 3300028381 | Bacteria | 4064 |
| 620 | Ga0268264_10122101 | 3300028381 | Bacteria | 2297 |
| 621 | Ga0268264_10478874 | 3300028381 | Bacteria | 1210 |
| 622 | Ga0268264_10737764 | 3300028381 | Bacteria | 980 |
| 623 | Ga0268264_10865587 | 3300028381 | Bacteria | 906 |
| 624 | Ga0268264_11084900 | 3300028381 | Bacteria | 809 |
| 625 | Ga0307517_10419102 | 3300028786 | Bacteria | 703 |
| 626 | Ga0307515_10037079 | 3300028794 | Bacteria | 7856 |
| 627 | Ga0307512_10047332 | 3300030522 | Bacteria | 3496 |
| 628 | Ga0316177_1108907 | 3300030731 | Bacteria | 2943 |
| 629 | Ga0316178_1161297 | 3300030735 | Bacteria | 1249 |
| 630 | Ga0316183_1077822 | 3300030742 | Bacteria | 7951 |
| 631 | Ga0316181_1283039 | 3300030744 | Bacteria | 1507 |
| 632 | Ga0265327_10009017 | 3300031251 | Bacteria | 7298 |
| 633 | Ga0265327_10206103 | 3300031251 | Bacteria | 889 |
| 634 | Ga0307513_10036111 | 3300031456 | Bacteria | 5520 |
| 635 | Ga0307509_10006929 | 3300031507 | Bacteria | 15037 |
| 636 | Ga0307509_10040010 | 3300031507 | Bacteria | 5101 |
| 637 | Ga0307509_10048217 | 3300031507 | Bacteria | 4576 |
| 638 | Ga0307509_10055748 | 3300031507 | Bacteria | 4198 |
| 639 | Ga0307509_10169015 | 3300031507 | Bacteria | 2069 |
| 640 | Ga0307509_10204162 | 3300031507 | Bacteria | 1809 |
| 641 | Ga0307509_10440007 | 3300031507 | Bacteria | 1000 |
| 642 | Ga0307408_100058784 | 3300031548 | Bacteria | 2796 |
| 643 | Ga0307408_100142859 | 3300031548 | Bacteria | 1880 |
| 644 | Ga0307408_100170459 | 3300031548 | Bacteria | 1737 |
| 645 | Ga0307408_100240492 | 3300031548 | Bacteria | 1487 |
| 646 | Ga0307408_100411058 | 3300031548 | Bacteria | 1164 |
| 647 | Ga0307408_100720503 | 3300031548 | Bacteria | 898 |
| 648 | Ga0307508_10001847 | 3300031616 | Bacteria | 23394 |
| 649 | Ga0307508_10003921 | 3300031616 | Bacteria | 14763 |
| 650 | Ga0307508_10256631 | 3300031616 | Bacteria | 1343 |
| 651 | Ga0307514_10101368 | 3300031649 | Bacteria | 2066 |
| 652 | Ga0307514_10315492 | 3300031649 | Bacteria | 863 |
| 653 | Ga0307516_10014389 | 3300031730 | Bacteria | 8372 |
| 654 | Ga0307516_10019586 | 3300031730 | Bacteria | 7006 |
| 655 | Ga0307516_10402332 | 3300031730 | Bacteria | 1028 |
| 656 | Ga0307405_10014627 | 3300031731 | Bacteria | 4226 |
| 657 | Ga0307405_10077571 | 3300031731 | Bacteria | 2159 |
| 658 | Ga0307405_10186570 | 3300031731 | Bacteria | 1493 |
| 659 | Ga0307405_10214880 | 3300031731 | Bacteria | 1407 |
| 660 | Ga0307405_10406792 | 3300031731 | Bacteria | 1067 |
| 661 | Ga0307413_10028093 | 3300031824 | Bacteria | 3127 |
| 662 | Ga0307413_10402923 | 3300031824 | Bacteria | 1072 |
| 663 | Ga0307413_10564725 | 3300031824 | Bacteria | 925 |
| 664 | Ga0307410_10040149 | 3300031852 | Bacteria | 3078 |
| 665 | Ga0307410_11413121 | 3300031852 | Bacteria | 611 |
| 666 | Ga0307406_10006613 | 3300031901 | Bacteria | 6407 |
| 667 | Ga0307406_10017377 | 3300031901 | Bacteria | 4186 |
| 668 | Ga0307406_10080974 | 3300031901 | Bacteria | 2158 |
| 669 | Ga0307406_10212251 | 3300031901 | Bacteria | 1433 |
| 670 | Ga0307407_10049890 | 3300031903 | Bacteria | 2391 |
| 671 | Ga0307407_10321590 | 3300031903 | Bacteria | 1086 |
| 672 | Ga0307407_11056417 | 3300031903 | Bacteria | 630 |
| 673 | Ga0307412_10036449 | 3300031911 | Bacteria | 3151 |
| 674 | Ga0307412_10083326 | 3300031911 | Bacteria | 2217 |
| 675 | Ga0307412_10359815 | 3300031911 | Bacteria | 1171 |
| 676 | Ga0307412_11255747 | 3300031911 | Bacteria | 665 |
| 677 | Ga0307412_11328922 | 3300031911 | Bacteria | 648 |
| 678 | Ga0307409_100039276 | 3300031995 | Bacteria | 3510 |
| 679 | Ga0307409_100089816 | 3300031995 | Bacteria | 2513 |
| 680 | Ga0307409_100401936 | 3300031995 | Bacteria | 1309 |
| 681 | Ga0307416_100021496 | 3300032002 | Bacteria | 4634 |
| 682 | Ga0307416_100162141 | 3300032002 | Bacteria | 2068 |
| 683 | Ga0307416_100181705 | 3300032002 | Bacteria | 1972 |
| 684 | Ga0307416_100298010 | 3300032002 | Bacteria | 1601 |
| 685 | Ga0307416_100447062 | 3300032002 | Bacteria | 1344 |
| 686 | Ga0307416_101270474 | 3300032002 | Bacteria | 842 |
| 687 | Ga0307416_101430846 | 3300032002 | Bacteria | 797 |
| 688 | Ga0307414_10047523 | 3300032004 | Bacteria | 2954 |
| 689 | Ga0307414_10119020 | 3300032004 | Bacteria | 2027 |
| 690 | Ga0307414_10199649 | 3300032004 | Bacteria | 1625 |
| 691 | Ga0307414_10296164 | 3300032004 | Bacteria | 1366 |
| 692 | Ga0307414_10558002 | 3300032004 | Bacteria | 1022 |
| 693 | Ga0307411_10045891 | 3300032005 | Bacteria | 2813 |
| 694 | Ga0307411_10294547 | 3300032005 | Bacteria | 1298 |
| 695 | Ga0307415_100656958 | 3300032126 | Bacteria | 941 |
| 696 | Ga0307507_10223120 | 3300033179 | Bacteria | 1263 |
| 697 | Ga0307507_10303508 | 3300033179 | Bacteria | 976 |
| 698 | Ga0307510_10003542 | 3300033180 | Bacteria | 18212 |
| 699 | Ga0307510_10047315 | 3300033180 | Bacteria | 4611 |
| 700 | Ga0307510_10079368 | 3300033180 | Bacteria | 3201 |
| 701 | Ga0307510_10204680 | 3300033180 | Bacteria | 1503 |
| 702 | Ga0373950_0029196 | 3300034818 | Bacteria | 1014 |
| 703 | Ga0373926_0061259 | 3300035083 | Bacteria | 1372 |
| 704 | Ga0373926_0125514 | 3300035083 | Bacteria | 969 |
| 705 | Ga0373934_0001944 | 3300035086 | Bacteria | 7576 |
| 706 | Ga0373934_0111782 | 3300035086 | Bacteria | 1108 |
| 707 | Ga0373944_0042467 | 3300035089 | Bacteria | 1410 |
| 708 | Ga0373944_0067651 | 3300035089 | Bacteria | 1158 |
| 709 | Ga0373923_0014386 | 3300035111 | Bacteria | 2971 |
| 710 | Ga0373923_0127939 | 3300035111 | Bacteria | 1139 |
| 711 | Ga0373945_0035307 | 3300035116 | Bacteria | 1786 |
| 712 | Ga0373945_0035348 | 3300035116 | Bacteria | 1785 |
| 713 | Ga0373953_0002425 | 3300035117 | Bacteria | 5634 |
| 714 | Ga0373953_0123953 | 3300035117 | Bacteria | 1099 |
| 715 | Ga0373954_0083455 | 3300035118 | Bacteria | 1529 |
| 716 | Ga0373954_0090801 | 3300035118 | Bacteria | 1467 |
| 717 | Ga0373956_0013642 | 3300035119 | Bacteria | 3382 |
| 718 | Ga0373956_0040515 | 3300035119 | Bacteria | 2066 |
| 719 | Ga0373957_0121707 | 3300035120 | Bacteria | 1057 |
| 720 | Ga0373943_0011441 | 3300035170 | Bacteria | 3993 |
| 721 | Ga0373943_0029843 | 3300035170 | Bacteria | 2578 |
| 722 | Ga0373943_0068861 | 3300035170 | Bacteria | 1788 |
| 723 | Ga0373946_0235798 | 3300035171 | Bacteria | 888 |
| 724 | Ga0373955_0106284 | 3300035172 | Bacteria | 1618 |
| 725 | Ga0373955_0552309 | 3300035172 | Bacteria | 704 |
| 726 | Ga0373962_0065095 | 3300035242 | Bacteria | 1078 |
| 727 | Ga0373931_0009901 | 3300035691 | Bacteria | 4566 |
| 728 | Ga0373931_0116490 | 3300035691 | Bacteria | 1522 |
| 729 | Ga0373935_0050688 | 3300035692 | Bacteria | 2635 |
| 730 | Ga0373927_0035225 | 3300035695 | Bacteria | 3255 |
| 731 | Ga0373927_0302084 | 3300035695 | Bacteria | 1053 |
| 732 | Ga0373933_0044922 | 3300035724 | Bacteria | 2618 |
| 733 | Ga0373933_0062359 | 3300035724 | Bacteria | 2251 |
| 734 | Ga0373933_0092523 | 3300035724 | Bacteria | 1867 |
| 735 | Ga0373933_0237657 | 3300035724 | Bacteria | 1171 |
| 736 | Ga0373947_0011021 | 3300035725 | Bacteria | 5187 |
| 737 | Ga0373947_0034480 | 3300035725 | Bacteria | 2993 |
| 738 | Ga0373947_0191593 | 3300035725 | Bacteria | 1334 |
| 739 | Ga0373937_0012463 | 3300036401 | Bacteria | 7480 |
| 740 | Ga0373937_0050109 | 3300036401 | Bacteria | 3824 |
| 741 | Ga0373937_0056460 | 3300036401 | Bacteria | 3606 |
| 742 | Ga0373937_0092168 | 3300036401 | Bacteria | 2808 |
| 743 | Ga0373937_0312952 | 3300036401 | Bacteria | 1485 |
| 744 | Ga0373937_0347217 | 3300036401 | Bacteria | 1405 |
| 745 | Ga0373937_1153671 | 3300036401 | Bacteria | 723 |
| 746 | Ga0373925_0024901 | 3300037068 | Bacteria | 4371 |
| 747 | Ga0373925_0031882 | 3300037068 | Bacteria | 3877 |
| 748 | Ga0373925_0048465 | 3300037068 | Bacteria | 3165 |
| 749 | Ga0373925_0048913 | 3300037068 | Bacteria | 3151 |
| 750 | Ga0373925_0075762 | 3300037068 | Bacteria | 2550 |
| 751 | Ga0373925_0508910 | 3300037068 | Bacteria | 989 |
| 752 | Ga0373925_0560284 | 3300037068 | Bacteria | 940 |
| 753 | Ga0373925_0782778 | 3300037068 | Bacteria | 786 |
| 754 | Ga0373925_0836834 | 3300037068 | Bacteria | 758 |
| 755 | Ga0439436_0000592 | 3300041404 | Bacteria | 9612 |
| 756 | Ga0439447_041199 | 3300041407 | Bacteria | 1125 |
| 757 | Ga0439466_0006056 | 3300041411 | Bacteria | 4604 |
| 758 | Ga0439465_0000761 | 3300041413 | Bacteria | 9995 |
| 759 | Ga0451789_0309580 | 3300041443 | Bacteria | 567 |
| 760 | Ga0451789_0336218 | 3300041443 | Bacteria | 1704 |
| 761 | Ga0451789_0447876 | 3300041443 | Bacteria | 919 |
| 762 | Ga0451789_0839090 | 3300041443 | Bacteria | 817 |
| 763 | Ga0451793_0508741 | 3300041452 | Bacteria | 2127 |
| 764 | Ga0451793_0660801 | 3300041452 | Bacteria | 664 |
| 765 | Ga0451795_0895049 | 3300041456 | Bacteria | 1002 |
| 766 | Ga0451798_0874042 | 3300041458 | Bacteria | 925 |
| 767 | Ga0451800_0879857 | 3300041459 | Bacteria | 2460 |
| 768 | Ga0451802_0480397 | 3300041460 | Bacteria | 2377 |
| 769 | Ga0451804_1035411 | 3300041463 | Bacteria | 2196 |
| 770 | Ga0451807_0573351 | 3300041486 | Bacteria | 1225 |
| 771 | Ga0451833_0538022 | 3300041491 | Bacteria | 613 |
| 772 | Ga0451837_1849440 | 3300041494 | Bacteria | 888 |
| 773 | Ga0451849_1545266 | 3300041505 | Bacteria | 604 |
| 774 | Ga0451843_0021787 | 3300041509 | Bacteria | 719 |
| 775 | Ga0451853_0118375 | 3300041512 | Bacteria | 759 |
| 776 | Ga0451853_0455726 | 3300041512 | Bacteria | 1238 |
| 777 | Ga0451853_1347476 | 3300041512 | Bacteria | 797 |
| 778 | Ga0451853_1937945 | 3300041512 | Bacteria | 2447 |
| 779 | Ga0451853_3168548 | 3300041512 | Bacteria | 1285 |
| 780 | Ga0439431_0001225 | 3300041997 | Bacteria | 5612 |
| 781 | Ga0439431_0114009 | 3300041997 | Bacteria | 750 |
| 782 | Ga0439433_0000449 | 3300041999 | Bacteria | 7568 |
| 783 | Ga0439433_0025632 | 3300041999 | Bacteria | 1333 |
| 784 | Ga0439442_002094 | 3300042002 | Bacteria | 3923 |
| 785 | Ga0439448_0237542 | 3300042005 | Bacteria | 642 |
| 786 | Ga0439432_000470 | 3300042006 | Bacteria | 15098 |
| 787 | Ga0439449_0000890 | 3300042007 | Bacteria | 11651 |
| 788 | Ga0439449_0054131 | 3300042007 | Bacteria | 1483 |
| 789 | Ga0439452_000804 | 3300042010 | Bacteria | 14812 |
| 790 | Ga0439457_005079 | 3300042014 | Bacteria | 3353 |
| 791 | Ga0439462_0004541 | 3300042015 | Bacteria | 3396 |
| 792 | Ga0450906_009092 | 3300042145 | Bacteria | 1903 |
| 793 | Ga0439446_0001717 | 3300042156 | Bacteria | 5086 |
| 794 | Ga0439464_0014380 | 3300042439 | Bacteria | 2127 |
| 795 | Ga0453684_0001928 | 3300044712 | Bacteria | 53626 |
| 796 | Ga0453684_0414336 | 3300044712 | Bacteria | 1506 |
| 797 | Ga0451576_0151313 | 3300045051 | Bacteria | 2420 |
| 798 | Ga0451576_0324954 | 3300045051 | Bacteria | 1610 |
| 799 | Ga0495617_063032 | 3300046452 | Bacteria | 1225 |
| 800 | Ga0495592_0000237 | 3300046454 | Bacteria | 47510 |
| 801 | Ga0495603_0186978 | 3300046455 | Bacteria | 1198 |
| 802 | Ga0495629_0356138 | 3300046459 | Bacteria | 998 |
| 803 | Ga0495629_0862694 | 3300046459 | Bacteria | 595 |
| 804 | Ga0495638_0081185 | 3300046460 | Bacteria | 1969 |
| 805 | Ga0495653_0303809 | 3300046463 | Bacteria | 1040 |
| 806 | Ga0495650_0052945 | 3300046471 | Bacteria | 1664 |
| 807 | Ga0495580_0028788 | 3300046472 | Bacteria | 4036 |
| 808 | Ga0495580_0100322 | 3300046472 | Bacteria | 2014 |
| 809 | Ga0495582_0263663 | 3300046473 | Bacteria | 988 |
| 810 | Ga0495639_0037083 | 3300046475 | Bacteria | 2185 |
| 811 | Ga0495639_0232973 | 3300046475 | Bacteria | 907 |
| 812 | Ga0495662_0043669 | 3300046476 | Bacteria | 2164 |
| 813 | Ga0495662_0109570 | 3300046476 | Bacteria | 1353 |
| 814 | Ga0495606_0220459 | 3300046507 | Bacteria | 1069 |
| 815 | Ga0495608_0394374 | 3300046511 | Bacteria | 847 |
| 816 | Ga0495610_0033947 | 3300046512 | Bacteria | 2632 |
| 817 | Ga0495620_0133392 | 3300046515 | Bacteria | 974 |
| 818 | Ga0495620_0215403 | 3300046515 | Bacteria | 736 |
| 819 | Ga0495628_0546241 | 3300046516 | Bacteria | 832 |
| 820 | Ga0495632_0004239 | 3300046519 | Bacteria | 9798 |
| 821 | Ga0495632_0015113 | 3300046519 | Bacteria | 4340 |
| 822 | Ga0495632_0155475 | 3300046519 | Bacteria | 1055 |
| 823 | Ga0495637_0028720 | 3300046520 | Bacteria | 2481 |
| 824 | Ga0495643_0027856 | 3300046522 | Bacteria | 3171 |
| 825 | Ga0495648_0052752 | 3300046524 | Bacteria | 2468 |
| 826 | Ga0495666_0071749 | 3300046526 | Bacteria | 1646 |
| 827 | Ga0495666_0203785 | 3300046526 | Bacteria | 909 |
| 828 | Ga0495642_0048223 | 3300046528 | Bacteria | 1746 |
| 829 | Ga0495642_0066155 | 3300046528 | Bacteria | 1506 |
| 830 | Ga0495665_0185392 | 3300046531 | Bacteria | 1080 |
| 831 | Ga0495640_0384680 | 3300046533 | Bacteria | 863 |
| 832 | Ga0495640_0443414 | 3300046533 | Bacteria | 794 |
| 833 | Ga0495586_0110782 | 3300046535 | Bacteria | 1528 |
| 834 | Ga0495586_0247947 | 3300046535 | Bacteria | 1016 |
| 835 | Ga0495587_0413393 | 3300046536 | Bacteria | 749 |
| 836 | Ga0495598_0022132 | 3300046537 | Bacteria | 1698 |
| 837 | Ga0495598_0029268 | 3300046537 | Bacteria | 1534 |
| 838 | Ga0495621_0078638 | 3300046539 | Bacteria | 1227 |
| 839 | Ga0495621_0120558 | 3300046539 | Bacteria | 1013 |
| 840 | Ga0495621_0132333 | 3300046539 | Bacteria | 971 |
| 841 | Ga0495597_0244212 | 3300046542 | Bacteria | 707 |
| 842 | Ga0495645_0040954 | 3300046543 | Bacteria | 3378 |
| 843 | Ga0495633_0270483 | 3300046558 | Bacteria | 774 |
| 844 | Ga0495667_0081112 | 3300046559 | Bacteria | 2109 |
| 845 | Ga0495667_0154727 | 3300046559 | Bacteria | 1476 |
| 846 | Ga0495634_0173094 | 3300046642 | Bacteria | 1356 |
| 847 | Ga0495625_0000250 | 3300046660 | Bacteria | 84096 |
| 848 | Ga0495625_0002839 | 3300046660 | Bacteria | 18202 |
| 849 | Ga0495625_0033710 | 3300046660 | Bacteria | 3783 |
| 850 | Ga0495635_0024341 | 3300046663 | Bacteria | 4220 |
| 851 | Ga0495635_0039339 | 3300046663 | Bacteria | 3271 |
| 852 | Ga0495635_0168591 | 3300046663 | Bacteria | 1489 |
| 853 | Ga0495659_0015569 | 3300046664 | Bacteria | 2502 |
| 854 | Ga0495661_0371687 | 3300046665 | Bacteria | 700 |
| 855 | Ga0495588_0280947 | 3300046674 | Bacteria | 877 |
| 856 | Ga0495623_0356522 | 3300046679 | Bacteria | 796 |
| 857 | Ga0495646_0110692 | 3300046680 | Bacteria | 1564 |
| 858 | Ga0495646_0116877 | 3300046680 | Bacteria | 1513 |
| 859 | Ga0495647_0018159 | 3300046681 | Bacteria | 2499 |
| 860 | Ga0495647_0132230 | 3300046681 | Bacteria | 1058 |
| 861 | Ga0495647_0200505 | 3300046681 | Bacteria | 875 |
| 862 | Ga0495658_0008454 | 3300046683 | Bacteria | 5100 |
| 863 | Ga0495658_0031936 | 3300046683 | Bacteria | 2872 |
| 864 | Ga0495658_0140345 | 3300046683 | Bacteria | 1477 |
| 865 | Ga0495658_0239986 | 3300046683 | Bacteria | 1138 |
| 866 | Ga0495613_0079797 | 3300046689 | Bacteria | 2379 |
| 867 | Ga0495613_0552100 | 3300046689 | Bacteria | 771 |
| 868 | Ga0495600_0142576 | 3300046809 | Bacteria | 1554 |
| 869 | Ga0495600_0621364 | 3300046809 | Bacteria | 655 |
| 870 | Ga0495660_0112047 | 3300046810 | Bacteria | 1391 |
| 871 | Ga0495581_0034926 | 3300047315 | Bacteria | 2909 |
| 872 | Ga0495636_0462665 | 3300047318 | Bacteria | 610 |
| 873 | Ga0495674_0229393 | 3300047319 | Bacteria | 1533 |
| 874 | Ga0495681_0256219 | 3300047470 | Bacteria | 689 |
| 875 | Ga0495684_0048192 | 3300047471 | Bacteria | 3258 |
| 876 | Ga0495684_0084397 | 3300047471 | Bacteria | 2409 |
| 877 | Ga0495684_0759639 | 3300047471 | Bacteria | 637 |
| 878 | Ga0495686_0150608 | 3300047472 | Bacteria | 1366 |
| 879 | Ga0495602_0326662 | 3300048088 | Bacteria | 1114 |
| 880 | Ga0495602_0638677 | 3300048088 | Bacteria | 728 |
| 881 | Ga0495614_0123573 | 3300048089 | Bacteria | 1142 |
| 882 | Ga0495614_0253342 | 3300048089 | Bacteria | 806 |
| 883 | Ga0496100_0001162 | 3300048903 | Bacteria | 12807 |
| 884 | Ga0496101_0020120 | 3300048904 | Bacteria | 4564 |
| 885 | Ga0496102_0029174 | 3300048905 | Bacteria | 4934 |
| 886 | Ga0496102_0080501 | 3300048905 | Bacteria | 3001 |
| 887 | Ga0496102_0210901 | 3300048905 | Bacteria | 1831 |
| 888 | Ga0496102_1712625 | 3300048905 | Bacteria | 546 |
| 889 | Ga0496103_0005038 | 3300048906 | Bacteria | 7969 |
| 890 | Ga0496103_0414978 | 3300048906 | Bacteria | 864 |
| 891 | Ga0496104_0003675 | 3300048907 | Bacteria | 13249 |
| 892 | Ga0496104_0035846 | 3300048907 | Bacteria | 4634 |
| 893 | Ga0496104_0038441 | 3300048907 | Bacteria | 4478 |
| 894 | Ga0496104_0721842 | 3300048907 | Bacteria | 904 |
| 895 | Ga0496105_0002647 | 3300048908 | Bacteria | 13035 |
| 896 | Ga0496105_0037483 | 3300048908 | Bacteria | 3992 |
| 897 | Ga0496105_0089552 | 3300048908 | Bacteria | 2542 |
| 898 | Ga0496106_0032767 | 3300048909 | Bacteria | 3875 |
| 899 | Ga0496106_0106134 | 3300048909 | Bacteria | 2183 |
| 900 | Ga0496106_0134457 | 3300048909 | Bacteria | 1941 |
| 901 | Ga0496106_0311310 | 3300048909 | Bacteria | 1263 |
| 902 | Ga0496107_0079063 | 3300048910 | Bacteria | 2397 |
| 903 | Ga0496107_0079311 | 3300048910 | Bacteria | 2393 |
| 904 | Ga0496108_0180201 | 3300048911 | Bacteria | 1829 |
| 905 | Ga0496108_0209180 | 3300048911 | Bacteria | 1693 |
| 906 | Ga0496108_0260481 | 3300048911 | Bacteria | 1509 |
| 907 | Ga0496108_0409089 | 3300048911 | Bacteria | 1185 |
| 908 | Ga0496108_0520621 | 3300048911 | Bacteria | 1038 |
| 909 | Ga0496109_0008486 | 3300048912 | Bacteria | 8734 |
| 910 | Ga0496109_0126638 | 3300048912 | Bacteria | 2382 |
| 911 | Ga0496109_0303394 | 3300048912 | Bacteria | 1506 |
| 912 | Ga0496109_0432002 | 3300048912 | Bacteria | 1244 |
| 913 | Ga0496109_0912162 | 3300048912 | Bacteria | 817 |
| 914 | Ga0496110_0052513 | 3300048913 | Bacteria | 3581 |
| 915 | Ga0496110_0197732 | 3300048913 | Bacteria | 1826 |
| 916 | Ga0496110_0299903 | 3300048913 | Bacteria | 1464 |
| 917 | Ga0496110_1046320 | 3300048913 | Bacteria | 724 |
| 918 | Ga0496110_1140457 | 3300048913 | Bacteria | 688 |
| 919 | Ga0496111_0058232 | 3300048914 | Bacteria | 2797 |
| 920 | Ga0496113_0753119 | 3300048916 | Bacteria | 775 |
| 921 | Ga0496113_0769547 | 3300048916 | Bacteria | 766 |
| 922 | Ga0496114_0014319 | 3300048917 | Bacteria | 6363 |
| 923 | Ga0496114_0067881 | 3300048917 | Bacteria | 2992 |
| 924 | Ga0496114_0292396 | 3300048917 | Bacteria | 1437 |
| 925 | Ga0496116_0074249 | 3300048919 | Bacteria | 2140 |
| 926 | Ga0496116_0135938 | 3300048919 | Bacteria | 1392 |
| 927 | Ga0496117_0037929 | 3300048920 | Bacteria | 3582 |
| 928 | Ga0496117_0059893 | 3300048920 | Bacteria | 2627 |
| 929 | Ga0496118_0022064 | 3300048921 | Bacteria | 5581 |
| 930 | Ga0496118_0258762 | 3300048921 | Bacteria | 984 |
| 931 | Ga0496121_0034238 | 3300048924 | Bacteria | 4575 |
| 932 | Ga0496121_0063784 | 3300048924 | Bacteria | 3007 |
| 933 | Ga0496123_0048613 | 3300048926 | Bacteria | 2852 |
| 934 | Ga0496123_0378850 | 3300048926 | Bacteria | 650 |
| 935 | Ga0496124_0082228 | 3300048927 | Bacteria | 2644 |
| 936 | Ga0496125_0023431 | 3300048928 | Bacteria | 5698 |
| 937 | Ga0501034_0192997 | 3300049571 | Bacteria | 1998 |
| 938 | Ga0501037_0277123 | 3300049573 | Bacteria | 1169 |
| 939 | Ga0501068_0450524 | 3300049584 | Bacteria | 832 |
| 940 | Ga0501249_001622 | 3300049679 | Bacteria | 4597 |
| 941 | Ga0501262_000374 | 3300049759 | Bacteria | 5421 |
| 942 | Ga0501044_1010103 | 3300049823 | Bacteria | 703 |
| 943 | nmdc:mga0k408_138699_c1 | 3300050493 | Bacteria | 1446 |
| 944 | nmdc:mga07m45_15933_c1 | 3300050496 | Bacteria | 4020 |
| 945 | nmdc:mga07m45_294038_c1 | 3300050496 | Bacteria | 945 |
| 946 | nmdc:mga07m45_93090_c1 | 3300050496 | Bacteria | 1728 |
| 947 | nmdc:mga05p37_87180_c1 | 3300050507 | Bacteria | 3847 |
| 948 | nmdc:mga0n895_161078_c1 | 3300050512 | Bacteria | 2275 |
| 949 | nmdc:mga0n895_696389_c1 | 3300050512 | Bacteria | 1012 |
| 950 | nmdc:mga0rr50_351399_c1 | 3300050513 | Bacteria | 1240 |
| 951 | nmdc:mga0rr50_437703_c1 | 3300050513 | Bacteria | 1107 |
| 952 | nmdc:mga08x19_48212_c1 | 3300050514 | Bacteria | 2728 |
| 953 | nmdc:mga0a205_74496_c1 | 3300050515 | Bacteria | 3280 |
| 954 | Ga0500610_0002609 | 3300053079 | Bacteria | 6694 |
| 955 | Ga0500635_0269197 | 3300053080 | Bacteria | 670 |
| 956 | Ga0495595_0038728 | 3300053084 | Bacteria | 2173 |
| 957 | Ga0495619_0039996 | 3300053085 | Bacteria | 3063 |
| 958 | Ga0500643_092695 | 3300053087 | Bacteria | 823 |
| 959 | Ga0500644_0001746 | 3300053088 | Bacteria | 5626 |
| 960 | Ga0500644_0132395 | 3300053088 | Bacteria | 983 |
| 961 | Ga0500646_0037551 | 3300053090 | Bacteria | 1353 |
| 962 | Ga0500646_0158474 | 3300053090 | Bacteria | 754 |
| 963 | Ga0500583_0260407 | 3300053092 | Bacteria | 855 |
| 964 | Ga0500651_0072961 | 3300053093 | Bacteria | 2133 |
| 965 | Ga0500651_0145730 | 3300053093 | Bacteria | 1424 |
| 966 | Ga0500562_058494 | 3300053108 | Bacteria | 1035 |
| 967 | Ga0500569_045660 | 3300053109 | Bacteria | 1302 |
| 968 | Ga0500594_0001437 | 3300053118 | Bacteria | 5165 |
| 969 | Ga0500607_007465 | 3300053121 | Bacteria | 6754 |
| 970 | Ga0500607_118496 | 3300053121 | Bacteria | 1285 |
| 971 | Ga0500614_129267 | 3300053123 | Bacteria | 749 |
| 972 | Ga0500623_205832 | 3300053127 | Bacteria | 719 |
| 973 | Ga0500642_0185573 | 3300053130 | Bacteria | 971 |
| 974 | Ga0500652_000312 | 3300053131 | Bacteria | 17547 |
| 975 | Ga0500655_029829 | 3300053133 | Bacteria | 1047 |
| 976 | Ga0500658_0021735 | 3300053134 | Bacteria | 2432 |
| 977 | Ga0500559_0000602 | 3300053136 | Bacteria | 24517 |
| 978 | Ga0500559_0008733 | 3300053136 | Bacteria | 4420 |
| 979 | Ga0500564_170922 | 3300053138 | Bacteria | 913 |
| 980 | Ga0500568_0018889 | 3300053139 | Bacteria | 3007 |
| 981 | Ga0500568_0090790 | 3300053139 | Bacteria | 1152 |
| 982 | Ga0500573_0157148 | 3300053140 | Bacteria | 1240 |
| 983 | Ga0500577_0065142 | 3300053142 | Bacteria | 1413 |
| 984 | Ga0500622_0000164 | 3300053156 | Bacteria | 70630 |
| 985 | Ga0500622_0017664 | 3300053156 | Bacteria | 3796 |
| 986 | Ga0500622_0096673 | 3300053156 | Bacteria | 1459 |
| 987 | Ga0500636_0232308 | 3300053177 | Bacteria | 953 |
| 988 | Ga0500636_0376878 | 3300053177 | Bacteria | 667 |
| 989 | Ga0500625_058055 | 3300053729 | Bacteria | 1766 |
| 990 | Ga0500596_015338 | 3300053735 | Bacteria | 1151 |
| 991 | Ga0500587_032142 | 3300053739 | Bacteria | 724 |
| 992 | 2587730116 | 2585428057 | Bacteria | 6737412 |
| 993 | 2588293191 | 2588253510 | Bacteria | 6901809 |
| 994 | 2643968425 | 2643221592 | Bacteria | 6608788 |
| 995 | 2644141783 | 2643221625 | Bacteria | 6512927 |
| 996 | 2644272547 | 2643221648 | Bacteria | 6521465 |
| 997 | 2644302706 | 2643221654 | Bacteria | 5273570 |
| 998 | 2644396627 | 2643221672 | Bacteria | 6322190 |
| 999 | 2644468875 | 2643221683 | Bacteria | 5749203 |
| 1000 | 2842678032 | 2842677519 | Bacteria | 5615038 |
| 1001 | 2885195385 | 2885192300 | Bacteria | 5882526 |
| 1002 | 2885200464 | 2885198086 | Bacteria | 7212419 |
| 1003 | 2885214753 | 2885211737 | Bacteria | 7212420 |
| 1004 | 2894026022 | 2894023352 | Bacteria | 5167372 |
| 1005 | 2904450309 | 2904449895 | Bacteria | 6927402 |
| 1006 | 2904456869 | 2904456579 | Bacteria | 6819253 |
| 1007 | 2928120402 | 2928115317 | Bacteria | 6477646 |
| 1008 | 2929521013 | 2929520902 | Bacteria | 6765052 |
| 1009 | 2945913416 | 2945909444 | Bacteria | 7065066 |
| 1010 | 2954773096 | 2954767861 | Bacteria | 5535784 |
| 1011 | Ga0070667_100022681 | |||
| 1012 | JGI25151J46595_10104850 | |||
| 1013 | rootL2_10065328 | |||
| 1014 | Ga0055537_1000011 | |||
| 1015 | Ga0055534_1000020 | |||
| 1016 | Ga0055528_1000523 | |||
| 1017 | Ga0055530_10010170 | |||
| 1018 | Ga0055530_10018936 | |||
| 1019 | Ga0055540_1002046 | |||
| 1020 | Ga0055540_1004422 | |||
| 1021 | Ga0055531_10006773 | |||
| 1022 | Ga0065165_1002674 | |||
| 1023 | Ga0070658_10614095 | |||
| 1024 | Ga0070676_10009731 | |||
| 1025 | Ga0070683_100041198 | |||
| 1026 | Ga0070683_100634859 | |||
| 1027 | Ga0070690_100041746 | |||
| 1028 | Ga0070690_100786197 | |||
| 1029 | Ga0070670_100001487 | |||
| 1030 | Ga0070670_100055083 | |||
| 1031 | Ga0070670_100089421 | |||
| 1032 | Ga0070670_100125593 | |||
| 1033 | Ga0070670_100127016 | |||
| 1034 | Ga0070670_100135869 | |||
| 1035 | Ga0070670_100189218 | |||
| 1036 | Ga0070670_100221409 | |||
| 1037 | Ga0070670_100489744 | |||
| 1038 | Ga0070670_100790512 | |||
| 1039 | Ga0070677_10022459 | |||
| 1040 | Ga0070677_10143422 | |||
| 1041 | Ga0070677_10165531 | |||
| 1042 | Ga0070677_10172939 | |||
| 1043 | Ga0068869_100007361 | |||
| 1044 | Ga0068869_100039693 | |||
| 1045 | Ga0068869_100104752 | |||
| 1046 | Ga0068869_100471759 | |||
| 1047 | Ga0068869_100937843 | |||
| 1048 | Ga0070666_10002463 | |||
| 1049 | Ga0070666_10022199 | |||
| 1050 | Ga0070666_10078188 | |||
| 1051 | Ga0070666_10304888 | |||
| 1052 | Ga0070682_100046022 | |||
| 1053 | Ga0068868_100012781 | |||
| 1054 | Ga0068868_100053419 | |||
| 1055 | Ga0068868_100060207 | |||
| 1056 | Ga0068868_100094600 | |||
| 1057 | Ga0068868_100163326 | |||
| 1058 | Ga0068868_100321783 | |||
| 1059 | Ga0068868_100786114 | |||
| 1060 | Ga0068868_101399971 | |||
| 1061 | Ga0070660_100027230 | |||
| 1062 | Ga0070660_100155198 | |||
| 1063 | Ga0070689_100001068 | |||
| 1064 | Ga0070689_100084179 | |||
| 1065 | Ga0070687_100026678 | |||
| 1066 | Ga0070687_100131028 | |||
| 1067 | Ga0070661_100046486 | |||
| 1068 | Ga0070661_100214944 | |||
| 1069 | Ga0070661_100676074 | |||
| 1070 | Ga0070692_10380246 | |||
| 1071 | Ga0070668_100255393 | |||
| 1072 | Ga0070669_100348521 | |||
| 1073 | Ga0070669_100468998 | |||
| 1074 | Ga0070675_100010343 | |||
| 1075 | Ga0070675_100016666 | |||
| 1076 | Ga0070675_100145213 | |||
| 1077 | Ga0070675_100271347 | |||
| 1078 | Ga0070675_100538419 | |||
| 1079 | Ga0070675_100783114 | |||
| 1080 | Ga0070671_100010237 | |||
| 1081 | Ga0070671_100014699 | |||
| 1082 | Ga0070671_100036188 | |||
| 1083 | Ga0070671_100042544 | |||
| 1084 | Ga0070671_100111098 | |||
| 1085 | Ga0070671_100168621 | |||
| 1086 | Ga0070671_100206778 | |||
| 1087 | Ga0070671_100347147 | |||
| 1088 | Ga0070671_100940816 | |||
| 1089 | Ga0070674_100670743 | |||
| 1090 | Ga0070673_100003065 | |||
| 1091 | Ga0070673_100007094 | |||
| 1092 | Ga0070673_100016138 | |||
| 1093 | Ga0070673_100409978 | |||
| 1094 | Ga0070673_100430116 | |||
| 1095 | Ga0070673_100581874 | |||
| 1096 | Ga0070688_100011432 | |||
| 1097 | Ga0070688_100169151 | |||
| 1098 | Ga0070688_100191588 | |||
| 1099 | Ga0070659_100014648 | |||
| 1100 | Ga0070659_100563020 | |||
| 1101 | Ga0070659_100568777 | |||
| 1102 | Ga0070667_100010871 | |||
| 1103 | Ga0070667_100020888 | |||
| 1104 | Ga0070667_100037047 | |||
| 1105 | Ga0070667_100044596 | |||
| 1106 | Ga0070667_100582445 | |||
| 1107 | Ga0070667_100679138 | |||
| 1108 | Ga0070667_100708390 | |||
| 1109 | Ga0070667_101204759 | |||
| 1110 | Ga0070703_10039761 | |||
| 1111 | Ga0070709_10027147 | |||
| 1112 | Ga0070709_10028305 | |||
| 1113 | Ga0070709_10219948 | |||
| 1114 | Ga0070713_100000045 | |||
| 1115 | Ga0070713_100001503 | |||
| 1116 | Ga0070713_100049974 | |||
| 1117 | Ga0070710_10052977 | |||
| 1118 | Ga0070710_10286235 | |||
| 1119 | Ga0070710_10535220 | |||
| 1120 | Ga0070701_10210128 | |||
| 1121 | Ga0070711_100103371 | |||
| 1122 | Ga0070711_100578376 | |||
| 1123 | Ga0070694_100005010 | |||
| 1124 | Ga0070663_100027741 | |||
| 1125 | Ga0070663_100186281 | |||
| 1126 | Ga0070678_100002879 | |||
| 1127 | Ga0070678_100009028 | |||
| 1128 | Ga0070678_100047655 | |||
| 1129 | Ga0070678_100075456 | |||
| 1130 | Ga0070678_100079341 | |||
| 1131 | Ga0070678_100140328 | |||
| 1132 | Ga0070678_100163370 | |||
| 1133 | Ga0070678_100253061 | |||
| 1134 | Ga0070678_100415136 | |||
| 1135 | Ga0070678_100701910 | |||
| 1136 | Ga0070678_101184725 | |||
| 1137 | Ga0070662_100008876 | |||
| 1138 | Ga0070662_100025218 | |||
| 1139 | Ga0070662_100031248 | |||
| 1140 | Ga0070662_100206289 | |||
| 1141 | Ga0070662_100319115 | |||
| 1142 | Ga0068867_100118121 | |||
| 1143 | Ga0068867_100368099 | |||
| 1144 | Ga0068867_100403351 | |||
| 1145 | Ga0070685_10067442 | |||
| 1146 | Ga0070685_10274666 | |||
| 1147 | Ga0070706_100047983 | |||
| 1148 | Ga0070706_100133028 | |||
| 1149 | Ga0070706_100281389 | |||
| 1150 | Ga0070707_100102012 | |||
| 1151 | Ga0070707_100377332 | |||
| 1152 | Ga0070707_101454537 | |||
| 1153 | Ga0070698_100009638 | |||
| 1154 | Ga0070698_100116161 | |||
| 1155 | Ga0070699_100010642 | |||
| 1156 | Ga0070699_100407521 | |||
| 1157 | Ga0070699_100485405 | |||
| 1158 | Ga0070679_100126651 | |||
| 1159 | Ga0070679_100223861 | |||
| 1160 | Ga0070684_100098116 | |||
| 1161 | Ga0070684_100114171 | |||
| 1162 | Ga0070697_100042000 | |||
| 1163 | Ga0070697_100101353 | |||
| 1164 | Ga0070697_100102902 | |||
| 1165 | Ga0068853_100043659 | |||
| 1166 | Ga0070672_100011240 | |||
| 1167 | Ga0070672_100011563 | |||
| 1168 | Ga0070672_100027935 | |||
| 1169 | Ga0070672_100146776 | |||
| 1170 | Ga0070672_100159859 | |||
| 1171 | Ga0070672_100283535 | |||
| 1172 | Ga0070686_100129106 | |||
| 1173 | Ga0070695_100037561 | |||
| 1174 | Ga0070696_100393471 | |||
| 1175 | Ga0070696_101091103 | |||
| 1176 | Ga0070693_100010511 | |||
| 1177 | Ga0070665_100016346 | |||
| 1178 | Ga0070704_100088429 | |||
| 1179 | Ga0070704_100157535 | |||
| 1180 | Ga0070704_100546163 | |||
| 1181 | Ga0068855_100297315 | |||
| 1182 | Ga0070664_100030558 | |||
| 1183 | Ga0070664_100161575 | |||
| 1184 | Ga0070664_100200654 | |||
| 1185 | Ga0070664_100327622 | |||
| 1186 | Ga0070664_100331493 | |||
| 1187 | Ga0070664_100409404 | |||
| 1188 | Ga0070664_100450448 | |||
| 1189 | Ga0068857_100141393 | |||
| 1190 | Ga0068857_100470352 | |||
| 1191 | Ga0068857_100783709 | |||
| 1192 | Ga0068854_100024823 | |||
| 1193 | Ga0068854_100105433 | |||
| 1194 | Ga0068854_100294115 | |||
| 1195 | Ga0068854_101353521 | |||
| 1196 | Ga0068856_100015296 | |||
| 1197 | Ga0068856_100043926 | |||
| 1198 | Ga0068856_100433020 | |||
| 1199 | Ga0070702_100028821 | |||
| 1200 | Ga0070702_100245778 | |||
| 1201 | Ga0068852_100037171 | |||
| 1202 | Ga0068852_100056346 | |||
| 1203 | Ga0068852_100389377 | |||
| 1204 | Ga0068852_100676677 | |||
| 1205 | Ga0068852_100730445 | |||
| 1206 | Ga0068859_100003878 | |||
| 1207 | Ga0068859_100023164 | |||
| 1208 | Ga0068859_100026347 | |||
| 1209 | Ga0068859_100161085 | |||
| 1210 | Ga0068864_100009333 | |||
| 1211 | Ga0068864_100022771 | |||
| 1212 | Ga0068864_100120311 | |||
| 1213 | Ga0068864_100168297 | |||
| 1214 | Ga0068864_100286921 | |||
| 1215 | Ga0068864_100473877 | |||
| 1216 | Ga0068864_100672271 | |||
| 1217 | Ga0068866_10149808 | |||
| 1218 | Ga0068861_100273062 | |||
| 1219 | Ga0068851_10015037 | |||
| 1220 | Ga0068851_10018571 | |||
| 1221 | Ga0068870_10255053 | |||
| 1222 | Ga0068870_10420219 | |||
| 1223 | Ga0068863_100007859 | |||
| 1224 | Ga0068863_100020501 | |||
| 1225 | Ga0068863_100023505 | |||
| 1226 | Ga0068863_100113749 | |||
| 1227 | Ga0068863_100158513 | |||
| 1228 | Ga0068863_100333584 | |||
| 1229 | Ga0068863_101095580 | |||
| 1230 | Ga0068863_101260554 | |||
| 1231 | Ga0068858_100000917 | |||
| 1232 | Ga0068858_100002260 | |||
| 1233 | Ga0068858_100108964 | |||
| 1234 | Ga0068858_100912940 | |||
| 1235 | Ga0068860_100018751 | |||
| 1236 | Ga0068860_100058802 | |||
| 1237 | Ga0068860_100146066 | |||
| 1238 | Ga0068860_100957543 | |||
| 1239 | Ga0070717_10353149 | |||
| 1240 | Ga0075363_100308706 | |||
| 1241 | Ga0075364_10132824 | |||
| 1242 | Ga0075364_10191424 | |||
| 1243 | Ga0070715_10195631 | |||
| 1244 | Ga0070716_100094909 | |||
| 1245 | Ga0070716_100318439 | |||
| 1246 | Ga0070712_100053214 | |||
| 1247 | Ga0070712_100643764 | |||
| 1248 | Ga0075362_10017186 | |||
| 1249 | Ga0075369_10464518 | |||
| 1250 | Ga0075366_10139536 | |||
| 1251 | Ga0075366_10322717 | |||
| 1252 | Ga0097621_100012061 | |||
| 1253 | Ga0097621_100014611 | |||
| 1254 | Ga0097621_100039624 | |||
| 1255 | Ga0097621_100099472 | |||
| 1256 | Ga0097621_100182156 | |||
| 1257 | Ga0097621_100235601 | |||
| 1258 | Ga0075370_10003454 | |||
| 1259 | Ga0075370_10016959 | |||
| 1260 | Ga0075370_10077453 | |||
| 1261 | Ga0075370_10297344 | |||
| 1262 | Ga0075370_10645882 | |||
| 1263 | Ga0068871_100015636 | |||
| 1264 | Ga0068871_100070073 | |||
| 1265 | Ga0068871_100133265 | |||
| 1266 | Ga0068871_100180102 | |||
| 1267 | Ga0068871_100206978 | |||
| 1268 | Ga0068871_100584291 | |||
| 1269 | Ga0075433_10081389 | |||
| 1270 | Ga0075434_100223689 | |||
| 1271 | Ga0068865_100103119 | |||
| 1272 | Ga0068865_100395557 | |||
| 1273 | Ga0075436_100122970 | |||
| 1274 | Ga0075436_100194676 | |||
| 1275 | Ga0075436_100951784 | |||
| 1276 | Ga0097620_100003877 | |||
| 1277 | Ga0097620_100023164 | |||
| 1278 | Ga0097620_100026347 | |||
| 1279 | Ga0097620_100161093 | |||
| 1280 | Ga0079104_1045477 | |||
| 1281 | Ga0099826_10000157 | |||
| 1282 | Ga0075435_100077307 | |||
| 1283 | Ga0075435_100092229 | |||
| 1284 | Ga0105240_10040469 | |||
| 1285 | Ga0111539_10657105 | |||
| 1286 | Ga0105245_10002930 | |||
| 1287 | Ga0105245_10015666 | |||
| 1288 | Ga0105245_10076351 | |||
| 1289 | Ga0105245_10096754 | |||
| 1290 | Ga0105245_10193688 | |||
| 1291 | Ga0105245_10878607 | |||
| 1292 | Ga0105245_12512678 | |||
| 1293 | Ga0105247_10047960 | |||
| 1294 | Ga0114129_10054987 | |||
| 1295 | Ga0114129_11326051 | |||
| 1296 | Ga0105243_10012787 | |||
| 1297 | Ga0105243_10073714 | |||
| 1298 | Ga0105243_10646974 | |||
| 1299 | Ga0105243_11541047 | |||
| 1300 | Ga0105241_10047855 | |||
| 1301 | Ga0105241_10290148 | |||
| 1302 | Ga0105241_10322420 | |||
| 1303 | Ga0105242_10175016 | |||
| 1304 | Ga0105242_10217425 | |||
| 1305 | Ga0105242_10474454 | |||
| 1306 | Ga0105248_10031634 | |||
| 1307 | Ga0105248_10125609 | |||
| 1308 | Ga0105248_10219924 | |||
| 1309 | Ga0105248_10596768 | |||
| 1310 | Ga0105248_10798034 | |||
| 1311 | Ga0105237_10697242 | |||
| 1312 | Ga0105238_10160530 | |||
| 1313 | Ga0105238_10219814 | |||
| 1314 | Ga0105238_10345899 | |||
| 1315 | Ga0105249_10039217 | |||
| 1316 | Ga0105239_10090555 | |||
| 1317 | Ga0105239_10314182 | |||
| 1318 | Ga0105239_10454872 | |||
| 1319 | Ga0105246_10024930 | |||
| 1320 | Ga0105246_10085345 | |||
| 1321 | Ga0105246_11632952 | |||
| 1322 | Ga0157317_1003741 | |||
| 1323 | Ga0157326_1038376 | |||
| 1324 | Ga0157373_10074127 | |||
| 1325 | Ga0157373_10497420 | |||
| 1326 | Ga0157370_10036088 | |||
| 1327 | Ga0157370_10334635 | |||
| 1328 | Ga0157369_10033694 | |||
| 1329 | Ga0157369_10572088 | |||
| 1330 | Ga0157369_10593050 | |||
| 1331 | Ga0157369_10973131 | |||
| 1332 | Ga0157374_10000727 | |||
| 1333 | Ga0157374_10055413 | |||
| 1334 | Ga0157374_10634974 | |||
| 1335 | Ga0157374_12071866 | |||
| 1336 | Ga0157378_10026558 | |||
| 1337 | Ga0157378_10085721 | |||
| 1338 | Ga0157378_10272705 | |||
| 1339 | Ga0163162_10020512 | |||
| 1340 | Ga0163162_10036973 | |||
| 1341 | Ga0163162_10056547 | |||
| 1342 | Ga0163162_10193077 | |||
| 1343 | Ga0163162_10263873 | |||
| 1344 | Ga0163162_10264379 | |||
| 1345 | Ga0163162_10549675 | |||
| 1346 | Ga0163162_11549939 | |||
| 1347 | Ga0157372_10080327 | |||
| 1348 | Ga0157372_11192067 | |||
| 1349 | Ga0157375_10024623 | |||
| 1350 | Ga0157375_10046902 | |||
| 1351 | Ga0157375_10113993 | |||
| 1352 | Ga0157375_10124563 | |||
| 1353 | Ga0157375_10154740 | |||
| 1354 | Ga0157375_10197305 | |||
| 1355 | Ga0157375_10480026 | |||
| 1356 | Ga0157375_10490971 | |||
| 1357 | Ga0157375_11677011 | |||
| 1358 | Ga0163163_10001923 | |||
| 1359 | Ga0163163_10003856 | |||
| 1360 | Ga0163163_10094864 | |||
| 1361 | Ga0163163_10255192 | |||
| 1362 | Ga0163163_11001069 | |||
| 1363 | Ga0163163_11162456 | |||
| 1364 | Ga0163163_11264428 | |||
| 1365 | Ga0157380_10275040 | |||
| 1366 | Ga0157380_10769688 | |||
| 1367 | Ga0182008_10001113 | |||
| 1368 | Ga0182008_10003869 | |||
| 1369 | Ga0182008_10339390 | |||
| 1370 | Ga0157377_10010573 | |||
| 1371 | Ga0157377_10192165 | |||
| 1372 | Ga0157379_10009923 | |||
| 1373 | Ga0157379_10019476 | |||
| 1374 | Ga0157379_10080360 | |||
| 1375 | Ga0157379_10086301 | |||
| 1376 | Ga0157379_10146617 | |||
| 1377 | Ga0157379_10290535 | |||
| 1378 | Ga0157379_10405281 | |||
| 1379 | Ga0157376_10014006 | |||
| 1380 | Ga0157376_10091714 | |||
| 1381 | Ga0157376_10093802 | |||
| 1382 | Ga0157376_10368241 | |||
| 1383 | Ga0157376_10677439 | |||
| 1384 | Ga0157376_11424590 | |||
| 1385 | Ga0182006_1004133 | |||
| 1386 | Ga0182007_10002389 | |||
| 1387 | Ga0182007_10003841 | |||
| 1388 | Ga0182005_1107394 | |||
| 1389 | Ga0163161_10008858 | |||
| 1390 | Ga0163161_10069257 | |||
| 1391 | Ga0163161_10147485 | |||
| 1392 | Ga0163161_10282753 | |||
| 1393 | Ga0209565_1000058 | |||
| 1394 | Ga0209673_1000053 | |||
| 1395 | Ga0209673_1001967 | |||
| 1396 | Ga0209675_1000010 | |||
| 1397 | Ga0209675_1001747 | |||
| 1398 | Ga0209676_1002070 | |||
| 1399 | Ga0209025_1008535 | |||
| 1400 | Ga0209025_1018183 | |||
| 1401 | Ga0209050_1000257 | |||
| 1402 | Ga0209050_1001209 | |||
| 1403 | Ga0209050_1012784 | |||
| 1404 | Ga0209051_1000145 | |||
| 1405 | Ga0209051_1009356 | |||
| 1406 | Ga0209051_1068542 | |||
| 1407 | Ga0209257_1000495 | |||
| 1408 | Ga0207656_10033651 | |||
| 1409 | Ga0207655_1011300 | |||
| 1410 | Ga0207682_10030129 | |||
| 1411 | Ga0207682_10057448 | |||
| 1412 | Ga0207692_10065458 | |||
| 1413 | Ga0207642_10097899 | |||
| 1414 | Ga0207642_10309601 | |||
| 1415 | Ga0207710_10079400 | |||
| 1416 | Ga0207680_10069422 | |||
| 1417 | Ga0207680_10134889 | |||
| 1418 | Ga0207680_10146437 | |||
| 1419 | Ga0207680_10174967 | |||
| 1420 | Ga0207680_10548762 | |||
| 1421 | Ga0207685_10057352 | |||
| 1422 | Ga0207645_10001304 | |||
| 1423 | Ga0207645_10017830 | |||
| 1424 | Ga0207643_10065954 | |||
| 1425 | Ga0207643_10097405 | |||
| 1426 | Ga0207643_10392591 | |||
| 1427 | Ga0207705_10064577 | |||
| 1428 | Ga0207705_10489366 | |||
| 1429 | Ga0207705_10587715 | |||
| 1430 | Ga0207684_10039887 | |||
| 1431 | Ga0207684_10051148 | |||
| 1432 | Ga0207684_10053024 | |||
| 1433 | Ga0207684_11353897 | |||
| 1434 | Ga0207654_10025788 | |||
| 1435 | Ga0207707_10340903 | |||
| 1436 | Ga0207671_10131192 | |||
| 1437 | Ga0207693_10000780 | |||
| 1438 | Ga0207693_10515811 | |||
| 1439 | Ga0207663_10044198 | |||
| 1440 | Ga0207663_10490389 | |||
| 1441 | Ga0207662_10086268 | |||
| 1442 | Ga0207662_10115686 | |||
| 1443 | Ga0207657_10004204 | |||
| 1444 | Ga0207657_10921345 | |||
| 1445 | Ga0207649_10039911 | |||
| 1446 | Ga0207649_10189348 | |||
| 1447 | Ga0207652_10169933 | |||
| 1448 | Ga0207652_10186737 | |||
| 1449 | Ga0207646_10050206 | |||
| 1450 | Ga0207681_10212104 | |||
| 1451 | Ga0207694_10078082 | |||
| 1452 | Ga0207650_10010870 | |||
| 1453 | Ga0207650_10072294 | |||
| 1454 | Ga0207650_10075107 | |||
| 1455 | Ga0207650_10101014 | |||
| 1456 | Ga0207650_10115048 | |||
| 1457 | Ga0207650_10123743 | |||
| 1458 | Ga0207650_10157624 | |||
| 1459 | Ga0207650_10166746 | |||
| 1460 | Ga0207659_10010811 | |||
| 1461 | Ga0207659_10011107 | |||
| 1462 | Ga0207659_10021252 | |||
| 1463 | Ga0207659_10030025 | |||
| 1464 | Ga0207659_10040044 | |||
| 1465 | Ga0207659_10264766 | |||
| 1466 | Ga0207659_10934099 | |||
| 1467 | Ga0207687_10007028 | |||
| 1468 | Ga0207687_10007672 | |||
| 1469 | Ga0207687_10010416 | |||
| 1470 | Ga0207687_10161223 | |||
| 1471 | Ga0207700_10000051 | |||
| 1472 | Ga0207700_10025874 | |||
| 1473 | Ga0207700_10761846 | |||
| 1474 | Ga0207664_10034832 | |||
| 1475 | Ga0207644_10000306 | |||
| 1476 | Ga0207644_10002436 | |||
| 1477 | Ga0207644_10020223 | |||
| 1478 | Ga0207644_10090539 | |||
| 1479 | Ga0207644_10180175 | |||
| 1480 | Ga0207644_10328725 | |||
| 1481 | Ga0207644_10399384 | |||
| 1482 | Ga0207644_10842618 | |||
| 1483 | Ga0207690_10435194 | |||
| 1484 | Ga0207706_10016770 | |||
| 1485 | Ga0207706_10026591 | |||
| 1486 | Ga0207706_10035763 | |||
| 1487 | Ga0207706_10037099 | |||
| 1488 | Ga0207706_10209178 | |||
| 1489 | Ga0207686_10375140 | |||
| 1490 | Ga0207709_10004174 | |||
| 1491 | Ga0207709_10268765 | |||
| 1492 | Ga0207709_10288863 | |||
| 1493 | Ga0207670_10002570 | |||
| 1494 | Ga0207670_10042168 | |||
| 1495 | Ga0207669_10230371 | |||
| 1496 | Ga0207704_10390784 | |||
| 1497 | Ga0207665_10009352 | |||
| 1498 | Ga0207665_10015629 | |||
| 1499 | Ga0207665_10162931 | |||
| 1500 | Ga0207665_10226437 | |||
| 1501 | Ga0207691_10009574 | |||
| 1502 | Ga0207691_10014086 | |||
| 1503 | Ga0207691_10050735 | |||
| 1504 | Ga0207691_10099690 | |||
| 1505 | Ga0207691_10149247 | |||
| 1506 | Ga0207691_10348705 | |||
| 1507 | Ga0207691_10385087 | |||
| 1508 | Ga0207691_10488151 | |||
| 1509 | Ga0207691_10589815 | |||
| 1510 | Ga0207711_10002784 | |||
| 1511 | Ga0207711_10005620 | |||
| 1512 | Ga0207711_10009978 | |||
| 1513 | Ga0207711_10150184 | |||
| 1514 | Ga0207711_10361745 | |||
| 1515 | Ga0207711_10896181 | |||
| 1516 | Ga0207689_10052134 | |||
| 1517 | Ga0207689_10087648 | |||
| 1518 | Ga0207689_10114270 | |||
| 1519 | Ga0207661_10082073 | |||
| 1520 | Ga0207679_10009947 | |||
| 1521 | Ga0207679_10027736 | |||
| 1522 | Ga0207679_10157656 | |||
| 1523 | Ga0207679_10271834 | |||
| 1524 | Ga0207679_10659290 | |||
| 1525 | Ga0207679_10892205 | |||
| 1526 | Ga0207667_10243480 | |||
| 1527 | Ga0207667_10605306 | |||
| 1528 | Ga0207651_10000147 | |||
| 1529 | Ga0207651_10057727 | |||
| 1530 | Ga0207651_10064602 | |||
| 1531 | Ga0207651_10069340 | |||
| 1532 | Ga0207651_10157631 | |||
| 1533 | Ga0207651_10165054 | |||
| 1534 | Ga0207651_10352182 | |||
| 1535 | Ga0207651_10628336 | |||
| 1536 | Ga0207712_10214613 | |||
| 1537 | Ga0207668_10333267 | |||
| 1538 | Ga0207640_10020071 | |||
| 1539 | Ga0207640_10094750 | |||
| 1540 | Ga0207640_10113018 | |||
| 1541 | Ga0207640_10203115 | |||
| 1542 | Ga0207640_10402102 | |||
| 1543 | Ga0207640_10724275 | |||
| 1544 | Ga0207640_10787507 | |||
| 1545 | Ga0207658_10020384 | |||
| 1546 | Ga0207658_10028137 | |||
| 1547 | Ga0207658_10032922 | |||
| 1548 | Ga0207658_10049901 | |||
| 1549 | Ga0207658_10056923 | |||
| 1550 | Ga0207658_10095017 | |||
| 1551 | Ga0207658_10101005 | |||
| 1552 | Ga0207658_10209904 | |||
| 1553 | Ga0207658_11073363 | |||
| 1554 | Ga0207677_10000259 | |||
| 1555 | Ga0207677_10002328 | |||
| 1556 | Ga0207677_10074113 | |||
| 1557 | Ga0207677_10096469 | |||
| 1558 | Ga0207677_10307282 | |||
| 1559 | Ga0207677_10956141 | |||
| 1560 | Ga0207703_10002244 | |||
| 1561 | Ga0207703_10010895 | |||
| 1562 | Ga0207703_10054103 | |||
| 1563 | Ga0207703_10666665 | |||
| 1564 | Ga0207639_10073000 | |||
| 1565 | Ga0207639_10156457 | |||
| 1566 | Ga0207639_10269627 | |||
| 1567 | Ga0207639_10501062 | |||
| 1568 | Ga0207678_10031930 | |||
| 1569 | Ga0207678_10136137 | |||
| 1570 | Ga0207678_10197326 | |||
| 1571 | Ga0207678_10254878 | |||
| 1572 | Ga0207708_11672814 | |||
| 1573 | Ga0207702_10035579 | |||
| 1574 | Ga0207702_10041335 | |||
| 1575 | Ga0207702_10085468 | |||
| 1576 | Ga0207702_11256887 | |||
| 1577 | Ga0207641_10011649 | |||
| 1578 | Ga0207641_10042940 | |||
| 1579 | Ga0207641_10061297 | |||
| 1580 | Ga0207641_10102982 | |||
| 1581 | Ga0207641_10165690 | |||
| 1582 | Ga0207641_10262007 | |||
| 1583 | Ga0207641_11003754 | |||
| 1584 | Ga0207648_10002312 | |||
| 1585 | Ga0207648_10073241 | |||
| 1586 | Ga0207648_10130960 | |||
| 1587 | Ga0207648_10148919 | |||
| 1588 | Ga0207648_10637109 | |||
| 1589 | Ga0207676_10000224 | |||
| 1590 | Ga0207676_10020243 | |||
| 1591 | Ga0207676_10054790 | |||
| 1592 | Ga0207676_10092258 | |||
| 1593 | Ga0207676_10112987 | |||
| 1594 | Ga0207676_10126585 | |||
| 1595 | Ga0207676_10248005 | |||
| 1596 | Ga0207676_10589466 | |||
| 1597 | Ga0207676_10723514 | |||
| 1598 | Ga0207674_10035125 | |||
| 1599 | Ga0207674_10054595 | |||
| 1600 | Ga0207674_10069225 | |||
| 1601 | Ga0207674_10269709 | |||
| 1602 | Ga0207675_100170665 | |||
| 1603 | Ga0207675_100409004 | |||
| 1604 | Ga0207675_100608467 | |||
| 1605 | Ga0207683_10000817 | |||
| 1606 | Ga0207683_10026644 | |||
| 1607 | Ga0207683_10046196 | |||
| 1608 | Ga0207683_10051245 | |||
| 1609 | Ga0207683_10069610 | |||
| 1610 | Ga0207683_10071175 | |||
| 1611 | Ga0207683_10121829 | |||
| 1612 | Ga0207683_10265332 | |||
| 1613 | Ga0207683_10394228 | |||
| 1614 | Ga0207683_10534236 | |||
| 1615 | Ga0207683_10710537 | |||
| 1616 | Ga0207683_10779907 | |||
| 1617 | Ga0207698_10018116 | |||
| 1618 | Ga0207698_10057622 | |||
| 1619 | Ga0207698_10064697 | |||
| 1620 | Ga0207698_10482893 | |||
| 1621 | Ga0207698_10700729 | |||
| 1622 | Ga0207698_10766644 | |||
| 1623 | Ga0209282_1000879 | |||
| 1624 | Ga0209998_10026790 | |||
| 1625 | Ga0268266_10005421 | |||
| 1626 | Ga0268266_11448733 | |||
| 1627 | Ga0268265_10601947 | |||
| 1628 | Ga0268264_10020524 | |||
| 1629 | Ga0268264_10036216 | |||
| 1630 | Ga0268264_10122101 | |||
| 1631 | Ga0268264_10478874 | |||
| 1632 | Ga0268264_10737764 | |||
| 1633 | Ga0268264_10865587 | |||
| 1634 | Ga0268264_11084900 | |||
| 1635 | Ga0307517_10419102 | |||
| 1636 | Ga0307515_10037079 | |||
| 1637 | Ga0307512_10047332 | |||
| 1638 | Ga0316177_1108907 | |||
| 1639 | Ga0316178_1161297 | |||
| 1640 | Ga0316183_1077822 | |||
| 1641 | Ga0316181_1283039 | |||
| 1642 | Ga0265327_10009017 | |||
| 1643 | Ga0265327_10206103 | |||
| 1644 | Ga0307513_10036111 | |||
| 1645 | Ga0307509_10006929 | |||
| 1646 | Ga0307509_10040010 | |||
| 1647 | Ga0307509_10048217 | |||
| 1648 | Ga0307509_10055748 | |||
| 1649 | Ga0307509_10169015 | |||
| 1650 | Ga0307509_10204162 | |||
| 1651 | Ga0307509_10440007 | |||
| 1652 | Ga0307408_100058784 | |||
| 1653 | Ga0307408_100142859 | |||
| 1654 | Ga0307408_100170459 | |||
| 1655 | Ga0307408_100240492 | |||
| 1656 | Ga0307408_100411058 | |||
| 1657 | Ga0307408_100720503 | |||
| 1658 | Ga0307508_10001847 | |||
| 1659 | Ga0307508_10003921 | |||
| 1660 | Ga0307508_10256631 | |||
| 1661 | Ga0307514_10101368 | |||
| 1662 | Ga0307514_10315492 | |||
| 1663 | Ga0307516_10014389 | |||
| 1664 | Ga0307516_10019586 | |||
| 1665 | Ga0307516_10402332 | |||
| 1666 | Ga0307405_10014627 | |||
| 1667 | Ga0307405_10077571 | |||
| 1668 | Ga0307405_10186570 | |||
| 1669 | Ga0307405_10214880 | |||
| 1670 | Ga0307405_10406792 | |||
| 1671 | Ga0307413_10028093 | |||
| 1672 | Ga0307413_10402923 | |||
| 1673 | Ga0307413_10564725 | |||
| 1674 | Ga0307410_10040149 | |||
| 1675 | Ga0307410_11413121 | |||
| 1676 | Ga0307406_10006613 | |||
| 1677 | Ga0307406_10017377 | |||
| 1678 | Ga0307406_10080974 | |||
| 1679 | Ga0307406_10212251 | |||
| 1680 | Ga0307407_10049890 | |||
| 1681 | Ga0307407_10321590 | |||
| 1682 | Ga0307407_11056417 | |||
| 1683 | Ga0307412_10036449 | |||
| 1684 | Ga0307412_10083326 | |||
| 1685 | Ga0307412_10359815 | |||
| 1686 | Ga0307412_11255747 | |||
| 1687 | Ga0307412_11328922 | |||
| 1688 | Ga0307409_100039276 | |||
| 1689 | Ga0307409_100089816 | |||
| 1690 | Ga0307409_100401936 | |||
| 1691 | Ga0307416_100021496 | |||
| 1692 | Ga0307416_100162141 | |||
| 1693 | Ga0307416_100181705 | |||
| 1694 | Ga0307416_100298010 | |||
| 1695 | Ga0307416_100447062 | |||
| 1696 | Ga0307416_101270474 | |||
| 1697 | Ga0307416_101430846 | |||
| 1698 | Ga0307414_10047523 | |||
| 1699 | Ga0307414_10119020 | |||
| 1700 | Ga0307414_10199649 | |||
| 1701 | Ga0307414_10296164 | |||
| 1702 | Ga0307414_10558002 | |||
| 1703 | Ga0307411_10045891 | |||
| 1704 | Ga0307411_10294547 | |||
| 1705 | Ga0307415_100656958 | |||
| 1706 | Ga0307507_10223120 | |||
| 1707 | Ga0307507_10303508 | |||
| 1708 | Ga0307510_10003542 | |||
| 1709 | Ga0307510_10047315 | |||
| 1710 | Ga0307510_10079368 | |||
| 1711 | Ga0307510_10204680 | |||
| 1712 | Ga0373950_0029196 | |||
| 1713 | Ga0373926_0061259 | |||
| 1714 | Ga0373926_0125514 | |||
| 1715 | Ga0373934_0001944 | |||
| 1716 | Ga0373934_0111782 | |||
| 1717 | Ga0373944_0042467 | |||
| 1718 | Ga0373944_0067651 | |||
| 1719 | Ga0373923_0014386 | |||
| 1720 | Ga0373923_0127939 | |||
| 1721 | Ga0373945_0035307 | |||
| 1722 | Ga0373945_0035348 | |||
| 1723 | Ga0373953_0002425 | |||
| 1724 | Ga0373953_0123953 | |||
| 1725 | Ga0373954_0083455 | |||
| 1726 | Ga0373954_0090801 | |||
| 1727 | Ga0373956_0013642 | |||
| 1728 | Ga0373956_0040515 | |||
| 1729 | Ga0373957_0121707 | |||
| 1730 | Ga0373943_0011441 | |||
| 1731 | Ga0373943_0029843 | |||
| 1732 | Ga0373943_0068861 | |||
| 1733 | Ga0373946_0235798 | |||
| 1734 | Ga0373955_0106284 | |||
| 1735 | Ga0373955_0552309 | |||
| 1736 | Ga0373962_0065095 | |||
| 1737 | Ga0373931_0009901 | |||
| 1738 | Ga0373931_0116490 | |||
| 1739 | Ga0373935_0050688 | |||
| 1740 | Ga0373927_0035225 | |||
| 1741 | Ga0373927_0302084 | |||
| 1742 | Ga0373933_0044922 | |||
| 1743 | Ga0373933_0062359 | |||
| 1744 | Ga0373933_0092523 | |||
| 1745 | Ga0373933_0237657 | |||
| 1746 | Ga0373947_0011021 | |||
| 1747 | Ga0373947_0034480 | |||
| 1748 | Ga0373947_0191593 | |||
| 1749 | Ga0373937_0012463 | |||
| 1750 | Ga0373937_0050109 | |||
| 1751 | Ga0373937_0056460 | |||
| 1752 | Ga0373937_0092168 | |||
| 1753 | Ga0373937_0312952 | |||
| 1754 | Ga0373937_0347217 | |||
| 1755 | Ga0373937_1153671 | |||
| 1756 | Ga0373925_0024901 | |||
| 1757 | Ga0373925_0031882 | |||
| 1758 | Ga0373925_0048465 | |||
| 1759 | Ga0373925_0048913 | |||
| 1760 | Ga0373925_0075762 | |||
| 1761 | Ga0373925_0508910 | |||
| 1762 | Ga0373925_0560284 | |||
| 1763 | Ga0373925_0782778 | |||
| 1764 | Ga0373925_0836834 | |||
| 1765 | Ga0439436_0000592 | |||
| 1766 | Ga0439447_041199 | |||
| 1767 | Ga0439466_0006056 | |||
| 1768 | Ga0439465_0000761 | |||
| 1769 | Ga0451789_0309580 | |||
| 1770 | Ga0451789_0336218 | |||
| 1771 | Ga0451789_0447876 | |||
| 1772 | Ga0451789_0839090 | |||
| 1773 | Ga0451793_0508741 | |||
| 1774 | Ga0451793_0660801 | |||
| 1775 | Ga0451795_0895049 | |||
| 1776 | Ga0451798_0874042 | |||
| 1777 | Ga0451800_0879857 | |||
| 1778 | Ga0451802_0480397 | |||
| 1779 | Ga0451804_1035411 | |||
| 1780 | Ga0451807_0573351 | |||
| 1781 | Ga0451833_0538022 | |||
| 1782 | Ga0451837_1849440 | |||
| 1783 | Ga0451849_1545266 | |||
| 1784 | Ga0451843_0021787 | |||
| 1785 | Ga0451853_0118375 | |||
| 1786 | Ga0451853_0455726 | |||
| 1787 | Ga0451853_1347476 | |||
| 1788 | Ga0451853_1937945 | |||
| 1789 | Ga0451853_3168548 | |||
| 1790 | Ga0439431_0001225 | |||
| 1791 | Ga0439431_0114009 | |||
| 1792 | Ga0439433_0000449 | |||
| 1793 | Ga0439433_0025632 | |||
| 1794 | Ga0439442_002094 | |||
| 1795 | Ga0439448_0237542 | |||
| 1796 | Ga0439432_000470 | |||
| 1797 | Ga0439449_0000890 | |||
| 1798 | Ga0439449_0054131 | |||
| 1799 | Ga0439452_000804 | |||
| 1800 | Ga0439457_005079 | |||
| 1801 | Ga0439462_0004541 | |||
| 1802 | Ga0450906_009092 | |||
| 1803 | Ga0439446_0001717 | |||
| 1804 | Ga0439464_0014380 | |||
| 1805 | Ga0453684_0001928 | |||
| 1806 | Ga0453684_0414336 | |||
| 1807 | Ga0451576_0151313 | |||
| 1808 | Ga0451576_0324954 | |||
| 1809 | Ga0495617_063032 | |||
| 1810 | Ga0495592_0000237 | |||
| 1811 | Ga0495603_0186978 | |||
| 1812 | Ga0495629_0356138 | |||
| 1813 | Ga0495629_0862694 | |||
| 1814 | Ga0495638_0081185 | |||
| 1815 | Ga0495653_0303809 | |||
| 1816 | Ga0495650_0052945 | |||
| 1817 | Ga0495580_0028788 | |||
| 1818 | Ga0495580_0100322 | |||
| 1819 | Ga0495582_0263663 | |||
| 1820 | Ga0495639_0037083 | |||
| 1821 | Ga0495639_0232973 | |||
| 1822 | Ga0495662_0043669 | |||
| 1823 | Ga0495662_0109570 | |||
| 1824 | Ga0495606_0220459 | |||
| 1825 | Ga0495608_0394374 | |||
| 1826 | Ga0495610_0033947 | |||
| 1827 | Ga0495620_0133392 | |||
| 1828 | Ga0495620_0215403 | |||
| 1829 | Ga0495628_0546241 | |||
| 1830 | Ga0495632_0004239 | |||
| 1831 | Ga0495632_0015113 | |||
| 1832 | Ga0495632_0155475 | |||
| 1833 | Ga0495637_0028720 | |||
| 1834 | Ga0495643_0027856 | |||
| 1835 | Ga0495648_0052752 | |||
| 1836 | Ga0495666_0071749 | |||
| 1837 | Ga0495666_0203785 | |||
| 1838 | Ga0495642_0048223 | |||
| 1839 | Ga0495642_0066155 | |||
| 1840 | Ga0495665_0185392 | |||
| 1841 | Ga0495640_0384680 | |||
| 1842 | Ga0495640_0443414 | |||
| 1843 | Ga0495586_0110782 | |||
| 1844 | Ga0495586_0247947 | |||
| 1845 | Ga0495587_0413393 | |||
| 1846 | Ga0495598_0022132 | |||
| 1847 | Ga0495598_0029268 | |||
| 1848 | Ga0495621_0078638 | |||
| 1849 | Ga0495621_0120558 | |||
| 1850 | Ga0495621_0132333 | |||
| 1851 | Ga0495597_0244212 | |||
| 1852 | Ga0495645_0040954 | |||
| 1853 | Ga0495633_0270483 | |||
| 1854 | Ga0495667_0081112 | |||
| 1855 | Ga0495667_0154727 | |||
| 1856 | Ga0495634_0173094 | |||
| 1857 | Ga0495625_0000250 | |||
| 1858 | Ga0495625_0002839 | |||
| 1859 | Ga0495625_0033710 | |||
| 1860 | Ga0495635_0024341 | |||
| 1861 | Ga0495635_0039339 | |||
| 1862 | Ga0495635_0168591 | |||
| 1863 | Ga0495659_0015569 | |||
| 1864 | Ga0495661_0371687 | |||
| 1865 | Ga0495588_0280947 | |||
| 1866 | Ga0495623_0356522 | |||
| 1867 | Ga0495646_0110692 | |||
| 1868 | Ga0495646_0116877 | |||
| 1869 | Ga0495647_0018159 | |||
| 1870 | Ga0495647_0132230 | |||
| 1871 | Ga0495647_0200505 | |||
| 1872 | Ga0495658_0008454 | |||
| 1873 | Ga0495658_0031936 | |||
| 1874 | Ga0495658_0140345 | |||
| 1875 | Ga0495658_0239986 | |||
| 1876 | Ga0495613_0079797 | |||
| 1877 | Ga0495613_0552100 | |||
| 1878 | Ga0495600_0142576 | |||
| 1879 | Ga0495600_0621364 | |||
| 1880 | Ga0495660_0112047 | |||
| 1881 | Ga0495581_0034926 | |||
| 1882 | Ga0495636_0462665 | |||
| 1883 | Ga0495674_0229393 | |||
| 1884 | Ga0495681_0256219 | |||
| 1885 | Ga0495684_0048192 | |||
| 1886 | Ga0495684_0084397 | |||
| 1887 | Ga0495684_0759639 | |||
| 1888 | Ga0495686_0150608 | |||
| 1889 | Ga0495602_0326662 | |||
| 1890 | Ga0495602_0638677 | |||
| 1891 | Ga0495614_0123573 | |||
| 1892 | Ga0495614_0253342 | |||
| 1893 | Ga0496100_0001162 | |||
| 1894 | Ga0496101_0020120 | |||
| 1895 | Ga0496102_0029174 | |||
| 1896 | Ga0496102_0080501 | |||
| 1897 | Ga0496102_0210901 | |||
| 1898 | Ga0496102_1712625 | |||
| 1899 | Ga0496103_0005038 | |||
| 1900 | Ga0496103_0414978 | |||
| 1901 | Ga0496104_0003675 | |||
| 1902 | Ga0496104_0035846 | |||
| 1903 | Ga0496104_0038441 | |||
| 1904 | Ga0496104_0721842 | |||
| 1905 | Ga0496105_0002647 | |||
| 1906 | Ga0496105_0037483 | |||
| 1907 | Ga0496105_0089552 | |||
| 1908 | Ga0496106_0032767 | |||
| 1909 | Ga0496106_0106134 | |||
| 1910 | Ga0496106_0134457 | |||
| 1911 | Ga0496106_0311310 | |||
| 1912 | Ga0496107_0079063 | |||
| 1913 | Ga0496107_0079311 | |||
| 1914 | Ga0496108_0180201 | |||
| 1915 | Ga0496108_0209180 | |||
| 1916 | Ga0496108_0260481 | |||
| 1917 | Ga0496108_0409089 | |||
| 1918 | Ga0496108_0520621 | |||
| 1919 | Ga0496109_0008486 | |||
| 1920 | Ga0496109_0126638 | |||
| 1921 | Ga0496109_0303394 | |||
| 1922 | Ga0496109_0432002 | |||
| 1923 | Ga0496109_0912162 | |||
| 1924 | Ga0496110_0052513 | |||
| 1925 | Ga0496110_0197732 | |||
| 1926 | Ga0496110_0299903 | |||
| 1927 | Ga0496110_1046320 | |||
| 1928 | Ga0496110_1140457 | |||
| 1929 | Ga0496111_0058232 | |||
| 1930 | Ga0496113_0753119 | |||
| 1931 | Ga0496113_0769547 | |||
| 1932 | Ga0496114_0014319 | |||
| 1933 | Ga0496114_0067881 | |||
| 1934 | Ga0496114_0292396 | |||
| 1935 | Ga0496116_0074249 | |||
| 1936 | Ga0496116_0135938 | |||
| 1937 | Ga0496117_0037929 | |||
| 1938 | Ga0496117_0059893 | |||
| 1939 | Ga0496118_0022064 | |||
| 1940 | Ga0496118_0258762 | |||
| 1941 | Ga0496121_0034238 | |||
| 1942 | Ga0496121_0063784 | |||
| 1943 | Ga0496123_0048613 | |||
| 1944 | Ga0496123_0378850 | |||
| 1945 | Ga0496124_0082228 | |||
| 1946 | Ga0496125_0023431 | |||
| 1947 | Ga0501034_0192997 | |||
| 1948 | Ga0501037_0277123 | |||
| 1949 | Ga0501068_0450524 | |||
| 1950 | Ga0501249_001622 | |||
| 1951 | Ga0501262_000374 | |||
| 1952 | Ga0501044_1010103 | |||
| 1953 | nmdc:mga0k408_138699_c1 | |||
| 1954 | nmdc:mga07m45_15933_c1 | |||
| 1955 | nmdc:mga07m45_294038_c1 | |||
| 1956 | nmdc:mga07m45_93090_c1 | |||
| 1957 | nmdc:mga05p37_87180_c1 | |||
| 1958 | nmdc:mga0n895_161078_c1 | |||
| 1959 | nmdc:mga0n895_696389_c1 | |||
| 1960 | nmdc:mga0rr50_351399_c1 | |||
| 1961 | nmdc:mga0rr50_437703_c1 | |||
| 1962 | nmdc:mga08x19_48212_c1 | |||
| 1963 | nmdc:mga0a205_74496_c1 | |||
| 1964 | Ga0500610_0002609 | |||
| 1965 | Ga0500635_0269197 | |||
| 1966 | Ga0495595_0038728 | |||
| 1967 | Ga0495619_0039996 | |||
| 1968 | Ga0500643_092695 | |||
| 1969 | Ga0500644_0001746 | |||
| 1970 | Ga0500644_0132395 | |||
| 1971 | Ga0500646_0037551 | |||
| 1972 | Ga0500646_0158474 | |||
| 1973 | Ga0500583_0260407 | |||
| 1974 | Ga0500651_0072961 | |||
| 1975 | Ga0500651_0145730 | |||
| 1976 | Ga0500562_058494 | |||
| 1977 | Ga0500569_045660 | |||
| 1978 | Ga0500594_0001437 | |||
| 1979 | Ga0500607_007465 | |||
| 1980 | Ga0500607_118496 | |||
| 1981 | Ga0500614_129267 | |||
| 1982 | Ga0500623_205832 | |||
| 1983 | Ga0500642_0185573 | |||
| 1984 | Ga0500652_000312 | |||
| 1985 | Ga0500655_029829 | |||
| 1986 | Ga0500658_0021735 | |||
| 1987 | Ga0500559_0000602 | |||
| 1988 | Ga0500559_0008733 | |||
| 1989 | Ga0500564_170922 | |||
| 1990 | Ga0500568_0018889 | |||
| 1991 | Ga0500568_0090790 | |||
| 1992 | Ga0500573_0157148 | |||
| 1993 | Ga0500577_0065142 | |||
| 1994 | Ga0500622_0000164 | |||
| 1995 | Ga0500622_0017664 | |||
| 1996 | Ga0500622_0096673 | |||
| 1997 | Ga0500636_0232308 | |||
| 1998 | Ga0500636_0376878 | |||
| 1999 | Ga0500625_058055 | |||
| 2000 | Ga0500596_015338 | |||
| 2001 | Ga0500587_032142 | |||
| 2002 | 2587730116 | |||
| 2003 | 2588293191 | |||
| 2004 | 2643968425 | |||
| 2005 | 2644141783 | |||
| 2006 | 2644272547 | |||
| 2007 | 2644302706 | |||
| 2008 | 2644396627 | |||
| 2009 | 2644468875 | |||
| 2010 | 2842678032 | |||
| 2011 | 2885195385 | |||
| 2012 | 2885200464 | |||
| 2013 | 2885214753 | |||
| 2014 | 2894026022 | |||
| 2015 | 2904450309 | |||
| 2016 | 2904456869 | |||
| 2017 | 2928120402 | |||
| 2018 | 2929521013 | |||
| 2019 | 2945913416 | |||
| 2020 | 2954773096 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cok-assembly1.cif.gz_A | structural analysis of ing3 protein and its binding to histone h3 | 0.7828 | 74 | 154 |
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.7276 | 2 | 154 |
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.7047 | 2 | 154 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.6501 | 1 | 154 |
| 8cok-assembly1.cif.gz_A | structural analysis of ing3 protein and its binding to histone h3 | 0.6095 | 74 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C4J9H4_130_217_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.7511 | 42 | 154 | 1.20.1280.290 |
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7329 | 26 | 154 | 1.20.120.550 |
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7106 | 26 | 154 | 1.20.120.550 |
| af_C4J9H4_130_217_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.6929 | 42 | 154 | 1.20.1280.290 |
| af_Q9ZV02_127_216_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.6723 | 42 | 155 | 1.20.1280.290 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521QWN6-F1-model_v4 | TRAP transporter small permease protein | 0.9389 | 3 | 157 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A2E2KVI2-F1-model_v4 | TRAP transporter small permease protein | 0.9274 | 1 | 156 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A327M6J7-F1-model_v4 | TRAP transporter small permease protein | 0.9241 | 1 | 156 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A432IXI5-F1-model_v4 | TRAP transporter small permease protein | 0.9139 | 30 | 156 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A4Q5VS17-F1-model_v4 | deleted | 0.9102 | 1 | 156 |
|