F488071

General Info

Members Datasets Scaffolds Average Seq Length
1008 520 744 320

Family's Representative Sequence

Representative Sequence 3300046538|Ga0495609_0066467|Ga0495609_0066467_356_1399
Length 347
Sequence MRSLPIQKPLKLMAFTALALLIVSCSSNSPTRSKPQGGGIVRAQPGLDINRAHKDGAPWWDVDVSRIPDAVPTLHTGPYKANPYTVLGKTYFPLNDSATYAQTGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPLPSYVRVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAEIGTARVKVEGIDPAQYWAQRGKPAPLMLDQPQVASSAPVRAQAAPVITASAGTIEQWTPPPQQHAAPVAPVPVQIDAKKNVSGQASGLFLQVGAFANPDAAELLRSKLSGMVRAPVFVSSIARNQQTLYRVRLGPVDTPGEAQQLQNSVRSANLGSPSVVTSDQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231004 Pseudomonas sp. GM102 Isolate Nodule
6 2511231006 Pseudomonas sp. GM17 Isolate Nodule
7 2511231007 Pseudomonas sp. GM18 Isolate Nodule
8 2511231008 Pseudomonas sp. GM21 Isolate Nodule
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2511231011 Pseudomonas sp. GM30 Isolate Nodule
11 2511231012 Pseudomonas sp. GM33 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231018 Pseudomonas sp. GM60 Isolate Nodule
17 2511231019 Pseudomonas sp. GM67 Isolate Nodule
18 2511231020 Pseudomonas sp. GM74 Isolate Nodule
19 2511231021 Pseudomonas sp. GM78 Isolate Nodule
20 2511231022 Pseudomonas sp. GM79 Isolate Nodule
21 2511231023 Pseudomonas sp. GM80 Isolate Nodule
22 2511231024 Pseudomonas sp. GM84 Isolate Nodule
23 2511231031 Pseudomonas sp. GM16 Isolate Nodule
24 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
25 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
26 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
27 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
28 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
29 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
30 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
31 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
32 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
33 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
34 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
35 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
36 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
37 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
38 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
39 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
40 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
41 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
42 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
43 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
44 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
45 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
46 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
47 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
48 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
49 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
50 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
51 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
52 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
53 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
54 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
55 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
56 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
57 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
58 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
59 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
60 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
61 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
62 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
63 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
64 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
65 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
66 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
67 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
68 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
69 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
70 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
71 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
72 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
73 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
74 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
75 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
76 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
77 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
78 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
79 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
80 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
81 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
82 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
83 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
84 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
85 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
86 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
87 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
88 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
89 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
90 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
91 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
92 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
93 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
94 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
95 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
96 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
97 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
98 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
99 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
100 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
101 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
102 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
103 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
104 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
105 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
106 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
107 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
108 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
109 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
110 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
111 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
112 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
113 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
114 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
115 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
116 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
117 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
118 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
119 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
120 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
121 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
122 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
123 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
124 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
125 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
126 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
127 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
128 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
129 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
130 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
131 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
132 2765235841 Pseudomonas putida AA7 Isolate Unclassified
133 2773857670 Pseudomonas sp. 478 Isolate Unclassified
134 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
135 2773857673 Pseudomonas sp. 443 Isolate Unclassified
136 2784132063 Pseudomonas sp. 424 Isolate Unclassified
137 2784132072 Pseudomonas sp. 460 Isolate Unclassified
138 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
139 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
140 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
141 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
142 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
143 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
144 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
145 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
146 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
147 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
148 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
149 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
150 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
151 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
152 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
153 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
154 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
155 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
156 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
157 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
158 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
159 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
160 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
161 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
162 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
163 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
164 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
165 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
166 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
167 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
168 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
169 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
170 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
171 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
172 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
173 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
174 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
175 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
176 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
177 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
178 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
179 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
180 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
181 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
182 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
183 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
184 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
185 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
186 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
187 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
188 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
189 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
190 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
191 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
192 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
193 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
194 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
195 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
196 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
197 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
198 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
199 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
200 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
201 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
202 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
203 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
204 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
205 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
206 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
207 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
208 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
209 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
210 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
211 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
212 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
213 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
214 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
215 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
216 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
217 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
218 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
219 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
220 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
221 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
222 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
223 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
224 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
225 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
226 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
227 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
228 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
229 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
230 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
231 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
232 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
233 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
234 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
235 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
236 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
237 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
238 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
239 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
240 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
241 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
242 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
243 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
244 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
245 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
246 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
247 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
248 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
249 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
250 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
251 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
252 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
253 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
254 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
255 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
256 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
257 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
258 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
259 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
260 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
261 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
262 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
263 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
264 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
265 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
266 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
267 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
268 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
269 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
270 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
271 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
272 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
273 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
274 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
275 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
276 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
277 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
278 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
279 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
280 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
281 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
282 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
283 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
284 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
285 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
286 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
287 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
288 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
289 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
290 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
291 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
292 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
293 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
294 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
295 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
296 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
297 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
298 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
299 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
300 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
301 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
302 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
303 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
309 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
310 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
312 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
314 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
315 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
341 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
342 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
343 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
344 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
345 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
346 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
348 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
349 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
350 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
351 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
352 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
353 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
354 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
355 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
356 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
357 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
358 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
359 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
361 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
362 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
363 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
364 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
365 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
366 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
367 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
368 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
369 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
370 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
371 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
372 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
373 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
374 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
375 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
376 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
377 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
378 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
379 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
380 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
381 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
382 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
383 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
384 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
385 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
386 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
387 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
388 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
389 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
390 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
391 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
392 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
393 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
394 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
395 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
396 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
397 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
398 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
399 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
400 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
401 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
402 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
403 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
404 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
405 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
406 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
407 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
408 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
409 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
410 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
411 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
412 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
413 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
414 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
415 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
416 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
417 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
418 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
419 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
420 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
421 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
422 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
423 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
424 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
425 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
426 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
427 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
428 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
429 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
430 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
431 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
432 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
433 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
434 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
435 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
436 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
437 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
438 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
439 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
440 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
441 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
442 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
443 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
444 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
445 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
446 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
447 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
448 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
449 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
450 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
451 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
452 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
453 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
454 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
455 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
456 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
457 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
458 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
459 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
460 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
461 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
462 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
463 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
464 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
465 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
466 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
467 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
468 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
469 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
470 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
471 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
472 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
473 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
474 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
475 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
476 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
477 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
479 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
481 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
482 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
483 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
484 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
485 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
486 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
487 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
488 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
489 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
490 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
491 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
492 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
493 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
494 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
495 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
496 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
497 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
498 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
499 8052494512 Pseudomonas putida LD6 Isolate Unclassified
500 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
501 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
502 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
503 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
504 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
505 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
506 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
507 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
508 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
509 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
510 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
511 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
512 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
513 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
514 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
515 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
516 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
517 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
518 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
519 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
520 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.61
Metatranscriptomes 0.2
Isolates 26.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 6.75
Nodule 2.68
Rhizoplane 7.44
Rhizosphere 68.15
Stem 0
Stem Tuber 0
Unclassified 14.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1994375 2162886007 Bacteria 1315
2 JGI25162J39368_1000122 3300002737 Bacteria 85129
3 JGI25162J39368_1000233 3300002737 Bacteria 56224
4 JGI25164J39214_1000099 3300002772 Bacteria 85129
5 JGI25164J39214_1000180 3300002772 Bacteria 56224
6 JGI25165J46597_1000205 3300003214 Bacteria 85129
7 JGI25165J46597_1000331 3300003214 Bacteria 56224
8 Ga0006562J51391_1020668 3300003578 Bacteria 3209
9 Ga0055538_1000042 3300003751 Bacteria 164754
10 Ga0055539_1000055 3300003752 Bacteria 164754
11 Ga0055533_1000067 3300003756 Bacteria 164754
12 Ga0055532_1000053 3300003758 Bacteria 164751
13 Ga0055525_1000103 3300003759 Bacteria 134778
14 Ga0055525_1002283 3300003759 Bacteria 2082
15 Ga0055536_1001766 3300003781 Bacteria 12745
16 Ga0055536_1003363 3300003781 Bacteria 8635
17 Ga0055536_1008077 3300003781 Bacteria 4592
18 Ga0055536_1021178 3300003781 Bacteria 1982
19 Ga0055530_10000884 3300003791 Bacteria 24615
20 Ga0055530_10001431 3300003791 Bacteria 17475
21 Ga0055530_10002933 3300003791 Bacteria 10326
22 Ga0055530_10008959 3300003791 Bacteria 3917
23 Ga0055540_1000333 3300003792 Bacteria 40988
24 Ga0055540_1000455 3300003792 Bacteria 31894
25 Ga0055540_1002283 3300003792 Bacteria 10326
26 Ga0055531_10001360 3300003794 Bacteria 18185
27 Ga0055541_1000042 3300003841 Bacteria 164754
28 Ga0058692_1002717 3300003856 Bacteria 5818
29 Ga0065714_10000379 3300005288 Bacteria 5607
30 Ga0065714_10003289 3300005288 Bacteria 12364
31 Ga0065714_10003418 3300005288 Bacteria 10099
32 Ga0065714_10025053 3300005288 Bacteria 2304
33 Ga0065714_10076102 3300005288 Bacteria 2829
34 Ga0065714_10082099 3300005288 Bacteria 2320
35 Ga0065714_10119037 3300005288 Bacteria 1363
36 Ga0065714_10147869 3300005288 Bacteria 1124
37 Ga0065704_10006960 3300005289 Bacteria 2883
38 Ga0065704_10009829 3300005289 Bacteria 3529
39 Ga0065704_10072683 3300005289 Bacteria 8151
40 Ga0065712_10000936 3300005290 Bacteria 8326
41 Ga0065712_10002123 3300005290 Bacteria 8891
42 Ga0065712_10068547 3300005290 Bacteria 9950
43 Ga0070670_100000002 3300005331 Bacteria 568775
44 Ga0070670_100004982 3300005331 Bacteria 11175
45 Ga0070680_100003483 3300005336 Bacteria 11750
46 Ga0070682_100108166 3300005337 Bacteria 1848
47 Ga0070661_100000729 3300005344 Bacteria 24032
48 Ga0070669_100000218 3300005353 Bacteria 47769
49 Ga0070669_100062268 3300005353 Bacteria 2743
50 Ga0070671_100000022 3300005355 Bacteria 124364
51 Ga0070713_100181425 3300005436 Bacteria 1892
52 Ga0070662_100002371 3300005457 Bacteria 11576
53 Ga0070681_10096046 3300005458 Bacteria 2912
54 Ga0070679_100002393 3300005530 Bacteria 17004
55 Ga0070679_100028256 3300005530 Bacteria 5529
56 Ga0068853_100000414 3300005539 Bacteria 29409
57 Ga0070665_100024188 3300005548 Bacteria 6117
58 Ga0070665_100118858 3300005548 Bacteria 2645
59 Ga0070665_100486116 3300005548 Bacteria 1245
60 Ga0068855_100010801 3300005563 Bacteria 11024
61 Ga0068855_100070916 3300005563 Bacteria 4052
62 Ga0070664_100012726 3300005564 Bacteria 6849
63 Ga0070664_100226216 3300005564 Bacteria 1675
64 Ga0068854_100001639 3300005578 Bacteria 13614
65 Ga0068856_100589436 3300005614 Bacteria 1133
66 Ga0068852_100451808 3300005616 Bacteria 1272
67 Ga0068851_10000002 3300005834 Bacteria 302756
68 Ga0075364_10055660 3300006051 Bacteria 2588
69 Ga0075364_10074023 3300006051 Bacteria 2246
70 Ga0075364_10121238 3300006051 Bacteria 1750
71 Ga0075432_10035384 3300006058 Bacteria 1735
72 Ga0075432_10063712 3300006058 Bacteria 1316
73 Ga0075432_10072561 3300006058 Bacteria 1238
74 Ga0075362_10105567 3300006177 Bacteria 1321
75 Ga0075369_10100356 3300006186 Bacteria 1298
76 Ga0099823_1019967 3300006944 Bacteria 6362
77 Ga0079104_1000116 3300006946 Bacteria 114868
78 Ga0079104_1002609 3300006946 Bacteria 9443
79 Ga0105251_10000011 3300009011 Bacteria 180176
80 Ga0105251_10002219 3300009011 Bacteria 15495
81 Ga0105251_10004234 3300009011 Bacteria 9909
82 Ga0105251_10008203 3300009011 Bacteria 6314
83 Ga0105251_10009460 3300009011 Bacteria 5753
84 Ga0105251_10021111 3300009011 Bacteria 3407
85 Ga0105251_10024384 3300009011 Bacteria 3107
86 Ga0105251_10031139 3300009011 Bacteria 2672
87 Ga0105251_10051625 3300009011 Bacteria 1960
88 Ga0105251_10080024 3300009011 Bacteria 1511
89 Ga0105244_10001066 3300009036 Bacteria 22914
90 Ga0105244_10006436 3300009036 Bacteria 7603
91 Ga0105244_10008892 3300009036 Bacteria 6226
92 Ga0105244_10011041 3300009036 Bacteria 5443
93 Ga0105244_10011294 3300009036 Bacteria 5370
94 Ga0105244_10011431 3300009036 Bacteria 5326
95 Ga0105244_10019152 3300009036 Bacteria 3828
96 Ga0105244_10028204 3300009036 Bacteria 3015
97 Ga0105244_10029959 3300009036 Bacteria 2900
98 Ga0105244_10038231 3300009036 Bacteria 2503
99 Ga0105244_10038927 3300009036 Bacteria 2477
100 Ga0105250_10000657 3300009092 Bacteria 21923
101 Ga0105250_10004400 3300009092 Bacteria 6488
102 Ga0105250_10055693 3300009092 Bacteria 1587
103 Ga0105240_10000960 3300009093 Bacteria 51436
104 Ga0105240_10012712 3300009093 Bacteria 11604
105 Ga0105240_10256444 3300009093 Bacteria 2020
106 Ga0105240_10686944 3300009093 Bacteria 1118
107 Ga0105243_10000188 3300009148 Bacteria 71863
108 Ga0105243_10001577 3300009148 Bacteria 19929
109 Ga0105243_10059100 3300009148 Bacteria 3058
110 Ga0105243_10115022 3300009148 Bacteria 2258
111 Ga0105242_10000442 3300009176 Bacteria 32971
112 Ga0105248_10014418 3300009177 Bacteria 8699
113 Ga0105248_10710898 3300009177 Bacteria 1134
114 Ga0105237_10001803 3300009545 Bacteria 27640
115 Ga0105237_10011832 3300009545 Bacteria 9228
116 Ga0105238_10001357 3300009551 Bacteria 24558
117 Ga0105238_10590346 3300009551 Bacteria 1118
118 Ga0105249_10187816 3300009553 Bacteria 2015
119 Ga0105246_10000552 3300011119 Bacteria 20625
120 Ga0105246_10000905 3300011119 Bacteria 17012
121 Ga0105246_10010477 3300011119 Bacteria 5737
122 Ga0157345_1001221 3300012498 Bacteria 1822
123 Ga0157373_10003549 3300013100 Bacteria 11782
124 Ga0157373_10024113 3300013100 Bacteria 4409
125 Ga0157373_10111642 3300013100 Bacteria 1922
126 Ga0157373_10144477 3300013100 Bacteria 1673
127 Ga0157373_10173169 3300013100 Bacteria 1519
128 Ga0157373_10247884 3300013100 Bacteria 1259
129 Ga0157373_10250491 3300013100 Bacteria 1253
130 Ga0157371_10000243 3300013102 Bacteria 77959
131 Ga0157371_10001094 3300013102 Bacteria 29390
132 Ga0157371_10011353 3300013102 Bacteria 6871
133 Ga0157371_10011506 3300013102 Bacteria 6808
134 Ga0157371_10033069 3300013102 Bacteria 3718
135 Ga0157370_10000388 3300013104 Bacteria 55229
136 Ga0157370_10001514 3300013104 Bacteria 28723
137 Ga0157370_10066193 3300013104 Bacteria 3418
138 Ga0157370_10116589 3300013104 Unclassified 2495
139 Ga0157370_10144054 3300013104 Bacteria 2219
140 Ga0157370_10167000 3300013104 Bacteria 2046
141 Ga0157370_10347488 3300013104 Bacteria 1367
142 Ga0157369_10000818 3300013105 Bacteria 39768
143 Ga0157369_10006101 3300013105 Bacteria 13991
144 Ga0157369_10148184 3300013105 Bacteria 2481
145 Ga0157369_10167030 3300013105 Bacteria 2320
146 Ga0157369_10169975 3300013105 Bacteria 2297
147 Ga0157369_10173827 3300013105 Bacteria 2268
148 Ga0157369_10564407 3300013105 Bacteria 1176
149 Ga0163162_10012103 3300013306 Bacteria 8417
150 Ga0163162_10587354 3300013306 Bacteria 1241
151 Ga0163162_10768447 3300013306 Bacteria 1082
152 Ga0157372_10001236 3300013307 Bacteria 27666
153 Ga0157372_10045650 3300013307 Bacteria 4861
154 Ga0157372_10101121 3300013307 Bacteria 3290
155 Ga0157375_10115247 3300013308 Bacteria 2790
156 Ga0182008_10000900 3300014497 Bacteria 20656
157 Ga0182008_10039844 3300014497 Bacteria 2347
158 Ga0182008_10040155 3300014497 Bacteria 2337
159 Ga0182008_10042578 3300014497 Bacteria 2262
160 Ga0182008_10056097 3300014497 Bacteria 1947
161 Ga0182008_10109988 3300014497 Bacteria 1365
162 Ga0182008_10135026 3300014497 Bacteria 1232
163 Ga0157379_10034328 3300014968 Bacteria 4523
164 Ga0157379_10316654 3300014968 Bacteria 1424
165 Ga0182006_1037239 3300015261 Bacteria 1929
166 Ga0182006_1072752 3300015261 Bacteria 1270
167 Ga0182006_1080464 3300015261 Bacteria 1190
168 Ga0182007_10002788 3300015262 Bacteria 8518
169 Ga0182005_1007407 3300015265 Bacteria 3294
170 Ga0163161_10127654 3300017792 Bacteria 1916
171 Ga0163161_10309887 3300017792 Bacteria 1245
172 Ga0163161_10310227 3300017792 Bacteria 1245
173 Ga0163161_10397654 3300017792 Bacteria 1104
174 Ga0209435_100900 3300025206 Bacteria 4520
175 Ga0209760_100058 3300025207 Bacteria 98827
176 Ga0209760_100060 3300025207 Bacteria 97274
177 Ga0209784_100060 3300025224 Bacteria 164838
178 Ga0209566_100075 3300025225 Bacteria 164838
179 Ga0209674_100100 3300025226 Bacteria 164838
180 Ga0209147_100096 3300025229 Bacteria 164838
181 Ga0209563_100118 3300025230 Bacteria 131627
182 Ga0209563_101016 3300025230 Bacteria 8182
183 Ga0207427_100056 3300025231 Bacteria 204343
184 Ga0207427_100063 3300025231 Bacteria 177711
185 Ga0209437_100065 3300025233 Bacteria 332417
186 Ga0209437_100133 3300025233 Bacteria 178493
187 Ga0209258_100221 3300025242 Bacteria 108497
188 Ga0209646_1000474 3300025246 Bacteria 20163
189 Ga0209677_100057 3300025253 Bacteria 164838
190 Ga0209759_1015683 3300025256 Bacteria 1945
191 Ga0209233_1000085 3300025261 Bacteria 333078
192 Ga0209233_1000133 3300025261 Bacteria 202716
193 Ga0209676_1000076 3300025292 Bacteria 301393
194 Ga0209676_1000264 3300025292 Bacteria 110593
195 Ga0209676_1000822 3300025292 Bacteria 40365
196 Ga0209676_1000952 3300025292 Bacteria 35453
197 Ga0209676_1003131 3300025292 Bacteria 10579
198 Ga0209676_1015731 3300025292 Bacteria 2769
199 Ga0209050_1000063 3300025298 Bacteria 314955
200 Ga0209050_1000080 3300025298 Bacteria 275154
201 Ga0209050_1000106 3300025298 Bacteria 224396
202 Ga0209050_1002243 3300025298 Bacteria 17249
203 Ga0209051_1000045 3300025303 Bacteria 297882
204 Ga0209051_1000082 3300025303 Bacteria 193133
205 Ga0209051_1000139 3300025303 Bacteria 136281
206 Ga0209257_1000185 3300025304 Bacteria 155047
207 Ga0209257_1012213 3300025304 Bacteria 4006
208 Ga0207656_10000010 3300025321 Bacteria 192224
209 Ga0207696_1000047 3300025711 Bacteria 285005
210 Ga0207696_1000065 3300025711 Bacteria 231818
211 Ga0207696_1000126 3300025711 Bacteria 136197
212 Ga0207696_1000168 3300025711 Bacteria 103496
213 Ga0207696_1009597 3300025711 Bacteria 3602
214 Ga0207696_1017805 3300025711 Bacteria 2345
215 Ga0207696_1037936 3300025711 Bacteria 1424
216 Ga0207655_1000120 3300025728 Bacteria 157018
217 Ga0207655_1000213 3300025728 Bacteria 101587
218 Ga0207655_1000214 3300025728 Bacteria 101123
219 Ga0207655_1000742 3300025728 Bacteria 36636
220 Ga0207655_1000810 3300025728 Bacteria 33884
221 Ga0207655_1001105 3300025728 Bacteria 26398
222 Ga0207655_1001674 3300025728 Bacteria 19532
223 Ga0207655_1004177 3300025728 Bacteria 10364
224 Ga0207655_1006183 3300025728 Bacteria 7978
225 Ga0207655_1009815 3300025728 Bacteria 5896
226 Ga0207655_1011058 3300025728 Bacteria 5413
227 Ga0207655_1011644 3300025728 Bacteria 5215
228 Ga0207655_1024689 3300025728 Bacteria 2938
229 Ga0207655_1035864 3300025728 Bacteria 2208
230 Ga0207655_1063911 3300025728 Bacteria 1407
231 Ga0207713_1000049 3300025735 Bacteria 227882
232 Ga0207713_1000073 3300025735 Bacteria 181519
233 Ga0207713_1000337 3300025735 Bacteria 52167
234 Ga0207713_1000467 3300025735 Bacteria 42199
235 Ga0207713_1000799 3300025735 Bacteria 29154
236 Ga0207713_1000862 3300025735 Bacteria 27758
237 Ga0207713_1002385 3300025735 Bacteria 13726
238 Ga0207713_1003051 3300025735 Bacteria 11656
239 Ga0207713_1004156 3300025735 Bacteria 9500
240 Ga0207713_1005188 3300025735 Bacteria 8226
241 Ga0207713_1006295 3300025735 Bacteria 7258
242 Ga0207713_1009274 3300025735 Bacteria 5571
243 Ga0207713_1019085 3300025735 Bacteria 3369
244 Ga0207713_1022056 3300025735 Bacteria 3035
245 Ga0207713_1023984 3300025735 Bacteria 2856
246 Ga0207713_1029733 3300025735 Bacteria 2442
247 Ga0207707_10000165 3300025912 Bacteria 69371
248 Ga0207695_10008884 3300025913 Bacteria 12509
249 Ga0207695_10009284 3300025913 Bacteria 12178
250 Ga0207695_10100317 3300025913 Bacteria 2891
251 Ga0207695_10518162 3300025913 Bacteria 1074
252 Ga0207671_10000373 3300025914 Bacteria 63578
253 Ga0207660_10003867 3300025917 Bacteria 9756
254 Ga0207660_10080199 3300025917 Bacteria 2396
255 Ga0207649_10000126 3300025920 Bacteria 64678
256 Ga0207652_10005936 3300025921 Bacteria 9878
257 Ga0207652_10022224 3300025921 Bacteria 5244
258 Ga0207652_10123589 3300025921 Bacteria 2304
259 Ga0207681_10000148 3300025923 Bacteria 58793
260 Ga0207681_10008503 3300025923 Bacteria 6272
261 Ga0207650_10000409 3300025925 Bacteria 38344
262 Ga0207650_10000620 3300025925 Bacteria 28400
263 Ga0207644_10000037 3300025931 Bacteria 124306
264 Ga0207706_10000871 3300025933 Bacteria 31040
265 Ga0207706_10014846 3300025933 Bacteria 7052
266 Ga0207686_10003589 3300025934 Bacteria 8323
267 Ga0207709_10000030 3300025935 Bacteria 331710
268 Ga0207709_10000265 3300025935 Bacteria 61850
269 Ga0207709_10005530 3300025935 Bacteria 7167
270 Ga0207709_10059153 3300025935 Bacteria 2384
271 Ga0207709_10071874 3300025935 Bacteria 2199
272 Ga0207709_10093172 3300025935 Bacteria 1974
273 Ga0207711_10090221 3300025941 Bacteria 2694
274 Ga0207679_10000017 3300025945 Bacteria 253004
275 Ga0207679_10116066 3300025945 Bacteria 2122
276 Ga0207667_10002663 3300025949 Bacteria 22069
277 Ga0207667_10010320 3300025949 Bacteria 10925
278 Ga0207667_10235358 3300025949 Bacteria 1875
279 Ga0207667_10363270 3300025949 Bacteria 1476
280 Ga0207639_10000418 3300026041 Bacteria 29438
281 Ga0207702_10481031 3300026078 Bacteria 1208
282 Ga0209281_1000070 3300027111 Bacteria 277098
283 Ga0209281_1000127 3300027111 Bacteria 200036
284 Ga0209281_1003227 3300027111 Bacteria 5558
285 Ga0209389_1000171 3300027296 Bacteria 52288
286 Ga0209371_1000094 3300027312 Bacteria 170815
287 Ga0209371_1000219 3300027312 Bacteria 76557
288 Ga0209995_1001312 3300027471 Bacteria 3830
289 Ga0209983_1002129 3300027665 Bacteria 4363
290 Ga0207428_10003468 3300027907 Bacteria 15304
291 Ga0268266_10000246 3300028379 Bacteria 91633
292 Ga0268266_10057991 3300028379 Bacteria 3333
293 Ga0268266_10176726 3300028379 Bacteria 1941
294 Ga0268256_1000083 3300030500 Bacteria 170829
295 Ga0268256_1000356 3300030500 Bacteria 43790
296 Ga0314311_1250128 3300030733 Bacteria 4937
297 Ga0316178_1105767 3300030735 Bacteria 15950
298 Ga0316181_1098368 3300030744 Bacteria 2006
299 Ga0316181_1105230 3300030744 Bacteria 1709
300 Ga0265316_10207768 3300031344 Bacteria 1449
301 Ga0307408_100000013 3300031548 Bacteria 386212
302 Ga0307408_100157661 3300031548 Bacteria 1799
303 Ga0307408_100188021 3300031548 Bacteria 1661
304 Ga0316575_10109859 3300031665 Bacteria 1125
305 Ga0316579_10000205 3300031691 Bacteria 17584
306 Ga0316578_10014339 3300031728 Bacteria 4231
307 Ga0316577_10003841 3300031733 Bacteria 7656
308 Ga0307409_100191685 3300031995 Bacteria 1820
309 Ga0316585_10004574 3300032137 Bacteria 3861
310 Ga0316593_10017867 3300032168 Bacteria 2169
311 Ga0307510_10164030 3300033180 Bacteria 1813
312 Ga0316574_0034538 3300035398 Bacteria 3084
313 Ga0316581_0000481 3300037588 Bacteria 7661
314 Ga0436365_0833723 3300039437 Bacteria 1624
315 Ga0439436_0000216 3300041404 Bacteria 13822
316 Ga0439438_000980 3300041405 Bacteria 12761
317 Ga0439438_005907 3300041405 Bacteria 4424
318 Ga0439438_009913 3300041405 Bacteria 3053
319 Ga0439438_012665 3300041405 Bacteria 2577
320 Ga0439447_001011 3300041407 Bacteria 10243
321 Ga0439447_004964 3300041407 Bacteria 4491
322 Ga0439447_006926 3300041407 Bacteria 3634
323 Ga0439447_010943 3300041407 Bacteria 2671
324 Ga0439447_015002 3300041407 Bacteria 2159
325 Ga0439447_015739 3300041407 Bacteria 2092
326 Ga0439466_0000892 3300041411 Bacteria 11370
327 Ga0439466_0003444 3300041411 Bacteria 6137
328 Ga0439466_0005529 3300041411 Bacteria 4821
329 Ga0439466_0006397 3300041411 Bacteria 4479
330 Ga0439466_0009496 3300041411 Bacteria 3633
331 Ga0439466_0010716 3300041411 Bacteria 3404
332 Ga0439466_0017178 3300041411 Bacteria 2609
333 Ga0451789_0974815 3300041443 Bacteria 1635
334 Ga0439431_0001116 3300041997 Bacteria 5834
335 Ga0439431_0007794 3300041997 Bacteria 2394
336 Ga0439437_000227 3300042000 Bacteria 5054
337 Ga0439432_007057 3300042006 Bacteria 3995
338 Ga0439432_011529 3300042006 Bacteria 3046
339 Ga0439432_017521 3300042006 Bacteria 2403
340 Ga0439432_020578 3300042006 Bacteria 2192
341 Ga0439451_002551 3300042009 Bacteria 3704
342 Ga0439451_013598 3300042009 Bacteria 1644
343 Ga0439452_000418 3300042010 Bacteria 24826
344 Ga0439452_003004 3300042010 Bacteria 5995
345 Ga0439452_004529 3300042010 Bacteria 4646
346 Ga0439452_013156 3300042010 Bacteria 2330
347 Ga0439452_019675 3300042010 Bacteria 1781
348 Ga0439456_000131 3300042013 Bacteria 23552
349 Ga0439456_003575 3300042013 Bacteria 3154
350 Ga0439456_005080 3300042013 Bacteria 2672
351 Ga0439456_024479 3300042013 Bacteria 1280
352 Ga0439463_005854 3300042016 Bacteria 3051
353 Ga0439463_006630 3300042016 Bacteria 2867
354 Ga0439463_015614 3300042016 Bacteria 1878
355 Ga0450911_000012 3300042115 Bacteria 129546
356 Ga0450911_003690 3300042115 Bacteria 2645
357 Ga0450911_004361 3300042115 Bacteria 2326
358 Ga0450923_004056 3300042125 Bacteria 2271
359 Ga0450890_003834 3300042127 Bacteria 1982
360 Ga0450898_003444 3300042134 Bacteria 2275
361 Ga0450900_001014 3300042136 Bacteria 2563
362 Ga0450902_003971 3300042137 Bacteria 2187
363 Ga0450904_000453 3300042139 Bacteria 8173
364 Ga0450905_000731 3300042142 Bacteria 4020
365 Ga0450906_007780 3300042145 Bacteria 2102
366 Ga0450906_020115 3300042145 Bacteria 1195
367 Ga0450907_000827 3300042146 Bacteria 7613
368 Ga0450907_003188 3300042146 Bacteria 2965
369 Ga0450910_001431 3300042147 Bacteria 3004
370 Ga0439446_0000270 3300042156 Bacteria 9731
371 Ga0439446_0004766 3300042156 Bacteria 3453
372 Ga0439446_0011069 3300042156 Bacteria 2442
373 Ga0450908_012048 3300042184 Bacteria 1574
374 Ga0450909_000842 3300042185 Bacteria 4160
375 Ga0439434_0002762 3300042435 Bacteria 5115
376 Ga0439459_0004312 3300042438 Bacteria 2286
377 Ga0439464_0012870 3300042439 Bacteria 2233
378 Ga0439464_0036442 3300042439 Bacteria 1391
379 Ga0450916_002789 3300042530 Bacteria 1881
380 Ga0450918_005874 3300042531 Bacteria 2197
381 Ga0450893_0000237 3300042532 Bacteria 7411
382 Ga0450901_001790 3300042533 Bacteria 2411
383 Ga0451577_0360142 3300042876 Bacteria 1319
384 Ga0439440_0003584 3300042993 Bacteria 3005
385 Ga0466969_0002332 3300044656 Bacteria 10138
386 Ga0453684_0002021 3300044712 Bacteria 51836
387 Ga0453684_0144229 3300044712 Bacteria 2839
388 Ga0466959_0001286 3300045049 Bacteria 15187
389 Ga0466959_0013335 3300045049 Bacteria 5957
390 Ga0495617_006136 3300046452 Bacteria 4231
391 Ga0495617_026908 3300046452 Bacteria 1936
392 Ga0495627_000037 3300046453 Bacteria 198542
393 Ga0495627_003242 3300046453 Bacteria 7304
394 Ga0495627_011888 3300046453 Bacteria 3106
395 Ga0495627_014626 3300046453 Bacteria 2732
396 Ga0495627_020892 3300046453 Bacteria 2175
397 Ga0495591_000036 3300046458 Bacteria 167479
398 Ga0495591_000571 3300046458 Bacteria 28201
399 Ga0495591_002368 3300046458 Bacteria 10588
400 Ga0495591_003076 3300046458 Bacteria 8840
401 Ga0495591_005316 3300046458 Bacteria 5994
402 Ga0495591_005675 3300046458 Bacteria 5714
403 Ga0495591_007513 3300046458 Bacteria 4622
404 Ga0495591_009824 3300046458 Bacteria 3767
405 Ga0495591_011543 3300046458 Bacteria 3339
406 Ga0495591_011647 3300046458 Bacteria 3314
407 Ga0495591_014947 3300046458 Bacteria 2762
408 Ga0495591_048402 3300046458 Bacteria 1172
409 Ga0495638_0041214 3300046460 Bacteria 2922
410 Ga0495653_0060776 3300046463 Bacteria 2861
411 Ga0495653_0069895 3300046463 Bacteria 2628
412 Ga0495653_0093187 3300046463 Bacteria 2198
413 Ga0495653_0098835 3300046463 Bacteria 2118
414 Ga0495650_0019791 3300046471 Bacteria 3299
415 Ga0495650_0031597 3300046471 Bacteria 2379
416 Ga0495650_0075575 3300046471 Bacteria 1311
417 Ga0495605_0000033 3300046474 Bacteria 209203
418 Ga0495605_0000442 3300046474 Bacteria 37385
419 Ga0495605_0000453 3300046474 Bacteria 36766
420 Ga0495605_0006045 3300046474 Bacteria 6993
421 Ga0495605_0034365 3300046474 Bacteria 2567
422 Ga0495605_0037682 3300046474 Bacteria 2430
423 Ga0495605_0040672 3300046474 Bacteria 2320
424 Ga0495639_0004168 3300046475 Bacteria 6198
425 Ga0495584_0006054 3300046491 Bacteria 6369
426 Ga0495584_0006365 3300046491 Bacteria 6185
427 Ga0495584_0017395 3300046491 Bacteria 3660
428 Ga0495584_0022204 3300046491 Bacteria 3221
429 Ga0495584_0058306 3300046491 Bacteria 1942
430 Ga0495584_0062519 3300046491 Bacteria 1871
431 Ga0495584_0062525 3300046491 Bacteria 1871
432 Ga0495584_0076807 3300046491 Bacteria 1679
433 Ga0495584_0088122 3300046491 Bacteria 1564
434 Ga0495585_0010926 3300046492 Bacteria 5395
435 Ga0495585_0012667 3300046492 Bacteria 4963
436 Ga0495585_0015984 3300046492 Bacteria 4352
437 Ga0495585_0031496 3300046492 Bacteria 3010
438 Ga0495594_0009324 3300046499 Bacteria 5070
439 Ga0495596_0001043 3300046500 Bacteria 16455
440 Ga0495596_0014076 3300046500 Bacteria 3374
441 Ga0495607_0000385 3300046501 Bacteria 45205
442 Ga0495607_0000614 3300046501 Bacteria 34704
443 Ga0495607_0000674 3300046501 Bacteria 32994
444 Ga0495607_0001352 3300046501 Bacteria 21875
445 Ga0495607_0004283 3300046501 Bacteria 10542
446 Ga0495607_0017751 3300046501 Bacteria 4555
447 Ga0495607_0053435 3300046501 Bacteria 2334
448 Ga0495607_0067797 3300046501 Bacteria 2003
449 Ga0495607_0082345 3300046501 Bacteria 1766
450 Ga0495607_0135260 3300046501 Bacteria 1277
451 Ga0495583_0000031 3300046506 Bacteria 253982
452 Ga0495583_0003664 3300046506 Bacteria 11444
453 Ga0495583_0005049 3300046506 Bacteria 9117
454 Ga0495583_0013177 3300046506 Bacteria 4628
455 Ga0495583_0032092 3300046506 Bacteria 2538
456 Ga0495583_0041293 3300046506 Bacteria 2162
457 Ga0495583_0054817 3300046506 Bacteria 1804
458 Ga0495606_0000722 3300046507 Bacteria 51115
459 Ga0495606_0001283 3300046507 Bacteria 34807
460 Ga0495606_0001919 3300046507 Bacteria 25814
461 Ga0495606_0011936 3300046507 Bacteria 7024
462 Ga0495606_0036936 3300046507 Bacteria 3322
463 Ga0495606_0048624 3300046507 Bacteria 2787
464 Ga0495606_0051326 3300046507 Bacteria 2691
465 Ga0495606_0112998 3300046507 Bacteria 1635
466 Ga0495606_0187822 3300046507 Bacteria 1187
467 Ga0495610_0009189 3300046512 Bacteria 6274
468 Ga0495610_0011481 3300046512 Bacteria 5415
469 Ga0495610_0058517 3300046512 Bacteria 1843
470 Ga0495616_0015598 3300046513 Bacteria 4221
471 Ga0495616_0019488 3300046513 Bacteria 3701
472 Ga0495616_0029577 3300046513 Bacteria 2890
473 Ga0495616_0051249 3300046513 Bacteria 2059
474 Ga0495616_0052584 3300046513 Bacteria 2028
475 Ga0495620_0000007 3300046515 Bacteria 191058
476 Ga0495620_0000038 3300046515 Bacteria 114064
477 Ga0495620_0005117 3300046515 Bacteria 7343
478 Ga0495620_0006559 3300046515 Bacteria 6382
479 Ga0495620_0006731 3300046515 Bacteria 6290
480 Ga0495620_0022344 3300046515 Bacteria 3047
481 Ga0495620_0046724 3300046515 Bacteria 1868
482 Ga0495631_0005175 3300046518 Bacteria 6870
483 Ga0495631_0006650 3300046518 Bacteria 5944
484 Ga0495631_0019960 3300046518 Bacteria 3136
485 Ga0495631_0022969 3300046518 Bacteria 2896
486 Ga0495631_0032643 3300046518 Bacteria 2346
487 Ga0495631_0052481 3300046518 Bacteria 1781
488 Ga0495632_0006732 3300046519 Bacteria 7346
489 Ga0495632_0009692 3300046519 Bacteria 5781
490 Ga0495632_0012800 3300046519 Bacteria 4815
491 Ga0495632_0023244 3300046519 Bacteria 3313
492 Ga0495632_0027149 3300046519 Bacteria 3001
493 Ga0495632_0033446 3300046519 Bacteria 2639
494 Ga0495632_0039664 3300046519 Bacteria 2375
495 Ga0495632_0043150 3300046519 Bacteria 2256
496 Ga0495632_0053872 3300046519 Bacteria 1973
497 Ga0495632_0062583 3300046519 Bacteria 1804
498 Ga0495632_0130720 3300046519 Bacteria 1168
499 Ga0495637_0000064 3300046520 Bacteria 92793
500 Ga0495637_0000610 3300046520 Bacteria 25464
501 Ga0495637_0006010 3300046520 Bacteria 6133
502 Ga0495637_0007118 3300046520 Bacteria 5569
503 Ga0495637_0023874 3300046520 Bacteria 2770
504 Ga0495637_0024152 3300046520 Bacteria 2751
505 Ga0495637_0024415 3300046520 Bacteria 2735
506 Ga0495637_0031839 3300046520 Bacteria 2329
507 Ga0495637_0032684 3300046520 Bacteria 2290
508 Ga0495637_0037617 3300046520 Bacteria 2099
509 Ga0495637_0063521 3300046520 Bacteria 1508
510 Ga0495637_0066098 3300046520 Bacteria 1470
511 Ga0495643_0000159 3300046522 Bacteria 108642
512 Ga0495643_0002175 3300046522 Bacteria 16050
513 Ga0495643_0014724 3300046522 Bacteria 4646
514 Ga0495643_0032701 3300046522 Bacteria 2884
515 Ga0495643_0051633 3300046522 Bacteria 2210
516 Ga0495643_0074767 3300046522 Bacteria 1773
517 Ga0495644_0006044 3300046523 Bacteria 4715
518 Ga0495644_0018656 3300046523 Bacteria 2648
519 Ga0495644_0045882 3300046523 Bacteria 1643
520 Ga0495648_0028708 3300046524 Bacteria 3701
521 Ga0495648_0028764 3300046524 Bacteria 3697
522 Ga0495648_0031832 3300046524 Bacteria 3469
523 Ga0495648_0041970 3300046524 Bacteria 2883
524 Ga0495648_0056618 3300046524 Bacteria 2357
525 Ga0495648_0064373 3300046524 Bacteria 2160
526 Ga0495648_0073707 3300046524 Bacteria 1969
527 Ga0495648_0085923 3300046524 Bacteria 1775
528 Ga0495648_0108286 3300046524 Bacteria 1517
529 Ga0495648_0134843 3300046524 Bacteria 1307
530 Ga0495666_0061529 3300046526 Bacteria 1793
531 Ga0495642_0003319 3300046528 Bacteria 6357
532 Ga0495654_0002905 3300046530 Bacteria 10740
533 Ga0495654_0004835 3300046530 Bacteria 7927
534 Ga0495654_0018079 3300046530 Bacteria 3697
535 Ga0495654_0030115 3300046530 Bacteria 2763
536 Ga0495654_0032189 3300046530 Bacteria 2658
537 Ga0495654_0063050 3300046530 Bacteria 1775
538 Ga0495654_0072908 3300046530 Bacteria 1624
539 Ga0495609_0000018 3300046538 Bacteria 302609
540 Ga0495609_0000056 3300046538 Bacteria 146060
541 Ga0495609_0002274 3300046538 Bacteria 11976
542 Ga0495609_0066467 3300046538 Bacteria 1588
543 Ga0495609_0101947 3300046538 Bacteria 1243
544 Ga0495597_0000026 3300046542 Bacteria 139551
545 Ga0495597_0013450 3300046542 Bacteria 3920
546 Ga0495597_0050026 3300046542 Bacteria 1846
547 Ga0495597_0057126 3300046542 Bacteria 1708
548 Ga0495622_0008113 3300046557 Bacteria 4866
549 Ga0495622_0060299 3300046557 Bacteria 1756
550 Ga0495622_0089808 3300046557 Bacteria 1412
551 Ga0495633_0000062 3300046558 Bacteria 142101
552 Ga0495633_0021810 3300046558 Bacteria 3197
553 Ga0495668_0025234 3300046616 Bacteria 3378
554 Ga0495634_0061358 3300046642 Bacteria 2499
555 Ga0495611_0001689 3300046648 Bacteria 10708
556 Ga0495611_0006048 3300046648 Bacteria 5162
557 Ga0495611_0019824 3300046648 Bacteria 2890
558 Ga0495611_0020800 3300046648 Bacteria 2828
559 Ga0495625_0000194 3300046660 Bacteria 96964
560 Ga0495625_0016515 3300046660 Bacteria 5806
561 Ga0495625_0066288 3300046660 Bacteria 2543
562 Ga0495625_0109977 3300046660 Bacteria 1884
563 Ga0495661_0000016 3300046665 Bacteria 213593
564 Ga0495661_0000093 3300046665 Bacteria 109808
565 Ga0495661_0000662 3300046665 Bacteria 34527
566 Ga0495661_0001069 3300046665 Bacteria 24134
567 Ga0495661_0008953 3300046665 Bacteria 6887
568 Ga0495661_0068742 3300046665 Bacteria 2077
569 Ga0495623_0038158 3300046679 Bacteria 3072
570 Ga0495646_0032496 3300046680 Bacteria 3247
571 Ga0495624_0018070 3300046690 Bacteria 4720
572 Ga0495670_0005692 3300046691 Bacteria 6111
573 Ga0495670_0006112 3300046691 Bacteria 5908
574 Ga0495670_0040183 3300046691 Bacteria 2333
575 Ga0495671_0003081 3300046692 Bacteria 10357
576 Ga0495671_0010355 3300046692 Bacteria 5170
577 Ga0495671_0011925 3300046692 Bacteria 4761
578 Ga0495671_0021917 3300046692 Bacteria 3350
579 Ga0495671_0022635 3300046692 Bacteria 3290
580 Ga0495671_0043571 3300046692 Bacteria 2252
581 Ga0495671_0044986 3300046692 Bacteria 2211
582 Ga0495671_0050759 3300046692 Bacteria 2064
583 Ga0495671_0050843 3300046692 Bacteria 2062
584 Ga0495671_0078991 3300046692 Bacteria 1613
585 Ga0495671_0107603 3300046692 Bacteria 1361
586 Ga0495671_0162099 3300046692 Bacteria 1087
587 Ga0495649_0002195 3300046694 Bacteria 13944
588 Ga0495649_0005784 3300046694 Bacteria 7789
589 Ga0495649_0008308 3300046694 Bacteria 6249
590 Ga0495649_0030107 3300046694 Bacteria 2998
591 Ga0495649_0070199 3300046694 Bacteria 1878
592 Ga0495649_0156515 3300046694 Bacteria 1195
593 Ga0495589_0005691 3300046794 Bacteria 6569
594 Ga0495589_0006010 3300046794 Bacteria 6410
595 Ga0495589_0021071 3300046794 Bacteria 3332
596 Ga0495589_0041601 3300046794 Bacteria 2292
597 Ga0495589_0065881 3300046794 Bacteria 1775
598 Ga0495589_0125669 3300046794 Bacteria 1233
599 Ga0495660_0001019 3300046810 Bacteria 20347
600 Ga0495660_0006561 3300046810 Bacteria 6873
601 Ga0495660_0007816 3300046810 Bacteria 6280
602 Ga0495660_0042921 3300046810 Bacteria 2496
603 Ga0495660_0145369 3300046810 Bacteria 1175
604 Ga0495604_0072323 3300047317 Bacteria 2606
605 Ga0495604_0072324 3300047317 Bacteria 2606
606 Ga0495636_0073632 3300047318 Bacteria 1461
607 Ga0495672_0020098 3300047320 Bacteria 4384
608 Ga0495672_0029740 3300047320 Bacteria 3435
609 Ga0495672_0030758 3300047320 Bacteria 3360
610 Ga0495672_0031137 3300047320 Bacteria 3334
611 Ga0495672_0034800 3300047320 Bacteria 3108
612 Ga0495672_0040424 3300047320 Bacteria 2828
613 Ga0495672_0058275 3300047320 Bacteria 2239
614 Ga0495672_0091221 3300047320 Bacteria 1672
615 Ga0495676_0000052 3300047321 Bacteria 97049
616 Ga0495676_0000957 3300047321 Bacteria 24239
617 Ga0495680_0014017 3300047322 Bacteria 6966
618 Ga0495680_0063462 3300047322 Bacteria 2837
619 Ga0495683_0000043 3300047323 Bacteria 136876
620 Ga0495683_0000092 3300047323 Bacteria 91056
621 Ga0495683_0007850 3300047323 Bacteria 5724
622 Ga0495683_0021391 3300047323 Bacteria 3333
623 Ga0495683_0021571 3300047323 Bacteria 3319
624 Ga0495683_0089315 3300047323 Bacteria 1495
625 Ga0495683_0107579 3300047323 Bacteria 1334
626 Ga0495687_047763 3300047443 Bacteria 1840
627 Ga0495675_0016370 3300047444 Bacteria 4690
628 Ga0495679_000504 3300047446 Bacteria 27741
629 Ga0495679_002108 3300047446 Bacteria 10486
630 Ga0495679_022097 3300047446 Bacteria 2183
631 Ga0495679_023322 3300047446 Bacteria 2100
632 Ga0495673_0000667 3300047469 Bacteria 33805
633 Ga0495673_0003353 3300047469 Bacteria 10594
634 Ga0495673_0013566 3300047469 Bacteria 4275
635 Ga0495673_0026694 3300047469 Bacteria 2757
636 Ga0495673_0027169 3300047469 Bacteria 2727
637 Ga0495673_0027763 3300047469 Bacteria 2688
638 Ga0495681_0008574 3300047470 Bacteria 6394
639 Ga0495681_0010639 3300047470 Bacteria 5557
640 Ga0495681_0016573 3300047470 Bacteria 4122
641 Ga0495681_0025986 3300047470 Bacteria 3057
642 Ga0495681_0035834 3300047470 Bacteria 2460
643 Ga0495681_0043624 3300047470 Bacteria 2160
644 Ga0495681_0051267 3300047470 Bacteria 1941
645 Ga0495681_0055628 3300047470 Bacteria 1844
646 Ga0495686_0074342 3300047472 Bacteria 2085
647 Ga0495686_0128609 3300047472 Bacteria 1503
648 Ga0495626_0000126 3300048091 Bacteria 99054
649 Ga0495626_0001308 3300048091 Bacteria 20262
650 Ga0495626_0022816 3300048091 Bacteria 3088
651 Ga0495626_0051716 3300048091 Bacteria 1894
652 Ga0495626_0058676 3300048091 Bacteria 1757
653 Ga0496102_0109735 3300048905 Bacteria 2571
654 Ga0496103_0119864 3300048906 Bacteria 1675
655 Ga0496110_0069686 3300048913 Bacteria 3115
656 Ga0496111_0144924 3300048914 Bacteria 1760
657 Ga0496114_0143281 3300048917 Bacteria 2070
658 Ga0496116_0000398 3300048919 Bacteria 63093
659 Ga0496116_0014823 3300048919 Bacteria 6197
660 Ga0496116_0050996 3300048919 Bacteria 2752
661 Ga0496116_0114506 3300048919 Bacteria 1575
662 Ga0496117_0003966 3300048920 Bacteria 16725
663 Ga0496117_0014254 3300048920 Bacteria 6860
664 Ga0496117_0014409 3300048920 Bacteria 6812
665 Ga0496117_0054268 3300048920 Bacteria 2808
666 Ga0496117_0067264 3300048920 Bacteria 2425
667 Ga0496117_0077593 3300048920 Bacteria 2197
668 Ga0496117_0177882 3300048920 Bacteria 1227
669 Ga0496117_0178719 3300048920 Bacteria 1222
670 Ga0496117_0181424 3300048920 Bacteria 1209
671 Ga0496118_0004770 3300048921 Bacteria 15859
672 Ga0496118_0030664 3300048921 Bacteria 4479
673 Ga0496118_0051762 3300048921 Bacteria 3138
674 Ga0496118_0087202 3300048921 Bacteria 2166
675 Ga0496119_0000479 3300048922 Bacteria 54626
676 Ga0496119_0070874 3300048922 Bacteria 2042
677 Ga0496120_0002540 3300048923 Bacteria 18213
678 Ga0496120_0060164 3300048923 Bacteria 2125
679 Ga0496120_0065231 3300048923 Bacteria 2018
680 Ga0496121_0000412 3300048924 Bacteria 84946
681 Ga0496121_0002869 3300048924 Bacteria 25394
682 Ga0496121_0011455 3300048924 Bacteria 9844
683 Ga0496121_0090665 3300048924 Bacteria 2389
684 Ga0496121_0109648 3300048924 Bacteria 2108
685 Ga0496121_0126103 3300048924 Bacteria 1924
686 Ga0496121_0202101 3300048924 Bacteria 1415
687 Ga0496122_0000434 3300048925 Bacteria 87536
688 Ga0496122_0013063 3300048925 Bacteria 8176
689 Ga0496122_0072134 3300048925 Bacteria 2456
690 Ga0496122_0150341 3300048925 Bacteria 1438
691 Ga0496122_0179936 3300048925 Bacteria 1263
692 Ga0496122_0193974 3300048925 Bacteria 1195
693 Ga0496122_0209813 3300048925 Bacteria 1129
694 Ga0496123_0000207 3300048926 Bacteria 120277
695 Ga0496123_0000318 3300048926 Bacteria 91911
696 Ga0496123_0003681 3300048926 Bacteria 16905
697 Ga0496123_0006979 3300048926 Bacteria 10775
698 Ga0496123_0068055 3300048926 Bacteria 2245
699 Ga0496123_0136878 3300048926 Bacteria 1346
700 Ga0496124_0000689 3300048927 Bacteria 55376
701 Ga0496124_0007409 3300048927 Bacteria 11672
702 Ga0496124_0014442 3300048927 Bacteria 7636
703 Ga0496124_0017267 3300048927 Bacteria 6807
704 Ga0496124_0018115 3300048927 Bacteria 6610
705 Ga0496124_0057530 3300048927 Bacteria 3275
706 Ga0496124_0062514 3300048927 Bacteria 3115
707 Ga0496124_0067621 3300048927 Bacteria 2972
708 Ga0496124_0240262 3300048927 Bacteria 1347
709 Ga0496124_0269553 3300048927 Bacteria 1247
710 Ga0496125_0001906 3300048928 Bacteria 28542
711 Ga0496125_0004964 3300048928 Bacteria 15045
712 Ga0496125_0017882 3300048928 Bacteria 6743
713 Ga0496125_0020043 3300048928 Bacteria 6287
714 Ga0496125_0043957 3300048928 Bacteria 3785
715 Ga0496125_0076692 3300048928 Bacteria 2580
716 Ga0496125_0140000 3300048928 Bacteria 1684
717 Ga0496125_0224104 3300048928 Bacteria 1209
718 Ga0496125_0242815 3300048928 Bacteria 1142
719 Ga0496126_0072293 3300048929 Bacteria 3068
720 Ga0496126_0215908 3300048929 Bacteria 1613
721 Ga0496126_0217998 3300048929 Bacteria 1604
722 Ga0496126_0417412 3300048929 Bacteria 1085
723 Ga0495678_000021 3300049459 Bacteria 239150
724 Ga0495678_002247 3300049459 Bacteria 13440
725 Ga0495678_007216 3300049459 Bacteria 5789
726 Ga0495678_017098 3300049459 Bacteria 3295
727 Ga0495678_041030 3300049459 Bacteria 1855
728 Ga0495682_0000697 3300049460 Bacteria 22057
729 Ga0495682_0000959 3300049460 Bacteria 17383
730 Ga0495682_0024842 3300049460 Bacteria 2231
731 Ga0501032_0035566 3300049569 Bacteria 3404
732 Ga0501034_0000085 3300049571 Bacteria 166893
733 Ga0501034_0040103 3300049571 Bacteria 4741
734 Ga0501034_0172263 3300049571 Bacteria 2131
735 Ga0501037_0136144 3300049573 Bacteria 1759
736 Ga0501039_0087342 3300049575 Bacteria 2429
737 Ga0501226_000002 3300049853 Bacteria 426935
738 nmdc:mga0sz30_100952_c1 3300050516 Bacteria 1260
739 Ga0500558_114090 3300053106 Bacteria 1056
740 Ga0500618_007870 3300053125 Bacteria 3009
741 Ga0500659_0011592 3300053135 Bacteria 4812
742 Ga0500573_0043944 3300053140 Bacteria 2577
743 Ga0500634_0060015 3300053161 Bacteria 2020
744 Ga0500636_0185532 3300053177 Bacteria 1113

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100024188 Ga0070665_1000241882 216
2 3300028379 Ga0268266_10000246 Ga0268266_1000024658 216
3 3300005616 Ga0068852_100451808 Ga0068852_1004518082 218
4 3300009093 Ga0105240_10000960 Ga0105240_1000096040 218
5 3300009551 Ga0105238_10001357 Ga0105238_100013579 218
6 3300013104 Ga0157370_10001514 Ga0157370_100015143 218
7 3300013105 Ga0157369_10006101 Ga0157369_100061013 218
8 3300025912 Ga0207707_10000165 Ga0207707_1000016539 218
9 3300025913 Ga0207695_10008884 Ga0207695_100088845 218
10 3300025917 Ga0207660_10003867 Ga0207660_100038677 218
11 3300025921 Ga0207652_10005936 Ga0207652_100059366 218
12 3300025949 Ga0207667_10002663 Ga0207667_100026636 218
13 3300045049 Ga0466959_0001286 Ga0466959_0001286_1664_2482 224
14 3300044656 Ga0466969_0002332 Ga0466969_0002332_2105_2926 228
15 3300045049 Ga0466959_0013335 Ga0466959_0013335_2479_3300 228
16 3300053177 Ga0500636_0185532 Ga0500636_0185532_199_924 233
17 3300009177 Ga0105248_10710898 Ga0105248_107108981 234
18 3300005563 Ga0068855_100010801 Ga0068855_1000108014 240
19 3300009093 Ga0105240_10012712 Ga0105240_100127124 240
20 3300009545 Ga0105237_10011832 Ga0105237_100118327 240
21 3300025913 Ga0207695_10009284 Ga0207695_100092849 240
22 3300025949 Ga0207667_10010320 Ga0207667_100103204 240
23 3300009093 Ga0105240_10256444 Ga0105240_102564442 243
24 3300013104 Ga0157370_10116589 Ga0157370_101165893 243
25 3300005337 Ga0070682_100108166 Ga0070682_1001081662 245
26 3300009093 Ga0105240_10686944 Ga0105240_106869442 245
27 3300014968 Ga0157379_10316654 Ga0157379_103166542 245
28 3300025913 Ga0207695_10518162 Ga0207695_105181622 245
29 3300025921 Ga0207652_10123589 Ga0207652_101235892 247
30 3300014968 Ga0157379_10034328 Ga0157379_100343282 249
31 3300005614 Ga0068856_100589436 Ga0068856_1005894362 250
32 3300005530 Ga0070679_100002393 Ga0070679_1000023937 251
33 3300026078 Ga0207702_10481031 Ga0207702_104810312 251
34 3300005336 Ga0070680_100003483 Ga0070680_1000034834 252
35 3300005436 Ga0070713_100181425 Ga0070713_1001814252 252
36 3300005563 Ga0068855_100070916 Ga0068855_1000709162 253
37 3300025913 Ga0207695_10100317 Ga0207695_101003172 253
38 3300025917 Ga0207660_10080199 Ga0207660_100801992 253
39 3300025949 Ga0207667_10363270 Ga0207667_103632701 253
40 3300048928 Ga0496125_0020043 Ga0496125_0020043_3784_4740 253
41 3300053106 Ga0500558_114090 Ga0500558_114090_134_967 254
42 3300013104 Ga0157370_10347488 Ga0157370_103474882 255
43 3300013105 Ga0157369_10148184 Ga0157369_101481843 255
44 3300025949 Ga0207667_10235358 Ga0207667_102353583 256
45 3300005458 Ga0070681_10096046 Ga0070681_100960462 259
46 3300005530 Ga0070679_100028256 Ga0070679_1000282562 259
47 3300025921 Ga0207652_10022224 Ga0207652_100222242 259
48 3300005331 Ga0070670_100000002 Ga0070670_100000002408 261
49 3300005355 Ga0070671_100000022 Ga0070671_10000002270 261
50 3300025931 Ga0207644_10000037 Ga0207644_1000003750 261
51 3300031665 Ga0316575_10109859 Ga0316575_101098592 267
52 3300031691 Ga0316579_10000205 Ga0316579_100002053 267
53 3300031728 Ga0316578_10014339 Ga0316578_100143392 267
54 3300031733 Ga0316577_10003841 Ga0316577_100038414 267
55 3300032137 Ga0316585_10004574 Ga0316585_100045742 267
56 3300032168 Ga0316593_10017867 Ga0316593_100178672 267
57 3300035398 Ga0316574_0034538 Ga0316574_0034538_495_1397 267
58 3300037588 Ga0316581_0000481 Ga0316581_0000481_1215_2117 267
59 3300048906 Ga0496103_0119864 Ga0496103_0119864_730_1617 267
60 3300044712 Ga0453684_0144229 Ga0453684_0144229_1163_2131 268
61 3300044712 Ga0453684_0002021 Ga0453684_0002021_17029_18033 271
62 3300039437 Ga0436365_0833723 Ga0436365_0833723_696_1607 275
63 3300041997 Ga0439431_0001116 Ga0439431_0001116_3842_4912 275
64 3300009553 Ga0105249_10187816 Ga0105249_101878162 276
65 3300042134 Ga0450898_003444 Ga0450898_003444_1033_2103 278
66 3300046810 Ga0495660_0145369 Ga0495660_0145369_246_1139 279
67 3300046794 Ga0495589_0125669 Ga0495589_0125669_80_1066 282
68 3300048920 Ga0496117_0177882 Ga0496117_0177882_11_1030 284
69 3300046507 Ga0495606_0001283 Ga0495606_0001283_3187_4194 285
70 3300046694 Ga0495649_0030107 Ga0495649_0030107_727_1734 285
71 iso_pu_bacteria 3007252601 3007254128 285
72 3300041443 Ga0451789_0974815 Ga0451789_0974815_42_938 286
73 3300042010 Ga0439452_019675 Ga0439452_019675_264_1277 288
74 iso_pu_bacteria 3007718800 3007721359 288
75 3300046491 Ga0495584_0076807 Ga0495584_0076807_11_982 290
76 3300046530 Ga0495654_0072908 Ga0495654_0072908_19_990 290
77 3300027665 Ga0209983_1002129 Ga0209983_10021294 294
78 3300046519 Ga0495632_0043150 Ga0495632_0043150_1056_2042 294
79 3300046520 Ga0495637_0063521 Ga0495637_0063521_40_1026 294
80 3300046694 Ga0495649_0070199 Ga0495649_0070199_719_1705 294
81 3300027471 Ga0209995_1001312 Ga0209995_10013124 295
82 3300046458 Ga0495591_011543 Ga0495591_011543_2232_3221 296
83 3300046519 Ga0495632_0053872 Ga0495632_0053872_274_1263 296
84 3300046524 Ga0495648_0064373 Ga0495648_0064373_1050_2039 296
85 3300046530 Ga0495654_0018079 Ga0495654_0018079_489_1478 296
86 3300046692 Ga0495671_0107603 Ga0495671_0107603_274_1263 296
87 3300046810 Ga0495660_0042921 Ga0495660_0042921_971_1960 296
88 3300048091 Ga0495626_0022816 Ga0495626_0022816_1025_2014 296
89 3300015265 Ga0182005_1007407 Ga0182005_10074074 297
90 3300046458 Ga0495591_011647 Ga0495591_011647_2252_3244 297
91 3300046471 Ga0495650_0019791 Ga0495650_0019791_58_1050 297
92 3300046500 Ga0495596_0014076 Ga0495596_0014076_2251_3243 297
93 3300046507 Ga0495606_0112998 Ga0495606_0112998_34_1026 297
94 3300046512 Ga0495610_0058517 Ga0495610_0058517_18_1007 297
95 3300046513 Ga0495616_0015598 Ga0495616_0015598_2258_3250 297
96 3300046519 Ga0495632_0023244 Ga0495632_0023244_73_1065 297
97 3300046520 Ga0495637_0007118 Ga0495637_0007118_2262_3254 297
98 3300046520 Ga0495637_0037617 Ga0495637_0037617_424_1416 297
99 3300046524 Ga0495648_0134843 Ga0495648_0134843_289_1281 297
100 3300046616 Ga0495668_0025234 Ga0495668_0025234_2294_3286 297
101 3300046660 Ga0495625_0066288 Ga0495625_0066288_869_1858 297
102 3300047469 Ga0495673_0027763 Ga0495673_0027763_879_1868 297
103 3300047470 Ga0495681_0043624 Ga0495681_0043624_71_1063 297
104 3300048091 Ga0495626_0001308 Ga0495626_0001308_2270_3262 297
105 3300025735 Ga0207713_1019085 Ga0207713_10190851 298
106 3300046491 Ga0495584_0058306 Ga0495584_0058306_863_1858 298
107 3300046523 Ga0495644_0018656 Ga0495644_0018656_414_1409 298
108 3300046530 Ga0495654_0030115 Ga0495654_0030115_71_1066 298
109 3300046692 Ga0495671_0021917 Ga0495671_0021917_99_1094 298
110 3300047320 Ga0495672_0040424 Ga0495672_0040424_108_1103 298
111 3300047323 Ga0495683_0107579 Ga0495683_0107579_255_1250 298
112 3300048927 Ga0496124_0057530 Ga0496124_0057530_75_1070 298
113 3300009036 Ga0105244_10028204 Ga0105244_100282042 299
114 3300013104 Ga0157370_10000388 Ga0157370_100003888 299
115 3300025728 Ga0207655_1035864 Ga0207655_10358642 299
116 3300046458 Ga0495591_000571 Ga0495591_000571_230_1240 299
117 3300046460 Ga0495638_0041214 Ga0495638_0041214_1143_2138 299
118 3300046491 Ga0495584_0062525 Ga0495584_0062525_54_1064 299
119 3300046507 Ga0495606_0036936 Ga0495606_0036936_2253_3263 299
120 3300046524 Ga0495648_0028764 Ga0495648_0028764_421_1431 299
121 3300046660 Ga0495625_0016515 Ga0495625_0016515_2256_3266 299
122 3300047323 Ga0495683_0021571 Ga0495683_0021571_2256_3266 299
123 3300047323 Ga0495683_0089315 Ga0495683_0089315_40_999 299
124 3300047472 Ga0495686_0074342 Ga0495686_0074342_692_1702 299
125 3300005288 Ga0065714_10119037 Ga0065714_101190371 300
126 3300041404 Ga0439436_0000216 Ga0439436_0000216_5458_6414 300
127 3300041405 Ga0439438_000980 Ga0439438_000980_8365_9321 300
128 3300041407 Ga0439447_001011 Ga0439447_001011_5569_6525 300
129 3300041411 Ga0439466_0010716 Ga0439466_0010716_1801_2757 300
130 3300042010 Ga0439452_000418 Ga0439452_000418_21859_22815 300
131 3300042125 Ga0450923_004056 Ga0450923_004056_932_1888 300
132 3300042156 Ga0439446_0004766 Ga0439446_0004766_748_1704 300
133 3300042435 Ga0439434_0002762 Ga0439434_0002762_210_1166 300
134 3300046692 Ga0495671_0043571 Ga0495671_0043571_716_1690 300
135 3300046692 Ga0495671_0050759 Ga0495671_0050759_556_1551 300
136 3300047323 Ga0495683_0007850 Ga0495683_0007850_2483_3481 300
137 3300047470 Ga0495681_0035834 Ga0495681_0035834_983_1996 300
138 3300005288 Ga0065714_10082099 Ga0065714_100820991 301
139 3300006058 Ga0075432_10063712 Ga0075432_100637122 301
140 3300006177 Ga0075362_10105567 Ga0075362_101055671 301
141 3300006186 Ga0075369_10100356 Ga0075369_101003561 301
142 3300006946 Ga0079104_1000116 Ga0079104_100011684 301
143 3300009011 Ga0105251_10051625 Ga0105251_100516252 301
144 3300014497 Ga0182008_10109988 Ga0182008_101099881 301
145 3300025735 Ga0207713_1029733 Ga0207713_10297332 301
146 3300027111 Ga0209281_1000070 Ga0209281_100007079 301
147 3300027907 Ga0207428_10003468 Ga0207428_100034687 301
148 3300041405 Ga0439438_005907 Ga0439438_005907_1056_2057 301
149 3300041407 Ga0439447_004964 Ga0439447_004964_2359_3360 301
150 3300041407 Ga0439447_006926 Ga0439447_006926_434_1429 301
151 3300041407 Ga0439447_015739 Ga0439447_015739_354_1352 301
152 3300041411 Ga0439466_0006397 Ga0439466_0006397_1157_2158 301
153 3300041411 Ga0439466_0009496 Ga0439466_0009496_2270_3265 301
154 3300042006 Ga0439432_007057 Ga0439432_007057_669_1664 301
155 3300042009 Ga0439451_013598 Ga0439451_013598_524_1519 301
156 3300042010 Ga0439452_004529 Ga0439452_004529_1244_2245 301
157 3300042013 Ga0439456_003575 Ga0439456_003575_108_1103 301
158 3300042013 Ga0439456_005080 Ga0439456_005080_434_1429 301
159 3300042016 Ga0439463_005854 Ga0439463_005854_1273_2268 301
160 3300042115 Ga0450911_003690 Ga0450911_003690_762_1757 301
161 3300042127 Ga0450890_003834 Ga0450890_003834_760_1755 301
162 3300042145 Ga0450906_007780 Ga0450906_007780_1072_2067 301
163 3300042146 Ga0450907_000827 Ga0450907_000827_2238_3233 301
164 3300042146 Ga0450907_003188 Ga0450907_003188_870_1865 301
165 3300042156 Ga0439446_0011069 Ga0439446_0011069_868_1863 301
166 3300042184 Ga0450908_012048 Ga0450908_012048_52_1047 301
167 3300042185 Ga0450909_000842 Ga0450909_000842_916_1911 301
168 3300042439 Ga0439464_0036442 Ga0439464_0036442_375_1370 301
169 3300042531 Ga0450918_005874 Ga0450918_005874_24_1019 301
170 3300042993 Ga0439440_0003584 Ga0439440_0003584_948_1943 301
171 3300046471 Ga0495650_0031597 Ga0495650_0031597_400_1398 301
172 3300046491 Ga0495584_0088122 Ga0495584_0088122_42_1040 301
173 3300046507 Ga0495606_0048624 Ga0495606_0048624_852_1850 301
174 3300046513 Ga0495616_0051249 Ga0495616_0051249_614_1612 301
175 3300046518 Ga0495631_0006650 Ga0495631_0006650_2590_3588 301
176 3300046520 Ga0495637_0032684 Ga0495637_0032684_683_1681 301
177 3300046524 Ga0495648_0073707 Ga0495648_0073707_798_1796 301
178 3300046558 Ga0495633_0021810 Ga0495633_0021810_2186_3184 301
179 3300047469 Ga0495673_0003353 Ga0495673_0003353_8916_9914 301
180 3300047470 Ga0495681_0016573 Ga0495681_0016573_907_1902 301
181 3300048928 Ga0496125_0140000 Ga0496125_0140000_658_1656 301
182 3300050516 nmdc:mga0sz30_100952_c1 nmdc:mga0sz30_100952_c1_163_1176 301
183 3300009011 Ga0105251_10080024 Ga0105251_100800242 302
184 3300017792 Ga0163161_10397654 Ga0163161_103976541 302
185 3300030744 Ga0316181_1105230 Ga0316181_11052301 302
186 3300046452 Ga0495617_026908 Ga0495617_026908_819_1814 302
187 3300046474 Ga0495605_0040672 Ga0495605_0040672_723_1718 302
188 3300046491 Ga0495584_0006054 Ga0495584_0006054_4343_5338 302
189 3300046491 Ga0495584_0022204 Ga0495584_0022204_2192_3187 302
190 3300046501 Ga0495607_0017751 Ga0495607_0017751_2243_3238 302
191 3300046513 Ga0495616_0029577 Ga0495616_0029577_760_1755 302
192 3300046522 Ga0495643_0074767 Ga0495643_0074767_743_1738 302
193 3300046523 Ga0495644_0045882 Ga0495644_0045882_614_1609 302
194 3300046642 Ga0495634_0061358 Ga0495634_0061358_717_1712 302
195 3300046692 Ga0495671_0044986 Ga0495671_0044986_1115_2110 302
196 3300046692 Ga0495671_0162099 Ga0495671_0162099_64_1059 302
197 3300046694 Ga0495649_0005784 Ga0495649_0005784_4571_5566 302
198 3300046794 Ga0495589_0005691 Ga0495589_0005691_4893_5888 302
199 3300047318 Ga0495636_0073632 Ga0495636_0073632_117_1112 302
200 3300047320 Ga0495672_0030758 Ga0495672_0030758_2258_3253 302
201 3300048091 Ga0495626_0051716 Ga0495626_0051716_60_1055 302
202 3300048924 Ga0496121_0090665 Ga0496121_0090665_791_1786 302
203 3300049459 Ga0495678_041030 Ga0495678_041030_776_1771 302
204 3300013100 Ga0157373_10250491 Ga0157373_102504911 303
205 3300041407 Ga0439447_010943 Ga0439447_010943_1187_2197 303
206 3300041411 Ga0439466_0000892 Ga0439466_0000892_166_1167 303
207 3300042006 Ga0439432_017521 Ga0439432_017521_1099_2124 303
208 3300042147 Ga0450910_001431 Ga0450910_001431_723_1733 303
209 3300046528 Ga0495642_0003319 Ga0495642_0003319_4460_5473 303
210 3300003791 Ga0055530_10008959 Ga0055530_100089593 304
211 3300005288 Ga0065714_10003418 Ga0065714_100034185 304
212 3300005289 Ga0065704_10072683 Ga0065704_100726836 304
213 3300006946 Ga0079104_1002609 Ga0079104_10026096 304
214 3300013100 Ga0157373_10003549 Ga0157373_1000354913 304
215 3300015261 Ga0182006_1080464 Ga0182006_10804641 304
216 3300027111 Ga0209281_1000127 Ga0209281_100012794 304
217 3300030733 Ga0314311_1250128 Ga0314311_12501282 304
218 3300031548 Ga0307408_100188021 Ga0307408_1001880211 304
219 3300046501 Ga0495607_0000385 Ga0495607_0000385_24900_25937 304
220 3300046513 Ga0495616_0052584 Ga0495616_0052584_584_1594 304
221 3300046794 Ga0495589_0006010 Ga0495589_0006010_943_1917 304
222 3300047470 Ga0495681_0051267 Ga0495681_0051267_731_1741 304
223 3300003781 Ga0055536_1003363 Ga0055536_10033634 305
224 3300003781 Ga0055536_1008077 Ga0055536_10080773 305
225 3300003791 Ga0055530_10001431 Ga0055530_100014314 305
226 3300003792 Ga0055540_1000333 Ga0055540_100033328 305
227 3300003794 Ga0055531_10001360 Ga0055531_1000136015 305
228 3300003856 Ga0058692_1002717 Ga0058692_10027174 305
229 3300005288 Ga0065714_10025053 Ga0065714_100250532 305
230 3300005353 Ga0070669_100062268 Ga0070669_1000622682 305
231 3300006051 Ga0075364_10074023 Ga0075364_100740232 305
232 3300006051 Ga0075364_10121238 Ga0075364_101212382 305
233 3300013100 Ga0157373_10111642 Ga0157373_101116422 305
234 3300025292 Ga0209676_1003131 Ga0209676_100313111 305
235 3300025298 Ga0209050_1002243 Ga0209050_10022434 305
236 3300025728 Ga0207655_1063911 Ga0207655_10639111 305
237 3300025735 Ga0207713_1022056 Ga0207713_10220562 305
238 3300027312 Ga0209371_1000094 Ga0209371_100009423 305
239 3300030500 Ga0268256_1000083 Ga0268256_100008323 305
240 3300030744 Ga0316181_1098368 Ga0316181_10983681 305
241 3300005288 Ga0065714_10147869 Ga0065714_101478691 306
242 3300013100 Ga0157373_10024113 Ga0157373_100241133 306
243 3300013102 Ga0157371_10011353 Ga0157371_100113537 306
244 3300013104 Ga0157370_10167000 Ga0157370_101670002 306
245 3300025292 Ga0209676_1000076 Ga0209676_1000076196 306
246 3300025292 Ga0209676_1000264 Ga0209676_100026499 306
247 3300025298 Ga0209050_1000063 Ga0209050_1000063122 306
248 3300025303 Ga0209051_1000045 Ga0209051_100004595 306
249 3300025304 Ga0209257_1000185 Ga0209257_100018595 306
250 3300025923 Ga0207681_10008503 Ga0207681_100085032 306
251 3300027111 Ga0209281_1003227 Ga0209281_10032272 306
252 3300030735 Ga0316178_1105767 Ga0316178_110576714 306
253 3300031548 Ga0307408_100157661 Ga0307408_1001576612 306
254 3300031995 Ga0307409_100191685 Ga0307409_1001916851 306
255 3300041405 Ga0439438_012665 Ga0439438_012665_1089_2099 306
256 3300042010 Ga0439452_003004 Ga0439452_003004_525_1535 306
257 3300042115 Ga0450911_004361 Ga0450911_004361_777_1787 306
258 3300042145 Ga0450906_020115 Ga0450906_020115_29_1042 306
259 3300046453 Ga0495627_014626 Ga0495627_014626_624_1607 306
260 3300046458 Ga0495591_014947 Ga0495591_014947_1115_2098 306
261 3300046501 Ga0495607_0053435 Ga0495607_0053435_535_1518 306
262 3300046519 Ga0495632_0039664 Ga0495632_0039664_319_1302 306
263 3300046665 Ga0495661_0008953 Ga0495661_0008953_791_1774 306
264 3300046794 Ga0495589_0041601 Ga0495589_0041601_240_1223 306
265 3300047320 Ga0495672_0029740 Ga0495672_0029740_2222_3232 306
266 3300046520 Ga0495637_0024415 Ga0495637_0024415_1017_1988 307
267 3300003791 Ga0055530_10002933 Ga0055530_100029337 308
268 3300003792 Ga0055540_1002283 Ga0055540_10022837 308
269 3300006058 Ga0075432_10072561 Ga0075432_100725612 308
270 3300025292 Ga0209676_1015731 Ga0209676_10157311 308
271 3300025298 Ga0209050_1000080 Ga0209050_1000080122 308
272 3300025303 Ga0209051_1000082 Ga0209051_100008253 308
273 3300025304 Ga0209257_1012213 Ga0209257_10122134 308
274 3300046538 Ga0495609_0101947 Ga0495609_0101947_35_1063 309
275 3300047322 Ga0495680_0014017 Ga0495680_0014017_5255_6250 309
276 3300047444 Ga0495675_0016370 Ga0495675_0016370_1762_2757 309
277 3300025925 Ga0207650_10000620 Ga0207650_100006202 310
278 3300046507 Ga0495606_0051326 Ga0495606_0051326_639_1622 310
279 3300047446 Ga0495679_022097 Ga0495679_022097_1032_2015 310
280 3300048920 Ga0496117_0014409 Ga0496117_0014409_596_1579 310
281 3300048923 Ga0496120_0065231 Ga0496120_0065231_601_1584 310
282 3300048927 Ga0496124_0018115 Ga0496124_0018115_5150_6133 310
283 3300048928 Ga0496125_0017882 Ga0496125_0017882_5145_6128 310
284 3300048929 Ga0496126_0217998 Ga0496126_0217998_459_1442 310
285 3300005288 Ga0065714_10000379 Ga0065714_100003791 311
286 3300005290 Ga0065712_10000936 Ga0065712_100009368 311
287 3300006058 Ga0075432_10035384 Ga0075432_100353841 311
288 3300014497 Ga0182008_10039844 Ga0182008_100398441 311
289 3300046463 Ga0495653_0069895 Ga0495653_0069895_857_1852 311
290 3300046463 Ga0495653_0098835 Ga0495653_0098835_825_1835 311
291 3300046471 Ga0495650_0075575 Ga0495650_0075575_253_1263 311
292 3300046507 Ga0495606_0011936 Ga0495606_0011936_1220_2230 311
293 3300046526 Ga0495666_0061529 Ga0495666_0061529_347_1342 311
294 3300046542 Ga0495597_0050026 Ga0495597_0050026_45_1055 311
295 3300046680 Ga0495646_0032496 Ga0495646_0032496_452_1447 311
296 3300047317 Ga0495604_0072324 Ga0495604_0072324_848_1843 311
297 3300047320 Ga0495672_0031137 Ga0495672_0031137_878_1900 311
298 3300013102 Ga0157371_10000243 Ga0157371_1000024361 312
299 3300042016 Ga0439463_015614 Ga0439463_015614_756_1757 312
300 3300046520 Ga0495637_0031839 Ga0495637_0031839_202_1212 312
301 3300047323 Ga0495683_0000043 Ga0495683_0000043_30266_31276 312
302 iso_pu_bacteria 2510065053 2510283260 312
303 iso_pu_bacteria 2510065055 2510292909 312
304 iso_pu_bacteria 2510065058 2510313382 312
305 3300025711 Ga0207696_1000168 Ga0207696_100016829 313
306 3300025735 Ga0207713_1000049 Ga0207713_1000049120 313
307 3300031344 Ga0265316_10207768 Ga0265316_102077681 313
308 3300031548 Ga0307408_100000013 Ga0307408_100000013261 313
309 3300048929 Ga0496126_0215908 Ga0496126_0215908_432_1430 313
310 3300049569 Ga0501032_0035566 Ga0501032_0035566_360_1361 313
311 3300049571 Ga0501034_0172263 Ga0501034_0172263_588_1589 313
312 3300049573 Ga0501037_0136144 Ga0501037_0136144_274_1275 313
313 3300049575 Ga0501039_0087342 Ga0501039_0087342_1185_2186 313
314 iso_pu_bacteria 2773857672 2774132567 313
315 iso_pu_bacteria 2919125081 2919128592 313
316 iso_pu_bacteria 2974298342 2974298910 313
317 iso_pu_bacteria 2984499530 2984501216 313
318 iso_pu_bacteria 2984504281 2984505327 313
319 iso_pu_bacteria 8016728285 8016732778 313
320 3300003751 Ga0055538_1000042 Ga0055538_100004243 314
321 3300003752 Ga0055539_1000055 Ga0055539_100005543 314
322 3300003756 Ga0055533_1000067 Ga0055533_100006743 314
323 3300003758 Ga0055532_1000053 Ga0055532_100005343 314
324 3300003759 Ga0055525_1000103 Ga0055525_100010392 314
325 3300003759 Ga0055525_1002283 Ga0055525_10022832 314
326 3300003841 Ga0055541_1000042 Ga0055541_1000042134 314
327 3300005288 Ga0065714_10076102 Ga0065714_100761023 314
328 3300005290 Ga0065712_10002123 Ga0065712_100021235 314
329 3300005331 Ga0070670_100004982 Ga0070670_1000049824 314
330 3300005344 Ga0070661_100000729 Ga0070661_10000072918 314
331 3300005353 Ga0070669_100000218 Ga0070669_1000002185 314
332 3300005457 Ga0070662_100002371 Ga0070662_1000023718 314
333 3300005539 Ga0068853_100000414 Ga0068853_10000041424 314
334 3300005548 Ga0070665_100118858 Ga0070665_1001188582 314
335 3300005548 Ga0070665_100486116 Ga0070665_1004861161 314
336 3300005564 Ga0070664_100012726 Ga0070664_1000127262 314
337 3300005564 Ga0070664_100226216 Ga0070664_1002262162 314
338 3300005578 Ga0068854_100001639 Ga0068854_10000163911 314
339 3300005834 Ga0068851_10000002 Ga0068851_10000002114 314
340 3300006051 Ga0075364_10055660 Ga0075364_100556602 314
341 3300009011 Ga0105251_10009460 Ga0105251_100094601 314
342 3300009011 Ga0105251_10031139 Ga0105251_100311391 314
343 3300009036 Ga0105244_10006436 Ga0105244_100064362 314
344 3300009036 Ga0105244_10011041 Ga0105244_100110412 314
345 3300009092 Ga0105250_10000657 Ga0105250_1000065717 314
346 3300009092 Ga0105250_10055693 Ga0105250_100556932 314
347 3300009148 Ga0105243_10000188 Ga0105243_1000018811 314
348 3300009148 Ga0105243_10059100 Ga0105243_100591002 314
349 3300009176 Ga0105242_10000442 Ga0105242_1000044228 314
350 3300009177 Ga0105248_10014418 Ga0105248_100144189 314
351 3300009545 Ga0105237_10001803 Ga0105237_1000180321 314
352 3300011119 Ga0105246_10000905 Ga0105246_1000090511 314
353 3300011119 Ga0105246_10010477 Ga0105246_100104772 314
354 3300012498 Ga0157345_1001221 Ga0157345_10012211 314
355 3300013100 Ga0157373_10144477 Ga0157373_101444772 314
356 3300013100 Ga0157373_10247884 Ga0157373_102478841 314
357 3300013102 Ga0157371_10001094 Ga0157371_1000109421 314
358 3300013104 Ga0157370_10066193 Ga0157370_100661932 314
359 3300013104 Ga0157370_10144054 Ga0157370_101440542 314
360 3300013105 Ga0157369_10167030 Ga0157369_101670302 314
361 3300013105 Ga0157369_10169975 Ga0157369_101699752 314
362 3300013105 Ga0157369_10564407 Ga0157369_105644071 314
363 3300013306 Ga0163162_10012103 Ga0163162_100121036 314
364 3300013306 Ga0163162_10587354 Ga0163162_105873541 314
365 3300013306 Ga0163162_10768447 Ga0163162_107684471 314
366 3300013307 Ga0157372_10045650 Ga0157372_100456502 314
367 3300013308 Ga0157375_10115247 Ga0157375_101152472 314
368 3300014497 Ga0182008_10000900 Ga0182008_1000090011 314
369 3300014497 Ga0182008_10042578 Ga0182008_100425782 314
370 3300015261 Ga0182006_1072752 Ga0182006_10727521 314
371 3300017792 Ga0163161_10309887 Ga0163161_103098871 314
372 3300017792 Ga0163161_10310227 Ga0163161_103102271 314
373 3300025206 Ga0209435_100900 Ga0209435_1009002 314
374 3300025224 Ga0209784_100060 Ga0209784_100060134 314
375 3300025225 Ga0209566_100075 Ga0209566_100075134 314
376 3300025226 Ga0209674_100100 Ga0209674_100100134 314
377 3300025229 Ga0209147_100096 Ga0209147_100096134 314
378 3300025230 Ga0209563_100118 Ga0209563_10011841 314
379 3300025242 Ga0209258_100221 Ga0209258_10022141 314
380 3300025246 Ga0209646_1000474 Ga0209646_100047417 314
381 3300025253 Ga0209677_100057 Ga0209677_100057134 314
382 3300025256 Ga0209759_1015683 Ga0209759_10156832 314
383 3300025321 Ga0207656_10000010 Ga0207656_10000010125 314
384 3300025711 Ga0207696_1000047 Ga0207696_1000047180 314
385 3300025711 Ga0207696_1000126 Ga0207696_100012640 314
386 3300025711 Ga0207696_1037936 Ga0207696_10379361 314
387 3300025728 Ga0207655_1000120 Ga0207655_100012085 314
388 3300025728 Ga0207655_1006183 Ga0207655_10061837 314
389 3300025735 Ga0207713_1000337 Ga0207713_100033743 314
390 3300025735 Ga0207713_1009274 Ga0207713_10092741 314
391 3300025914 Ga0207671_10000373 Ga0207671_1000037348 314
392 3300025920 Ga0207649_10000126 Ga0207649_1000012625 314
393 3300025923 Ga0207681_10000148 Ga0207681_1000014831 314
394 3300025925 Ga0207650_10000409 Ga0207650_100004098 314
395 3300025933 Ga0207706_10000871 Ga0207706_1000087111 314
396 3300025934 Ga0207686_10003589 Ga0207686_100035897 314
397 3300025935 Ga0207709_10000265 Ga0207709_100002657 314
398 3300025935 Ga0207709_10059153 Ga0207709_100591531 314
399 3300025941 Ga0207711_10090221 Ga0207711_100902213 314
400 3300025945 Ga0207679_10000017 Ga0207679_10000017195 314
401 3300025945 Ga0207679_10116066 Ga0207679_101160662 314
402 3300026041 Ga0207639_10000418 Ga0207639_1000041824 314
403 3300028379 Ga0268266_10176726 Ga0268266_101767262 314
404 3300041405 Ga0439438_009913 Ga0439438_009913_1434_2438 314
405 3300042006 Ga0439432_020578 Ga0439432_020578_1006_2004 314
406 3300046506 Ga0495583_0041293 Ga0495583_0041293_166_1164 314
407 3300046507 Ga0495606_0187822 Ga0495606_0187822_54_1055 314
408 3300046515 Ga0495620_0046724 Ga0495620_0046724_842_1840 314
409 3300046530 Ga0495654_0032189 Ga0495654_0032189_999_1997 314
410 3300046694 Ga0495649_0156515 Ga0495649_0156515_144_1142 314
411 3300048919 Ga0496116_0000398 Ga0496116_0000398_48368_49366 314
412 3300048920 Ga0496117_0003966 Ga0496117_0003966_10083_11081 314
413 3300048920 Ga0496117_0077593 Ga0496117_0077593_203_1201 314
414 3300048920 Ga0496117_0178719 Ga0496117_0178719_57_1055 314
415 3300048921 Ga0496118_0087202 Ga0496118_0087202_203_1201 314
416 3300048922 Ga0496119_0070874 Ga0496119_0070874_881_1879 314
417 3300048923 Ga0496120_0060164 Ga0496120_0060164_939_1937 314
418 3300048924 Ga0496121_0000412 Ga0496121_0000412_73761_74759 314
419 3300048924 Ga0496121_0109648 Ga0496121_0109648_913_1911 314
420 3300048924 Ga0496121_0202101 Ga0496121_0202101_274_1272 314
421 3300048925 Ga0496122_0072134 Ga0496122_0072134_473_1471 314
422 3300048925 Ga0496122_0179936 Ga0496122_0179936_63_1061 314
423 3300048925 Ga0496122_0193974 Ga0496122_0193974_39_1037 314
424 3300048926 Ga0496123_0003681 Ga0496123_0003681_9356_10354 314
425 3300048927 Ga0496124_0240262 Ga0496124_0240262_147_1145 314
426 3300048928 Ga0496125_0224104 Ga0496125_0224104_55_1053 314
427 3300048929 Ga0496126_0072293 Ga0496126_0072293_1869_2867 314
428 3300048929 Ga0496126_0417412 Ga0496126_0417412_73_1071 314
429 iso_pu_bacteria 2917832318 2917832892 314
430 iso_pu_bacteria 2990196909 2990198158 314
431 3300002737 JGI25162J39368_1000122 JGI25162J39368_100012276 315
432 3300002772 JGI25164J39214_1000099 JGI25164J39214_100009976 315
433 3300003214 JGI25165J46597_1000205 JGI25165J46597_100020576 315
434 3300009551 Ga0105238_10590346 Ga0105238_105903462 315
435 3300017792 Ga0163161_10127654 Ga0163161_101276542 315
436 3300025207 Ga0209760_100060 Ga0209760_10006077 315
437 3300025230 Ga0209563_101016 Ga0209563_1010162 315
438 3300025231 Ga0207427_100056 Ga0207427_100056109 315
439 3300025233 Ga0209437_100065 Ga0209437_100065109 315
440 3300025261 Ga0209233_1000085 Ga0209233_1000085109 315
441 3300025711 Ga0207696_1009597 Ga0207696_10095974 315
442 3300025728 Ga0207655_1009815 Ga0207655_10098154 315
443 3300025735 Ga0207713_1000467 Ga0207713_100046719 315
444 3300025735 Ga0207713_1000799 Ga0207713_100079919 315
445 3300025735 Ga0207713_1000862 Ga0207713_100086219 315
446 3300025735 Ga0207713_1003051 Ga0207713_10030518 315
447 3300025933 Ga0207706_10014846 Ga0207706_100148462 315
448 3300028379 Ga0268266_10057991 Ga0268266_100579913 315
449 3300033180 Ga0307510_10164030 Ga0307510_101640301 315
450 3300046452 Ga0495617_006136 Ga0495617_006136_733_1743 315
451 3300046453 Ga0495627_020892 Ga0495627_020892_827_1837 315
452 3300046458 Ga0495591_005316 Ga0495591_005316_4492_5502 315
453 3300046458 Ga0495591_048402 Ga0495591_048402_126_1136 315
454 3300046463 Ga0495653_0060776 Ga0495653_0060776_767_1759 315
455 3300046463 Ga0495653_0093187 Ga0495653_0093187_888_1898 315
456 3300046491 Ga0495584_0006365 Ga0495584_0006365_987_2000 315
457 3300046492 Ga0495585_0031496 Ga0495585_0031496_382_1392 315
458 3300046501 Ga0495607_0082345 Ga0495607_0082345_745_1755 315
459 3300046506 Ga0495583_0013177 Ga0495583_0013177_763_1773 315
460 3300046515 Ga0495620_0005117 Ga0495620_0005117_2229_3239 315
461 3300046518 Ga0495631_0052481 Ga0495631_0052481_725_1735 315
462 3300046519 Ga0495632_0062583 Ga0495632_0062583_762_1772 315
463 3300046520 Ga0495637_0006010 Ga0495637_0006010_5055_6065 315
464 3300046524 Ga0495648_0108286 Ga0495648_0108286_175_1185 315
465 3300046530 Ga0495654_0063050 Ga0495654_0063050_129_1139 315
466 3300046557 Ga0495622_0089808 Ga0495622_0089808_372_1382 315
467 3300046648 Ga0495611_0019824 Ga0495611_0019824_1115_2125 315
468 3300046660 Ga0495625_0109977 Ga0495625_0109977_257_1267 315
469 3300046679 Ga0495623_0038158 Ga0495623_0038158_719_1711 315
470 3300046690 Ga0495624_0018070 Ga0495624_0018070_2975_3985 315
471 3300046691 Ga0495670_0006112 Ga0495670_0006112_4466_5476 315
472 3300047317 Ga0495604_0072323 Ga0495604_0072323_694_1704 315
473 3300047320 Ga0495672_0020098 Ga0495672_0020098_2642_3652 315
474 3300047320 Ga0495672_0091221 Ga0495672_0091221_48_1058 315
475 3300047322 Ga0495680_0063462 Ga0495680_0063462_1102_2094 315
476 3300047470 Ga0495681_0008574 Ga0495681_0008574_759_1769 315
477 3300047470 Ga0495681_0010639 Ga0495681_0010639_953_1966 315
478 3300047472 Ga0495686_0128609 Ga0495686_0128609_480_1490 315
479 3300048091 Ga0495626_0058676 Ga0495626_0058676_619_1629 315
480 3300048919 Ga0496116_0014823 Ga0496116_0014823_4491_5501 315
481 3300048920 Ga0496117_0181424 Ga0496117_0181424_25_1035 315
482 3300048921 Ga0496118_0051762 Ga0496118_0051762_175_1185 315
483 3300048926 Ga0496123_0136878 Ga0496123_0136878_300_1310 315
484 3300049459 Ga0495678_007216 Ga0495678_007216_4096_5106 315
485 3300049460 Ga0495682_0024842 Ga0495682_0024842_470_1480 315
486 iso_pu_bacteria 2728369097 2729146080 315
487 3300009011 Ga0105251_10004234 Ga0105251_100042343 316
488 3300009036 Ga0105244_10019152 Ga0105244_100191522 316
489 3300013102 Ga0157371_10011506 Ga0157371_100115067 316
490 3300013105 Ga0157369_10000818 Ga0157369_1000081829 316
491 3300013307 Ga0157372_10101121 Ga0157372_101011213 316
492 3300014497 Ga0182008_10135026 Ga0182008_101350261 316
493 3300046692 Ga0495671_0078991 Ga0495671_0078991_166_1173 316
494 3300047321 Ga0495676_0000957 Ga0495676_0000957_3835_4842 316
495 3300048927 Ga0496124_0269553 Ga0496124_0269553_199_1203 316
496 iso_pu_bacteria 2600255389 2602012313 316
497 3300046491 Ga0495584_0062519 Ga0495584_0062519_28_1023 317
498 3300047469 Ga0495673_0013566 Ga0495673_0013566_1019_2014 317
499 3300009092 Ga0105250_10004400 Ga0105250_100044003 318
500 3300025735 Ga0207713_1023984 Ga0207713_10239842 318
501 3300046492 Ga0495585_0015984 Ga0495585_0015984_2260_3258 318
502 3300046501 Ga0495607_0067797 Ga0495607_0067797_494_1477 318
503 iso_pu_bacteria 640427133 640489720 318
504 iso_pu_bacteria 651053060 651177733 318
505 3300003578 Ga0006562J51391_1020668 Ga0006562J51391_10206682 319
506 3300003781 Ga0055536_1001766 Ga0055536_10017663 319
507 3300003791 Ga0055530_10000884 Ga0055530_100008845 319
508 3300003792 Ga0055540_1000455 Ga0055540_100045522 319
509 3300005288 Ga0065714_10003289 Ga0065714_100032897 319
510 3300015261 Ga0182006_1037239 Ga0182006_10372391 319
511 3300025292 Ga0209676_1000822 Ga0209676_100082220 319
512 3300025298 Ga0209050_1000106 Ga0209050_1000106105 319
513 3300025303 Ga0209051_1000139 Ga0209051_100013922 319
514 3300041407 Ga0439447_015002 Ga0439447_015002_600_1610 319
515 3300041411 Ga0439466_0003444 Ga0439466_0003444_4446_5456 319
516 3300041997 Ga0439431_0007794 Ga0439431_0007794_1220_2230 319
517 3300042000 Ga0439437_000227 Ga0439437_000227_2390_3400 319
518 3300042010 Ga0439452_013156 Ga0439452_013156_323_1333 319
519 3300042013 Ga0439456_000131 Ga0439456_000131_3022_4017 319
520 3300042013 Ga0439456_024479 Ga0439456_024479_239_1246 319
521 3300042115 Ga0450911_000012 Ga0450911_000012_21617_22627 319
522 3300042139 Ga0450904_000453 Ga0450904_000453_6460_7470 319
523 3300042438 Ga0439459_0004312 Ga0439459_0004312_261_1271 319
524 3300042532 Ga0450893_0000237 Ga0450893_0000237_4270_5280 319
525 3300046475 Ga0495639_0004168 Ga0495639_0004168_738_1733 319
526 3300046519 Ga0495632_0130720 Ga0495632_0130720_62_1039 319
527 3300046542 Ga0495597_0000026 Ga0495597_0000026_118901_119878 319
528 3300046557 Ga0495622_0060299 Ga0495622_0060299_30_1025 319
529 3300046692 Ga0495671_0022635 Ga0495671_0022635_920_1897 319
530 3300046794 Ga0495589_0065881 Ga0495589_0065881_41_1036 319
531 3300047320 Ga0495672_0034800 Ga0495672_0034800_2079_3074 319
532 3300047323 Ga0495683_0021391 Ga0495683_0021391_1474_2469 319
533 3300047443 Ga0495687_047763 Ga0495687_047763_775_1770 319
534 3300046474 Ga0495605_0000442 Ga0495605_0000442_18991_20031 320
535 3300046538 Ga0495609_0000056 Ga0495609_0000056_28116_29156 320
536 iso_pu_bacteria 2600254954 2600445207 320
537 iso_pu_bacteria 2738543020 2739289545 320
538 iso_pu_bacteria 2738543021 2739294857 320
539 iso_pu_bacteria 2808606379 2808941257 320
540 iso_pu_bacteria 2823421272 2823422161 320
541 iso_pu_bacteria 2917070673 2917076244 320
542 iso_pu_bacteria 2919501602 2919505989 320
543 iso_pu_bacteria 2926063275 2926067484 320
544 iso_pu_bacteria 8034962539 8034966973 320
545 3300042009 Ga0439451_002551 Ga0439451_002551_1027_2037 321
546 3300042876 Ga0451577_0360142 Ga0451577_0360142_182_1198 321
547 3300046542 Ga0495597_0057126 Ga0495597_0057126_405_1397 321
548 iso_pu_bacteria 2808606373 2808905308 321
549 iso_pu_bacteria 2842805378 2842809941 321
550 3300002737 JGI25162J39368_1000233 JGI25162J39368_100023354 322
551 3300002772 JGI25164J39214_1000180 JGI25164J39214_100018054 322
552 3300003214 JGI25165J46597_1000331 JGI25165J46597_100033154 322
553 3300025207 Ga0209760_100058 Ga0209760_10005866 322
554 3300025231 Ga0207427_100063 Ga0207427_10006379 322
555 3300025233 Ga0209437_100133 Ga0209437_100133105 322
556 3300025261 Ga0209233_1000133 Ga0209233_1000133133 322
557 3300046506 Ga0495583_0032092 Ga0495583_0032092_527_1567 322
558 3300046524 Ga0495648_0028708 Ga0495648_0028708_1870_2880 322
559 iso_pu_bacteria 2784132063 2784262282 322
560 iso_pu_bacteria 2811994881 2812368854 322
561 iso_pu_bacteria 2904550169 2904554100 322
562 iso_pu_bacteria 2923519811 2923522923 322
563 iso_pu_bacteria 3007315729 3007317134 322
564 iso_pu_bacteria 8011350971 8011355908 322
565 iso_pu_bacteria 8019769354 8019771288 322
566 iso_pu_bacteria 8057798959 8057805242 322
567 3300009011 Ga0105251_10024384 Ga0105251_100243843 323
568 3300009036 Ga0105244_10038231 Ga0105244_100382312 323
569 3300014497 Ga0182008_10040155 Ga0182008_100401551 323
570 3300015262 Ga0182007_10002788 Ga0182007_100027887 323
571 3300025728 Ga0207655_1000810 Ga0207655_10008104 323
572 3300025728 Ga0207655_1011644 Ga0207655_10116444 323
573 iso_pu_bacteria 2554235132 2554813281 323
574 iso_pu_bacteria 2554235341 2555672363 323
575 iso_pu_bacteria 2599185160 2599358194 323
576 iso_pu_bacteria 2599185161 2599364548 323
577 iso_pu_bacteria 2599185162 2599370916 323
578 iso_pu_bacteria 2599185163 2599376938 323
579 iso_pu_bacteria 2599185164 2599383359 323
580 iso_pu_bacteria 2599185165 2599389806 323
581 iso_pu_bacteria 2599185166 2599396094 323
582 iso_pu_bacteria 2599185168 2599407934 323
583 iso_pu_bacteria 2599185181 2599465009 323
584 iso_pu_bacteria 2599185182 2599471325 323
585 iso_pu_bacteria 2599185186 2599494076 323
586 iso_pu_bacteria 2599185356 2600217741 323
587 iso_pu_bacteria 2600255313 2601777908 323
588 iso_pu_bacteria 2606217733 2608381539 323
589 iso_pu_bacteria 2667528171 2671100722 323
590 iso_pu_bacteria 2818991464 2819706389 323
591 iso_pu_bacteria 2860339153 2860343937 323
592 iso_pu_bacteria 2919456309 2919461700 323
593 iso_pu_bacteria 2919697872 2919701417 323
594 iso_pu_bacteria 2931396565 2931397606 323
595 iso_pu_bacteria 2935353572 2935359668 323
596 iso_pu_bacteria 3007419365 3007420303 323
597 iso_pu_bacteria 637000220 637322784 323
598 3300041411 Ga0439466_0005529 Ga0439466_0005529_3262_4263 324
599 3300042156 Ga0439446_0000270 Ga0439446_0000270_3289_4293 324
600 3300046522 Ga0495643_0000159 Ga0495643_0000159_42549_43556 324
601 3300046692 Ga0495671_0003081 Ga0495671_0003081_8489_9496 324
602 iso_pu_bacteria 2511231006 2511266255 324
603 iso_pu_bacteria 2582580891 2583794939 324
604 iso_pu_bacteria 2597489887 2597860434 324
605 iso_pu_bacteria 2597489888 2597866177 324
606 iso_pu_bacteria 2597489889 2597872014 324
607 iso_pu_bacteria 2599185167 2599401330 324
608 iso_pu_bacteria 2599185179 2599453055 324
609 iso_pu_bacteria 2599185185 2599486725 324
610 iso_pu_bacteria 2599185189 2599509809 324
611 iso_pu_bacteria 2599185190 2599515060 324
612 iso_pu_bacteria 2599185191 2599520221 324
613 iso_pu_bacteria 2599185257 2599807151 324
614 iso_pu_bacteria 2599185288 2599881660 324
615 iso_pu_bacteria 2599185290 2599894440 324
616 iso_pu_bacteria 2599185303 2599949285 324
617 iso_pu_bacteria 2600254931 2600367816 324
618 iso_pu_bacteria 2600255296 2601693886 324
619 iso_pu_bacteria 2619619299 2621297284 324
620 iso_pu_bacteria 2643221571 2643870887 324
621 iso_pu_bacteria 2643221713 2644625272 324
622 iso_pu_bacteria 2671180172 2671773289 324
623 iso_pu_bacteria 2675903420 2677898444 324
624 iso_pu_bacteria 2721755607 2723250914 324
625 iso_pu_bacteria 2738541265 2738672972 324
626 iso_pu_bacteria 2738541282 2738751365 324
627 iso_pu_bacteria 2738541294 2738810212 324
628 iso_pu_bacteria 2738541303 2738860406 324
629 iso_pu_bacteria 2738541309 2738897572 324
630 iso_pu_bacteria 2740892503 2743739981 324
631 iso_pu_bacteria 2808606385 2808977542 324
632 iso_pu_bacteria 2808606388 2808992800 324
633 iso_pu_bacteria 2816332298 2817493591 324
634 iso_pu_bacteria 2834028612 2834033199 324
635 iso_pu_bacteria 2842826826 2842829099 324
636 iso_pu_bacteria 2842837860 2842840468 324
637 iso_pu_bacteria 2844665904 2844666531 324
638 iso_pu_bacteria 2852612431 2852618104 324
639 iso_pu_bacteria 2852667396 2852673162 324
640 iso_pu_bacteria 2860867994 2860872587 324
641 iso_pu_bacteria 2908446538 2908452109 324
642 iso_pu_bacteria 2923153595 2923159072 324
643 iso_pu_bacteria 2929189879 2929194696 324
644 iso_pu_bacteria 2931390751 2931395973 324
645 iso_pu_bacteria 2945928738 2945931359 324
646 iso_pu_bacteria 2945961074 2945966324 324
647 iso_pu_bacteria 2946006987 2946007410 324
648 iso_pu_bacteria 2946027586 2946033189 324
649 iso_pu_bacteria 2947233263 2947233959 324
650 iso_pu_bacteria 8015687852 8015693149 324
651 iso_pu_bacteria 8054285046 8054289461 324
652 iso_pu_bacteria 8054347763 8054352975 324
653 iso_pu_bacteria 8054503363 8054508477 324
654 iso_pu_bacteria 8055770955 8055776398 324
655 iso_pu_bacteria 8055817908 8055823433 324
656 iso_pu_bacteria 8056131705 8056136876 324
657 iso_pu_bacteria 8056148874 8056150188 324
658 iso_pu_bacteria 8056161164 8056163147 324
659 3300042530 Ga0450916_002789 Ga0450916_002789_214_1224 325
660 3300046458 Ga0495591_007513 Ga0495591_007513_2776_3792 325
661 3300046691 Ga0495670_0040183 Ga0495670_0040183_160_1176 325
662 3300048924 Ga0496121_0011455 Ga0496121_0011455_1022_2038 325
663 3300048925 Ga0496122_0000434 Ga0496122_0000434_3534_4550 325
664 3300048926 Ga0496123_0000318 Ga0496123_0000318_82987_84003 325
665 3300049571 Ga0501034_0040103 Ga0501034_0040103_609_1640 325
666 3300049853 Ga0501226_000002 Ga0501226_000002_238289_239299 325
667 iso_pu_bacteria 2842854478 2842859617 325
668 iso_pu_bacteria 2923586266 2923591027 325
669 iso_pu_bacteria 2931369376 2931373138 325
670 iso_pu_bacteria 3007395558 3007398697 325
671 3300013102 Ga0157371_10033069 Ga0157371_100330693 326
672 3300042016 Ga0439463_006630 Ga0439463_006630_1377_2399 326
673 3300042439 Ga0439464_0012870 Ga0439464_0012870_68_1081 326
674 3300046458 Ga0495591_002368 Ga0495591_002368_9431_10447 326
675 3300046458 Ga0495591_003076 Ga0495591_003076_104_1123 326
676 3300046458 Ga0495591_009824 Ga0495591_009824_2705_3721 326
677 3300046474 Ga0495605_0000453 Ga0495605_0000453_24260_25276 326
678 3300046491 Ga0495584_0017395 Ga0495584_0017395_258_1274 326
679 3300046492 Ga0495585_0012667 Ga0495585_0012667_3041_4057 326
680 3300046500 Ga0495596_0001043 Ga0495596_0001043_2921_3937 326
681 3300046501 Ga0495607_0000614 Ga0495607_0000614_9529_10545 326
682 3300046501 Ga0495607_0004283 Ga0495607_0004283_7079_8095 326
683 3300046506 Ga0495583_0005049 Ga0495583_0005049_8017_9036 326
684 3300046506 Ga0495583_0054817 Ga0495583_0054817_137_1153 326
685 3300046507 Ga0495606_0000722 Ga0495606_0000722_47704_48723 326
686 3300046507 Ga0495606_0001919 Ga0495606_0001919_17725_18741 326
687 3300046512 Ga0495610_0011481 Ga0495610_0011481_2541_3557 326
688 3300046513 Ga0495616_0019488 Ga0495616_0019488_203_1219 326
689 3300046515 Ga0495620_0006559 Ga0495620_0006559_110_1126 326
690 3300046515 Ga0495620_0006731 Ga0495620_0006731_756_1772 326
691 3300046518 Ga0495631_0005175 Ga0495631_0005175_3538_4554 326
692 3300046518 Ga0495631_0022969 Ga0495631_0022969_794_1810 326
693 3300046519 Ga0495632_0006732 Ga0495632_0006732_5045_6061 326
694 3300046519 Ga0495632_0012800 Ga0495632_0012800_1352_2368 326
695 3300046520 Ga0495637_0000064 Ga0495637_0000064_9470_10486 326
696 3300046520 Ga0495637_0000610 Ga0495637_0000610_909_1925 326
697 3300046522 Ga0495643_0032701 Ga0495643_0032701_1195_2211 326
698 3300046522 Ga0495643_0051633 Ga0495643_0051633_75_1091 326
699 3300046523 Ga0495644_0006044 Ga0495644_0006044_3245_4261 326
700 3300046524 Ga0495648_0031832 Ga0495648_0031832_912_1928 326
701 3300046524 Ga0495648_0085923 Ga0495648_0085923_135_1151 326
702 3300046538 Ga0495609_0002274 Ga0495609_0002274_9580_10596 326
703 3300046557 Ga0495622_0008113 Ga0495622_0008113_3049_4065 326
704 3300046648 Ga0495611_0001689 Ga0495611_0001689_9399_10415 326
705 3300046648 Ga0495611_0020800 Ga0495611_0020800_1335_2351 326
706 3300046660 Ga0495625_0000194 Ga0495625_0000194_9572_10588 326
707 3300046665 Ga0495661_0000662 Ga0495661_0000662_9466_10482 326
708 3300046692 Ga0495671_0010355 Ga0495671_0010355_2443_3459 326
709 3300046692 Ga0495671_0050843 Ga0495671_0050843_422_1438 326
710 3300046694 Ga0495649_0008308 Ga0495649_0008308_1287_2303 326
711 3300047320 Ga0495672_0058275 Ga0495672_0058275_1212_2228 326
712 3300047321 Ga0495676_0000052 Ga0495676_0000052_86447_87463 326
713 3300047446 Ga0495679_000504 Ga0495679_000504_17567_18583 326
714 3300047469 Ga0495673_0027169 Ga0495673_0027169_1544_2560 326
715 3300047470 Ga0495681_0025986 Ga0495681_0025986_1219_2235 326
716 3300048091 Ga0495626_0000126 Ga0495626_0000126_88515_89531 326
717 3300048905 Ga0496102_0109735 Ga0496102_0109735_938_1954 326
718 3300048913 Ga0496110_0069686 Ga0496110_0069686_1593_2612 326
719 3300048914 Ga0496111_0144924 Ga0496111_0144924_591_1607 326
720 3300048919 Ga0496116_0050996 Ga0496116_0050996_359_1375 326
721 3300048924 Ga0496121_0002869 Ga0496121_0002869_13015_14031 326
722 3300048925 Ga0496122_0209813 Ga0496122_0209813_58_1074 326
723 3300048927 Ga0496124_0000689 Ga0496124_0000689_31293_32327 326
724 3300048927 Ga0496124_0017267 Ga0496124_0017267_3554_4570 326
725 3300049459 Ga0495678_002247 Ga0495678_002247_7975_8991 326
726 3300049459 Ga0495678_017098 Ga0495678_017098_1287_2303 326
727 3300049460 Ga0495682_0000697 Ga0495682_0000697_20180_21196 326
728 iso_pu_bacteria 2806310737 2807410398 326
729 iso_pu_bacteria 2806310745 2807458743 326
730 iso_pu_bacteria 8056120720 8056121355 326
731 3300046665 Ga0495661_0068742 Ga0495661_0068742_175_1173 327
732 3300047446 Ga0495679_023322 Ga0495679_023322_896_1894 327
733 3300048925 Ga0496122_0150341 Ga0496122_0150341_384_1382 327
734 3300048928 Ga0496125_0076692 Ga0496125_0076692_939_1937 327
735 3300049460 Ga0495682_0000959 Ga0495682_0000959_6520_7515 327
736 3300053161 Ga0500634_0060015 Ga0500634_0060015_90_1088 327
737 iso_pu_bacteria 2511231010 2511292247 327
738 iso_pu_bacteria 2511231011 2511293215 327
739 iso_pu_bacteria 2511231012 2511302609 327
740 iso_pu_bacteria 2511231014 2511315921 327
741 iso_pu_bacteria 2511231015 2511320440 327
742 iso_pu_bacteria 2511231017 2511335226 327
743 iso_pu_bacteria 2511231020 2511351914 327
744 iso_pu_bacteria 2511231021 2511359831 327
745 iso_pu_bacteria 2511231023 2511372223 327
746 iso_pu_bacteria 2511231031 2511411365 327
747 iso_pu_bacteria 2599185212 2599616575 327
748 iso_pu_bacteria 2599185302 2599945030 327
749 iso_pu_bacteria 2599185304 2599955241 327
750 iso_pu_bacteria 2599185307 2599974678 327
751 iso_pu_bacteria 2599185309 2599983974 327
752 iso_pu_bacteria 2599185310 2599990308 327
753 iso_pu_bacteria 2599185311 2599997710 327
754 iso_pu_bacteria 2599185312 2600001750 327
755 iso_pu_bacteria 2599185316 2600026843 327
756 iso_pu_bacteria 2599185317 2600032825 327
757 iso_pu_bacteria 2599185318 2600039073 327
758 iso_pu_bacteria 2599185319 2600044719 327
759 iso_pu_bacteria 2599185320 2600048842 327
760 iso_pu_bacteria 2599185322 2600062294 327
761 iso_pu_bacteria 2599185323 2600068770 327
762 iso_pu_bacteria 2599185325 2600079586 327
763 iso_pu_bacteria 2600254930 2600360391 327
764 iso_pu_bacteria 2600255283 2601628695 327
765 iso_pu_bacteria 2600255318 2601800532 327
766 iso_pu_bacteria 2603880185 2606078660 327
767 iso_pu_bacteria 2603880199 2606125680 327
768 iso_pu_bacteria 2623620443 2624482949 327
769 iso_pu_bacteria 2643221565 2643844922 327
770 iso_pu_bacteria 2643221589 2643957633 327
771 iso_pu_bacteria 2643221602 2644025747 327
772 iso_pu_bacteria 2667528176 2671129938 327
773 iso_pu_bacteria 2713897148 2715752371 327
774 iso_pu_bacteria 2713897149 2715759122 327
775 iso_pu_bacteria 2718217725 2718636156 327
776 iso_pu_bacteria 2738541271 2738691051 327
777 iso_pu_bacteria 2738543004 2739198117 327
778 iso_pu_bacteria 2738543015 2739260883 327
779 iso_pu_bacteria 2738543016 2739266812 327
780 iso_pu_bacteria 2738543025 2739314902 327
781 iso_pu_bacteria 2773857673 2774137094 327
782 iso_pu_bacteria 2818991456 2819659246 327
783 iso_pu_bacteria 2842832357 2842836931 327
784 iso_pu_bacteria 2842843487 2842847668 327
785 iso_pu_bacteria 2852657418 2852661067 327
786 iso_pu_bacteria 2878029506 2878034882 327
787 iso_pu_bacteria 2880230671 2880235520 327
788 iso_pu_bacteria 2904518522 2904522609 327
789 iso_pu_bacteria 2913036834 2913042076 327
790 iso_pu_bacteria 2919063839 2919067738 327
791 iso_pu_bacteria 2919385768 2919390601 327
792 iso_pu_bacteria 2919481497 2919485909 327
793 iso_pu_bacteria 2919487758 2919490915 327
794 iso_pu_bacteria 2939636861 2939641870 327
795 iso_pu_bacteria 2969304461 2969309694 327
796 iso_pu_bacteria 2974289157 2974294574 327
797 iso_pu_bacteria 2998139840 2998144939 327
798 iso_pu_bacteria 3007614139 3007614644 327
799 iso_pu_bacteria 3007855910 3007860142 327
800 iso_pu_bacteria 3007861166 3007866396 327
801 iso_pu_bacteria 8029995093 8029995959 327
802 iso_pu_bacteria 8056125926 8056131156 327
803 iso_pu_bacteria 8056166840 8056171627 327
804 iso_pu_bacteria 8056172158 8056172304 327
805 iso_pu_bacteria 8056177738 8056179232 327
806 iso_pu_bacteria 8056569372 8056571987 327
807 3300046506 Ga0495583_0003664 Ga0495583_0003664_9279_10313 328
808 3300046519 Ga0495632_0027149 Ga0495632_0027149_1146_2180 328
809 3300046665 Ga0495661_0001069 Ga0495661_0001069_22302_23336 328
810 3300046694 Ga0495649_0002195 Ga0495649_0002195_8699_9706 328
811 3300047469 Ga0495673_0026694 Ga0495673_0026694_1072_2079 328
812 3300053125 Ga0500618_007870 Ga0500618_007870_607_1614 328
813 iso_pu_bacteria 2511231004 2511252548 328
814 iso_pu_bacteria 2511231007 2511271434 328
815 iso_pu_bacteria 2511231008 2511278566 328
816 iso_pu_bacteria 2511231016 2511325970 328
817 iso_pu_bacteria 2511231018 2511341350 328
818 iso_pu_bacteria 2511231019 2511347276 328
819 iso_pu_bacteria 2511231022 2511362126 328
820 iso_pu_bacteria 2511231024 2511373285 328
821 iso_pu_bacteria 2511231156 2511827152 328
822 iso_pu_bacteria 2512047018 2512328029 328
823 iso_pu_bacteria 2554235231 2555247061 328
824 iso_pu_bacteria 2599185155 2599329397 328
825 iso_pu_bacteria 2599185188 2599504893 328
826 iso_pu_bacteria 2599185248 2599772939 328
827 iso_pu_bacteria 2599185289 2599888252 328
828 iso_pu_bacteria 2599185291 2599900966 328
829 iso_pu_bacteria 2599185300 2599930442 328
830 iso_pu_bacteria 2599185305 2599962696 328
831 iso_pu_bacteria 2599185306 2599967102 328
832 iso_pu_bacteria 2599185308 2599981005 328
833 iso_pu_bacteria 2599185313 2600009287 328
834 iso_pu_bacteria 2599185314 2600013881 328
835 iso_pu_bacteria 2599185315 2600021203 328
836 iso_pu_bacteria 2599185321 2600056199 328
837 iso_pu_bacteria 2599185324 2600074504 328
838 iso_pu_bacteria 2623620446 2624494483 328
839 iso_pu_bacteria 2643221633 2644189001 328
840 iso_pu_bacteria 2643221650 2644286552 328
841 iso_pu_bacteria 2651869719 2652546014 328
842 iso_pu_bacteria 2667528170 2671093860 328
843 iso_pu_bacteria 2675903515 2678265665 328
844 iso_pu_bacteria 2744054620 2745006900 328
845 iso_pu_bacteria 2765235841 2765586170 328
846 iso_pu_bacteria 2773857670 2774121855 328
847 iso_pu_bacteria 2784132072 2784314518 328
848 iso_pu_bacteria 2791355520 2794595249 328
849 iso_pu_bacteria 2808606361 2808857296 328
850 iso_pu_bacteria 2808606376 2808926397 328
851 iso_pu_bacteria 2808606377 2808930917 328
852 iso_pu_bacteria 2808606378 2808937400 328
853 iso_pu_bacteria 2808606380 2808948558 328
854 iso_pu_bacteria 2808606381 2808953039 328
855 iso_pu_bacteria 2808606382 2808961262 328
856 iso_pu_bacteria 2808606383 2808965730 328
857 iso_pu_bacteria 2808606389 2809000671 328
858 iso_pu_bacteria 2808606445 2809219235 328
859 iso_pu_bacteria 2825651385 2825655587 328
860 iso_pu_bacteria 2826581358 2826582865 328
861 iso_pu_bacteria 2842815866 2842819915 328
862 iso_pu_bacteria 2842849001 2842852841 328
863 iso_pu_bacteria 2912963787 2912968428 328
864 iso_pu_bacteria 2929144301 2929149450 328
865 iso_pu_bacteria 2939651529 2939654653 328
866 iso_pu_bacteria 2984286254 2984287098 328
867 iso_pu_bacteria 2988728565 2988730991 328
868 iso_pu_bacteria 3007511990 3007516729 328
869 iso_pu_bacteria 3007619802 3007621157 328
870 iso_pu_bacteria 3007872151 3007873601 328
871 iso_pu_bacteria 8019775933 8019780417 328
872 iso_pu_bacteria 8056115690 8056115695 328
873 iso_pu_bacteria 8056137416 8056138070 328
874 iso_pu_bacteria 8056143049 8056148272 328
875 iso_pu_bacteria 8056155041 8056156350 328
876 3300009011 Ga0105251_10000011 Ga0105251_1000001178 329
877 3300009011 Ga0105251_10021111 Ga0105251_100211113 329
878 3300009036 Ga0105244_10011294 Ga0105244_100112942 329
879 3300013100 Ga0157373_10173169 Ga0157373_101731692 329
880 3300013105 Ga0157369_10173827 Ga0157369_101738272 329
881 3300025728 Ga0207655_1004177 Ga0207655_10041778 329
882 3300025735 Ga0207713_1000073 Ga0207713_100007378 329
883 3300046453 Ga0495627_003242 Ga0495627_003242_3883_4896 329
884 3300046458 Ga0495591_005675 Ga0495591_005675_1991_3004 329
885 3300046474 Ga0495605_0000033 Ga0495605_0000033_103238_104251 329
886 3300046492 Ga0495585_0010926 Ga0495585_0010926_3616_4626 329
887 3300046499 Ga0495594_0009324 Ga0495594_0009324_2632_3645 329
888 3300046501 Ga0495607_0135260 Ga0495607_0135260_89_1129 329
889 3300046506 Ga0495583_0000031 Ga0495583_0000031_150193_151206 329
890 3300046512 Ga0495610_0009189 Ga0495610_0009189_3635_4648 329
891 3300046515 Ga0495620_0000038 Ga0495620_0000038_33779_34792 329
892 3300046518 Ga0495631_0032643 Ga0495631_0032643_634_1647 329
893 3300046520 Ga0495637_0066098 Ga0495637_0066098_183_1196 329
894 3300046524 Ga0495648_0041970 Ga0495648_0041970_775_1788 329
895 3300046530 Ga0495654_0004835 Ga0495654_0004835_3883_4896 329
896 3300046538 Ga0495609_0000018 Ga0495609_0000018_202970_203983 329
897 3300046542 Ga0495597_0013450 Ga0495597_0013450_2562_3575 329
898 3300046558 Ga0495633_0000062 Ga0495633_0000062_132093_133106 329
899 3300046648 Ga0495611_0006048 Ga0495611_0006048_1176_2189 329
900 3300046665 Ga0495661_0000016 Ga0495661_0000016_87954_88967 329
901 3300046665 Ga0495661_0000093 Ga0495661_0000093_50826_51836 329
902 3300046691 Ga0495670_0005692 Ga0495670_0005692_2891_3904 329
903 3300046692 Ga0495671_0011925 Ga0495671_0011925_2342_3355 329
904 3300046794 Ga0495589_0021071 Ga0495589_0021071_1344_2357 329
905 3300046810 Ga0495660_0006561 Ga0495660_0006561_2972_3985 329
906 3300047323 Ga0495683_0000092 Ga0495683_0000092_8523_9536 329
907 3300047446 Ga0495679_002108 Ga0495679_002108_6518_7531 329
908 3300047470 Ga0495681_0055628 Ga0495681_0055628_227_1240 329
909 3300048926 Ga0496123_0006979 Ga0496123_0006979_2869_3882 329
910 3300049459 Ga0495678_000021 Ga0495678_000021_102874_103887 329
911 iso_pu_bacteria 2919155634 2919158268 329
912 iso_pu_bacteria 3007803356 3007803619 329
913 iso_pu_bacteria 3007866637 3007867230 329
914 iso_pu_bacteria 8052494512 8052495231 329
915 iso_pu_bacteria 8054929484 8054933614 329
916 iso_pu_bacteria 8055878733 8055882295 329
917 3300009011 Ga0105251_10002219 Ga0105251_1000221911 330
918 3300009148 Ga0105243_10001577 Ga0105243_1000157717 330
919 3300011119 Ga0105246_10000552 Ga0105246_1000055216 330
920 3300014497 Ga0182008_10056097 Ga0182008_100560972 330
921 3300025728 Ga0207655_1000214 Ga0207655_100021443 330
922 3300025728 Ga0207655_1000742 Ga0207655_100074219 330
923 3300025735 Ga0207713_1002385 Ga0207713_10023854 330
924 3300025935 Ga0207709_10000030 Ga0207709_10000030127 330
925 3300025935 Ga0207709_10005530 Ga0207709_100055302 330
926 3300041411 Ga0439466_0017178 Ga0439466_0017178_631_1653 330
927 3300046453 Ga0495627_000037 Ga0495627_000037_115615_116628 330
928 3300046453 Ga0495627_011888 Ga0495627_011888_1316_2329 330
929 3300046458 Ga0495591_000036 Ga0495591_000036_20235_21248 330
930 3300046474 Ga0495605_0006045 Ga0495605_0006045_2963_3976 330
931 3300046474 Ga0495605_0034365 Ga0495605_0034365_1398_2411 330
932 3300046474 Ga0495605_0037682 Ga0495605_0037682_1056_2069 330
933 3300046501 Ga0495607_0000674 Ga0495607_0000674_8256_9269 330
934 3300046501 Ga0495607_0001352 Ga0495607_0001352_12356_13369 330
935 3300046515 Ga0495620_0022344 Ga0495620_0022344_1358_2395 330
936 3300046518 Ga0495631_0019960 Ga0495631_0019960_975_1988 330
937 3300046519 Ga0495632_0033446 Ga0495632_0033446_488_1501 330
938 3300046520 Ga0495637_0023874 Ga0495637_0023874_641_1654 330
939 3300046520 Ga0495637_0024152 Ga0495637_0024152_1067_2104 330
940 3300046530 Ga0495654_0002905 Ga0495654_0002905_1179_2192 330
941 3300046538 Ga0495609_0066467 Ga0495609_0066467_356_1399 330
942 3300046810 Ga0495660_0001019 Ga0495660_0001019_1036_2049 330
943 3300046810 Ga0495660_0007816 Ga0495660_0007816_1417_2430 330
944 3300047469 Ga0495673_0000667 Ga0495673_0000667_23650_24687 330
945 3300053140 Ga0500573_0043944 Ga0500573_0043944_1169_2182 330
946 3300005290 Ga0065712_10068547 Ga0065712_100685476 331
947 3300009036 Ga0105244_10001066 Ga0105244_1000106610 331
948 3300009148 Ga0105243_10115022 Ga0105243_101150222 331
949 3300025728 Ga0207655_1001674 Ga0207655_10016749 331
950 3300025935 Ga0207709_10093172 Ga0207709_100931722 331
951 3300042137 Ga0450902_003971 Ga0450902_003971_745_1740 331
952 3300042142 Ga0450905_000731 Ga0450905_000731_1018_2013 331
953 3300042533 Ga0450901_001790 Ga0450901_001790_1181_2176 331
954 3300009011 Ga0105251_10008203 Ga0105251_100082035 332
955 3300025735 Ga0207713_1006295 Ga0207713_10062954 332
956 3300046515 Ga0495620_0000007 Ga0495620_0000007_1649_2647 332
957 3300046519 Ga0495632_0009692 Ga0495632_0009692_2016_3017 332
958 3300046522 Ga0495643_0014724 Ga0495643_0014724_2469_3470 332
959 3300046524 Ga0495648_0056618 Ga0495648_0056618_480_1481 332
960 3300048917 Ga0496114_0143281 Ga0496114_0143281_163_1161 332
961 3300048926 Ga0496123_0068055 Ga0496123_0068055_475_1473 332
962 3300048927 Ga0496124_0007409 Ga0496124_0007409_5151_6149 332
963 3300048927 Ga0496124_0062514 Ga0496124_0062514_591_1589 332
964 3300048928 Ga0496125_0043957 Ga0496125_0043957_2300_3298 332
965 2162886007 SwRhRL2b_contig_1994375 SwRhRL2b_0920.00006100 333
966 3300003781 Ga0055536_1021178 Ga0055536_10211782 333
967 3300005289 Ga0065704_10006960 Ga0065704_100069603 333
968 3300005289 Ga0065704_10009829 Ga0065704_100098293 333
969 3300006944 Ga0099823_1019967 Ga0099823_10199674 333
970 3300009036 Ga0105244_10008892 Ga0105244_100088926 333
971 3300009036 Ga0105244_10011431 Ga0105244_100114314 333
972 3300009036 Ga0105244_10029959 Ga0105244_100299593 333
973 3300009036 Ga0105244_10038927 Ga0105244_100389273 333
974 3300013307 Ga0157372_10001236 Ga0157372_1000123611 333
975 3300025292 Ga0209676_1000952 Ga0209676_100095223 333
976 3300025711 Ga0207696_1000065 Ga0207696_1000065143 333
977 3300025711 Ga0207696_1017805 Ga0207696_10178052 333
978 3300025728 Ga0207655_1000213 Ga0207655_100021374 333
979 3300025728 Ga0207655_1001105 Ga0207655_100110518 333
980 3300025728 Ga0207655_1011058 Ga0207655_10110582 333
981 3300025728 Ga0207655_1024689 Ga0207655_10246892 333
982 3300025735 Ga0207713_1004156 Ga0207713_10041562 333
983 3300025735 Ga0207713_1005188 Ga0207713_10051885 333
984 3300025935 Ga0207709_10071874 Ga0207709_100718742 333
985 3300027296 Ga0209389_1000171 Ga0209389_100017111 333
986 3300027312 Ga0209371_1000219 Ga0209371_100021964 333
987 3300030500 Ga0268256_1000356 Ga0268256_100035639 333
988 3300042006 Ga0439432_011529 Ga0439432_011529_1400_2401 333
989 3300042136 Ga0450900_001014 Ga0450900_001014_416_1417 333
990 3300046522 Ga0495643_0002175 Ga0495643_0002175_4373_5374 333
991 3300048919 Ga0496116_0114506 Ga0496116_0114506_107_1108 333
992 3300048920 Ga0496117_0014254 Ga0496117_0014254_2451_3452 333
993 3300048920 Ga0496117_0054268 Ga0496117_0054268_1518_2522 333
994 3300048920 Ga0496117_0067264 Ga0496117_0067264_1092_2093 333
995 3300048921 Ga0496118_0004770 Ga0496118_0004770_14412_15413 333
996 3300048921 Ga0496118_0030664 Ga0496118_0030664_2395_3399 333
997 3300048922 Ga0496119_0000479 Ga0496119_0000479_16991_17998 333
998 3300048923 Ga0496120_0002540 Ga0496120_0002540_2338_3345 333
999 3300048924 Ga0496121_0126103 Ga0496121_0126103_666_1670 333
1000 3300048925 Ga0496122_0013063 Ga0496122_0013063_1055_2056 333
1001 3300048926 Ga0496123_0000207 Ga0496123_0000207_25520_26521 333
1002 3300048927 Ga0496124_0014442 Ga0496124_0014442_58_1059 333
1003 3300048927 Ga0496124_0067621 Ga0496124_0067621_135_1139 333
1004 3300048928 Ga0496125_0001906 Ga0496125_0001906_10409_11413 333
1005 3300048928 Ga0496125_0004964 Ga0496125_0004964_9336_10337 333
1006 3300048928 Ga0496125_0242815 Ga0496125_0242815_67_1068 333
1007 3300049571 Ga0501034_0000085 Ga0501034_0000085_89046_90047 333
1008 3300053135 Ga0500659_0011592 Ga0500659_0011592_691_1692 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03330

DPBB_1

Lytic transglycolase

101

191

0.95

PF05036

SPOR

SPOR domain

267

344

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i05-assembly1.cif.gz_A crystal structure of rlpa spor domain from pseudomonas aeruginosa 0.9915 257 331
4avr-assembly1.cif.gz_B crystal structure of the hypothetical protein pa4485 from pseudomonas aeruginosa 0.972 100 192
6i05-assembly1.cif.gz_A crystal structure of rlpa spor domain from pseudomonas aeruginosa 0.966 257 331
4avr-assembly1.cif.gz_B crystal structure of the hypothetical protein pa4485 from pseudomonas aeruginosa 0.952 100 192
5ntb-assembly2.cif.gz_B streptomyces papain inhibitor (spi) 0.773 94 193
ID Description Score Start End Superfamily
4avrB00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases;RlpA-like domain 0.9619 100 193 2.40.40.10
4avrB00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases;RlpA-like domain 0.9423 100 193 2.40.40.10
af_P10100_78_169_2.40.40.10 Mainly Beta;Beta Barrel;Barwin-like endoglucanases;RlpA-like domain 0.916 100 192 2.40.40.10
af_P10100_78_169_2.40.40.10 Mainly Beta;Beta Barrel;Barwin-like endoglucanases;RlpA-like domain 0.897 100 192 2.40.40.10
af_A0A0R0HU31_5_119_2.40.40.10 Mainly Beta;Beta Barrel;Barwin-like endoglucanases;RlpA-like domain 0.8468 138 193 2.40.40.10
ID Description Score Start End GO Terms
AF-A0A5P0Q1B6-F1-model_v4 deleted 0.9916 97 193
AF-A0A382Y0S1-F1-model_v4 RlpA-like protein double-psi beta-barrel domain-containing protein 0.9859 100 193 GO:0016829
GO:0071555
AF-A0A2E4BZ23-F1-model_v4 Probable endolytic peptidoglycan transglycosylase RlpA (EC 4.2.2.-) 0.9854 92 194 GO:0000270
GO:0008932
GO:0009279
GO:0071555
AF-B6WXT8-F1-model_v4 Probable endolytic peptidoglycan transglycosylase RlpA (EC 4.2.2.-) 0.9844 99 193 GO:0000270
GO:0008932
GO:0071555
AF-A0A3M1BK31-F1-model_v4 Probable endolytic peptidoglycan transglycosylase RlpA (EC 4.2.2.-) 0.9835 99 193 GO:0000270
GO:0008932
GO:0071555

Feature Viewer

pLDDT pTM Quality
69.75 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map