F487995

General Info

Members Datasets Scaffolds Average Seq Length
1005 245 2010 165

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0474400|Ga0496109_0474400_462_1037
Length 191
Sequence MTAPTAFSSRGSGVRASRRVEVEELMRFLPHLVLAGLAGVAFAAAPVTGQRADDQIQPKSVELQRQAKGLMTAGKLEQAEDVLETALAVDPRNRGAFVDLARVAEKQHLYGKAIRMTNKALLLEPNDPDAIAVQGEAMVEMGATARAQANLQKLQTVCGGKPCPQVAQLSAAITRGPTVASAKAPATPKSN

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
182 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
197 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
198 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
199 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
200 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
201 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
243 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.07
Rhizosphere 94.93
Stem 0
Stem Tuber 0
Unclassified 5.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0474400 3300048912 Bacteria 1181
2 JGI24736J21556_1017809 3300001904 Bacteria 1126
3 JGI24741J21665_1031047 3300001915 Bacteria 800
4 JGI24740J21852_10004829 3300001979 Bacteria 5740
5 JGI24740J21852_10047922 3300001979 Bacteria 1244
6 JGI24740J21852_10049545 3300001979 Bacteria 1213
7 JGI24739J22299_10002616 3300001989 Bacteria 6933
8 JGI24739J22299_10046539 3300001989 Bacteria 1420
9 JGI24739J22299_10073770 3300001989 Unclassified 1058
10 JGI24739J22299_10098064 3300001989 Bacteria 886
11 JGI24737J22298_10000015 3300001990 Bacteria 49821
12 JGI24737J22298_10003025 3300001990 Bacteria 5961
13 JGI24737J22298_10071799 3300001990 Bacteria 1033
14 JGI24737J22298_10073346 3300001990 Unclassified 1021
15 JGI24737J22298_10075568 3300001990 Unclassified 1004
16 JGI24743J22301_10010330 3300001991 Bacteria 1665
17 JGI24735J21928_10026095 3300002067 Bacteria 1759
18 JGI24735J21928_10034852 3300002067 Bacteria 1482
19 JGI24738J21930_10004089 3300002075 Bacteria 3602
20 JGI24738J21930_10013070 3300002075 Bacteria 1801
21 JGI24742J22300_10011349 3300002244 Bacteria 1479
22 Ga0070658_10000409 3300005327 Bacteria 37237
23 Ga0070658_10016905 3300005327 Bacteria 5839
24 Ga0070658_10030779 3300005327 Bacteria 4311
25 Ga0070658_10057898 3300005327 Bacteria 3153
26 Ga0070658_10085772 3300005327 Bacteria 2590
27 Ga0070658_10132989 3300005327 Bacteria 2074
28 Ga0070658_10209791 3300005327 Unclassified 1645
29 Ga0070658_10211136 3300005327 Bacteria 1640
30 Ga0070658_10269106 3300005327 Bacteria 1449
31 Ga0070658_10356549 3300005327 Bacteria 1252
32 Ga0070658_10718448 3300005327 Bacteria 867
33 Ga0070676_10183632 3300005328 Bacteria 1361
34 Ga0070676_10195652 3300005328 Bacteria 1322
35 Ga0070676_10580462 3300005328 Bacteria 806
36 Ga0070683_100015550 3300005329 Bacteria 6688
37 Ga0070683_100019736 3300005329 Bacteria 5990
38 Ga0070683_100427363 3300005329 Bacteria 1264
39 Ga0070683_100508060 3300005329 Bacteria 1151
40 Ga0070690_100020876 3300005330 Bacteria 3995
41 Ga0070670_100005760 3300005331 Bacteria 10468
42 Ga0070670_100017907 3300005331 Bacteria 6081
43 Ga0070670_100022672 3300005331 Bacteria 5402
44 Ga0070670_100028036 3300005331 Bacteria 4846
45 Ga0070670_100032466 3300005331 Bacteria 4497
46 Ga0070670_100043505 3300005331 Bacteria 3860
47 Ga0070670_100092956 3300005331 Bacteria 2594
48 Ga0070670_100489230 3300005331 Bacteria 1093
49 Ga0070670_100684981 3300005331 Bacteria 921
50 Ga0070677_10076617 3300005333 Bacteria 1420
51 Ga0070677_10378092 3300005333 Bacteria 741
52 Ga0068869_100086829 3300005334 Bacteria 2346
53 Ga0068869_100111210 3300005334 Bacteria 2084
54 Ga0068869_100279796 3300005334 Bacteria 1341
55 Ga0070666_10003929 3300005335 Bacteria 9028
56 Ga0070666_10011811 3300005335 Bacteria 5490
57 Ga0070666_10058069 3300005335 Bacteria 2616
58 Ga0070666_10217881 3300005335 Bacteria 1346
59 Ga0070680_100000835 3300005336 Bacteria 21767
60 Ga0070680_100013386 3300005336 Bacteria 6388
61 Ga0070680_100034043 3300005336 Bacteria 4108
62 Ga0070680_100211046 3300005336 Bacteria 1638
63 Ga0070680_100259246 3300005336 Bacteria 1470
64 Ga0070680_100296686 3300005336 Bacteria 1370
65 Ga0070680_100387827 3300005336 Bacteria 1190
66 Ga0070682_100144773 3300005337 Bacteria 1624
67 Ga0070682_100556106 3300005337 Unclassified 899
68 Ga0068868_100009256 3300005338 Bacteria 7077
69 Ga0068868_100208002 3300005338 Bacteria 1634
70 Ga0068868_100262825 3300005338 Bacteria 1456
71 Ga0070660_100000055 3300005339 Bacteria 67100
72 Ga0070660_100001167 3300005339 Bacteria 17757
73 Ga0070660_100014441 3300005339 Bacteria 5689
74 Ga0070660_100014536 3300005339 Bacteria 5675
75 Ga0070660_100016023 3300005339 Bacteria 5430
76 Ga0070660_100024447 3300005339 Bacteria 4480
77 Ga0070660_100031504 3300005339 Bacteria 3983
78 Ga0070660_100057697 3300005339 Bacteria 3008
79 Ga0070660_100062565 3300005339 Bacteria 2892
80 Ga0070660_100081192 3300005339 Bacteria 2545
81 Ga0070660_100158495 3300005339 Bacteria 1823
82 Ga0070660_100218017 3300005339 Bacteria 1550
83 Ga0070660_100222046 3300005339 Bacteria 1536
84 Ga0070660_101603790 3300005339 Bacteria 554
85 Ga0070689_100073345 3300005340 Bacteria 2677
86 Ga0070689_100102404 3300005340 Bacteria 2268
87 Ga0070691_10001910 3300005341 Bacteria 9137
88 Ga0070691_10463626 3300005341 Bacteria 726
89 Ga0070687_100165304 3300005343 Bacteria 1312
90 Ga0070661_100000340 3300005344 Bacteria 37237
91 Ga0070661_100035683 3300005344 Bacteria 3612
92 Ga0070661_100039047 3300005344 Bacteria 3458
93 Ga0070661_100044937 3300005344 Bacteria 3228
94 Ga0070661_100046073 3300005344 Bacteria 3189
95 Ga0070661_100103465 3300005344 Bacteria 2121
96 Ga0070661_100119754 3300005344 Bacteria 1971
97 Ga0070661_100120273 3300005344 Bacteria 1967
98 Ga0070661_100132615 3300005344 Bacteria 1872
99 Ga0070661_100243193 3300005344 Bacteria 1386
100 Ga0070661_100311658 3300005344 Bacteria 1227
101 Ga0070692_10122671 3300005345 Bacteria 1451
102 Ga0070692_10212549 3300005345 Bacteria 1139
103 Ga0070668_100001813 3300005347 Bacteria 15545
104 Ga0070668_100019253 3300005347 Bacteria 5137
105 Ga0070668_100291855 3300005347 Bacteria 1365
106 Ga0070668_100550784 3300005347 Bacteria 1004
107 Ga0070669_100003087 3300005353 Bacteria 11989
108 Ga0070669_100023936 3300005353 Bacteria 4375
109 Ga0070669_100050368 3300005353 Bacteria 3042
110 Ga0070669_100059559 3300005353 Bacteria 2804
111 Ga0070675_100040660 3300005354 Bacteria 3797
112 Ga0070675_100049231 3300005354 Bacteria 3458
113 Ga0070675_100373450 3300005354 Bacteria 1268
114 Ga0070671_100002064 3300005355 Bacteria 15494
115 Ga0070671_100002819 3300005355 Bacteria 13513
116 Ga0070671_100004315 3300005355 Bacteria 11250
117 Ga0070671_100070425 3300005355 Bacteria 2917
118 Ga0070671_100195854 3300005355 Bacteria 1713
119 Ga0070671_100229413 3300005355 Bacteria 1575
120 Ga0070671_100272698 3300005355 Bacteria 1438
121 Ga0070674_100046571 3300005356 Bacteria 2968
122 Ga0070674_100085989 3300005356 Bacteria 2258
123 Ga0070674_100104374 3300005356 Bacteria 2071
124 Ga0070673_100000046 3300005364 Bacteria 50435
125 Ga0070673_100009135 3300005364 Bacteria 6639
126 Ga0070673_100104361 3300005364 Bacteria 2340
127 Ga0070673_100367727 3300005364 Bacteria 1280
128 Ga0070673_100442146 3300005364 Bacteria 1169
129 Ga0070688_100364012 3300005365 Bacteria 1062
130 Ga0070659_100000139 3300005366 Bacteria 55743
131 Ga0070659_100000833 3300005366 Bacteria 22486
132 Ga0070659_100018127 3300005366 Bacteria 5309
133 Ga0070659_100054534 3300005366 Bacteria 3148
134 Ga0070659_100082020 3300005366 Bacteria 2576
135 Ga0070659_100101753 3300005366 Bacteria 2313
136 Ga0070659_100156971 3300005366 Bacteria 1858
137 Ga0070659_100196630 3300005366 Bacteria 1659
138 Ga0070659_100202530 3300005366 Bacteria 1634
139 Ga0070659_100428398 3300005366 Bacteria 1120
140 Ga0070659_101095235 3300005366 Bacteria 702
141 Ga0070659_101403338 3300005366 Bacteria 621
142 Ga0070667_100007107 3300005367 Bacteria 9310
143 Ga0070667_100045832 3300005367 Bacteria 3678
144 Ga0070667_100046437 3300005367 Bacteria 3653
145 Ga0070667_100084523 3300005367 Bacteria 2720
146 Ga0070667_100371523 3300005367 Bacteria 1297
147 Ga0070714_100038973 3300005435 Bacteria 3999
148 Ga0070714_100048442 3300005435 Bacteria 3614
149 Ga0070714_100110189 3300005435 Bacteria 2437
150 Ga0070714_100451115 3300005435 Bacteria 1222
151 Ga0070713_100232844 3300005436 Bacteria 1675
152 Ga0070694_100033072 3300005444 Bacteria 3399
153 Ga0070663_100000504 3300005455 Bacteria 20646
154 Ga0070663_100038328 3300005455 Bacteria 3343
155 Ga0070663_100051439 3300005455 Bacteria 2935
156 Ga0070663_100110074 3300005455 Bacteria 2068
157 Ga0070663_100183889 3300005455 Bacteria 1623
158 Ga0070663_100263851 3300005455 Bacteria 1367
159 Ga0070663_100322536 3300005455 Unclassified 1243
160 Ga0070663_100382612 3300005455 Bacteria 1146
161 Ga0070678_100001329 3300005456 Bacteria 13125
162 Ga0070662_100000024 3300005457 Bacteria 91042
163 Ga0070662_100000391 3300005457 Bacteria 26178
164 Ga0070662_100024789 3300005457 Bacteria 4136
165 Ga0070662_100036344 3300005457 Bacteria 3483
166 Ga0070662_100048142 3300005457 Bacteria 3070
167 Ga0070662_100064095 3300005457 Bacteria 2690
168 Ga0070662_100089666 3300005457 Bacteria 2307
169 Ga0070662_100096455 3300005457 Bacteria 2230
170 Ga0070662_100101288 3300005457 Bacteria 2180
171 Ga0070662_100146720 3300005457 Bacteria 1833
172 Ga0070662_100179045 3300005457 Bacteria 1670
173 Ga0070662_100361534 3300005457 Bacteria 1191
174 Ga0070662_100473854 3300005457 Bacteria 1042
175 Ga0070681_10031170 3300005458 Bacteria 5352
176 Ga0070681_10206766 3300005458 Bacteria 1880
177 Ga0070681_10269674 3300005458 Bacteria 1613
178 Ga0070681_10495438 3300005458 Bacteria 1135
179 Ga0068867_100003011 3300005459 Bacteria 11877
180 Ga0068867_100020259 3300005459 Bacteria 4739
181 Ga0068867_100237887 3300005459 Bacteria 1475
182 Ga0068867_100624170 3300005459 Bacteria 943
183 Ga0068867_100735805 3300005459 Unclassified 874
184 Ga0068867_100957412 3300005459 Bacteria 774
185 Ga0070685_10146478 3300005466 Bacteria 1492
186 Ga0070679_100058079 3300005530 Bacteria 3856
187 Ga0070679_100123264 3300005530 Bacteria 2575
188 Ga0070679_100156385 3300005530 Bacteria 2255
189 Ga0070679_100246908 3300005530 Bacteria 1741
190 Ga0070679_100297491 3300005530 Bacteria 1565
191 Ga0070679_100481935 3300005530 Bacteria 1184
192 Ga0070679_100895826 3300005530 Bacteria 831
193 Ga0070684_100012523 3300005535 Bacteria 6803
194 Ga0070684_100037821 3300005535 Bacteria 4142
195 Ga0070684_100416076 3300005535 Bacteria 1240
196 Ga0070684_100550494 3300005535 Bacteria 1071
197 Ga0070684_101021410 3300005535 Bacteria 776
198 Ga0070684_101063376 3300005535 Bacteria 760
199 Ga0070684_101068350 3300005535 Bacteria 758
200 Ga0068853_100000342 3300005539 Bacteria 32471
201 Ga0068853_100023933 3300005539 Bacteria 5118
202 Ga0068853_100048444 3300005539 Bacteria 3650
203 Ga0068853_100050453 3300005539 Bacteria 3580
204 Ga0068853_100105179 3300005539 Bacteria 2500
205 Ga0068853_100127870 3300005539 Bacteria 2271
206 Ga0068853_100144227 3300005539 Bacteria 2139
207 Ga0068853_100158704 3300005539 Unclassified 2039
208 Ga0068853_100245337 3300005539 Bacteria 1642
209 Ga0068853_100330707 3300005539 Unclassified 1414
210 Ga0070672_100011152 3300005543 Bacteria 6258
211 Ga0070672_100019054 3300005543 Bacteria 4973
212 Ga0070672_100023487 3300005543 Bacteria 4546
213 Ga0070672_100057978 3300005543 Bacteria 3041
214 Ga0070672_100251209 3300005543 Bacteria 1489
215 Ga0070672_100387069 3300005543 Bacteria 1197
216 Ga0070695_100052790 3300005545 Bacteria 2613
217 Ga0070695_100349279 3300005545 Bacteria 1108
218 Ga0070696_100004253 3300005546 Bacteria 9550
219 Ga0070693_100002285 3300005547 Bacteria 8785
220 Ga0070693_100003111 3300005547 Bacteria 7705
221 Ga0070693_100013178 3300005547 Bacteria 4205
222 Ga0070693_100638349 3300005547 Bacteria 773
223 Ga0070665_100000705 3300005548 Bacteria 44568
224 Ga0070665_100008558 3300005548 Bacteria 10354
225 Ga0070665_100013825 3300005548 Bacteria 8119
226 Ga0070665_100014608 3300005548 Bacteria 7880
227 Ga0070665_100121465 3300005548 Bacteria 2614
228 Ga0070665_100135897 3300005548 Bacteria 2461
229 Ga0068855_100001003 3300005563 Bacteria 35196
230 Ga0068855_100066130 3300005563 Bacteria 4215
231 Ga0068855_100088679 3300005563 Bacteria 3573
232 Ga0068855_100118992 3300005563 Bacteria 3025
233 Ga0068855_100184374 3300005563 Bacteria 2358
234 Ga0068855_100222214 3300005563 Bacteria 2117
235 Ga0068855_100449922 3300005563 Bacteria 1405
236 Ga0068855_100527016 3300005563 Bacteria 1281
237 Ga0068855_101423870 3300005563 Bacteria 714
238 Ga0070664_100000082 3300005564 Bacteria 60083
239 Ga0070664_100009829 3300005564 Bacteria 7752
240 Ga0070664_100011365 3300005564 Bacteria 7222
241 Ga0070664_100014466 3300005564 Bacteria 6433
242 Ga0070664_100015877 3300005564 Bacteria 6165
243 Ga0070664_100020839 3300005564 Bacteria 5400
244 Ga0070664_100044101 3300005564 Bacteria 3765
245 Ga0070664_100075378 3300005564 Bacteria 2897
246 Ga0070664_100089727 3300005564 Bacteria 2660
247 Ga0070664_100136014 3300005564 Bacteria 2161
248 Ga0070664_100139825 3300005564 Bacteria 2131
249 Ga0070664_100190434 3300005564 Bacteria 1827
250 Ga0070664_101202701 3300005564 Unclassified 715
251 Ga0068857_100011952 3300005577 Bacteria 7549
252 Ga0068857_100040055 3300005577 Bacteria 4154
253 Ga0068857_100049674 3300005577 Bacteria 3721
254 Ga0068857_100096523 3300005577 Bacteria 2649
255 Ga0068857_100171648 3300005577 Bacteria 1971
256 Ga0068857_100185139 3300005577 Bacteria 1895
257 Ga0068857_100243943 3300005577 Bacteria 1645
258 Ga0068857_100316356 3300005577 Bacteria 1441
259 Ga0068857_100496951 3300005577 Bacteria 1144
260 Ga0068854_100005522 3300005578 Bacteria 7990
261 Ga0068854_100014119 3300005578 Bacteria 5258
262 Ga0068854_100014148 3300005578 Bacteria 5253
263 Ga0068854_100015201 3300005578 Bacteria 5094
264 Ga0068854_100025466 3300005578 Bacteria 4060
265 Ga0068854_100044115 3300005578 Bacteria 3163
266 Ga0068854_100087726 3300005578 Bacteria 2309
267 Ga0068854_100156793 3300005578 Bacteria 1760
268 Ga0068854_100230272 3300005578 Bacteria 1470
269 Ga0068854_100294635 3300005578 Bacteria 1310
270 Ga0068854_100637272 3300005578 Bacteria 914
271 Ga0068854_100863301 3300005578 Bacteria 793
272 Ga0068856_100000085 3300005614 Bacteria 87665
273 Ga0068856_100039189 3300005614 Bacteria 4651
274 Ga0068856_100084955 3300005614 Bacteria 3144
275 Ga0068856_100148116 3300005614 Bacteria 2355
276 Ga0068856_100905754 3300005614 Unclassified 901
277 Ga0070702_100239405 3300005615 Bacteria 1224
278 Ga0068852_100000736 3300005616 Bacteria 21492
279 Ga0068852_100001258 3300005616 Bacteria 16883
280 Ga0068852_100064654 3300005616 Bacteria 3190
281 Ga0068852_100130897 3300005616 Bacteria 2310
282 Ga0068852_100135037 3300005616 Bacteria 2277
283 Ga0068852_100169533 3300005616 Bacteria 2045
284 Ga0068852_100197837 3300005616 Bacteria 1900
285 Ga0068852_100244833 3300005616 Bacteria 1715
286 Ga0068852_100292563 3300005616 Bacteria 1574
287 Ga0068852_100449870 3300005616 Bacteria 1275
288 Ga0068852_100630696 3300005616 Bacteria 1078
289 Ga0068852_100865789 3300005616 Bacteria 920
290 Ga0068852_101955802 3300005616 Bacteria 608
291 Ga0068859_100020355 3300005617 Bacteria 6660
292 Ga0068859_100622981 3300005617 Bacteria 1172
293 Ga0068859_102107410 3300005617 Unclassified 622
294 Ga0068864_100051460 3300005618 Bacteria 3548
295 Ga0068864_100080680 3300005618 Bacteria 2851
296 Ga0068864_100087745 3300005618 Bacteria 2739
297 Ga0068864_100194710 3300005618 Bacteria 1859
298 Ga0068864_100280895 3300005618 Bacteria 1554
299 Ga0068866_10146944 3300005718 Bacteria 1361
300 Ga0068851_10005869 3300005834 Bacteria 5592
301 Ga0068851_10034172 3300005834 Bacteria 2537
302 Ga0068851_10045441 3300005834 Bacteria 2220
303 Ga0068851_10097577 3300005834 Bacteria 1555
304 Ga0068851_10136481 3300005834 Bacteria 1330
305 Ga0068851_10156858 3300005834 Bacteria 1248
306 Ga0068851_10185317 3300005834 Unclassified 1155
307 Ga0068851_10228188 3300005834 Unclassified 1049
308 Ga0068851_10499953 3300005834 Bacteria 729
309 Ga0068870_10052733 3300005840 Bacteria 2157
310 Ga0068863_100023352 3300005841 Bacteria 5908
311 Ga0068863_100207866 3300005841 Bacteria 1884
312 Ga0068863_100213068 3300005841 Bacteria 1860
313 Ga0068863_100423299 3300005841 Bacteria 1305
314 Ga0068863_101247918 3300005841 Bacteria 749
315 Ga0068858_100001044 3300005842 Bacteria 28595
316 Ga0068858_100012453 3300005842 Bacteria 8020
317 Ga0068858_100036446 3300005842 Bacteria 4561
318 Ga0068858_100115029 3300005842 Bacteria 2513
319 Ga0068858_100236943 3300005842 Bacteria 1731
320 Ga0068860_100007914 3300005843 Bacteria 10610
321 Ga0068860_100013216 3300005843 Bacteria 8099
322 Ga0068860_100024420 3300005843 Bacteria 5840
323 Ga0068862_100127011 3300005844 Bacteria 2252
324 Ga0068862_100216891 3300005844 Bacteria 1731
325 Ga0068862_100304566 3300005844 Bacteria 1467
326 Ga0068862_101429593 3300005844 Bacteria 695
327 Ga0081539_10030639 3300005985 Bacteria 3334
328 Ga0075432_10243735 3300006058 Bacteria 727
329 Ga0070715_10231244 3300006163 Unclassified 956
330 Ga0097621_100276479 3300006237 Bacteria 1477
331 Ga0097621_100327992 3300006237 Bacteria 1357
332 Ga0097621_100861850 3300006237 Bacteria 842
333 Ga0097621_101587731 3300006237 Unclassified 622
334 Ga0068871_100024537 3300006358 Bacteria 4678
335 Ga0068871_100749049 3300006358 Bacteria 898
336 Ga0075433_10030095 3300006852 Bacteria 4631
337 Ga0075429_100155560 3300006880 Bacteria 2002
338 Ga0075429_100668866 3300006880 Bacteria 910
339 Ga0068865_100011395 3300006881 Bacteria 5562
340 Ga0068865_100145149 3300006881 Bacteria 1794
341 Ga0075436_100414333 3300006914 Bacteria 978
342 Ga0097620_100020355 3300006931 Bacteria 6660
343 Ga0097620_100622941 3300006931 Bacteria 1172
344 Ga0097620_102107504 3300006931 Unclassified 622
345 Ga0105240_10010028 3300009093 Bacteria 13343
346 Ga0105240_10314492 3300009093 Bacteria 1787
347 Ga0105240_10387309 3300009093 Bacteria 1577
348 Ga0105240_10437630 3300009093 Bacteria 1466
349 Ga0111539_10030273 3300009094 Bacteria 6582
350 Ga0105245_10004912 3300009098 Bacteria 11764
351 Ga0105245_10115389 3300009098 Bacteria 2502
352 Ga0105245_11068975 3300009098 Bacteria 853
353 Ga0105247_10694640 3300009101 Bacteria 765
354 Ga0114129_10748024 3300009147 Bacteria 1252
355 Ga0105243_10199796 3300009148 Bacteria 1752
356 Ga0105243_10200263 3300009148 Bacteria 1751
357 Ga0105241_10025436 3300009174 Bacteria 4398
358 Ga0105241_10130758 3300009174 Bacteria 2032
359 Ga0105241_10132914 3300009174 Bacteria 2017
360 Ga0105241_10600820 3300009174 Bacteria 994
361 Ga0105242_10070580 3300009176 Bacteria 2896
362 Ga0105242_10344313 3300009176 Bacteria 1375
363 Ga0105248_10000059 3300009177 Bacteria 137176
364 Ga0105248_10011918 3300009177 Bacteria 9588
365 Ga0105248_10013505 3300009177 Bacteria 8991
366 Ga0105248_10167642 3300009177 Bacteria 2475
367 Ga0105248_10240244 3300009177 Bacteria 2039
368 Ga0105248_10250018 3300009177 Bacteria 1995
369 Ga0105248_10546583 3300009177 Bacteria 1306
370 Ga0105248_10831937 3300009177 Bacteria 1042
371 Ga0105237_10038498 3300009545 Bacteria 4828
372 Ga0105238_10001777 3300009551 Bacteria 21567
373 Ga0105238_10006370 3300009551 Bacteria 11739
374 Ga0105238_10040802 3300009551 Bacteria 4701
375 Ga0105238_10099734 3300009551 Bacteria 2887
376 Ga0105238_10158281 3300009551 Bacteria 2240
377 Ga0105238_11200124 3300009551 Bacteria 783
378 Ga0105249_10036961 3300009553 Bacteria 4431
379 Ga0105249_10078396 3300009553 Bacteria 3065
380 Ga0105239_10177877 3300010375 Bacteria 2380
381 Ga0105239_10257237 3300010375 Bacteria 1962
382 Ga0105239_10689430 3300010375 Bacteria 1168
383 Ga0105239_11351181 3300010375 Bacteria 822
384 Ga0105246_10110848 3300011119 Bacteria 2016
385 Ga0105246_10477964 3300011119 Bacteria 1053
386 Ga0157373_10002971 3300013100 Bacteria 12844
387 Ga0157373_10012761 3300013100 Bacteria 6173
388 Ga0157373_10037470 3300013100 Bacteria 3476
389 Ga0157373_10037908 3300013100 Bacteria 3454
390 Ga0157373_10134399 3300013100 Bacteria 1739
391 Ga0157373_10238175 3300013100 Bacteria 1286
392 Ga0157373_11069694 3300013100 Bacteria 604
393 Ga0157373_11094343 3300013100 Bacteria 598
394 Ga0157373_11105901 3300013100 Bacteria 595
395 Ga0157371_10002587 3300013102 Bacteria 17169
396 Ga0157371_10003776 3300013102 Bacteria 13558
397 Ga0157371_10052576 3300013102 Bacteria 2893
398 Ga0157371_10096680 3300013102 Unclassified 2093
399 Ga0157371_10214978 3300013102 Bacteria 1380
400 Ga0157371_10237892 3300013102 Bacteria 1309
401 Ga0157371_10255457 3300013102 Bacteria 1262
402 Ga0157371_10276406 3300013102 Bacteria 1213
403 Ga0157371_10296874 3300013102 Bacteria 1169
404 Ga0157371_10313694 3300013102 Unclassified 1137
405 Ga0157371_10345438 3300013102 Bacteria 1083
406 Ga0157371_10547624 3300013102 Bacteria 857
407 Ga0157370_10030524 3300013104 Bacteria 5281
408 Ga0157370_10032658 3300013104 Bacteria 5081
409 Ga0157370_10039701 3300013104 Bacteria 4548
410 Ga0157370_10065339 3300013104 Bacteria 3442
411 Ga0157370_10147764 3300013104 Bacteria 2188
412 Ga0157369_10000691 3300013105 Bacteria 43536
413 Ga0157369_10052564 3300013105 Bacteria 4407
414 Ga0157369_10098028 3300013105 Bacteria 3127
415 Ga0157369_10163687 3300013105 Bacteria 2347
416 Ga0157369_10211972 3300013105 Bacteria 2030
417 Ga0157369_10306892 3300013105 Bacteria 1650
418 Ga0157369_10347256 3300013105 Unclassified 1541
419 Ga0157369_10453536 3300013105 Bacteria 1328
420 Ga0157369_10640995 3300013105 Unclassified 1096
421 Ga0157369_10753204 3300013105 Bacteria 1002
422 Ga0157374_10138846 3300013296 Bacteria 2358
423 Ga0157374_10461677 3300013296 Bacteria 1272
424 Ga0157374_10502225 3300013296 Bacteria 1217
425 Ga0157374_10794516 3300013296 Unclassified 962
426 Ga0157378_10001242 3300013297 Bacteria 23038
427 Ga0157378_10582230 3300013297 Bacteria 1128
428 Ga0163162_10052573 3300013306 Bacteria 4092
429 Ga0163162_10119733 3300013306 Bacteria 2736
430 Ga0163162_10146836 3300013306 Bacteria 2475
431 Ga0163162_10541120 3300013306 Bacteria 1293
432 Ga0157372_10004194 3300013307 Bacteria 15426
433 Ga0157372_10031841 3300013307 Bacteria 5779
434 Ga0157372_10248927 3300013307 Bacteria 2062
435 Ga0157372_10351769 3300013307 Bacteria 1716
436 Ga0157372_10850425 3300013307 Bacteria 1059
437 Ga0157372_11064753 3300013307 Bacteria 936
438 Ga0157372_11523277 3300013307 Bacteria 770
439 Ga0157375_10007583 3300013308 Bacteria 9489
440 Ga0157375_10166200 3300013308 Bacteria 2351
441 Ga0157375_10459145 3300013308 Bacteria 1439
442 Ga0157375_10658457 3300013308 Bacteria 1203
443 Ga0157375_11016317 3300013308 Bacteria 968
444 Ga0163163_10000763 3300014325 Bacteria 27341
445 Ga0163163_10011737 3300014325 Bacteria 7959
446 Ga0163163_10964984 3300014325 Bacteria 916
447 Ga0157380_10405961 3300014326 Bacteria 1294
448 Ga0157377_10079376 3300014745 Bacteria 1914
449 Ga0157377_10209882 3300014745 Bacteria 1241
450 Ga0157379_10102405 3300014968 Bacteria 2570
451 Ga0157379_10124170 3300014968 Bacteria 2323
452 Ga0157379_10557470 3300014968 Bacteria 1067
453 Ga0157376_10127966 3300014969 Bacteria 2262
454 Ga0206356_11371520 3300020070 Bacteria 1334
455 Ga0206353_10844233 3300020082 Bacteria 828
456 Ga0207697_10000250 3300025315 Bacteria 29574
457 Ga0207697_10075548 3300025315 Bacteria 1416
458 Ga0207697_10172612 3300025315 Bacteria 946
459 Ga0207656_10002438 3300025321 Bacteria 6264
460 Ga0207656_10038440 3300025321 Bacteria 2019
461 Ga0207656_10160275 3300025321 Bacteria 1070
462 Ga0207656_10168995 3300025321 Unclassified 1044
463 Ga0207656_10200157 3300025321 Bacteria 964
464 Ga0207656_10220155 3300025321 Unclassified 922
465 Ga0207682_10020979 3300025893 Bacteria 2569
466 Ga0207642_10003912 3300025899 Bacteria 4750
467 Ga0207642_10088356 3300025899 Bacteria 1524
468 Ga0207688_10003101 3300025901 Bacteria 9076
469 Ga0207688_10008736 3300025901 Bacteria 5512
470 Ga0207688_10454205 3300025901 Unclassified 799
471 Ga0207680_10000473 3300025903 Bacteria 19026
472 Ga0207680_10115309 3300025903 Bacteria 1749
473 Ga0207680_10246643 3300025903 Unclassified 1232
474 Ga0207680_10261708 3300025903 Bacteria 1197
475 Ga0207680_10308534 3300025903 Bacteria 1104
476 Ga0207680_10348061 3300025903 Bacteria 1040
477 Ga0207647_10000153 3300025904 Bacteria 54496
478 Ga0207647_10000870 3300025904 Bacteria 23366
479 Ga0207647_10003089 3300025904 Bacteria 12516
480 Ga0207647_10007895 3300025904 Bacteria 7652
481 Ga0207647_10018065 3300025904 Bacteria 4780
482 Ga0207647_10027063 3300025904 Bacteria 3743
483 Ga0207647_10091176 3300025904 Bacteria 1817
484 Ga0207647_10183265 3300025904 Bacteria 1215
485 Ga0207699_10629925 3300025906 Unclassified 782
486 Ga0207645_10001588 3300025907 Bacteria 18529
487 Ga0207645_10005018 3300025907 Bacteria 9695
488 Ga0207645_10538783 3300025907 Bacteria 791
489 Ga0207643_10151890 3300025908 Bacteria 1389
490 Ga0207643_10212657 3300025908 Bacteria 1181
491 Ga0207705_10000062 3300025909 Bacteria 149432
492 Ga0207705_10001553 3300025909 Bacteria 18222
493 Ga0207705_10003689 3300025909 Bacteria 11653
494 Ga0207705_10009755 3300025909 Bacteria 6986
495 Ga0207705_10019133 3300025909 Bacteria 4898
496 Ga0207705_10019240 3300025909 Bacteria 4883
497 Ga0207705_10048995 3300025909 Bacteria 3040
498 Ga0207705_10101439 3300025909 Bacteria 2117
499 Ga0207705_10117275 3300025909 Bacteria 1972
500 Ga0207705_10129873 3300025909 Bacteria 1874
501 Ga0207705_10335269 3300025909 Bacteria 1164
502 Ga0207705_10378459 3300025909 Bacteria 1093
503 Ga0207705_10893684 3300025909 Unclassified 688
504 Ga0207654_10071913 3300025911 Bacteria 2057
505 Ga0207654_10436873 3300025911 Bacteria 916
506 Ga0207707_10315496 3300025912 Bacteria 1350
507 Ga0207695_10002617 3300025913 Bacteria 26348
508 Ga0207695_10318441 3300025913 Bacteria 1445
509 Ga0207695_10559987 3300025913 Bacteria 1024
510 Ga0207671_10071482 3300025914 Bacteria 2588
511 Ga0207660_10001300 3300025917 Bacteria 16670
512 Ga0207660_10022446 3300025917 Bacteria 4252
513 Ga0207660_10038174 3300025917 Bacteria 3352
514 Ga0207660_10228669 3300025917 Bacteria 1462
515 Ga0207660_10335364 3300025917 Bacteria 1210
516 Ga0207660_11120352 3300025917 Bacteria 641
517 Ga0207657_10000015 3300025919 Bacteria 175776
518 Ga0207657_10000948 3300025919 Bacteria 30737
519 Ga0207657_10001896 3300025919 Bacteria 22595
520 Ga0207657_10003254 3300025919 Bacteria 17391
521 Ga0207657_10003972 3300025919 Bacteria 15709
522 Ga0207657_10005969 3300025919 Bacteria 12670
523 Ga0207657_10011577 3300025919 Bacteria 8750
524 Ga0207657_10012877 3300025919 Bacteria 8225
525 Ga0207657_10025063 3300025919 Bacteria 5509
526 Ga0207657_10057045 3300025919 Bacteria 3368
527 Ga0207657_10064199 3300025919 Bacteria 3135
528 Ga0207657_10075191 3300025919 Bacteria 2851
529 Ga0207657_10121695 3300025919 Bacteria 2147
530 Ga0207657_10184163 3300025919 Bacteria 1687
531 Ga0207657_10220645 3300025919 Bacteria 1519
532 Ga0207657_10288128 3300025919 Bacteria 1303
533 Ga0207657_10407814 3300025919 Bacteria 1069
534 Ga0207657_10412333 3300025919 Unclassified 1062
535 Ga0207657_10544629 3300025919 Unclassified 907
536 Ga0207657_10640846 3300025919 Bacteria 828
537 Ga0207649_10003376 3300025920 Bacteria 8732
538 Ga0207649_10004215 3300025920 Bacteria 7833
539 Ga0207649_10007557 3300025920 Bacteria 5909
540 Ga0207649_10010461 3300025920 Bacteria 5098
541 Ga0207649_10083190 3300025920 Bacteria 2077
542 Ga0207649_10131764 3300025920 Bacteria 1699
543 Ga0207649_10287182 3300025920 Bacteria 1198
544 Ga0207649_10298949 3300025920 Bacteria 1176
545 Ga0207649_10300634 3300025920 Bacteria 1173
546 Ga0207649_10302859 3300025920 Bacteria 1169
547 Ga0207649_10321387 3300025920 Bacteria 1137
548 Ga0207649_10390073 3300025920 Bacteria 1040
549 Ga0207649_10476139 3300025920 Bacteria 946
550 Ga0207652_10096826 3300025921 Bacteria 2600
551 Ga0207652_10152006 3300025921 Bacteria 2073
552 Ga0207652_10217605 3300025921 Bacteria 1721
553 Ga0207652_10499586 3300025921 Bacteria 1095
554 Ga0207652_10751665 3300025921 Bacteria 868
555 Ga0207681_10003120 3300025923 Bacteria 10424
556 Ga0207681_10015014 3300025923 Bacteria 4827
557 Ga0207681_10035890 3300025923 Bacteria 3268
558 Ga0207694_10019733 3300025924 Bacteria 5099
559 Ga0207694_10026005 3300025924 Bacteria 4450
560 Ga0207694_10032275 3300025924 Bacteria 4007
561 Ga0207694_11280261 3300025924 Unclassified 620
562 Ga0207650_10014617 3300025925 Bacteria 5452
563 Ga0207650_10024327 3300025925 Bacteria 4303
564 Ga0207650_10042899 3300025925 Bacteria 3318
565 Ga0207650_10047581 3300025925 Bacteria 3161
566 Ga0207650_10071444 3300025925 Bacteria 2611
567 Ga0207650_10117863 3300025925 Bacteria 2063
568 Ga0207650_10165969 3300025925 Bacteria 1752
569 Ga0207659_10038761 3300025926 Bacteria 3317
570 Ga0207659_10116827 3300025926 Bacteria 2037
571 Ga0207687_10482157 3300025927 Bacteria 1033
572 Ga0207700_10262606 3300025928 Unclassified 1479
573 Ga0207700_10629387 3300025928 Bacteria 956
574 Ga0207664_10112349 3300025929 Bacteria 2268
575 Ga0207644_10001099 3300025931 Bacteria 17353
576 Ga0207644_10012442 3300025931 Bacteria 5651
577 Ga0207644_10037824 3300025931 Bacteria 3397
578 Ga0207644_10043061 3300025931 Bacteria 3202
579 Ga0207644_10157896 3300025931 Bacteria 1760
580 Ga0207644_10233587 3300025931 Bacteria 1462
581 Ga0207644_10233599 3300025931 Bacteria 1462
582 Ga0207644_10255839 3300025931 Bacteria 1398
583 Ga0207690_10000032 3300025932 Bacteria 152479
584 Ga0207690_10004940 3300025932 Bacteria 7870
585 Ga0207690_10007689 3300025932 Bacteria 6396
586 Ga0207690_10011323 3300025932 Bacteria 5332
587 Ga0207690_10021998 3300025932 Bacteria 3961
588 Ga0207690_10087967 3300025932 Bacteria 2187
589 Ga0207690_10221923 3300025932 Bacteria 1446
590 Ga0207690_10225492 3300025932 Bacteria 1436
591 Ga0207690_10330322 3300025932 Bacteria 1201
592 Ga0207690_10463523 3300025932 Bacteria 1020
593 Ga0207690_10540767 3300025932 Unclassified 946
594 Ga0207690_10768414 3300025932 Bacteria 795
595 Ga0207690_11041651 3300025932 Unclassified 681
596 Ga0207706_10000032 3300025933 Bacteria 142723
597 Ga0207706_10000194 3300025933 Bacteria 67452
598 Ga0207706_10002828 3300025933 Bacteria 16835
599 Ga0207706_10007703 3300025933 Bacteria 9943
600 Ga0207706_10008829 3300025933 Bacteria 9274
601 Ga0207706_10020549 3300025933 Bacteria 5934
602 Ga0207706_10050146 3300025933 Bacteria 3690
603 Ga0207706_10056408 3300025933 Bacteria 3463
604 Ga0207706_10076852 3300025933 Bacteria 2937
605 Ga0207706_10123037 3300025933 Bacteria 2282
606 Ga0207706_10138860 3300025933 Bacteria 2138
607 Ga0207706_10458034 3300025933 Bacteria 1103
608 Ga0207706_10463005 3300025933 Bacteria 1096
609 Ga0207706_10528385 3300025933 Bacteria 1017
610 Ga0207686_10180508 3300025934 Bacteria 1496
611 Ga0207686_10218269 3300025934 Bacteria 1375
612 Ga0207709_10107977 3300025935 Bacteria 1855
613 Ga0207670_10083402 3300025936 Bacteria 2242
614 Ga0207669_10019100 3300025937 Bacteria 3560
615 Ga0207669_10021047 3300025937 Bacteria 3434
616 Ga0207669_10130230 3300025937 Bacteria 1727
617 Ga0207669_10238256 3300025937 Bacteria 1347
618 Ga0207669_10375464 3300025937 Bacteria 1106
619 Ga0207704_10527382 3300025938 Bacteria 956
620 Ga0207704_10941458 3300025938 Bacteria 728
621 Ga0207691_10000603 3300025940 Bacteria 35845
622 Ga0207691_10022853 3300025940 Bacteria 5895
623 Ga0207691_10066993 3300025940 Bacteria 3247
624 Ga0207691_10082094 3300025940 Bacteria 2896
625 Ga0207691_10155266 3300025940 Bacteria 2010
626 Ga0207691_10204150 3300025940 Bacteria 1719
627 Ga0207691_10376859 3300025940 Bacteria 1212
628 Ga0207711_10000046 3300025941 Bacteria 153238
629 Ga0207711_10001202 3300025941 Bacteria 24498
630 Ga0207711_10113654 3300025941 Bacteria 2411
631 Ga0207711_10599563 3300025941 Bacteria 1028
632 Ga0207689_10000094 3300025942 Bacteria 71733
633 Ga0207689_10021514 3300025942 Bacteria 5423
634 Ga0207689_10177354 3300025942 Bacteria 1757
635 Ga0207661_10000460 3300025944 Bacteria 26287
636 Ga0207661_10020074 3300025944 Bacteria 4990
637 Ga0207661_10142985 3300025944 Bacteria 2060
638 Ga0207661_10559019 3300025944 Bacteria 1048
639 Ga0207679_10000983 3300025945 Bacteria 18340
640 Ga0207679_10003734 3300025945 Bacteria 9442
641 Ga0207679_10023101 3300025945 Bacteria 4246
642 Ga0207679_10028697 3300025945 Bacteria 3865
643 Ga0207679_10044915 3300025945 Bacteria 3192
644 Ga0207679_10114286 3300025945 Bacteria 2137
645 Ga0207679_10124343 3300025945 Bacteria 2059
646 Ga0207679_10141747 3300025945 Bacteria 1944
647 Ga0207679_10257591 3300025945 Unclassified 1486
648 Ga0207679_10501272 3300025945 Bacteria 1083
649 Ga0207679_10612102 3300025945 Bacteria 982
650 Ga0207679_10862464 3300025945 Bacteria 827
651 Ga0207667_10002422 3300025949 Bacteria 23379
652 Ga0207667_10018328 3300025949 Bacteria 7853
653 Ga0207667_10032107 3300025949 Bacteria 5660
654 Ga0207667_10074641 3300025949 Bacteria 3522
655 Ga0207667_10140286 3300025949 Bacteria 2489
656 Ga0207667_10310287 3300025949 Bacteria 1611
657 Ga0207667_10412658 3300025949 Bacteria 1374
658 Ga0207667_10510627 3300025949 Bacteria 1218
659 Ga0207667_10526261 3300025949 Bacteria 1197
660 Ga0207651_10003067 3300025960 Bacteria 8109
661 Ga0207651_10320641 3300025960 Bacteria 1295
662 Ga0207651_10429448 3300025960 Bacteria 1129
663 Ga0207651_10538967 3300025960 Bacteria 1013
664 Ga0207712_10016841 3300025961 Bacteria 4740
665 Ga0207712_10093662 3300025961 Bacteria 2217
666 Ga0207712_10104951 3300025961 Bacteria 2108
667 Ga0207668_10000074 3300025972 Bacteria 75726
668 Ga0207668_10075115 3300025972 Bacteria 2429
669 Ga0207668_10130182 3300025972 Bacteria 1920
670 Ga0207668_10308507 3300025972 Bacteria 1309
671 Ga0207640_10008210 3300025981 Bacteria 5788
672 Ga0207640_10025024 3300025981 Bacteria 3609
673 Ga0207640_10030685 3300025981 Bacteria 3313
674 Ga0207640_10062940 3300025981 Bacteria 2464
675 Ga0207640_10067450 3300025981 Bacteria 2394
676 Ga0207640_10088408 3300025981 Bacteria 2139
677 Ga0207640_10101328 3300025981 Bacteria 2020
678 Ga0207640_10159849 3300025981 Bacteria 1666
679 Ga0207640_10222254 3300025981 Bacteria 1447
680 Ga0207640_10232048 3300025981 Bacteria 1420
681 Ga0207640_10813978 3300025981 Bacteria 810
682 Ga0207658_10010924 3300025986 Bacteria 6182
683 Ga0207658_10050024 3300025986 Bacteria 3073
684 Ga0207658_10061553 3300025986 Bacteria 2805
685 Ga0207658_10108518 3300025986 Bacteria 2189
686 Ga0207677_10301658 3300026023 Bacteria 1323
687 Ga0207677_10559812 3300026023 Bacteria 998
688 Ga0207677_11286970 3300026023 Unclassified 671
689 Ga0207703_10010364 3300026035 Bacteria 7295
690 Ga0207703_10012796 3300026035 Bacteria 6542
691 Ga0207703_10026943 3300026035 Bacteria 4527
692 Ga0207703_10049408 3300026035 Bacteria 3400
693 Ga0207703_10114566 3300026035 Bacteria 2305
694 Ga0207703_10348982 3300026035 Bacteria 1362
695 Ga0207703_11432474 3300026035 Bacteria 665
696 Ga0207639_10002345 3300026041 Bacteria 12725
697 Ga0207639_10038258 3300026041 Bacteria 3568
698 Ga0207639_10054095 3300026041 Bacteria 3066
699 Ga0207639_10086773 3300026041 Bacteria 2493
700 Ga0207639_10091010 3300026041 Bacteria 2441
701 Ga0207639_10104797 3300026041 Bacteria 2293
702 Ga0207639_10204153 3300026041 Bacteria 1697
703 Ga0207639_10561092 3300026041 Bacteria 1049
704 Ga0207639_10826218 3300026041 Bacteria 864
705 Ga0207678_10001029 3300026067 Bacteria 25450
706 Ga0207678_10004608 3300026067 Bacteria 12388
707 Ga0207678_10006051 3300026067 Bacteria 10762
708 Ga0207678_10008636 3300026067 Bacteria 8980
709 Ga0207678_10012868 3300026067 Bacteria 7344
710 Ga0207678_10015130 3300026067 Bacteria 6787
711 Ga0207678_10062629 3300026067 Bacteria 3196
712 Ga0207678_10075988 3300026067 Bacteria 2877
713 Ga0207678_10098920 3300026067 Bacteria 2492
714 Ga0207678_10124916 3300026067 Bacteria 2195
715 Ga0207678_10132187 3300026067 Bacteria 2129
716 Ga0207678_10136666 3300026067 Bacteria 2091
717 Ga0207678_10184578 3300026067 Bacteria 1781
718 Ga0207678_10187237 3300026067 Bacteria 1768
719 Ga0207678_10217518 3300026067 Bacteria 1635
720 Ga0207702_10000072 3300026078 Bacteria 113840
721 Ga0207702_10003186 3300026078 Bacteria 15168
722 Ga0207702_10012624 3300026078 Bacteria 7032
723 Ga0207702_10031079 3300026078 Bacteria 4451
724 Ga0207702_10117515 3300026078 Bacteria 2374
725 Ga0207702_10152810 3300026078 Bacteria 2101
726 Ga0207702_10192083 3300026078 Bacteria 1887
727 Ga0207702_11062396 3300026078 Bacteria 803
728 Ga0207641_10028994 3300026088 Bacteria 4576
729 Ga0207641_10051146 3300026088 Bacteria 3499
730 Ga0207641_10073928 3300026088 Bacteria 2938
731 Ga0207641_10164036 3300026088 Bacteria 2022
732 Ga0207641_11112913 3300026088 Bacteria 789
733 Ga0207641_11524385 3300026088 Bacteria 670
734 Ga0207648_10000104 3300026089 Bacteria 81717
735 Ga0207648_10024927 3300026089 Bacteria 5332
736 Ga0207648_10064282 3300026089 Bacteria 3198
737 Ga0207648_10107136 3300026089 Bacteria 2453
738 Ga0207648_10306487 3300026089 Bacteria 1425
739 Ga0207648_10340379 3300026089 Bacteria 1351
740 Ga0207676_10000604 3300026095 Bacteria 29483
741 Ga0207676_10012299 3300026095 Bacteria 6128
742 Ga0207676_10037542 3300026095 Bacteria 3692
743 Ga0207676_10104845 3300026095 Bacteria 2352
744 Ga0207676_10185516 3300026095 Bacteria 1825
745 Ga0207676_10187332 3300026095 Bacteria 1818
746 Ga0207674_10001488 3300026116 Bacteria 30251
747 Ga0207674_10001704 3300026116 Bacteria 28122
748 Ga0207674_10001949 3300026116 Bacteria 26188
749 Ga0207674_10007062 3300026116 Bacteria 13125
750 Ga0207674_10008119 3300026116 Bacteria 12167
751 Ga0207674_10008440 3300026116 Bacteria 11900
752 Ga0207674_10121022 3300026116 Bacteria 2585
753 Ga0207674_10356635 3300026116 Bacteria 1414
754 Ga0207674_10363311 3300026116 Bacteria 1399
755 Ga0207675_100070948 3300026118 Bacteria 3256
756 Ga0207675_100094525 3300026118 Bacteria 2812
757 Ga0207683_10005385 3300026121 Bacteria 10969
758 Ga0207683_10093361 3300026121 Bacteria 2682
759 Ga0207683_10216287 3300026121 Bacteria 1745
760 Ga0207698_10000955 3300026142 Bacteria 16786
761 Ga0207698_10005330 3300026142 Bacteria 7928
762 Ga0207698_10008234 3300026142 Bacteria 6579
763 Ga0207698_10010311 3300026142 Bacteria 5994
764 Ga0207698_10029176 3300026142 Bacteria 3946
765 Ga0207698_10051023 3300026142 Bacteria 3160
766 Ga0207698_10103704 3300026142 Bacteria 2364
767 Ga0207698_10162790 3300026142 Bacteria 1954
768 Ga0207698_10229481 3300026142 Bacteria 1684
769 Ga0207698_10237956 3300026142 Bacteria 1657
770 Ga0207698_10248672 3300026142 Bacteria 1625
771 Ga0207698_10344155 3300026142 Bacteria 1406
772 Ga0207698_10576682 3300026142 Bacteria 1106
773 Ga0207698_10755927 3300026142 Bacteria 971
774 Ga0207698_11107088 3300026142 Unclassified 805
775 Ga0207428_10322215 3300027907 Bacteria 1141
776 Ga0268266_10000133 3300028379 Bacteria 143210
777 Ga0268266_10015377 3300028379 Bacteria 6567
778 Ga0268266_10036640 3300028379 Bacteria 4176
779 Ga0268265_10118248 3300028380 Bacteria 2178
780 Ga0268265_10262901 3300028380 Bacteria 1535
781 Ga0268265_10340569 3300028380 Bacteria 1365
782 Ga0268264_10002210 3300028381 Bacteria 17265
783 Ga0268264_10036943 3300028381 Bacteria 4026
784 Ga0268264_10188033 3300028381 Bacteria 1880
785 Ga0268264_10493341 3300028381 Bacteria 1193
786 Ga0307408_100865659 3300031548 Bacteria 825
787 Ga0307405_10454740 3300031731 Bacteria 1016
788 Ga0307405_10677485 3300031731 Bacteria 851
789 Ga0307413_10075142 3300031824 Bacteria 2143
790 Ga0307413_10267342 3300031824 Bacteria 1278
791 Ga0307410_10006046 3300031852 Bacteria 6487
792 Ga0307407_10011566 3300031903 Bacteria 4206
793 Ga0307407_10096739 3300031903 Bacteria 1823
794 Ga0307412_10077860 3300031911 Bacteria 2282
795 Ga0307409_100054389 3300031995 Bacteria 3082
796 Ga0307409_100571863 3300031995 Bacteria 1113
797 Ga0307414_10117182 3300032004 Bacteria 2040
798 Ga0307411_10019818 3300032005 Bacteria 3895
799 Ga0307415_100010622 3300032126 Bacteria 5222
800 Ga0373938_0107045 3300034957 Bacteria 708
801 Ga0373928_0101491 3300035084 Unclassified 751
802 Ga0373949_0082624 3300035090 Bacteria 858
803 Ga0373941_0273105 3300035115 Bacteria 667
804 Ga0373960_0016983 3300035121 Bacteria 1879
805 Ga0373942_0065343 3300035207 Bacteria 1051
806 Ga0373962_0066387 3300035242 Bacteria 1070
807 Ga0373931_0019826 3300035691 Bacteria 3360
808 Ga0373931_0047795 3300035691 Bacteria 2266
809 Ga0373931_0355743 3300035691 Bacteria 918
810 Ga0373947_0456444 3300035725 Bacteria 866
811 Ga0395899_0000653 3300037312 Bacteria 35325
812 Ga0395899_0003881 3300037312 Bacteria 11781
813 Ga0395899_0028132 3300037312 Bacteria 4233
814 Ga0395899_0060988 3300037312 Bacteria 2778
815 Ga0395899_0138931 3300037312 Bacteria 1730
816 Ga0395899_0365164 3300037312 Unclassified 962
817 Ga0395899_0365643 3300037312 Bacteria 962
818 Ga0395899_0616814 3300037312 Bacteria 689
819 Ga0395900_0001018 3300037418 Bacteria 36138
820 Ga0395900_0002074 3300037418 Bacteria 22489
821 Ga0395900_0013920 3300037418 Bacteria 8210
822 Ga0395900_0016113 3300037418 Bacteria 7614
823 Ga0395900_0024158 3300037418 Bacteria 6222
824 Ga0395900_0031079 3300037418 Bacteria 5485
825 Ga0395900_0049062 3300037418 Bacteria 4349
826 Ga0395900_0053516 3300037418 Bacteria 4155
827 Ga0395900_0140123 3300037418 Bacteria 2477
828 Ga0395900_0146631 3300037418 Bacteria 2413
829 Ga0395900_0176284 3300037418 Bacteria 2174
830 Ga0395900_0407530 3300037418 Bacteria 1322
831 Ga0395900_0451867 3300037418 Bacteria 1241
832 Ga0395900_0696950 3300037418 Bacteria 949
833 Ga0395900_0836996 3300037418 Unclassified 846
834 Ga0395900_0896745 3300037418 Unclassified 810
835 Ga0395898_0000021 3300037466 Bacteria 393971
836 Ga0395898_0003817 3300037466 Bacteria 16688
837 Ga0395898_0008073 3300037466 Bacteria 11147
838 Ga0395898_0030398 3300037466 Bacteria 5404
839 Ga0395898_0048331 3300037466 Bacteria 4173
840 Ga0395898_0074734 3300037466 Bacteria 3273
841 Ga0395898_0087245 3300037466 Bacteria 3006
842 Ga0395898_0087738 3300037466 Bacteria 2997
843 Ga0395898_0374271 3300037466 Bacteria 1358
844 Ga0395898_0420772 3300037466 Bacteria 1273
845 Ga0395898_0452225 3300037466 Bacteria 1223
846 Ga0395905_0000006 3300037471 Bacteria 549428
847 Ga0395905_0000313 3300037471 Bacteria 70446
848 Ga0395905_0001726 3300037471 Bacteria 25585
849 Ga0395905_0001786 3300037471 Bacteria 24960
850 Ga0395905_0002356 3300037471 Bacteria 21049
851 Ga0395905_0014176 3300037471 Bacteria 7616
852 Ga0395905_0015296 3300037471 Bacteria 7295
853 Ga0395905_0026668 3300037471 Bacteria 5448
854 Ga0395905_0029495 3300037471 Bacteria 5168
855 Ga0395905_0035202 3300037471 Bacteria 4702
856 Ga0395905_0038143 3300037471 Bacteria 4507
857 Ga0395905_0044332 3300037471 Bacteria 4174
858 Ga0395905_0045727 3300037471 Bacteria 4105
859 Ga0395905_0045760 3300037471 Bacteria 4104
860 Ga0395905_0045762 3300037471 Bacteria 4104
861 Ga0395905_0056441 3300037471 Bacteria 3674
862 Ga0395905_0072954 3300037471 Bacteria 3217
863 Ga0395905_0113026 3300037471 Bacteria 2551
864 Ga0395905_0140988 3300037471 Bacteria 2267
865 Ga0395905_0257014 3300037471 Bacteria 1631
866 Ga0395905_0270157 3300037471 Bacteria 1586
867 Ga0395905_0286678 3300037471 Bacteria 1533
868 Ga0395905_0305332 3300037471 Bacteria 1479
869 Ga0395905_0328902 3300037471 Bacteria 1418
870 Ga0395905_0354284 3300037471 Bacteria 1360
871 Ga0395905_0555886 3300037471 Bacteria 1049
872 Ga0395905_0644562 3300037471 Bacteria 961
873 Ga0395905_0679815 3300037471 Bacteria 932
874 Ga0395905_1158607 3300037471 Bacteria 676
875 Ga0395905_1388387 3300037471 Unclassified 606
876 Ga0395901_0000696 3300038443 Bacteria 38377
877 Ga0395901_0005955 3300038443 Bacteria 12346
878 Ga0395901_0010261 3300038443 Bacteria 9488
879 Ga0395901_0027525 3300038443 Bacteria 5842
880 Ga0395901_0031893 3300038443 Bacteria 5433
881 Ga0395901_0052303 3300038443 Bacteria 4244
882 Ga0395901_0127441 3300038443 Bacteria 2675
883 Ga0395901_0189508 3300038443 Bacteria 2157
884 Ga0395901_0251721 3300038443 Bacteria 1840
885 Ga0395901_0259366 3300038443 Bacteria 1809
886 Ga0395901_0357261 3300038443 Bacteria 1507
887 Ga0395901_0364932 3300038443 Bacteria 1488
888 Ga0395901_0714612 3300038443 Bacteria 998
889 Ga0395901_0720897 3300038443 Bacteria 993
890 Ga0395901_1034590 3300038443 Bacteria 795
891 Ga0439448_0051411 3300042005 Bacteria 1349
892 Ga0450914_002566 3300042118 Bacteria 1309
893 Ga0450890_009009 3300042127 Bacteria 1276
894 Ga0450905_000260 3300042142 Bacteria 6210
895 Ga0450889_000079 3300042144 Bacteria 8828
896 Ga0439458_0130580 3300042157 Bacteria 665
897 Ga0439464_0015913 3300042439 Bacteria 2032
898 Ga0466972_0023001 3300044658 Bacteria 3101
899 Ga0466972_0032698 3300044658 Bacteria 2554
900 Ga0466965_0059513 3300044683 Bacteria 1907
901 Ga0466965_0145053 3300044683 Bacteria 1238
902 Ga0466965_0406041 3300044683 Unclassified 753
903 Ga0466966_0265883 3300044684 Bacteria 1032
904 Ga0466961_0022933 3300044693 Bacteria 4015
905 Ga0466961_0470036 3300044693 Bacteria 760
906 Ga0466961_0536307 3300044693 Bacteria 705
907 Ga0466963_0065761 3300044694 Bacteria 2431
908 Ga0466963_0303149 3300044694 Bacteria 1124
909 Ga0466963_0328099 3300044694 Bacteria 1077
910 Ga0466963_0973995 3300044694 Unclassified 597
911 Ga0466971_0161499 3300044719 Bacteria 1049
912 Ga0466971_0207089 3300044719 Bacteria 927
913 Ga0466968_0325280 3300044735 Unclassified 743
914 Ga0466970_0143886 3300044765 Bacteria 1314
915 Ga0466957_0211020 3300044842 Bacteria 1278
916 Ga0466957_0335489 3300044842 Bacteria 1023
917 Ga0466960_0029019 3300044901 Bacteria 2535
918 Ga0466960_0431729 3300044901 Unclassified 763
919 Ga0466959_0051885 3300045049 Bacteria 3005
920 Ga0466959_0277920 3300045049 Bacteria 1150
921 Ga0466959_0321504 3300045049 Unclassified 1058
922 Ga0466958_0051234 3300045836 Bacteria 2499
923 Ga0466958_0129631 3300045836 Bacteria 1583
924 Ga0466958_0186280 3300045836 Bacteria 1318
925 Ga0466967_0027766 3300045976 Bacteria 4712
926 Ga0466967_0064598 3300045976 Bacteria 3255
927 Ga0466967_0095322 3300045976 Bacteria 2712
928 Ga0466967_0097661 3300045976 Bacteria 2681
929 Ga0466967_0610296 3300045976 Bacteria 1077
930 Ga0466967_0925982 3300045976 Bacteria 867
931 Ga0466967_1252280 3300045976 Unclassified 739
932 Ga0495605_0110504 3300046474 Bacteria 1255
933 Ga0495663_0334817 3300046525 Bacteria 549
934 Ga0495654_0133143 3300046530 Bacteria 1114
935 Ga0495668_0008243 3300046616 Bacteria 6533
936 Ga0495668_0145482 3300046616 Bacteria 1297
937 Ga0495668_0242324 3300046616 Bacteria 987
938 Ga0495669_0000819 3300046684 Bacteria 13241
939 Ga0495669_0034923 3300046684 Bacteria 2218
940 Ga0495669_0126072 3300046684 Bacteria 1203
941 Ga0495669_0128142 3300046684 Bacteria 1193
942 Ga0495669_0146494 3300046684 Bacteria 1116
943 Ga0495670_0142664 3300046691 Bacteria 1253
944 Ga0495677_0073949 3300047445 Bacteria 1272
945 Ga0495677_0128201 3300047445 Bacteria 970
946 Ga0495593_0344914 3300047673 Unclassified 744
947 Ga0496100_0010000 3300048903 Bacteria 5355
948 Ga0496100_0393420 3300048903 Unclassified 1054
949 Ga0496100_1027000 3300048903 Unclassified 649
950 Ga0496101_0000345 3300048904 Bacteria 31342
951 Ga0496101_0102990 3300048904 Bacteria 2139
952 Ga0496101_0356598 3300048904 Bacteria 1150
953 Ga0496102_0040754 3300048905 Bacteria 4203
954 Ga0496102_0656999 3300048905 Unclassified 972
955 Ga0496103_0150044 3300048906 Bacteria 1493
956 Ga0496103_0177514 3300048906 Bacteria 1368
957 Ga0496104_0055551 3300048907 Bacteria 3744
958 Ga0496105_0018522 3300048908 Bacteria 5601
959 Ga0496106_0005731 3300048909 Bacteria 9190
960 Ga0496106_0380998 3300048909 Bacteria 1133
961 Ga0496107_0004816 3300048910 Bacteria 9162
962 Ga0496107_0362082 3300048910 Bacteria 1079
963 Ga0496107_0435151 3300048910 Bacteria 975
964 Ga0496107_0613710 3300048910 Bacteria 803
965 Ga0496108_0000615 3300048911 Bacteria 27935
966 Ga0496108_0095807 3300048911 Bacteria 2527
967 Ga0496108_0828366 3300048911 Bacteria 797
968 Ga0496109_0026802 3300048912 Bacteria 5141
969 Ga0496109_0031504 3300048912 Bacteria 4758
970 Ga0496109_0387404 3300048912 Bacteria 1320
971 Ga0496109_0664822 3300048912 Unclassified 979
972 Ga0496110_0000202 3300048913 Bacteria 37993
973 Ga0496110_0060246 3300048913 Bacteria 3347
974 Ga0496110_0799434 3300048913 Bacteria 847
975 Ga0496111_0019071 3300048914 Bacteria 4758
976 Ga0496111_0064436 3300048914 Bacteria 2658
977 Ga0496111_0197161 3300048914 Unclassified 1497
978 Ga0496111_0448770 3300048914 Bacteria 952
979 Ga0496111_0598858 3300048914 Unclassified 807
980 Ga0496111_0816368 3300048914 Unclassified 674
981 Ga0496112_0034107 3300048915 Bacteria 4951
982 Ga0496112_0047562 3300048915 Bacteria 4209
983 Ga0496112_0078076 3300048915 Bacteria 3274
984 Ga0496112_0085021 3300048915 Bacteria 3130
985 Ga0496112_0114618 3300048915 Bacteria 2665
986 Ga0496112_0137762 3300048915 Bacteria 2410
987 Ga0496112_0288471 3300048915 Bacteria 1587
988 Ga0496112_1082470 3300048915 Bacteria 720
989 Ga0496113_0002802 3300048916 Bacteria 10260
990 Ga0496113_0039805 3300048916 Bacteria 3461
991 Ga0496113_0093111 3300048916 Bacteria 2325
992 Ga0496113_0129142 3300048916 Bacteria 1982
993 Ga0496114_0000021 3300048917 Bacteria 227038
994 Ga0496114_0100447 3300048917 Bacteria 2469
995 Ga0496114_0227247 3300048917 Bacteria 1639
996 Ga0496115_0001985 3300048918 Bacteria 14608
997 Ga0501080_0068064 3300049742 Bacteria 3312
998 nmdc:mga08y16_595624_c1 3300050511 Bacteria 1115
999 nmdc:mga08x19_362143_c1 3300050514 Bacteria 1013
1000 nmdc:mga0a205_19624_c1 3300050515 Bacteria 6376
1001 Ga0495655_0006555 3300053083 Bacteria 2121
1002 Ga0587106_064392 3300059605 Bacteria 681
1003 Ga0587099_036858 3300059622 Unclassified 614
1004 Ga0466962_0181202 3300061719 Bacteria 1027
1005 Ga0466962_0189450 3300061719 Bacteria 1003
1006 Ga0496109_0474400
1007 JGI24736J21556_1017809
1008 JGI24741J21665_1031047
1009 JGI24740J21852_10004829
1010 JGI24740J21852_10047922
1011 JGI24740J21852_10049545
1012 JGI24739J22299_10002616
1013 JGI24739J22299_10046539
1014 JGI24739J22299_10073770
1015 JGI24739J22299_10098064
1016 JGI24737J22298_10000015
1017 JGI24737J22298_10003025
1018 JGI24737J22298_10071799
1019 JGI24737J22298_10073346
1020 JGI24737J22298_10075568
1021 JGI24743J22301_10010330
1022 JGI24735J21928_10026095
1023 JGI24735J21928_10034852
1024 JGI24738J21930_10004089
1025 JGI24738J21930_10013070
1026 JGI24742J22300_10011349
1027 Ga0070658_10000409
1028 Ga0070658_10016905
1029 Ga0070658_10030779
1030 Ga0070658_10057898
1031 Ga0070658_10085772
1032 Ga0070658_10132989
1033 Ga0070658_10209791
1034 Ga0070658_10211136
1035 Ga0070658_10269106
1036 Ga0070658_10356549
1037 Ga0070658_10718448
1038 Ga0070676_10183632
1039 Ga0070676_10195652
1040 Ga0070676_10580462
1041 Ga0070683_100015550
1042 Ga0070683_100019736
1043 Ga0070683_100427363
1044 Ga0070683_100508060
1045 Ga0070690_100020876
1046 Ga0070670_100005760
1047 Ga0070670_100017907
1048 Ga0070670_100022672
1049 Ga0070670_100028036
1050 Ga0070670_100032466
1051 Ga0070670_100043505
1052 Ga0070670_100092956
1053 Ga0070670_100489230
1054 Ga0070670_100684981
1055 Ga0070677_10076617
1056 Ga0070677_10378092
1057 Ga0068869_100086829
1058 Ga0068869_100111210
1059 Ga0068869_100279796
1060 Ga0070666_10003929
1061 Ga0070666_10011811
1062 Ga0070666_10058069
1063 Ga0070666_10217881
1064 Ga0070680_100000835
1065 Ga0070680_100013386
1066 Ga0070680_100034043
1067 Ga0070680_100211046
1068 Ga0070680_100259246
1069 Ga0070680_100296686
1070 Ga0070680_100387827
1071 Ga0070682_100144773
1072 Ga0070682_100556106
1073 Ga0068868_100009256
1074 Ga0068868_100208002
1075 Ga0068868_100262825
1076 Ga0070660_100000055
1077 Ga0070660_100001167
1078 Ga0070660_100014441
1079 Ga0070660_100014536
1080 Ga0070660_100016023
1081 Ga0070660_100024447
1082 Ga0070660_100031504
1083 Ga0070660_100057697
1084 Ga0070660_100062565
1085 Ga0070660_100081192
1086 Ga0070660_100158495
1087 Ga0070660_100218017
1088 Ga0070660_100222046
1089 Ga0070660_101603790
1090 Ga0070689_100073345
1091 Ga0070689_100102404
1092 Ga0070691_10001910
1093 Ga0070691_10463626
1094 Ga0070687_100165304
1095 Ga0070661_100000340
1096 Ga0070661_100035683
1097 Ga0070661_100039047
1098 Ga0070661_100044937
1099 Ga0070661_100046073
1100 Ga0070661_100103465
1101 Ga0070661_100119754
1102 Ga0070661_100120273
1103 Ga0070661_100132615
1104 Ga0070661_100243193
1105 Ga0070661_100311658
1106 Ga0070692_10122671
1107 Ga0070692_10212549
1108 Ga0070668_100001813
1109 Ga0070668_100019253
1110 Ga0070668_100291855
1111 Ga0070668_100550784
1112 Ga0070669_100003087
1113 Ga0070669_100023936
1114 Ga0070669_100050368
1115 Ga0070669_100059559
1116 Ga0070675_100040660
1117 Ga0070675_100049231
1118 Ga0070675_100373450
1119 Ga0070671_100002064
1120 Ga0070671_100002819
1121 Ga0070671_100004315
1122 Ga0070671_100070425
1123 Ga0070671_100195854
1124 Ga0070671_100229413
1125 Ga0070671_100272698
1126 Ga0070674_100046571
1127 Ga0070674_100085989
1128 Ga0070674_100104374
1129 Ga0070673_100000046
1130 Ga0070673_100009135
1131 Ga0070673_100104361
1132 Ga0070673_100367727
1133 Ga0070673_100442146
1134 Ga0070688_100364012
1135 Ga0070659_100000139
1136 Ga0070659_100000833
1137 Ga0070659_100018127
1138 Ga0070659_100054534
1139 Ga0070659_100082020
1140 Ga0070659_100101753
1141 Ga0070659_100156971
1142 Ga0070659_100196630
1143 Ga0070659_100202530
1144 Ga0070659_100428398
1145 Ga0070659_101095235
1146 Ga0070659_101403338
1147 Ga0070667_100007107
1148 Ga0070667_100045832
1149 Ga0070667_100046437
1150 Ga0070667_100084523
1151 Ga0070667_100371523
1152 Ga0070714_100038973
1153 Ga0070714_100048442
1154 Ga0070714_100110189
1155 Ga0070714_100451115
1156 Ga0070713_100232844
1157 Ga0070694_100033072
1158 Ga0070663_100000504
1159 Ga0070663_100038328
1160 Ga0070663_100051439
1161 Ga0070663_100110074
1162 Ga0070663_100183889
1163 Ga0070663_100263851
1164 Ga0070663_100322536
1165 Ga0070663_100382612
1166 Ga0070678_100001329
1167 Ga0070662_100000024
1168 Ga0070662_100000391
1169 Ga0070662_100024789
1170 Ga0070662_100036344
1171 Ga0070662_100048142
1172 Ga0070662_100064095
1173 Ga0070662_100089666
1174 Ga0070662_100096455
1175 Ga0070662_100101288
1176 Ga0070662_100146720
1177 Ga0070662_100179045
1178 Ga0070662_100361534
1179 Ga0070662_100473854
1180 Ga0070681_10031170
1181 Ga0070681_10206766
1182 Ga0070681_10269674
1183 Ga0070681_10495438
1184 Ga0068867_100003011
1185 Ga0068867_100020259
1186 Ga0068867_100237887
1187 Ga0068867_100624170
1188 Ga0068867_100735805
1189 Ga0068867_100957412
1190 Ga0070685_10146478
1191 Ga0070679_100058079
1192 Ga0070679_100123264
1193 Ga0070679_100156385
1194 Ga0070679_100246908
1195 Ga0070679_100297491
1196 Ga0070679_100481935
1197 Ga0070679_100895826
1198 Ga0070684_100012523
1199 Ga0070684_100037821
1200 Ga0070684_100416076
1201 Ga0070684_100550494
1202 Ga0070684_101021410
1203 Ga0070684_101063376
1204 Ga0070684_101068350
1205 Ga0068853_100000342
1206 Ga0068853_100023933
1207 Ga0068853_100048444
1208 Ga0068853_100050453
1209 Ga0068853_100105179
1210 Ga0068853_100127870
1211 Ga0068853_100144227
1212 Ga0068853_100158704
1213 Ga0068853_100245337
1214 Ga0068853_100330707
1215 Ga0070672_100011152
1216 Ga0070672_100019054
1217 Ga0070672_100023487
1218 Ga0070672_100057978
1219 Ga0070672_100251209
1220 Ga0070672_100387069
1221 Ga0070695_100052790
1222 Ga0070695_100349279
1223 Ga0070696_100004253
1224 Ga0070693_100002285
1225 Ga0070693_100003111
1226 Ga0070693_100013178
1227 Ga0070693_100638349
1228 Ga0070665_100000705
1229 Ga0070665_100008558
1230 Ga0070665_100013825
1231 Ga0070665_100014608
1232 Ga0070665_100121465
1233 Ga0070665_100135897
1234 Ga0068855_100001003
1235 Ga0068855_100066130
1236 Ga0068855_100088679
1237 Ga0068855_100118992
1238 Ga0068855_100184374
1239 Ga0068855_100222214
1240 Ga0068855_100449922
1241 Ga0068855_100527016
1242 Ga0068855_101423870
1243 Ga0070664_100000082
1244 Ga0070664_100009829
1245 Ga0070664_100011365
1246 Ga0070664_100014466
1247 Ga0070664_100015877
1248 Ga0070664_100020839
1249 Ga0070664_100044101
1250 Ga0070664_100075378
1251 Ga0070664_100089727
1252 Ga0070664_100136014
1253 Ga0070664_100139825
1254 Ga0070664_100190434
1255 Ga0070664_101202701
1256 Ga0068857_100011952
1257 Ga0068857_100040055
1258 Ga0068857_100049674
1259 Ga0068857_100096523
1260 Ga0068857_100171648
1261 Ga0068857_100185139
1262 Ga0068857_100243943
1263 Ga0068857_100316356
1264 Ga0068857_100496951
1265 Ga0068854_100005522
1266 Ga0068854_100014119
1267 Ga0068854_100014148
1268 Ga0068854_100015201
1269 Ga0068854_100025466
1270 Ga0068854_100044115
1271 Ga0068854_100087726
1272 Ga0068854_100156793
1273 Ga0068854_100230272
1274 Ga0068854_100294635
1275 Ga0068854_100637272
1276 Ga0068854_100863301
1277 Ga0068856_100000085
1278 Ga0068856_100039189
1279 Ga0068856_100084955
1280 Ga0068856_100148116
1281 Ga0068856_100905754
1282 Ga0070702_100239405
1283 Ga0068852_100000736
1284 Ga0068852_100001258
1285 Ga0068852_100064654
1286 Ga0068852_100130897
1287 Ga0068852_100135037
1288 Ga0068852_100169533
1289 Ga0068852_100197837
1290 Ga0068852_100244833
1291 Ga0068852_100292563
1292 Ga0068852_100449870
1293 Ga0068852_100630696
1294 Ga0068852_100865789
1295 Ga0068852_101955802
1296 Ga0068859_100020355
1297 Ga0068859_100622981
1298 Ga0068859_102107410
1299 Ga0068864_100051460
1300 Ga0068864_100080680
1301 Ga0068864_100087745
1302 Ga0068864_100194710
1303 Ga0068864_100280895
1304 Ga0068866_10146944
1305 Ga0068851_10005869
1306 Ga0068851_10034172
1307 Ga0068851_10045441
1308 Ga0068851_10097577
1309 Ga0068851_10136481
1310 Ga0068851_10156858
1311 Ga0068851_10185317
1312 Ga0068851_10228188
1313 Ga0068851_10499953
1314 Ga0068870_10052733
1315 Ga0068863_100023352
1316 Ga0068863_100207866
1317 Ga0068863_100213068
1318 Ga0068863_100423299
1319 Ga0068863_101247918
1320 Ga0068858_100001044
1321 Ga0068858_100012453
1322 Ga0068858_100036446
1323 Ga0068858_100115029
1324 Ga0068858_100236943
1325 Ga0068860_100007914
1326 Ga0068860_100013216
1327 Ga0068860_100024420
1328 Ga0068862_100127011
1329 Ga0068862_100216891
1330 Ga0068862_100304566
1331 Ga0068862_101429593
1332 Ga0081539_10030639
1333 Ga0075432_10243735
1334 Ga0070715_10231244
1335 Ga0097621_100276479
1336 Ga0097621_100327992
1337 Ga0097621_100861850
1338 Ga0097621_101587731
1339 Ga0068871_100024537
1340 Ga0068871_100749049
1341 Ga0075433_10030095
1342 Ga0075429_100155560
1343 Ga0075429_100668866
1344 Ga0068865_100011395
1345 Ga0068865_100145149
1346 Ga0075436_100414333
1347 Ga0097620_100020355
1348 Ga0097620_100622941
1349 Ga0097620_102107504
1350 Ga0105240_10010028
1351 Ga0105240_10314492
1352 Ga0105240_10387309
1353 Ga0105240_10437630
1354 Ga0111539_10030273
1355 Ga0105245_10004912
1356 Ga0105245_10115389
1357 Ga0105245_11068975
1358 Ga0105247_10694640
1359 Ga0114129_10748024
1360 Ga0105243_10199796
1361 Ga0105243_10200263
1362 Ga0105241_10025436
1363 Ga0105241_10130758
1364 Ga0105241_10132914
1365 Ga0105241_10600820
1366 Ga0105242_10070580
1367 Ga0105242_10344313
1368 Ga0105248_10000059
1369 Ga0105248_10011918
1370 Ga0105248_10013505
1371 Ga0105248_10167642
1372 Ga0105248_10240244
1373 Ga0105248_10250018
1374 Ga0105248_10546583
1375 Ga0105248_10831937
1376 Ga0105237_10038498
1377 Ga0105238_10001777
1378 Ga0105238_10006370
1379 Ga0105238_10040802
1380 Ga0105238_10099734
1381 Ga0105238_10158281
1382 Ga0105238_11200124
1383 Ga0105249_10036961
1384 Ga0105249_10078396
1385 Ga0105239_10177877
1386 Ga0105239_10257237
1387 Ga0105239_10689430
1388 Ga0105239_11351181
1389 Ga0105246_10110848
1390 Ga0105246_10477964
1391 Ga0157373_10002971
1392 Ga0157373_10012761
1393 Ga0157373_10037470
1394 Ga0157373_10037908
1395 Ga0157373_10134399
1396 Ga0157373_10238175
1397 Ga0157373_11069694
1398 Ga0157373_11094343
1399 Ga0157373_11105901
1400 Ga0157371_10002587
1401 Ga0157371_10003776
1402 Ga0157371_10052576
1403 Ga0157371_10096680
1404 Ga0157371_10214978
1405 Ga0157371_10237892
1406 Ga0157371_10255457
1407 Ga0157371_10276406
1408 Ga0157371_10296874
1409 Ga0157371_10313694
1410 Ga0157371_10345438
1411 Ga0157371_10547624
1412 Ga0157370_10030524
1413 Ga0157370_10032658
1414 Ga0157370_10039701
1415 Ga0157370_10065339
1416 Ga0157370_10147764
1417 Ga0157369_10000691
1418 Ga0157369_10052564
1419 Ga0157369_10098028
1420 Ga0157369_10163687
1421 Ga0157369_10211972
1422 Ga0157369_10306892
1423 Ga0157369_10347256
1424 Ga0157369_10453536
1425 Ga0157369_10640995
1426 Ga0157369_10753204
1427 Ga0157374_10138846
1428 Ga0157374_10461677
1429 Ga0157374_10502225
1430 Ga0157374_10794516
1431 Ga0157378_10001242
1432 Ga0157378_10582230
1433 Ga0163162_10052573
1434 Ga0163162_10119733
1435 Ga0163162_10146836
1436 Ga0163162_10541120
1437 Ga0157372_10004194
1438 Ga0157372_10031841
1439 Ga0157372_10248927
1440 Ga0157372_10351769
1441 Ga0157372_10850425
1442 Ga0157372_11064753
1443 Ga0157372_11523277
1444 Ga0157375_10007583
1445 Ga0157375_10166200
1446 Ga0157375_10459145
1447 Ga0157375_10658457
1448 Ga0157375_11016317
1449 Ga0163163_10000763
1450 Ga0163163_10011737
1451 Ga0163163_10964984
1452 Ga0157380_10405961
1453 Ga0157377_10079376
1454 Ga0157377_10209882
1455 Ga0157379_10102405
1456 Ga0157379_10124170
1457 Ga0157379_10557470
1458 Ga0157376_10127966
1459 Ga0206356_11371520
1460 Ga0206353_10844233
1461 Ga0207697_10000250
1462 Ga0207697_10075548
1463 Ga0207697_10172612
1464 Ga0207656_10002438
1465 Ga0207656_10038440
1466 Ga0207656_10160275
1467 Ga0207656_10168995
1468 Ga0207656_10200157
1469 Ga0207656_10220155
1470 Ga0207682_10020979
1471 Ga0207642_10003912
1472 Ga0207642_10088356
1473 Ga0207688_10003101
1474 Ga0207688_10008736
1475 Ga0207688_10454205
1476 Ga0207680_10000473
1477 Ga0207680_10115309
1478 Ga0207680_10246643
1479 Ga0207680_10261708
1480 Ga0207680_10308534
1481 Ga0207680_10348061
1482 Ga0207647_10000153
1483 Ga0207647_10000870
1484 Ga0207647_10003089
1485 Ga0207647_10007895
1486 Ga0207647_10018065
1487 Ga0207647_10027063
1488 Ga0207647_10091176
1489 Ga0207647_10183265
1490 Ga0207699_10629925
1491 Ga0207645_10001588
1492 Ga0207645_10005018
1493 Ga0207645_10538783
1494 Ga0207643_10151890
1495 Ga0207643_10212657
1496 Ga0207705_10000062
1497 Ga0207705_10001553
1498 Ga0207705_10003689
1499 Ga0207705_10009755
1500 Ga0207705_10019133
1501 Ga0207705_10019240
1502 Ga0207705_10048995
1503 Ga0207705_10101439
1504 Ga0207705_10117275
1505 Ga0207705_10129873
1506 Ga0207705_10335269
1507 Ga0207705_10378459
1508 Ga0207705_10893684
1509 Ga0207654_10071913
1510 Ga0207654_10436873
1511 Ga0207707_10315496
1512 Ga0207695_10002617
1513 Ga0207695_10318441
1514 Ga0207695_10559987
1515 Ga0207671_10071482
1516 Ga0207660_10001300
1517 Ga0207660_10022446
1518 Ga0207660_10038174
1519 Ga0207660_10228669
1520 Ga0207660_10335364
1521 Ga0207660_11120352
1522 Ga0207657_10000015
1523 Ga0207657_10000948
1524 Ga0207657_10001896
1525 Ga0207657_10003254
1526 Ga0207657_10003972
1527 Ga0207657_10005969
1528 Ga0207657_10011577
1529 Ga0207657_10012877
1530 Ga0207657_10025063
1531 Ga0207657_10057045
1532 Ga0207657_10064199
1533 Ga0207657_10075191
1534 Ga0207657_10121695
1535 Ga0207657_10184163
1536 Ga0207657_10220645
1537 Ga0207657_10288128
1538 Ga0207657_10407814
1539 Ga0207657_10412333
1540 Ga0207657_10544629
1541 Ga0207657_10640846
1542 Ga0207649_10003376
1543 Ga0207649_10004215
1544 Ga0207649_10007557
1545 Ga0207649_10010461
1546 Ga0207649_10083190
1547 Ga0207649_10131764
1548 Ga0207649_10287182
1549 Ga0207649_10298949
1550 Ga0207649_10300634
1551 Ga0207649_10302859
1552 Ga0207649_10321387
1553 Ga0207649_10390073
1554 Ga0207649_10476139
1555 Ga0207652_10096826
1556 Ga0207652_10152006
1557 Ga0207652_10217605
1558 Ga0207652_10499586
1559 Ga0207652_10751665
1560 Ga0207681_10003120
1561 Ga0207681_10015014
1562 Ga0207681_10035890
1563 Ga0207694_10019733
1564 Ga0207694_10026005
1565 Ga0207694_10032275
1566 Ga0207694_11280261
1567 Ga0207650_10014617
1568 Ga0207650_10024327
1569 Ga0207650_10042899
1570 Ga0207650_10047581
1571 Ga0207650_10071444
1572 Ga0207650_10117863
1573 Ga0207650_10165969
1574 Ga0207659_10038761
1575 Ga0207659_10116827
1576 Ga0207687_10482157
1577 Ga0207700_10262606
1578 Ga0207700_10629387
1579 Ga0207664_10112349
1580 Ga0207644_10001099
1581 Ga0207644_10012442
1582 Ga0207644_10037824
1583 Ga0207644_10043061
1584 Ga0207644_10157896
1585 Ga0207644_10233587
1586 Ga0207644_10233599
1587 Ga0207644_10255839
1588 Ga0207690_10000032
1589 Ga0207690_10004940
1590 Ga0207690_10007689
1591 Ga0207690_10011323
1592 Ga0207690_10021998
1593 Ga0207690_10087967
1594 Ga0207690_10221923
1595 Ga0207690_10225492
1596 Ga0207690_10330322
1597 Ga0207690_10463523
1598 Ga0207690_10540767
1599 Ga0207690_10768414
1600 Ga0207690_11041651
1601 Ga0207706_10000032
1602 Ga0207706_10000194
1603 Ga0207706_10002828
1604 Ga0207706_10007703
1605 Ga0207706_10008829
1606 Ga0207706_10020549
1607 Ga0207706_10050146
1608 Ga0207706_10056408
1609 Ga0207706_10076852
1610 Ga0207706_10123037
1611 Ga0207706_10138860
1612 Ga0207706_10458034
1613 Ga0207706_10463005
1614 Ga0207706_10528385
1615 Ga0207686_10180508
1616 Ga0207686_10218269
1617 Ga0207709_10107977
1618 Ga0207670_10083402
1619 Ga0207669_10019100
1620 Ga0207669_10021047
1621 Ga0207669_10130230
1622 Ga0207669_10238256
1623 Ga0207669_10375464
1624 Ga0207704_10527382
1625 Ga0207704_10941458
1626 Ga0207691_10000603
1627 Ga0207691_10022853
1628 Ga0207691_10066993
1629 Ga0207691_10082094
1630 Ga0207691_10155266
1631 Ga0207691_10204150
1632 Ga0207691_10376859
1633 Ga0207711_10000046
1634 Ga0207711_10001202
1635 Ga0207711_10113654
1636 Ga0207711_10599563
1637 Ga0207689_10000094
1638 Ga0207689_10021514
1639 Ga0207689_10177354
1640 Ga0207661_10000460
1641 Ga0207661_10020074
1642 Ga0207661_10142985
1643 Ga0207661_10559019
1644 Ga0207679_10000983
1645 Ga0207679_10003734
1646 Ga0207679_10023101
1647 Ga0207679_10028697
1648 Ga0207679_10044915
1649 Ga0207679_10114286
1650 Ga0207679_10124343
1651 Ga0207679_10141747
1652 Ga0207679_10257591
1653 Ga0207679_10501272
1654 Ga0207679_10612102
1655 Ga0207679_10862464
1656 Ga0207667_10002422
1657 Ga0207667_10018328
1658 Ga0207667_10032107
1659 Ga0207667_10074641
1660 Ga0207667_10140286
1661 Ga0207667_10310287
1662 Ga0207667_10412658
1663 Ga0207667_10510627
1664 Ga0207667_10526261
1665 Ga0207651_10003067
1666 Ga0207651_10320641
1667 Ga0207651_10429448
1668 Ga0207651_10538967
1669 Ga0207712_10016841
1670 Ga0207712_10093662
1671 Ga0207712_10104951
1672 Ga0207668_10000074
1673 Ga0207668_10075115
1674 Ga0207668_10130182
1675 Ga0207668_10308507
1676 Ga0207640_10008210
1677 Ga0207640_10025024
1678 Ga0207640_10030685
1679 Ga0207640_10062940
1680 Ga0207640_10067450
1681 Ga0207640_10088408
1682 Ga0207640_10101328
1683 Ga0207640_10159849
1684 Ga0207640_10222254
1685 Ga0207640_10232048
1686 Ga0207640_10813978
1687 Ga0207658_10010924
1688 Ga0207658_10050024
1689 Ga0207658_10061553
1690 Ga0207658_10108518
1691 Ga0207677_10301658
1692 Ga0207677_10559812
1693 Ga0207677_11286970
1694 Ga0207703_10010364
1695 Ga0207703_10012796
1696 Ga0207703_10026943
1697 Ga0207703_10049408
1698 Ga0207703_10114566
1699 Ga0207703_10348982
1700 Ga0207703_11432474
1701 Ga0207639_10002345
1702 Ga0207639_10038258
1703 Ga0207639_10054095
1704 Ga0207639_10086773
1705 Ga0207639_10091010
1706 Ga0207639_10104797
1707 Ga0207639_10204153
1708 Ga0207639_10561092
1709 Ga0207639_10826218
1710 Ga0207678_10001029
1711 Ga0207678_10004608
1712 Ga0207678_10006051
1713 Ga0207678_10008636
1714 Ga0207678_10012868
1715 Ga0207678_10015130
1716 Ga0207678_10062629
1717 Ga0207678_10075988
1718 Ga0207678_10098920
1719 Ga0207678_10124916
1720 Ga0207678_10132187
1721 Ga0207678_10136666
1722 Ga0207678_10184578
1723 Ga0207678_10187237
1724 Ga0207678_10217518
1725 Ga0207702_10000072
1726 Ga0207702_10003186
1727 Ga0207702_10012624
1728 Ga0207702_10031079
1729 Ga0207702_10117515
1730 Ga0207702_10152810
1731 Ga0207702_10192083
1732 Ga0207702_11062396
1733 Ga0207641_10028994
1734 Ga0207641_10051146
1735 Ga0207641_10073928
1736 Ga0207641_10164036
1737 Ga0207641_11112913
1738 Ga0207641_11524385
1739 Ga0207648_10000104
1740 Ga0207648_10024927
1741 Ga0207648_10064282
1742 Ga0207648_10107136
1743 Ga0207648_10306487
1744 Ga0207648_10340379
1745 Ga0207676_10000604
1746 Ga0207676_10012299
1747 Ga0207676_10037542
1748 Ga0207676_10104845
1749 Ga0207676_10185516
1750 Ga0207676_10187332
1751 Ga0207674_10001488
1752 Ga0207674_10001704
1753 Ga0207674_10001949
1754 Ga0207674_10007062
1755 Ga0207674_10008119
1756 Ga0207674_10008440
1757 Ga0207674_10121022
1758 Ga0207674_10356635
1759 Ga0207674_10363311
1760 Ga0207675_100070948
1761 Ga0207675_100094525
1762 Ga0207683_10005385
1763 Ga0207683_10093361
1764 Ga0207683_10216287
1765 Ga0207698_10000955
1766 Ga0207698_10005330
1767 Ga0207698_10008234
1768 Ga0207698_10010311
1769 Ga0207698_10029176
1770 Ga0207698_10051023
1771 Ga0207698_10103704
1772 Ga0207698_10162790
1773 Ga0207698_10229481
1774 Ga0207698_10237956
1775 Ga0207698_10248672
1776 Ga0207698_10344155
1777 Ga0207698_10576682
1778 Ga0207698_10755927
1779 Ga0207698_11107088
1780 Ga0207428_10322215
1781 Ga0268266_10000133
1782 Ga0268266_10015377
1783 Ga0268266_10036640
1784 Ga0268265_10118248
1785 Ga0268265_10262901
1786 Ga0268265_10340569
1787 Ga0268264_10002210
1788 Ga0268264_10036943
1789 Ga0268264_10188033
1790 Ga0268264_10493341
1791 Ga0307408_100865659
1792 Ga0307405_10454740
1793 Ga0307405_10677485
1794 Ga0307413_10075142
1795 Ga0307413_10267342
1796 Ga0307410_10006046
1797 Ga0307407_10011566
1798 Ga0307407_10096739
1799 Ga0307412_10077860
1800 Ga0307409_100054389
1801 Ga0307409_100571863
1802 Ga0307414_10117182
1803 Ga0307411_10019818
1804 Ga0307415_100010622
1805 Ga0373938_0107045
1806 Ga0373928_0101491
1807 Ga0373949_0082624
1808 Ga0373941_0273105
1809 Ga0373960_0016983
1810 Ga0373942_0065343
1811 Ga0373962_0066387
1812 Ga0373931_0019826
1813 Ga0373931_0047795
1814 Ga0373931_0355743
1815 Ga0373947_0456444
1816 Ga0395899_0000653
1817 Ga0395899_0003881
1818 Ga0395899_0028132
1819 Ga0395899_0060988
1820 Ga0395899_0138931
1821 Ga0395899_0365164
1822 Ga0395899_0365643
1823 Ga0395899_0616814
1824 Ga0395900_0001018
1825 Ga0395900_0002074
1826 Ga0395900_0013920
1827 Ga0395900_0016113
1828 Ga0395900_0024158
1829 Ga0395900_0031079
1830 Ga0395900_0049062
1831 Ga0395900_0053516
1832 Ga0395900_0140123
1833 Ga0395900_0146631
1834 Ga0395900_0176284
1835 Ga0395900_0407530
1836 Ga0395900_0451867
1837 Ga0395900_0696950
1838 Ga0395900_0836996
1839 Ga0395900_0896745
1840 Ga0395898_0000021
1841 Ga0395898_0003817
1842 Ga0395898_0008073
1843 Ga0395898_0030398
1844 Ga0395898_0048331
1845 Ga0395898_0074734
1846 Ga0395898_0087245
1847 Ga0395898_0087738
1848 Ga0395898_0374271
1849 Ga0395898_0420772
1850 Ga0395898_0452225
1851 Ga0395905_0000006
1852 Ga0395905_0000313
1853 Ga0395905_0001726
1854 Ga0395905_0001786
1855 Ga0395905_0002356
1856 Ga0395905_0014176
1857 Ga0395905_0015296
1858 Ga0395905_0026668
1859 Ga0395905_0029495
1860 Ga0395905_0035202
1861 Ga0395905_0038143
1862 Ga0395905_0044332
1863 Ga0395905_0045727
1864 Ga0395905_0045760
1865 Ga0395905_0045762
1866 Ga0395905_0056441
1867 Ga0395905_0072954
1868 Ga0395905_0113026
1869 Ga0395905_0140988
1870 Ga0395905_0257014
1871 Ga0395905_0270157
1872 Ga0395905_0286678
1873 Ga0395905_0305332
1874 Ga0395905_0328902
1875 Ga0395905_0354284
1876 Ga0395905_0555886
1877 Ga0395905_0644562
1878 Ga0395905_0679815
1879 Ga0395905_1158607
1880 Ga0395905_1388387
1881 Ga0395901_0000696
1882 Ga0395901_0005955
1883 Ga0395901_0010261
1884 Ga0395901_0027525
1885 Ga0395901_0031893
1886 Ga0395901_0052303
1887 Ga0395901_0127441
1888 Ga0395901_0189508
1889 Ga0395901_0251721
1890 Ga0395901_0259366
1891 Ga0395901_0357261
1892 Ga0395901_0364932
1893 Ga0395901_0714612
1894 Ga0395901_0720897
1895 Ga0395901_1034590
1896 Ga0439448_0051411
1897 Ga0450914_002566
1898 Ga0450890_009009
1899 Ga0450905_000260
1900 Ga0450889_000079
1901 Ga0439458_0130580
1902 Ga0439464_0015913
1903 Ga0466972_0023001
1904 Ga0466972_0032698
1905 Ga0466965_0059513
1906 Ga0466965_0145053
1907 Ga0466965_0406041
1908 Ga0466966_0265883
1909 Ga0466961_0022933
1910 Ga0466961_0470036
1911 Ga0466961_0536307
1912 Ga0466963_0065761
1913 Ga0466963_0303149
1914 Ga0466963_0328099
1915 Ga0466963_0973995
1916 Ga0466971_0161499
1917 Ga0466971_0207089
1918 Ga0466968_0325280
1919 Ga0466970_0143886
1920 Ga0466957_0211020
1921 Ga0466957_0335489
1922 Ga0466960_0029019
1923 Ga0466960_0431729
1924 Ga0466959_0051885
1925 Ga0466959_0277920
1926 Ga0466959_0321504
1927 Ga0466958_0051234
1928 Ga0466958_0129631
1929 Ga0466958_0186280
1930 Ga0466967_0027766
1931 Ga0466967_0064598
1932 Ga0466967_0095322
1933 Ga0466967_0097661
1934 Ga0466967_0610296
1935 Ga0466967_0925982
1936 Ga0466967_1252280
1937 Ga0495605_0110504
1938 Ga0495663_0334817
1939 Ga0495654_0133143
1940 Ga0495668_0008243
1941 Ga0495668_0145482
1942 Ga0495668_0242324
1943 Ga0495669_0000819
1944 Ga0495669_0034923
1945 Ga0495669_0126072
1946 Ga0495669_0128142
1947 Ga0495669_0146494
1948 Ga0495670_0142664
1949 Ga0495677_0073949
1950 Ga0495677_0128201
1951 Ga0495593_0344914
1952 Ga0496100_0010000
1953 Ga0496100_0393420
1954 Ga0496100_1027000
1955 Ga0496101_0000345
1956 Ga0496101_0102990
1957 Ga0496101_0356598
1958 Ga0496102_0040754
1959 Ga0496102_0656999
1960 Ga0496103_0150044
1961 Ga0496103_0177514
1962 Ga0496104_0055551
1963 Ga0496105_0018522
1964 Ga0496106_0005731
1965 Ga0496106_0380998
1966 Ga0496107_0004816
1967 Ga0496107_0362082
1968 Ga0496107_0435151
1969 Ga0496107_0613710
1970 Ga0496108_0000615
1971 Ga0496108_0095807
1972 Ga0496108_0828366
1973 Ga0496109_0026802
1974 Ga0496109_0031504
1975 Ga0496109_0387404
1976 Ga0496109_0664822
1977 Ga0496110_0000202
1978 Ga0496110_0060246
1979 Ga0496110_0799434
1980 Ga0496111_0019071
1981 Ga0496111_0064436
1982 Ga0496111_0197161
1983 Ga0496111_0448770
1984 Ga0496111_0598858
1985 Ga0496111_0816368
1986 Ga0496112_0034107
1987 Ga0496112_0047562
1988 Ga0496112_0078076
1989 Ga0496112_0085021
1990 Ga0496112_0114618
1991 Ga0496112_0137762
1992 Ga0496112_0288471
1993 Ga0496112_1082470
1994 Ga0496113_0002802
1995 Ga0496113_0039805
1996 Ga0496113_0093111
1997 Ga0496113_0129142
1998 Ga0496114_0000021
1999 Ga0496114_0100447
2000 Ga0496114_0227247
2001 Ga0496115_0001985
2002 Ga0501080_0068064
2003 nmdc:mga08y16_595624_c1
2004 nmdc:mga08x19_362143_c1
2005 nmdc:mga0a205_19624_c1
2006 Ga0495655_0006555
2007 Ga0587106_064392
2008 Ga0587099_036858
2009 Ga0466962_0181202
2010 Ga0466962_0189450

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14559

TPR_19

Tetratricopeptide repeat

70

136

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.987 35 101
3kd7-assembly5.cif.gz_E designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) 0.985 36 131
2wqh-assembly1.cif.gz_A-2 crystal structure of ctpr3y3 0.9789 34 131
1na3-assembly2.cif.gz_B design of stable alpha-helical arrays from an idealized tpr motif 0.978 31 111
1na3-assembly1.cif.gz_A design of stable alpha-helical arrays from an idealized tpr motif 0.9729 31 111
ID Description Score Start End Superfamily
3kd7E00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.985 36 131 1.25.40.10
af_F1R498_263_378_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9845 33 131 1.25.40.10
3kd7D00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9837 34 131 1.25.40.10
af_Q9H6T3_265_381_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9821 33 131 1.25.40.10
af_I1KUC8_473_581_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9819 33 131 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A1H7Z8K4-F1-model_v4 Tfp pilus assembly protein PilF 0.9564 34 149 GO:0000030
GO:0030968
GO:0035269
AF-A0A0G4IZI4-F1-model_v4 RNA polymerase II-associated protein 3 0.9475 33 148 GO:0101031
AF-A0A3Q0IML8-F1-model_v4 DnaJ homolog subfamily C member 7 isoform X2 0.9452 33 147
AF-A0A2U1FYQ8-F1-model_v4 deleted 0.9379 30 148
AF-A0A446R8M8-F1-model_v4 deleted 0.9311 33 148

Map