F487836
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 999 | 450 | 789 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100008399|Ga0070670_1000083992 |
| Length | 270 |
| Sequence | MELRPWALLLGLSLLPGLALAAGKCERLVITGSPDTPPLLWRDPQDPTHLIGATADVLQQVTKDLGVKIDLLYGGNRSMALDEVRSGRMDIFADAPLNHAQLGNFDYIHPALVQTDYRVWTRTDSALVYASATDLQGFKGAASERARLSQGFETLAQHLTLQRFPSLTPAFQKLLLGEVDYVLAGRYSGMAMAQTLGMSNDLIARDTPVDQAGLHLAISHNSACNDPWLRGQLAKKMTELPGSGVTEAALQRNLERWKAQLQQPVGTPTQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 7 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 8 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 9 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 10 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 11 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 12 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 13 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 14 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 15 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 16 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 17 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 18 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 19 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 20 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 21 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 22 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 23 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 24 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 25 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 26 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 27 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 28 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 29 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 30 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 31 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 32 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 33 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 34 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 35 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 36 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 37 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 38 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 39 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 40 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 41 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 42 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 43 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 44 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 45 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 46 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 47 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 48 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 49 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 50 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 51 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 52 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 53 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 54 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 55 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 56 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 57 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 58 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 59 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 60 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 61 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 62 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 63 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 64 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 65 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 66 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 67 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 68 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 69 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 70 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 71 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 72 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 73 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 74 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 75 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 76 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 77 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 78 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 79 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 80 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 81 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 82 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 83 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 84 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 85 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 86 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 87 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 88 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 89 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 90 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 91 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 92 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 93 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 94 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 95 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 96 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 97 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 98 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 99 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 100 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 101 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 102 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 103 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 104 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 105 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 106 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 107 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 108 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 109 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 110 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 111 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 112 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 113 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 114 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 115 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 116 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 117 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 118 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 119 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 120 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 121 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 122 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 123 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 124 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 125 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 126 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 127 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 128 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 129 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 130 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 131 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 132 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 133 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 134 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 135 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 136 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 137 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 138 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 139 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 140 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 141 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 142 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 143 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 144 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 145 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 146 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 147 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 148 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 149 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 150 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 151 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 152 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 153 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 154 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 155 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 156 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 157 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 158 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 159 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 160 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 161 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 162 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 163 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 164 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 165 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 166 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 167 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 168 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 169 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 170 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 171 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 172 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 173 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 174 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 175 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 176 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 177 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 178 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 179 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 180 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 181 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 182 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 183 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 184 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 185 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 186 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 187 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 188 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 189 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 190 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 191 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 192 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 193 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 194 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 195 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 196 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 197 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 198 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 199 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 200 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 201 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 202 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 203 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 204 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 205 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 206 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 207 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 208 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 209 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 214 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 217 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 218 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 219 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 220 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 221 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 222 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 223 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 224 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 225 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 240 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 241 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 242 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 243 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 254 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 256 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 276 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 277 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 279 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 280 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 281 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 282 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 283 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 284 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 285 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 286 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 287 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 288 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 289 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 290 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 291 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 292 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 293 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 294 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 295 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 296 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 297 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 298 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 299 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 300 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 301 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 302 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 303 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 304 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 305 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 306 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 307 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 308 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 309 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 310 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 311 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 312 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 313 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 314 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 315 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 316 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 317 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 318 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 319 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 320 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 321 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 322 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 323 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 324 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 405 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 406 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 407 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 408 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 409 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 410 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 411 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 412 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 413 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 414 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 415 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 416 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 417 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 418 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 419 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 420 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 423 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 424 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 425 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 427 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 428 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 429 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 430 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 431 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 432 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 433 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 434 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 435 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 436 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 437 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 438 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 439 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 440 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 441 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 442 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 443 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 444 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 445 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 446 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 447 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 448 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 449 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 450 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.98 |
| Metatranscriptomes | 0 |
| Isolates | 21.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.31 |
| Nodule | 2.7 |
| Rhizoplane | 6.91 |
| Rhizosphere | 73.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_380 | 2124908027 | Bacteria | 6217 |
| 2 | SwRhRL2b_contig_113783 | 2162886007 | Bacteria | 2361 |
| 3 | JGI25162J39368_1000042 | 3300002737 | Bacteria | 173466 |
| 4 | JGI25162J39368_1000080 | 3300002737 | Bacteria | 113071 |
| 5 | JGI25154J39366_1005919 | 3300002738 | Bacteria | 1868 |
| 6 | JGI25163J39215_1000372 | 3300002771 | Bacteria | 14501 |
| 7 | JGI25163J39215_1000761 | 3300002771 | Bacteria | 8009 |
| 8 | JGI25164J39214_1000023 | 3300002772 | Bacteria | 165681 |
| 9 | JGI25164J39214_1000073 | 3300002772 | Bacteria | 98902 |
| 10 | JGI25165J46597_1000083 | 3300003214 | Bacteria | 173466 |
| 11 | JGI25165J46597_1000152 | 3300003214 | Bacteria | 113071 |
| 12 | Ga0055538_1000027 | 3300003751 | Bacteria | 216576 |
| 13 | Ga0055539_1000036 | 3300003752 | Bacteria | 216576 |
| 14 | Ga0055533_1000046 | 3300003756 | Bacteria | 216576 |
| 15 | Ga0055532_1000032 | 3300003758 | Bacteria | 216568 |
| 16 | Ga0055525_1000145 | 3300003759 | Bacteria | 98169 |
| 17 | Ga0055536_1000233 | 3300003781 | Bacteria | 44539 |
| 18 | Ga0055536_1000246 | 3300003781 | Bacteria | 43104 |
| 19 | Ga0055536_1000579 | 3300003781 | Bacteria | 24926 |
| 20 | Ga0055530_10000120 | 3300003791 | Bacteria | 67749 |
| 21 | Ga0055530_10000240 | 3300003791 | Bacteria | 49322 |
| 22 | Ga0055530_10001021 | 3300003791 | Bacteria | 22378 |
| 23 | Ga0055540_1000074 | 3300003792 | Bacteria | 116719 |
| 24 | Ga0055540_1000248 | 3300003792 | Bacteria | 49322 |
| 25 | Ga0055540_1000633 | 3300003792 | Bacteria | 24956 |
| 26 | Ga0055531_10000342 | 3300003794 | Bacteria | 45796 |
| 27 | Ga0055541_1000024 | 3300003841 | Bacteria | 216576 |
| 28 | Ga0065714_10002428 | 3300005288 | Bacteria | 23357 |
| 29 | Ga0065714_10003367 | 3300005288 | Bacteria | 11473 |
| 30 | Ga0065714_10007950 | 3300005288 | Bacteria | 2844 |
| 31 | Ga0065714_10017841 | 3300005288 | Bacteria | 2302 |
| 32 | Ga0065714_10020066 | 3300005288 | Bacteria | 1167 |
| 33 | Ga0065714_10077206 | 3300005288 | Bacteria | 2709 |
| 34 | Ga0065714_10085274 | 3300005288 | Bacteria | 2156 |
| 35 | Ga0065704_10070222 | 3300005289 | Bacteria | 63342 |
| 36 | Ga0065712_10001182 | 3300005290 | Bacteria | 6542 |
| 37 | Ga0065712_10009700 | 3300005290 | Bacteria | 2811 |
| 38 | Ga0070670_100008399 | 3300005331 | Bacteria | 8803 |
| 39 | Ga0070670_100009562 | 3300005331 | Bacteria | 8275 |
| 40 | Ga0070661_100000627 | 3300005344 | Bacteria | 26263 |
| 41 | Ga0070669_100017216 | 3300005353 | Bacteria | 5156 |
| 42 | Ga0070669_100021607 | 3300005353 | Bacteria | 4599 |
| 43 | Ga0070662_100000292 | 3300005457 | Bacteria | 29603 |
| 44 | Ga0068853_100009350 | 3300005539 | Bacteria | 7902 |
| 45 | Ga0070665_100060434 | 3300005548 | Bacteria | 3798 |
| 46 | Ga0070665_100226561 | 3300005548 | Bacteria | 1869 |
| 47 | Ga0070664_100000249 | 3300005564 | Bacteria | 38905 |
| 48 | Ga0068851_10000194 | 3300005834 | Bacteria | 29920 |
| 49 | Ga0075364_10171564 | 3300006051 | Bacteria | 1466 |
| 50 | Ga0075432_10010646 | 3300006058 | Bacteria | 3125 |
| 51 | Ga0075432_10012745 | 3300006058 | Bacteria | 2856 |
| 52 | Ga0075432_10017884 | 3300006058 | Bacteria | 2417 |
| 53 | Ga0075432_10019216 | 3300006058 | Bacteria | 2332 |
| 54 | Ga0075432_10080050 | 3300006058 | Bacteria | 1183 |
| 55 | Ga0075362_10067080 | 3300006177 | Bacteria | 1632 |
| 56 | Ga0075362_10084406 | 3300006177 | Bacteria | 1467 |
| 57 | Ga0075369_10112894 | 3300006186 | Bacteria | 1226 |
| 58 | Ga0075436_100074505 | 3300006914 | Bacteria | 2350 |
| 59 | Ga0075436_100134149 | 3300006914 | Bacteria | 1738 |
| 60 | Ga0079104_1000094 | 3300006946 | Bacteria | 130202 |
| 61 | Ga0079104_1000115 | 3300006946 | Bacteria | 115517 |
| 62 | Ga0079104_1013365 | 3300006946 | Bacteria | 2532 |
| 63 | Ga0099826_10011129 | 3300006948 | Bacteria | 6763 |
| 64 | Ga0105251_10000018 | 3300009011 | Bacteria | 142493 |
| 65 | Ga0105251_10001611 | 3300009011 | Bacteria | 19183 |
| 66 | Ga0105251_10002244 | 3300009011 | Bacteria | 15382 |
| 67 | Ga0105251_10002881 | 3300009011 | Bacteria | 12963 |
| 68 | Ga0105251_10004174 | 3300009011 | Bacteria | 10025 |
| 69 | Ga0105251_10029716 | 3300009011 | Bacteria | 2750 |
| 70 | Ga0105251_10055966 | 3300009011 | Bacteria | 1869 |
| 71 | Ga0105251_10114612 | 3300009011 | Bacteria | 1226 |
| 72 | Ga0105244_10004412 | 3300009036 | Bacteria | 9699 |
| 73 | Ga0105244_10026037 | 3300009036 | Bacteria | 3170 |
| 74 | Ga0105244_10033499 | 3300009036 | Bacteria | 2707 |
| 75 | Ga0105244_10033988 | 3300009036 | Bacteria | 2686 |
| 76 | Ga0105244_10112289 | 3300009036 | Bacteria | 1325 |
| 77 | Ga0105244_10179488 | 3300009036 | Bacteria | 1005 |
| 78 | Ga0105250_10009453 | 3300009092 | Bacteria | 4102 |
| 79 | Ga0105250_10010723 | 3300009092 | Bacteria | 3813 |
| 80 | Ga0105250_10013833 | 3300009092 | Bacteria | 3324 |
| 81 | Ga0105250_10016874 | 3300009092 | Bacteria | 2972 |
| 82 | Ga0105243_10000355 | 3300009148 | Bacteria | 48942 |
| 83 | Ga0105243_10115829 | 3300009148 | Bacteria | 2251 |
| 84 | Ga0105243_10140842 | 3300009148 | Bacteria | 2058 |
| 85 | Ga0105242_10000347 | 3300009176 | Bacteria | 37208 |
| 86 | Ga0105242_10327486 | 3300009176 | Bacteria | 1407 |
| 87 | Ga0105237_10000279 | 3300009545 | Bacteria | 71168 |
| 88 | Ga0105249_10522156 | 3300009553 | Bacteria | 1235 |
| 89 | Ga0105246_10005168 | 3300011119 | Bacteria | 7929 |
| 90 | Ga0105246_10022009 | 3300011119 | Bacteria | 4111 |
| 91 | Ga0157373_10009493 | 3300013100 | Bacteria | 7187 |
| 92 | Ga0157373_10019698 | 3300013100 | Bacteria | 4908 |
| 93 | Ga0157373_10068043 | 3300013100 | Bacteria | 2518 |
| 94 | Ga0157373_10069991 | 3300013100 | Bacteria | 2480 |
| 95 | Ga0157373_10089816 | 3300013100 | Bacteria | 2164 |
| 96 | Ga0157371_10003771 | 3300013102 | Bacteria | 13565 |
| 97 | Ga0157371_10011042 | 3300013102 | Bacteria | 6996 |
| 98 | Ga0157371_10070678 | 3300013102 | Bacteria | 2471 |
| 99 | Ga0157371_10274987 | 3300013102 | Bacteria | 1216 |
| 100 | Ga0157370_10021831 | 3300013104 | Bacteria | 6377 |
| 101 | Ga0157370_10051426 | 3300013104 | Bacteria | 3936 |
| 102 | Ga0157370_10128484 | 3300013104 | Bacteria | 2365 |
| 103 | Ga0157370_10180128 | 3300013104 | Bacteria | 1964 |
| 104 | Ga0157370_10376429 | 3300013104 | Bacteria | 1308 |
| 105 | Ga0157369_10032034 | 3300013105 | Bacteria | 5783 |
| 106 | Ga0157369_10147135 | 3300013105 | Bacteria | 2490 |
| 107 | Ga0163162_10000298 | 3300013306 | Bacteria | 45571 |
| 108 | Ga0157372_10001795 | 3300013307 | Bacteria | 23304 |
| 109 | Ga0157375_10142916 | 3300013308 | Bacteria | 2521 |
| 110 | Ga0157375_10142969 | 3300013308 | Bacteria | 2521 |
| 111 | Ga0157375_10146625 | 3300013308 | Bacteria | 2491 |
| 112 | Ga0182008_10001585 | 3300014497 | Bacteria | 15142 |
| 113 | Ga0182008_10005978 | 3300014497 | Bacteria | 6853 |
| 114 | Ga0182008_10037548 | 3300014497 | Bacteria | 2424 |
| 115 | Ga0182008_10040067 | 3300014497 | Bacteria | 2340 |
| 116 | Ga0182008_10216371 | 3300014497 | Bacteria | 979 |
| 117 | Ga0182006_1000648 | 3300015261 | Bacteria | 24701 |
| 118 | Ga0182006_1011183 | 3300015261 | Bacteria | 3962 |
| 119 | Ga0182006_1026114 | 3300015261 | Bacteria | 2394 |
| 120 | Ga0182006_1042720 | 3300015261 | Bacteria | 1774 |
| 121 | Ga0182006_1083250 | 3300015261 | Bacteria | 1164 |
| 122 | Ga0182007_10000381 | 3300015262 | Bacteria | 27915 |
| 123 | Ga0182007_10006996 | 3300015262 | Bacteria | 4785 |
| 124 | Ga0182005_1000394 | 3300015265 | Bacteria | 23798 |
| 125 | Ga0182005_1012188 | 3300015265 | Bacteria | 2434 |
| 126 | Ga0182005_1023554 | 3300015265 | Bacteria | 1682 |
| 127 | Ga0182005_1037233 | 3300015265 | Bacteria | 1323 |
| 128 | Ga0182005_1053759 | 3300015265 | Bacteria | 1096 |
| 129 | Ga0163161_10007368 | 3300017792 | Bacteria | 7596 |
| 130 | Ga0163161_10012000 | 3300017792 | Bacteria | 6011 |
| 131 | Ga0163161_10058743 | 3300017792 | Bacteria | 2796 |
| 132 | Ga0163161_10072891 | 3300017792 | Bacteria | 2515 |
| 133 | Ga0163161_10085338 | 3300017792 | Bacteria | 2329 |
| 134 | Ga0163161_10221423 | 3300017792 | Bacteria | 1465 |
| 135 | Ga0163161_10480608 | 3300017792 | Bacteria | 1009 |
| 136 | Ga0163161_10650166 | 3300017792 | Bacteria | 874 |
| 137 | Ga0209760_100114 | 3300025207 | Bacteria | 57573 |
| 138 | Ga0209760_100200 | 3300025207 | Bacteria | 28448 |
| 139 | Ga0209784_100017 | 3300025224 | Bacteria | 472003 |
| 140 | Ga0209566_100014 | 3300025225 | Bacteria | 472003 |
| 141 | Ga0209674_100028 | 3300025226 | Bacteria | 472003 |
| 142 | Ga0209147_100038 | 3300025229 | Bacteria | 314497 |
| 143 | Ga0209563_100032 | 3300025230 | Bacteria | 472003 |
| 144 | Ga0209563_100888 | 3300025230 | Bacteria | 8857 |
| 145 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 146 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 147 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 148 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 149 | Ga0209437_104655 | 3300025233 | Bacteria | 2394 |
| 150 | Ga0209258_100212 | 3300025242 | Bacteria | 116067 |
| 151 | Ga0209646_1000266 | 3300025246 | Bacteria | 49739 |
| 152 | Ga0209677_100018 | 3300025253 | Bacteria | 472003 |
| 153 | Ga0209759_1012322 | 3300025256 | Bacteria | 2375 |
| 154 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 155 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 156 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 157 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 158 | Ga0209676_1000345 | 3300025292 | Bacteria | 88051 |
| 159 | Ga0209676_1001648 | 3300025292 | Bacteria | 19583 |
| 160 | Ga0209050_1000081 | 3300025298 | Bacteria | 267533 |
| 161 | Ga0209050_1000162 | 3300025298 | Bacteria | 155309 |
| 162 | Ga0209050_1000227 | 3300025298 | Bacteria | 123743 |
| 163 | Ga0209050_1001348 | 3300025298 | Bacteria | 27074 |
| 164 | Ga0209051_1000104 | 3300025303 | Bacteria | 161001 |
| 165 | Ga0209051_1000121 | 3300025303 | Bacteria | 146477 |
| 166 | Ga0209051_1000164 | 3300025303 | Bacteria | 124186 |
| 167 | Ga0209051_1014193 | 3300025303 | Bacteria | 3730 |
| 168 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 169 | Ga0209257_1006723 | 3300025304 | Bacteria | 7268 |
| 170 | Ga0207656_10000200 | 3300025321 | Bacteria | 21415 |
| 171 | Ga0207696_1000097 | 3300025711 | Bacteria | 175696 |
| 172 | Ga0207696_1000152 | 3300025711 | Bacteria | 119512 |
| 173 | Ga0207696_1000321 | 3300025711 | Bacteria | 51398 |
| 174 | Ga0207696_1001961 | 3300025711 | Bacteria | 10438 |
| 175 | Ga0207696_1002724 | 3300025711 | Bacteria | 8419 |
| 176 | Ga0207696_1014946 | 3300025711 | Bacteria | 2645 |
| 177 | Ga0207696_1022273 | 3300025711 | Bacteria | 2016 |
| 178 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 179 | Ga0207655_1000142 | 3300025728 | Bacteria | 137562 |
| 180 | Ga0207655_1000622 | 3300025728 | Bacteria | 42525 |
| 181 | Ga0207655_1000772 | 3300025728 | Bacteria | 35772 |
| 182 | Ga0207655_1003503 | 3300025728 | Bacteria | 11640 |
| 183 | Ga0207655_1027723 | 3300025728 | Bacteria | 2691 |
| 184 | Ga0207655_1032951 | 3300025728 | Bacteria | 2358 |
| 185 | Ga0207655_1036123 | 3300025728 | Bacteria | 2196 |
| 186 | Ga0207713_1000009 | 3300025735 | Bacteria | 551314 |
| 187 | Ga0207713_1000721 | 3300025735 | Bacteria | 30937 |
| 188 | Ga0207713_1001350 | 3300025735 | Bacteria | 20006 |
| 189 | Ga0207713_1001775 | 3300025735 | Bacteria | 16499 |
| 190 | Ga0207713_1003692 | 3300025735 | Bacteria | 10291 |
| 191 | Ga0207713_1003762 | 3300025735 | Bacteria | 10187 |
| 192 | Ga0207713_1009390 | 3300025735 | Bacteria | 5513 |
| 193 | Ga0207713_1009446 | 3300025735 | Bacteria | 5495 |
| 194 | Ga0207713_1014802 | 3300025735 | Bacteria | 4029 |
| 195 | Ga0207713_1018496 | 3300025735 | Bacteria | 3448 |
| 196 | Ga0207713_1030410 | 3300025735 | Bacteria | 2405 |
| 197 | Ga0207713_1033067 | 3300025735 | Bacteria | 2263 |
| 198 | Ga0207713_1099267 | 3300025735 | Bacteria | 1008 |
| 199 | Ga0207671_10000343 | 3300025914 | Bacteria | 68390 |
| 200 | Ga0207649_10000013 | 3300025920 | Bacteria | 255009 |
| 201 | Ga0207681_10000619 | 3300025923 | Bacteria | 23732 |
| 202 | Ga0207681_10011889 | 3300025923 | Bacteria | 5359 |
| 203 | Ga0207650_10000457 | 3300025925 | Bacteria | 34586 |
| 204 | Ga0207650_10000610 | 3300025925 | Bacteria | 28544 |
| 205 | Ga0207706_10000140 | 3300025933 | Bacteria | 78477 |
| 206 | Ga0207706_10004624 | 3300025933 | Bacteria | 12905 |
| 207 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 208 | Ga0207709_10000210 | 3300025935 | Bacteria | 75685 |
| 209 | Ga0207709_10245296 | 3300025935 | Bacteria | 1305 |
| 210 | Ga0207679_10000005 | 3300025945 | Bacteria | 525011 |
| 211 | Ga0207712_10318413 | 3300025961 | Bacteria | 1282 |
| 212 | Ga0207639_10000714 | 3300026041 | Bacteria | 22749 |
| 213 | Ga0207678_10230949 | 3300026067 | Bacteria | 1584 |
| 214 | Ga0209281_1000077 | 3300027111 | Bacteria | 262887 |
| 215 | Ga0209281_1000212 | 3300027111 | Bacteria | 130216 |
| 216 | Ga0209281_1002280 | 3300027111 | Bacteria | 8087 |
| 217 | Ga0209281_1020846 | 3300027111 | Bacteria | 1275 |
| 218 | Ga0207428_10034127 | 3300027907 | Bacteria | 4173 |
| 219 | Ga0207428_10084262 | 3300027907 | Bacteria | 2478 |
| 220 | Ga0207428_10101690 | 3300027907 | Bacteria | 2221 |
| 221 | Ga0207428_10105023 | 3300027907 | Bacteria | 2179 |
| 222 | Ga0268266_10014563 | 3300028379 | Bacteria | 6758 |
| 223 | Ga0307517_10092459 | 3300028786 | Bacteria | 2461 |
| 224 | Ga0307511_10038433 | 3300030521 | Bacteria | 4109 |
| 225 | Ga0316178_1165151 | 3300030735 | Bacteria | 5036 |
| 226 | Ga0316181_1160091 | 3300030744 | Bacteria | 4244 |
| 227 | Ga0307408_100003149 | 3300031548 | Bacteria | 11367 |
| 228 | Ga0307408_100160811 | 3300031548 | Bacteria | 1783 |
| 229 | Ga0307408_100420348 | 3300031548 | Bacteria | 1152 |
| 230 | Ga0307405_10002283 | 3300031731 | Bacteria | 8401 |
| 231 | Ga0307405_10008605 | 3300031731 | Bacteria | 5183 |
| 232 | Ga0307405_10162262 | 3300031731 | Bacteria | 1584 |
| 233 | Ga0307413_10020501 | 3300031824 | Bacteria | 3517 |
| 234 | Ga0307413_10171673 | 3300031824 | Bacteria | 1535 |
| 235 | Ga0307406_10023500 | 3300031901 | Bacteria | 3668 |
| 236 | Ga0307412_10001838 | 3300031911 | Bacteria | 11763 |
| 237 | Ga0307412_10008886 | 3300031911 | Bacteria | 5755 |
| 238 | Ga0307412_10028897 | 3300031911 | Bacteria | 3475 |
| 239 | Ga0307409_100126984 | 3300031995 | Bacteria | 2171 |
| 240 | Ga0307409_100546422 | 3300031995 | Bacteria | 1136 |
| 241 | Ga0307416_100256312 | 3300032002 | Bacteria | 1706 |
| 242 | Ga0307414_10096067 | 3300032004 | Bacteria | 2216 |
| 243 | Ga0307411_10026068 | 3300032005 | Bacteria | 3513 |
| 244 | Ga0307510_10000361 | 3300033180 | Bacteria | 42879 |
| 245 | Ga0237819_00664 | 3300038705 | Bacteria | 11188 |
| 246 | Ga0439438_002777 | 3300041405 | Bacteria | 7329 |
| 247 | Ga0439438_005048 | 3300041405 | Bacteria | 4921 |
| 248 | Ga0439438_012140 | 3300041405 | Bacteria | 2653 |
| 249 | Ga0439438_016637 | 3300041405 | Bacteria | 2136 |
| 250 | Ga0439438_053841 | 3300041405 | Bacteria | 1018 |
| 251 | Ga0439447_000211 | 3300041407 | Bacteria | 20579 |
| 252 | Ga0439447_002131 | 3300041407 | Bacteria | 7263 |
| 253 | Ga0439447_003217 | 3300041407 | Bacteria | 5816 |
| 254 | Ga0439447_006680 | 3300041407 | Bacteria | 3720 |
| 255 | Ga0439447_008087 | 3300041407 | Bacteria | 3280 |
| 256 | Ga0439447_013451 | 3300041407 | Bacteria | 2320 |
| 257 | Ga0439447_017022 | 3300041407 | Bacteria | 1985 |
| 258 | Ga0439466_0001699 | 3300041411 | Bacteria | 8595 |
| 259 | Ga0439466_0013843 | 3300041411 | Bacteria | 2947 |
| 260 | Ga0439466_0014054 | 3300041411 | Bacteria | 2921 |
| 261 | Ga0439466_0017878 | 3300041411 | Bacteria | 2549 |
| 262 | Ga0439465_0016959 | 3300041413 | Bacteria | 2273 |
| 263 | Ga0439431_0007447 | 3300041997 | Bacteria | 2441 |
| 264 | Ga0439445_0013932 | 3300042004 | Bacteria | 1952 |
| 265 | Ga0439432_000345 | 3300042006 | Bacteria | 16944 |
| 266 | Ga0439432_002044 | 3300042006 | Bacteria | 7632 |
| 267 | Ga0439432_022050 | 3300042006 | Bacteria | 2105 |
| 268 | Ga0439432_024206 | 3300042006 | Bacteria | 1996 |
| 269 | Ga0439432_052842 | 3300042006 | Bacteria | 1264 |
| 270 | Ga0439432_078328 | 3300042006 | Bacteria | 1003 |
| 271 | Ga0439451_002939 | 3300042009 | Bacteria | 3465 |
| 272 | Ga0439451_007175 | 3300042009 | Bacteria | 2275 |
| 273 | Ga0439451_010953 | 3300042009 | Bacteria | 1828 |
| 274 | Ga0439451_030333 | 3300042009 | Bacteria | 1087 |
| 275 | Ga0439452_000260 | 3300042010 | Bacteria | 35564 |
| 276 | Ga0439452_000369 | 3300042010 | Bacteria | 27281 |
| 277 | Ga0439452_002426 | 3300042010 | Bacteria | 6875 |
| 278 | Ga0439452_011706 | 3300042010 | Bacteria | 2512 |
| 279 | Ga0439452_015355 | 3300042010 | Bacteria | 2104 |
| 280 | Ga0439452_018057 | 3300042010 | Bacteria | 1885 |
| 281 | Ga0439452_021515 | 3300042010 | Bacteria | 1679 |
| 282 | Ga0439452_040714 | 3300042010 | Bacteria | 1095 |
| 283 | Ga0439456_000020 | 3300042013 | Bacteria | 60976 |
| 284 | Ga0439456_002240 | 3300042013 | Bacteria | 3894 |
| 285 | Ga0439456_005623 | 3300042013 | Bacteria | 2547 |
| 286 | Ga0439456_010385 | 3300042013 | Bacteria | 1923 |
| 287 | Ga0439456_038260 | 3300042013 | Bacteria | 1037 |
| 288 | Ga0439463_006180 | 3300042016 | Bacteria | 2970 |
| 289 | Ga0450911_002783 | 3300042115 | Bacteria | 3303 |
| 290 | Ga0450911_004090 | 3300042115 | Bacteria | 2441 |
| 291 | Ga0450911_004718 | 3300042115 | Bacteria | 2200 |
| 292 | Ga0450919_001084 | 3300042121 | Bacteria | 3541 |
| 293 | Ga0450919_002565 | 3300042121 | Bacteria | 2351 |
| 294 | Ga0450920_002530 | 3300042122 | Bacteria | 3117 |
| 295 | Ga0450922_000230 | 3300042124 | Bacteria | 6028 |
| 296 | Ga0450922_003980 | 3300042124 | Bacteria | 1358 |
| 297 | Ga0450890_000462 | 3300042127 | Bacteria | 5953 |
| 298 | Ga0450902_001942 | 3300042137 | Bacteria | 2882 |
| 299 | Ga0450902_002606 | 3300042137 | Bacteria | 2566 |
| 300 | Ga0450902_004206 | 3300042137 | Bacteria | 2135 |
| 301 | Ga0450902_025330 | 3300042137 | Bacteria | 990 |
| 302 | Ga0450903_006114 | 3300042138 | Bacteria | 2009 |
| 303 | Ga0450903_009006 | 3300042138 | Bacteria | 1630 |
| 304 | Ga0450903_012540 | 3300042138 | Bacteria | 1353 |
| 305 | Ga0450905_003581 | 3300042142 | Bacteria | 2042 |
| 306 | Ga0450906_003853 | 3300042145 | Bacteria | 3187 |
| 307 | Ga0450906_006196 | 3300042145 | Bacteria | 2422 |
| 308 | Ga0450906_006810 | 3300042145 | Bacteria | 2289 |
| 309 | Ga0450907_000091 | 3300042146 | Bacteria | 35679 |
| 310 | Ga0450907_009673 | 3300042146 | Bacteria | 1599 |
| 311 | Ga0450907_018419 | 3300042146 | Bacteria | 1168 |
| 312 | Ga0450910_006369 | 3300042147 | Bacteria | 1627 |
| 313 | Ga0439446_0010173 | 3300042156 | Bacteria | 2530 |
| 314 | Ga0439446_0037314 | 3300042156 | Bacteria | 1422 |
| 315 | Ga0450908_004255 | 3300042184 | Bacteria | 2765 |
| 316 | Ga0450909_000736 | 3300042185 | Bacteria | 4414 |
| 317 | Ga0450909_002924 | 3300042185 | Bacteria | 2425 |
| 318 | Ga0439434_0019081 | 3300042435 | Bacteria | 2056 |
| 319 | Ga0439464_0016259 | 3300042439 | Bacteria | 2010 |
| 320 | Ga0439460_0000623 | 3300042461 | Bacteria | 7816 |
| 321 | Ga0439460_0004129 | 3300042461 | Bacteria | 3530 |
| 322 | Ga0450918_003883 | 3300042531 | Bacteria | 2752 |
| 323 | Ga0450893_0027592 | 3300042532 | Bacteria | 1001 |
| 324 | Ga0439440_0007359 | 3300042993 | Bacteria | 2235 |
| 325 | Ga0439440_0027862 | 3300042993 | Bacteria | 1315 |
| 326 | Ga0439440_0027885 | 3300042993 | Bacteria | 1315 |
| 327 | Ga0495617_000364 | 3300046452 | Bacteria | 24979 |
| 328 | Ga0495617_004893 | 3300046452 | Bacteria | 4815 |
| 329 | Ga0495617_006203 | 3300046452 | Bacteria | 4207 |
| 330 | Ga0495617_011129 | 3300046452 | Bacteria | 3075 |
| 331 | Ga0495617_019300 | 3300046452 | Bacteria | 2305 |
| 332 | Ga0495617_033290 | 3300046452 | Bacteria | 1729 |
| 333 | Ga0495617_036969 | 3300046452 | Bacteria | 1636 |
| 334 | Ga0495617_052857 | 3300046452 | Bacteria | 1349 |
| 335 | Ga0495617_066684 | 3300046452 | Bacteria | 1185 |
| 336 | Ga0495627_000566 | 3300046453 | Bacteria | 30110 |
| 337 | Ga0495627_003622 | 3300046453 | Bacteria | 6721 |
| 338 | Ga0495627_018085 | 3300046453 | Bacteria | 2384 |
| 339 | Ga0495627_018425 | 3300046453 | Bacteria | 2354 |
| 340 | Ga0495627_019510 | 3300046453 | Bacteria | 2273 |
| 341 | Ga0495627_069838 | 3300046453 | Bacteria | 1027 |
| 342 | Ga0495603_0002139 | 3300046455 | Bacteria | 11624 |
| 343 | Ga0495603_0111872 | 3300046455 | Bacteria | 1592 |
| 344 | Ga0495590_0004085 | 3300046457 | Bacteria | 5917 |
| 345 | Ga0495590_0017315 | 3300046457 | Bacteria | 2594 |
| 346 | Ga0495590_0021767 | 3300046457 | Bacteria | 2270 |
| 347 | Ga0495590_0022648 | 3300046457 | Bacteria | 2221 |
| 348 | Ga0495590_0042034 | 3300046457 | Bacteria | 1593 |
| 349 | Ga0495591_000311 | 3300046458 | Bacteria | 44231 |
| 350 | Ga0495591_004686 | 3300046458 | Bacteria | 6569 |
| 351 | Ga0495591_017921 | 3300046458 | Bacteria | 2415 |
| 352 | Ga0495591_018412 | 3300046458 | Bacteria | 2369 |
| 353 | Ga0495591_020351 | 3300046458 | Bacteria | 2194 |
| 354 | Ga0495591_023799 | 3300046458 | Bacteria | 1954 |
| 355 | Ga0495591_031550 | 3300046458 | Bacteria | 1588 |
| 356 | Ga0495591_032037 | 3300046458 | Bacteria | 1569 |
| 357 | Ga0495591_050811 | 3300046458 | Bacteria | 1133 |
| 358 | Ga0495629_0083244 | 3300046459 | Bacteria | 2233 |
| 359 | Ga0495638_0001645 | 3300046460 | Bacteria | 19832 |
| 360 | Ga0495638_0006372 | 3300046460 | Bacteria | 8596 |
| 361 | Ga0495638_0009417 | 3300046460 | Bacteria | 6861 |
| 362 | Ga0495638_0013324 | 3300046460 | Bacteria | 5602 |
| 363 | Ga0495638_0016495 | 3300046460 | Bacteria | 4946 |
| 364 | Ga0495638_0022326 | 3300046460 | Bacteria | 4155 |
| 365 | Ga0495638_0036824 | 3300046460 | Bacteria | 3114 |
| 366 | Ga0495638_0057833 | 3300046460 | Bacteria | 2404 |
| 367 | Ga0495638_0059844 | 3300046460 | Bacteria | 2357 |
| 368 | Ga0495638_0089285 | 3300046460 | Bacteria | 1859 |
| 369 | Ga0495638_0195157 | 3300046460 | Bacteria | 1146 |
| 370 | Ga0495653_0042046 | 3300046463 | Bacteria | 3562 |
| 371 | Ga0495653_0237520 | 3300046463 | Bacteria | 1216 |
| 372 | Ga0495653_0274265 | 3300046463 | Bacteria | 1110 |
| 373 | Ga0495650_0004955 | 3300046471 | Bacteria | 8878 |
| 374 | Ga0495650_0008290 | 3300046471 | Bacteria | 6087 |
| 375 | Ga0495650_0029443 | 3300046471 | Bacteria | 2502 |
| 376 | Ga0495650_0043402 | 3300046471 | Bacteria | 1908 |
| 377 | Ga0495650_0142911 | 3300046471 | Bacteria | 864 |
| 378 | Ga0495582_0011175 | 3300046473 | Bacteria | 4945 |
| 379 | Ga0495605_0000464 | 3300046474 | Bacteria | 36246 |
| 380 | Ga0495605_0034473 | 3300046474 | Bacteria | 2562 |
| 381 | Ga0495605_0034666 | 3300046474 | Bacteria | 2555 |
| 382 | Ga0495605_0035876 | 3300046474 | Bacteria | 2503 |
| 383 | Ga0495605_0058365 | 3300046474 | Bacteria | 1855 |
| 384 | Ga0495605_0082376 | 3300046474 | Bacteria | 1503 |
| 385 | Ga0495605_0143964 | 3300046474 | Bacteria | 1067 |
| 386 | Ga0495605_0145234 | 3300046474 | Bacteria | 1061 |
| 387 | Ga0495639_0000126 | 3300046475 | Bacteria | 39275 |
| 388 | Ga0495639_0149700 | 3300046475 | Bacteria | 1125 |
| 389 | Ga0495639_0181761 | 3300046475 | Bacteria | 1024 |
| 390 | Ga0495584_0012814 | 3300046491 | Bacteria | 4278 |
| 391 | Ga0495584_0024517 | 3300046491 | Bacteria | 3059 |
| 392 | Ga0495584_0033055 | 3300046491 | Bacteria | 2616 |
| 393 | Ga0495584_0035561 | 3300046491 | Bacteria | 2517 |
| 394 | Ga0495584_0077702 | 3300046491 | Bacteria | 1669 |
| 395 | Ga0495584_0155476 | 3300046491 | Bacteria | 1162 |
| 396 | Ga0495584_0193946 | 3300046491 | Bacteria | 1032 |
| 397 | Ga0495584_0198951 | 3300046491 | Bacteria | 1018 |
| 398 | Ga0495585_0000731 | 3300046492 | Bacteria | 29294 |
| 399 | Ga0495585_0009157 | 3300046492 | Bacteria | 5958 |
| 400 | Ga0495585_0010143 | 3300046492 | Bacteria | 5626 |
| 401 | Ga0495585_0049777 | 3300046492 | Bacteria | 2325 |
| 402 | Ga0495585_0053129 | 3300046492 | Bacteria | 2242 |
| 403 | Ga0495585_0053263 | 3300046492 | Bacteria | 2239 |
| 404 | Ga0495585_0060099 | 3300046492 | Bacteria | 2092 |
| 405 | Ga0495585_0069803 | 3300046492 | Bacteria | 1917 |
| 406 | Ga0495585_0079685 | 3300046492 | Bacteria | 1776 |
| 407 | Ga0495585_0093000 | 3300046492 | Bacteria | 1622 |
| 408 | Ga0495594_0029492 | 3300046499 | Bacteria | 2965 |
| 409 | Ga0495594_0071648 | 3300046499 | Bacteria | 1927 |
| 410 | Ga0495596_0000158 | 3300046500 | Bacteria | 47438 |
| 411 | Ga0495596_0070917 | 3300046500 | Bacteria | 1353 |
| 412 | Ga0495596_0147041 | 3300046500 | Bacteria | 915 |
| 413 | Ga0495607_0001220 | 3300046501 | Bacteria | 23108 |
| 414 | Ga0495607_0008515 | 3300046501 | Bacteria | 7010 |
| 415 | Ga0495607_0009108 | 3300046501 | Bacteria | 6748 |
| 416 | Ga0495607_0012496 | 3300046501 | Bacteria | 5601 |
| 417 | Ga0495607_0046364 | 3300046501 | Bacteria | 2553 |
| 418 | Ga0495607_0047077 | 3300046501 | Bacteria | 2528 |
| 419 | Ga0495607_0051481 | 3300046501 | Bacteria | 2391 |
| 420 | Ga0495607_0054684 | 3300046501 | Bacteria | 2299 |
| 421 | Ga0495607_0067582 | 3300046501 | Bacteria | 2007 |
| 422 | Ga0495607_0072384 | 3300046501 | Bacteria | 1919 |
| 423 | Ga0495607_0075994 | 3300046501 | Bacteria | 1859 |
| 424 | Ga0495607_0103650 | 3300046501 | Bacteria | 1519 |
| 425 | Ga0495583_0032884 | 3300046506 | Bacteria | 2499 |
| 426 | Ga0495583_0033633 | 3300046506 | Bacteria | 2464 |
| 427 | Ga0495583_0128898 | 3300046506 | Bacteria | 1059 |
| 428 | Ga0495606_0006527 | 3300046507 | Bacteria | 10730 |
| 429 | Ga0495606_0014136 | 3300046507 | Bacteria | 6249 |
| 430 | Ga0495606_0024688 | 3300046507 | Bacteria | 4324 |
| 431 | Ga0495606_0055497 | 3300046507 | Bacteria | 2561 |
| 432 | Ga0495606_0060789 | 3300046507 | Bacteria | 2418 |
| 433 | Ga0495610_0008339 | 3300046512 | Bacteria | 6724 |
| 434 | Ga0495610_0014630 | 3300046512 | Bacteria | 4600 |
| 435 | Ga0495610_0036879 | 3300046512 | Bacteria | 2494 |
| 436 | Ga0495610_0039525 | 3300046512 | Bacteria | 2384 |
| 437 | Ga0495610_0039584 | 3300046512 | Bacteria | 2382 |
| 438 | Ga0495610_0092479 | 3300046512 | Bacteria | 1368 |
| 439 | Ga0495610_0121970 | 3300046512 | Bacteria | 1141 |
| 440 | Ga0495610_0124852 | 3300046512 | Bacteria | 1123 |
| 441 | Ga0495610_0129395 | 3300046512 | Bacteria | 1097 |
| 442 | Ga0495610_0146478 | 3300046512 | Bacteria | 1011 |
| 443 | Ga0495616_0000456 | 3300046513 | Bacteria | 31180 |
| 444 | Ga0495616_0012166 | 3300046513 | Bacteria | 4897 |
| 445 | Ga0495616_0015155 | 3300046513 | Bacteria | 4289 |
| 446 | Ga0495616_0043391 | 3300046513 | Bacteria | 2285 |
| 447 | Ga0495616_0044339 | 3300046513 | Bacteria | 2255 |
| 448 | Ga0495616_0049852 | 3300046513 | Bacteria | 2096 |
| 449 | Ga0495616_0146811 | 3300046513 | Bacteria | 1069 |
| 450 | Ga0495616_0149598 | 3300046513 | Bacteria | 1057 |
| 451 | Ga0495620_0004628 | 3300046515 | Bacteria | 7734 |
| 452 | Ga0495620_0010406 | 3300046515 | Bacteria | 4909 |
| 453 | Ga0495620_0025156 | 3300046515 | Bacteria | 2821 |
| 454 | Ga0495620_0033137 | 3300046515 | Bacteria | 2347 |
| 455 | Ga0495620_0034818 | 3300046515 | Bacteria | 2271 |
| 456 | Ga0495620_0088474 | 3300046515 | Bacteria | 1244 |
| 457 | Ga0495628_0193347 | 3300046516 | Bacteria | 1536 |
| 458 | Ga0495630_0012487 | 3300046517 | Bacteria | 6168 |
| 459 | Ga0495631_0000173 | 3300046518 | Bacteria | 43899 |
| 460 | Ga0495631_0006792 | 3300046518 | Bacteria | 5872 |
| 461 | Ga0495631_0006959 | 3300046518 | Bacteria | 5789 |
| 462 | Ga0495631_0032137 | 3300046518 | Bacteria | 2367 |
| 463 | Ga0495631_0062922 | 3300046518 | Bacteria | 1607 |
| 464 | Ga0495631_0148495 | 3300046518 | Bacteria | 1006 |
| 465 | Ga0495631_0165296 | 3300046518 | Bacteria | 949 |
| 466 | Ga0495632_0000427 | 3300046519 | Bacteria | 40066 |
| 467 | Ga0495632_0005144 | 3300046519 | Bacteria | 8731 |
| 468 | Ga0495632_0005190 | 3300046519 | Bacteria | 8686 |
| 469 | Ga0495632_0020071 | 3300046519 | Bacteria | 3627 |
| 470 | Ga0495632_0020584 | 3300046519 | Bacteria | 3568 |
| 471 | Ga0495632_0037048 | 3300046519 | Bacteria | 2478 |
| 472 | Ga0495632_0039979 | 3300046519 | Bacteria | 2364 |
| 473 | Ga0495632_0041174 | 3300046519 | Bacteria | 2322 |
| 474 | Ga0495632_0041919 | 3300046519 | Bacteria | 2297 |
| 475 | Ga0495632_0047694 | 3300046519 | Bacteria | 2123 |
| 476 | Ga0495632_0051408 | 3300046519 | Bacteria | 2029 |
| 477 | Ga0495632_0051723 | 3300046519 | Bacteria | 2021 |
| 478 | Ga0495632_0057419 | 3300046519 | Bacteria | 1899 |
| 479 | Ga0495632_0064272 | 3300046519 | Bacteria | 1775 |
| 480 | Ga0495632_0077040 | 3300046519 | Bacteria | 1594 |
| 481 | Ga0495632_0098901 | 3300046519 | Bacteria | 1376 |
| 482 | Ga0495632_0127005 | 3300046519 | Bacteria | 1188 |
| 483 | Ga0495637_0000228 | 3300046520 | Bacteria | 43608 |
| 484 | Ga0495637_0010815 | 3300046520 | Bacteria | 4399 |
| 485 | Ga0495637_0012084 | 3300046520 | Bacteria | 4135 |
| 486 | Ga0495637_0023417 | 3300046520 | Bacteria | 2807 |
| 487 | Ga0495637_0026080 | 3300046520 | Bacteria | 2628 |
| 488 | Ga0495637_0030403 | 3300046520 | Bacteria | 2396 |
| 489 | Ga0495637_0031187 | 3300046520 | Bacteria | 2359 |
| 490 | Ga0495637_0031571 | 3300046520 | Bacteria | 2341 |
| 491 | Ga0495637_0033844 | 3300046520 | Bacteria | 2241 |
| 492 | Ga0495637_0037686 | 3300046520 | Bacteria | 2097 |
| 493 | Ga0495637_0051574 | 3300046520 | Bacteria | 1721 |
| 494 | Ga0495637_0051769 | 3300046520 | Bacteria | 1716 |
| 495 | Ga0495643_0018488 | 3300046522 | Bacteria | 4048 |
| 496 | Ga0495643_0041904 | 3300046522 | Bacteria | 2495 |
| 497 | Ga0495643_0047318 | 3300046522 | Bacteria | 2329 |
| 498 | Ga0495643_0062338 | 3300046522 | Bacteria | 1974 |
| 499 | Ga0495643_0092879 | 3300046522 | Bacteria | 1554 |
| 500 | Ga0495644_0000263 | 3300046523 | Bacteria | 24138 |
| 501 | Ga0495644_0003427 | 3300046523 | Bacteria | 6276 |
| 502 | Ga0495644_0007693 | 3300046523 | Bacteria | 4154 |
| 503 | Ga0495644_0026376 | 3300046523 | Bacteria | 2205 |
| 504 | Ga0495644_0045490 | 3300046523 | Bacteria | 1651 |
| 505 | Ga0495644_0111029 | 3300046523 | Bacteria | 1040 |
| 506 | Ga0495648_0000330 | 3300046524 | Bacteria | 52286 |
| 507 | Ga0495648_0010552 | 3300046524 | Bacteria | 7023 |
| 508 | Ga0495648_0014300 | 3300046524 | Bacteria | 5818 |
| 509 | Ga0495648_0014408 | 3300046524 | Bacteria | 5789 |
| 510 | Ga0495648_0050867 | 3300046524 | Bacteria | 2528 |
| 511 | Ga0495648_0055177 | 3300046524 | Bacteria | 2396 |
| 512 | Ga0495648_0057960 | 3300046524 | Bacteria | 2319 |
| 513 | Ga0495648_0153126 | 3300046524 | Bacteria | 1200 |
| 514 | Ga0495666_0083334 | 3300046526 | Bacteria | 1511 |
| 515 | Ga0495666_0112594 | 3300046526 | Bacteria | 1277 |
| 516 | Ga0495642_0000230 | 3300046528 | Bacteria | 31990 |
| 517 | Ga0495642_0020713 | 3300046528 | Bacteria | 2584 |
| 518 | Ga0495642_0021576 | 3300046528 | Bacteria | 2533 |
| 519 | Ga0495654_0005559 | 3300046530 | Bacteria | 7299 |
| 520 | Ga0495654_0005639 | 3300046530 | Bacteria | 7240 |
| 521 | Ga0495654_0009777 | 3300046530 | Bacteria | 5243 |
| 522 | Ga0495654_0028554 | 3300046530 | Bacteria | 2852 |
| 523 | Ga0495654_0030401 | 3300046530 | Bacteria | 2748 |
| 524 | Ga0495654_0035550 | 3300046530 | Bacteria | 2507 |
| 525 | Ga0495654_0038136 | 3300046530 | Bacteria | 2405 |
| 526 | Ga0495654_0041762 | 3300046530 | Bacteria | 2279 |
| 527 | Ga0495654_0045923 | 3300046530 | Bacteria | 2153 |
| 528 | Ga0495654_0061452 | 3300046530 | Bacteria | 1803 |
| 529 | Ga0495654_0064574 | 3300046530 | Bacteria | 1749 |
| 530 | Ga0495654_0091559 | 3300046530 | Bacteria | 1410 |
| 531 | Ga0495654_0144181 | 3300046530 | Bacteria | 1058 |
| 532 | Ga0495586_0042579 | 3300046535 | Bacteria | 2445 |
| 533 | Ga0495587_0009787 | 3300046536 | Bacteria | 6126 |
| 534 | Ga0495587_0027521 | 3300046536 | Bacteria | 3461 |
| 535 | Ga0495609_0000558 | 3300046538 | Bacteria | 29364 |
| 536 | Ga0495609_0009321 | 3300046538 | Bacteria | 4755 |
| 537 | Ga0495609_0027600 | 3300046538 | Bacteria | 2593 |
| 538 | Ga0495609_0031071 | 3300046538 | Bacteria | 2429 |
| 539 | Ga0495609_0033331 | 3300046538 | Bacteria | 2338 |
| 540 | Ga0495609_0038753 | 3300046538 | Bacteria | 2147 |
| 541 | Ga0495609_0069762 | 3300046538 | Bacteria | 1545 |
| 542 | Ga0495609_0117406 | 3300046538 | Bacteria | 1145 |
| 543 | Ga0495597_0006879 | 3300046542 | Bacteria | 5838 |
| 544 | Ga0495597_0011910 | 3300046542 | Bacteria | 4206 |
| 545 | Ga0495597_0025461 | 3300046542 | Bacteria | 2723 |
| 546 | Ga0495597_0030943 | 3300046542 | Bacteria | 2437 |
| 547 | Ga0495597_0031941 | 3300046542 | Bacteria | 2392 |
| 548 | Ga0495597_0055168 | 3300046542 | Bacteria | 1743 |
| 549 | Ga0495597_0076953 | 3300046542 | Bacteria | 1430 |
| 550 | Ga0495597_0122675 | 3300046542 | Bacteria | 1082 |
| 551 | Ga0495622_0001469 | 3300046557 | Bacteria | 11845 |
| 552 | Ga0495622_0004298 | 3300046557 | Bacteria | 6632 |
| 553 | Ga0495622_0006301 | 3300046557 | Bacteria | 5509 |
| 554 | Ga0495622_0023025 | 3300046557 | Bacteria | 2903 |
| 555 | Ga0495622_0033120 | 3300046557 | Bacteria | 2412 |
| 556 | Ga0495633_0008368 | 3300046558 | Bacteria | 5836 |
| 557 | Ga0495656_0014942 | 3300046615 | Bacteria | 2920 |
| 558 | Ga0495668_0012891 | 3300046616 | Bacteria | 4949 |
| 559 | Ga0495668_0017547 | 3300046616 | Bacteria | 4149 |
| 560 | Ga0495668_0175663 | 3300046616 | Bacteria | 1173 |
| 561 | Ga0495634_0043051 | 3300046642 | Bacteria | 3061 |
| 562 | Ga0495611_0000355 | 3300046648 | Bacteria | 29951 |
| 563 | Ga0495611_0119780 | 3300046648 | Bacteria | 1227 |
| 564 | Ga0495611_0134168 | 3300046648 | Bacteria | 1155 |
| 565 | Ga0495625_0015972 | 3300046660 | Bacteria | 5922 |
| 566 | Ga0495625_0045098 | 3300046660 | Bacteria | 3189 |
| 567 | Ga0495625_0057291 | 3300046660 | Bacteria | 2772 |
| 568 | Ga0495625_0071664 | 3300046660 | Bacteria | 2432 |
| 569 | Ga0495625_0080452 | 3300046660 | Bacteria | 2269 |
| 570 | Ga0495635_0002382 | 3300046663 | Bacteria | 12802 |
| 571 | Ga0495635_0003528 | 3300046663 | Bacteria | 10822 |
| 572 | Ga0495659_0000468 | 3300046664 | Bacteria | 15048 |
| 573 | Ga0495661_0020091 | 3300046665 | Bacteria | 4367 |
| 574 | Ga0495661_0036064 | 3300046665 | Bacteria | 3099 |
| 575 | Ga0495661_0054952 | 3300046665 | Bacteria | 2389 |
| 576 | Ga0495661_0075465 | 3300046665 | Bacteria | 1959 |
| 577 | Ga0495661_0104795 | 3300046665 | Bacteria | 1585 |
| 578 | Ga0495661_0133245 | 3300046665 | Bacteria | 1359 |
| 579 | Ga0495588_0004408 | 3300046674 | Bacteria | 6218 |
| 580 | Ga0495588_0048602 | 3300046674 | Bacteria | 2179 |
| 581 | Ga0495588_0056486 | 3300046674 | Bacteria | 2027 |
| 582 | Ga0495657_0087236 | 3300046675 | Bacteria | 2008 |
| 583 | Ga0495623_0057376 | 3300046679 | Bacteria | 2449 |
| 584 | Ga0495646_0010200 | 3300046680 | Bacteria | 5973 |
| 585 | Ga0495669_0010984 | 3300046684 | Bacteria | 3834 |
| 586 | Ga0495669_0036043 | 3300046684 | Bacteria | 2185 |
| 587 | Ga0495613_0001979 | 3300046689 | Bacteria | 15554 |
| 588 | Ga0495613_0092226 | 3300046689 | Bacteria | 2193 |
| 589 | Ga0495624_0009404 | 3300046690 | Bacteria | 6771 |
| 590 | Ga0495670_0006310 | 3300046691 | Bacteria | 5822 |
| 591 | Ga0495670_0006336 | 3300046691 | Bacteria | 5812 |
| 592 | Ga0495670_0012400 | 3300046691 | Bacteria | 4190 |
| 593 | Ga0495670_0023283 | 3300046691 | Bacteria | 3057 |
| 594 | Ga0495670_0037601 | 3300046691 | Bacteria | 2412 |
| 595 | Ga0495670_0068211 | 3300046691 | Bacteria | 1796 |
| 596 | Ga0495670_0088772 | 3300046691 | Bacteria | 1580 |
| 597 | Ga0495671_0011783 | 3300046692 | Bacteria | 4792 |
| 598 | Ga0495671_0014700 | 3300046692 | Bacteria | 4206 |
| 599 | Ga0495671_0019126 | 3300046692 | Bacteria | 3624 |
| 600 | Ga0495671_0030860 | 3300046692 | Bacteria | 2742 |
| 601 | Ga0495671_0036366 | 3300046692 | Bacteria | 2494 |
| 602 | Ga0495671_0036385 | 3300046692 | Bacteria | 2493 |
| 603 | Ga0495671_0038266 | 3300046692 | Bacteria | 2424 |
| 604 | Ga0495671_0041772 | 3300046692 | Bacteria | 2307 |
| 605 | Ga0495671_0054151 | 3300046692 | Bacteria | 1989 |
| 606 | Ga0495671_0055953 | 3300046692 | Bacteria | 1953 |
| 607 | Ga0495671_0088566 | 3300046692 | Bacteria | 1515 |
| 608 | Ga0495671_0108233 | 3300046692 | Bacteria | 1357 |
| 609 | Ga0495671_0121954 | 3300046692 | Bacteria | 1271 |
| 610 | Ga0495671_0137699 | 3300046692 | Bacteria | 1190 |
| 611 | Ga0495671_0151128 | 3300046692 | Bacteria | 1130 |
| 612 | Ga0495649_0001671 | 3300046694 | Bacteria | 16475 |
| 613 | Ga0495649_0006623 | 3300046694 | Bacteria | 7199 |
| 614 | Ga0495649_0014802 | 3300046694 | Bacteria | 4457 |
| 615 | Ga0495649_0043997 | 3300046694 | Bacteria | 2437 |
| 616 | Ga0495649_0049666 | 3300046694 | Bacteria | 2278 |
| 617 | Ga0495649_0051795 | 3300046694 | Bacteria | 2225 |
| 618 | Ga0495649_0055951 | 3300046694 | Bacteria | 2130 |
| 619 | Ga0495649_0064181 | 3300046694 | Bacteria | 1972 |
| 620 | Ga0495649_0107469 | 3300046694 | Bacteria | 1480 |
| 621 | Ga0495589_0005113 | 3300046794 | Bacteria | 6940 |
| 622 | Ga0495589_0005201 | 3300046794 | Bacteria | 6883 |
| 623 | Ga0495589_0006828 | 3300046794 | Bacteria | 6001 |
| 624 | Ga0495589_0035101 | 3300046794 | Bacteria | 2515 |
| 625 | Ga0495589_0038432 | 3300046794 | Bacteria | 2395 |
| 626 | Ga0495589_0042552 | 3300046794 | Bacteria | 2263 |
| 627 | Ga0495589_0046978 | 3300046794 | Bacteria | 2140 |
| 628 | Ga0495600_0067995 | 3300046809 | Bacteria | 2328 |
| 629 | Ga0495660_0000599 | 3300046810 | Bacteria | 28455 |
| 630 | Ga0495660_0052062 | 3300046810 | Bacteria | 2226 |
| 631 | Ga0495660_0056765 | 3300046810 | Bacteria | 2114 |
| 632 | Ga0495660_0087999 | 3300046810 | Bacteria | 1619 |
| 633 | Ga0495660_0112082 | 3300046810 | Bacteria | 1390 |
| 634 | Ga0495660_0184313 | 3300046810 | Bacteria | 1007 |
| 635 | Ga0495581_0048449 | 3300047315 | Bacteria | 2454 |
| 636 | Ga0495604_0001530 | 3300047317 | Bacteria | 19039 |
| 637 | Ga0495604_0083241 | 3300047317 | Bacteria | 2391 |
| 638 | Ga0495604_0094517 | 3300047317 | Bacteria | 2209 |
| 639 | Ga0495636_0003818 | 3300047318 | Bacteria | 5869 |
| 640 | Ga0495636_0138033 | 3300047318 | Bacteria | 1087 |
| 641 | Ga0495636_0195964 | 3300047318 | Bacteria | 921 |
| 642 | Ga0495674_0112698 | 3300047319 | Bacteria | 2304 |
| 643 | Ga0495672_0009929 | 3300047320 | Bacteria | 6838 |
| 644 | Ga0495672_0010213 | 3300047320 | Bacteria | 6709 |
| 645 | Ga0495672_0010958 | 3300047320 | Bacteria | 6428 |
| 646 | Ga0495672_0011169 | 3300047320 | Bacteria | 6349 |
| 647 | Ga0495672_0012956 | 3300047320 | Bacteria | 5780 |
| 648 | Ga0495672_0020849 | 3300047320 | Bacteria | 4286 |
| 649 | Ga0495672_0024418 | 3300047320 | Bacteria | 3893 |
| 650 | Ga0495672_0031265 | 3300047320 | Bacteria | 3325 |
| 651 | Ga0495672_0068758 | 3300047320 | Bacteria | 2012 |
| 652 | Ga0495672_0069409 | 3300047320 | Bacteria | 2000 |
| 653 | Ga0495672_0075812 | 3300047320 | Bacteria | 1890 |
| 654 | Ga0495672_0123491 | 3300047320 | Bacteria | 1372 |
| 655 | Ga0495676_0101965 | 3300047321 | Bacteria | 2121 |
| 656 | Ga0495676_0122278 | 3300047321 | Bacteria | 1891 |
| 657 | Ga0495680_0216629 | 3300047322 | Bacteria | 1368 |
| 658 | Ga0495683_0005619 | 3300047323 | Bacteria | 6942 |
| 659 | Ga0495683_0021324 | 3300047323 | Bacteria | 3338 |
| 660 | Ga0495683_0040157 | 3300047323 | Bacteria | 2364 |
| 661 | Ga0495683_0063581 | 3300047323 | Bacteria | 1823 |
| 662 | Ga0495683_0064867 | 3300047323 | Bacteria | 1802 |
| 663 | Ga0495683_0114668 | 3300047323 | Bacteria | 1283 |
| 664 | Ga0495683_0176616 | 3300047323 | Bacteria | 978 |
| 665 | Ga0495687_005757 | 3300047443 | Bacteria | 7786 |
| 666 | Ga0495687_022403 | 3300047443 | Bacteria | 3032 |
| 667 | Ga0495687_030540 | 3300047443 | Bacteria | 2480 |
| 668 | Ga0495687_045587 | 3300047443 | Bacteria | 1897 |
| 669 | Ga0495675_0002521 | 3300047444 | Bacteria | 10970 |
| 670 | Ga0495677_0003786 | 3300047445 | Bacteria | 5849 |
| 671 | Ga0495679_017612 | 3300047446 | Bacteria | 2554 |
| 672 | Ga0495679_018778 | 3300047446 | Bacteria | 2444 |
| 673 | Ga0495679_031797 | 3300047446 | Bacteria | 1699 |
| 674 | Ga0495685_023507 | 3300047447 | Bacteria | 2122 |
| 675 | Ga0495685_057075 | 3300047447 | Bacteria | 1319 |
| 676 | Ga0495673_0000986 | 3300047469 | Bacteria | 25501 |
| 677 | Ga0495673_0001019 | 3300047469 | Bacteria | 24721 |
| 678 | Ga0495673_0012503 | 3300047469 | Bacteria | 4497 |
| 679 | Ga0495673_0015115 | 3300047469 | Bacteria | 3988 |
| 680 | Ga0495673_0019229 | 3300047469 | Bacteria | 3425 |
| 681 | Ga0495673_0027043 | 3300047469 | Bacteria | 2734 |
| 682 | Ga0495673_0029074 | 3300047469 | Bacteria | 2611 |
| 683 | Ga0495673_0029872 | 3300047469 | Bacteria | 2568 |
| 684 | Ga0495673_0031370 | 3300047469 | Bacteria | 2488 |
| 685 | Ga0495673_0038111 | 3300047469 | Bacteria | 2189 |
| 686 | Ga0495673_0115602 | 3300047469 | Bacteria | 1067 |
| 687 | Ga0495681_0001733 | 3300047470 | Bacteria | 16133 |
| 688 | Ga0495681_0002261 | 3300047470 | Bacteria | 13848 |
| 689 | Ga0495681_0002319 | 3300047470 | Bacteria | 13683 |
| 690 | Ga0495681_0010043 | 3300047470 | Bacteria | 5764 |
| 691 | Ga0495681_0017951 | 3300047470 | Bacteria | 3914 |
| 692 | Ga0495681_0021905 | 3300047470 | Bacteria | 3432 |
| 693 | Ga0495681_0038747 | 3300047470 | Bacteria | 2333 |
| 694 | Ga0495681_0043515 | 3300047470 | Bacteria | 2164 |
| 695 | Ga0495681_0060221 | 3300047470 | Bacteria | 1752 |
| 696 | Ga0495681_0084662 | 3300047470 | Bacteria | 1409 |
| 697 | Ga0495681_0094371 | 3300047470 | Bacteria | 1316 |
| 698 | Ga0495681_0099819 | 3300047470 | Bacteria | 1270 |
| 699 | Ga0495684_0053962 | 3300047471 | Bacteria | 3066 |
| 700 | Ga0495686_0017289 | 3300047472 | Bacteria | 4862 |
| 701 | Ga0495686_0048581 | 3300047472 | Bacteria | 2674 |
| 702 | Ga0495686_0057325 | 3300047472 | Bacteria | 2431 |
| 703 | Ga0495686_0065359 | 3300047472 | Bacteria | 2248 |
| 704 | Ga0495686_0209630 | 3300047472 | Bacteria | 1114 |
| 705 | Ga0495593_0041077 | 3300047673 | Bacteria | 2488 |
| 706 | Ga0495593_0055691 | 3300047673 | Bacteria | 2080 |
| 707 | Ga0495593_0123199 | 3300047673 | Bacteria | 1318 |
| 708 | Ga0495593_0174330 | 3300047673 | Bacteria | 1083 |
| 709 | Ga0495602_0021303 | 3300048088 | Bacteria | 6385 |
| 710 | Ga0495626_0000416 | 3300048091 | Bacteria | 43594 |
| 711 | Ga0495626_0001069 | 3300048091 | Bacteria | 23398 |
| 712 | Ga0495626_0002043 | 3300048091 | Bacteria | 14773 |
| 713 | Ga0495626_0002207 | 3300048091 | Bacteria | 13956 |
| 714 | Ga0495626_0007710 | 3300048091 | Bacteria | 5964 |
| 715 | Ga0495626_0031169 | 3300048091 | Bacteria | 2567 |
| 716 | Ga0495626_0072382 | 3300048091 | Bacteria | 1546 |
| 717 | Ga0495626_0116140 | 3300048091 | Bacteria | 1154 |
| 718 | Ga0495626_0120786 | 3300048091 | Bacteria | 1126 |
| 719 | Ga0495626_0137805 | 3300048091 | Bacteria | 1036 |
| 720 | Ga0496102_0000649 | 3300048905 | Bacteria | 35082 |
| 721 | Ga0496102_0223409 | 3300048905 | Bacteria | 1776 |
| 722 | Ga0496102_0556469 | 3300048905 | Bacteria | 1070 |
| 723 | Ga0496103_0079918 | 3300048906 | Bacteria | 2055 |
| 724 | Ga0496110_0113655 | 3300048913 | Bacteria | 2435 |
| 725 | Ga0496111_0226886 | 3300048914 | Bacteria | 1387 |
| 726 | Ga0496112_0458980 | 3300048915 | Bacteria | 1211 |
| 727 | Ga0496116_0000185 | 3300048919 | Bacteria | 123912 |
| 728 | Ga0496116_0003783 | 3300048919 | Bacteria | 14790 |
| 729 | Ga0496116_0008290 | 3300048919 | Bacteria | 9033 |
| 730 | Ga0496116_0022008 | 3300048919 | Bacteria | 4794 |
| 731 | Ga0496116_0065459 | 3300048919 | Bacteria | 2331 |
| 732 | Ga0496116_0190307 | 3300048919 | Bacteria | 1087 |
| 733 | Ga0496117_0004272 | 3300048920 | Bacteria | 15923 |
| 734 | Ga0496117_0024130 | 3300048920 | Bacteria | 4821 |
| 735 | Ga0496117_0062740 | 3300048920 | Bacteria | 2545 |
| 736 | Ga0496117_0071466 | 3300048920 | Bacteria | 2325 |
| 737 | Ga0496117_0082349 | 3300048920 | Bacteria | 2108 |
| 738 | Ga0496117_0092404 | 3300048920 | Bacteria | 1943 |
| 739 | Ga0496118_0015623 | 3300048921 | Bacteria | 7016 |
| 740 | Ga0496118_0020864 | 3300048921 | Bacteria | 5795 |
| 741 | Ga0496118_0028863 | 3300048921 | Bacteria | 4663 |
| 742 | Ga0496118_0063795 | 3300048921 | Bacteria | 2708 |
| 743 | Ga0496118_0148079 | 3300048921 | Bacteria | 1474 |
| 744 | Ga0496118_0239916 | 3300048921 | Bacteria | 1039 |
| 745 | Ga0496119_0082598 | 3300048922 | Bacteria | 1847 |
| 746 | Ga0496120_0047072 | 3300048923 | Bacteria | 2488 |
| 747 | Ga0496120_0056973 | 3300048923 | Bacteria | 2202 |
| 748 | Ga0496121_0001963 | 3300048924 | Bacteria | 32764 |
| 749 | Ga0496121_0061053 | 3300048924 | Bacteria | 3096 |
| 750 | Ga0496121_0149779 | 3300048924 | Bacteria | 1718 |
| 751 | Ga0496121_0371822 | 3300048924 | Bacteria | 945 |
| 752 | Ga0496122_0014568 | 3300048925 | Bacteria | 7590 |
| 753 | Ga0496122_0020247 | 3300048925 | Bacteria | 6023 |
| 754 | Ga0496122_0029988 | 3300048925 | Bacteria | 4569 |
| 755 | Ga0496122_0289820 | 3300048925 | Bacteria | 889 |
| 756 | Ga0496123_0022696 | 3300048926 | Bacteria | 4827 |
| 757 | Ga0496123_0159475 | 3300048926 | Bacteria | 1204 |
| 758 | Ga0496124_0013704 | 3300048927 | Bacteria | 7896 |
| 759 | Ga0496124_0066112 | 3300048927 | Bacteria | 3012 |
| 760 | Ga0496124_0098956 | 3300048927 | Bacteria | 2365 |
| 761 | Ga0496124_0104339 | 3300048927 | Bacteria | 2292 |
| 762 | Ga0496124_0153710 | 3300048927 | Bacteria | 1802 |
| 763 | Ga0496124_0172177 | 3300048927 | Bacteria | 1675 |
| 764 | Ga0496125_0000451 | 3300048928 | Bacteria | 74695 |
| 765 | Ga0496125_0014983 | 3300048928 | Bacteria | 7527 |
| 766 | Ga0496125_0073794 | 3300048928 | Bacteria | 2649 |
| 767 | Ga0496125_0083020 | 3300048928 | Bacteria | 2439 |
| 768 | Ga0496125_0105966 | 3300048928 | Bacteria | 2053 |
| 769 | Ga0496125_0153073 | 3300048928 | Bacteria | 1580 |
| 770 | Ga0496125_0182236 | 3300048928 | Bacteria | 1397 |
| 771 | Ga0496126_0161159 | 3300048929 | Bacteria | 1916 |
| 772 | Ga0496126_0411830 | 3300048929 | Bacteria | 1094 |
| 773 | Ga0495678_006332 | 3300049459 | Bacteria | 6313 |
| 774 | Ga0495678_021911 | 3300049459 | Bacteria | 2804 |
| 775 | Ga0495678_023876 | 3300049459 | Bacteria | 2649 |
| 776 | Ga0495678_087455 | 3300049459 | Bacteria | 1105 |
| 777 | Ga0495678_094727 | 3300049459 | Bacteria | 1045 |
| 778 | Ga0495678_113799 | 3300049459 | Bacteria | 918 |
| 779 | Ga0495682_0001023 | 3300049460 | Bacteria | 16581 |
| 780 | Ga0495682_0019588 | 3300049460 | Bacteria | 2543 |
| 781 | Ga0495682_0021588 | 3300049460 | Bacteria | 2411 |
| 782 | Ga0495682_0116906 | 3300049460 | Bacteria | 955 |
| 783 | Ga0501241_005473 | 3300049758 | Bacteria | 2365 |
| 784 | Ga0501269_002297 | 3300049766 | Bacteria | 2370 |
| 785 | nmdc:mga00v17_172740_c1 | 3300050491 | Bacteria | 1394 |
| 786 | nmdc:mga08x19_77137_c1 | 3300050514 | Bacteria | 2182 |
| 787 | nmdc:mga0sz30_22252_c1 | 3300050516 | Bacteria | 2571 |
| 788 | Ga0500572_002052 | 3300053111 | Bacteria | 5005 |
| 789 | Ga0500634_0168177 | 3300053161 | Bacteria | 1002 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009011 | Ga0105251_10055966 | Ga0105251_100559662 | 259 |
| 2 | 3300013102 | Ga0157371_10274987 | Ga0157371_102749872 | 259 |
| 3 | 3300048928 | Ga0496125_0182236 | Ga0496125_0182236_601_1386 | 261 |
| 4 | 3300048925 | Ga0496122_0289820 | Ga0496122_0289820_24_812 | 262 |
| 5 | 3300046538 | Ga0495609_0069762 | Ga0495609_0069762_728_1519 | 263 |
| 6 | 3300053161 | Ga0500634_0168177 | Ga0500634_0168177_23_838 | 263 |
| 7 | 3300046492 | Ga0495585_0000731 | Ga0495585_0000731_867_1661 | 264 |
| 8 | 3300048928 | Ga0496125_0014983 | Ga0496125_0014983_6470_7324 | 264 |
| 9 | iso_pu_bacteria | 3007419365 | 3007424327 | 264 |
| 10 | 3300046459 | Ga0495629_0083244 | Ga0495629_0083244_1283_2107 | 265 |
| 11 | 3300046473 | Ga0495582_0011175 | Ga0495582_0011175_4078_4902 | 265 |
| 12 | 3300046492 | Ga0495585_0009157 | Ga0495585_0009157_4937_5767 | 265 |
| 13 | 3300046517 | Ga0495630_0012487 | Ga0495630_0012487_5143_5967 | 265 |
| 14 | 3300046526 | Ga0495666_0112594 | Ga0495666_0112594_117_941 | 265 |
| 15 | 3300046535 | Ga0495586_0042579 | Ga0495586_0042579_1308_2132 | 265 |
| 16 | 3300046536 | Ga0495587_0009787 | Ga0495587_0009787_5014_5838 | 265 |
| 17 | 3300046663 | Ga0495635_0002382 | Ga0495635_0002382_11643_12467 | 265 |
| 18 | 3300046689 | Ga0495613_0001979 | Ga0495613_0001979_14716_15540 | 265 |
| 19 | 3300047317 | Ga0495604_0001530 | Ga0495604_0001530_832_1656 | 265 |
| 20 | 3300047322 | Ga0495680_0216629 | Ga0495680_0216629_338_1162 | 265 |
| 21 | 3300047444 | Ga0495675_0002521 | Ga0495675_0002521_9811_10635 | 265 |
| 22 | iso_pu_bacteria | 2511231156 | 2511826104 | 265 |
| 23 | iso_pu_bacteria | 2844665904 | 2844669305 | 265 |
| 24 | iso_pu_bacteria | 2908446538 | 2908451313 | 265 |
| 25 | iso_pu_bacteria | 2946006987 | 2946008200 | 265 |
| 26 | 3300046458 | Ga0495591_020351 | Ga0495591_020351_1366_2166 | 266 |
| 27 | 3300046471 | Ga0495650_0142911 | Ga0495650_0142911_51_851 | 266 |
| 28 | 3300046523 | Ga0495644_0026376 | Ga0495644_0026376_1374_2174 | 266 |
| 29 | iso_pu_bacteria | 8056131705 | 8056136123 | 266 |
| 30 | 3300014497 | Ga0182008_10040067 | Ga0182008_100400673 | 267 |
| 31 | 3300042013 | Ga0439456_000020 | Ga0439456_000020_4702_5526 | 267 |
| 32 | 3300046460 | Ga0495638_0009417 | Ga0495638_0009417_5707_6510 | 267 |
| 33 | 3300046460 | Ga0495638_0013324 | Ga0495638_0013324_4781_5584 | 267 |
| 34 | 3300046501 | Ga0495607_0072384 | Ga0495607_0072384_328_1152 | 267 |
| 35 | 3300046692 | Ga0495671_0137699 | Ga0495671_0137699_107_931 | 267 |
| 36 | 3300048927 | Ga0496124_0153710 | Ga0496124_0153710_742_1548 | 267 |
| 37 | 3300049460 | Ga0495682_0001023 | Ga0495682_0001023_15392_16198 | 267 |
| 38 | iso_pu_bacteria | 2511231021 | 2511357303 | 267 |
| 39 | iso_pu_bacteria | 2597489888 | 2597865422 | 267 |
| 40 | iso_pu_bacteria | 2597489889 | 2597871228 | 267 |
| 41 | iso_pu_bacteria | 2599185167 | 2599402053 | 267 |
| 42 | iso_pu_bacteria | 2599185179 | 2599454256 | 267 |
| 43 | iso_pu_bacteria | 2599185189 | 2599508445 | 267 |
| 44 | iso_pu_bacteria | 2599185190 | 2599512349 | 267 |
| 45 | iso_pu_bacteria | 2599185191 | 2599520452 | 267 |
| 46 | iso_pu_bacteria | 2599185288 | 2599884001 | 267 |
| 47 | iso_pu_bacteria | 2599185290 | 2599891025 | 267 |
| 48 | iso_pu_bacteria | 2599185303 | 2599947911 | 267 |
| 49 | iso_pu_bacteria | 2600255296 | 2601689381 | 267 |
| 50 | iso_pu_bacteria | 2619619299 | 2621298086 | 267 |
| 51 | iso_pu_bacteria | 2643221713 | 2644622205 | 267 |
| 52 | iso_pu_bacteria | 2675903420 | 2677900165 | 267 |
| 53 | iso_pu_bacteria | 2721755607 | 2723250133 | 267 |
| 54 | iso_pu_bacteria | 2738541265 | 2738671542 | 267 |
| 55 | iso_pu_bacteria | 2738541282 | 2738749936 | 267 |
| 56 | iso_pu_bacteria | 2738541294 | 2738808199 | 267 |
| 57 | iso_pu_bacteria | 2738541303 | 2738858976 | 267 |
| 58 | iso_pu_bacteria | 2738541309 | 2738895559 | 267 |
| 59 | iso_pu_bacteria | 2808606385 | 2808978076 | 267 |
| 60 | iso_pu_bacteria | 2808606388 | 2808993556 | 267 |
| 61 | iso_pu_bacteria | 2816332298 | 2817492775 | 267 |
| 62 | iso_pu_bacteria | 2834028612 | 2834031620 | 267 |
| 63 | iso_pu_bacteria | 2842826826 | 2842827413 | 267 |
| 64 | iso_pu_bacteria | 2842837860 | 2842842627 | 267 |
| 65 | iso_pu_bacteria | 2852612431 | 2852612855 | 267 |
| 66 | iso_pu_bacteria | 2852667396 | 2852669410 | 267 |
| 67 | iso_pu_bacteria | 2860867994 | 2860871864 | 267 |
| 68 | iso_pu_bacteria | 2912963787 | 2912965475 | 267 |
| 69 | iso_pu_bacteria | 2929189879 | 2929193943 | 267 |
| 70 | iso_pu_bacteria | 2931390751 | 2931395236 | 267 |
| 71 | iso_pu_bacteria | 2939651529 | 2939656180 | 267 |
| 72 | iso_pu_bacteria | 2945928738 | 2945932086 | 267 |
| 73 | iso_pu_bacteria | 2945961074 | 2945965292 | 267 |
| 74 | iso_pu_bacteria | 2947233263 | 2947239245 | 267 |
| 75 | iso_pu_bacteria | 8054285046 | 8054287089 | 267 |
| 76 | iso_pu_bacteria | 8054347763 | 8054350475 | 267 |
| 77 | iso_pu_bacteria | 8054503363 | 8054507733 | 267 |
| 78 | iso_pu_bacteria | 8055817908 | 8055822675 | 267 |
| 79 | iso_pu_bacteria | 8055878733 | 8055880420 | 267 |
| 80 | iso_pu_bacteria | 8056161164 | 8056162382 | 267 |
| 81 | 3300009011 | Ga0105251_10000018 | Ga0105251_1000001847 | 268 |
| 82 | 3300009011 | Ga0105251_10002244 | Ga0105251_1000224412 | 268 |
| 83 | 3300009011 | Ga0105251_10002881 | Ga0105251_100028812 | 268 |
| 84 | 3300009036 | Ga0105244_10026037 | Ga0105244_100260372 | 268 |
| 85 | 3300009092 | Ga0105250_10016874 | Ga0105250_100168744 | 268 |
| 86 | 3300025711 | Ga0207696_1000152 | Ga0207696_100015293 | 268 |
| 87 | 3300025728 | Ga0207655_1000005 | Ga0207655_1000005872 | 268 |
| 88 | 3300025735 | Ga0207713_1000009 | Ga0207713_1000009424 | 268 |
| 89 | 3300025735 | Ga0207713_1014802 | Ga0207713_10148024 | 268 |
| 90 | 3300025735 | Ga0207713_1030410 | Ga0207713_10304103 | 268 |
| 91 | 3300046513 | Ga0495616_0049852 | Ga0495616_0049852_1143_1949 | 268 |
| 92 | 3300046530 | Ga0495654_0144181 | Ga0495654_0144181_164_970 | 268 |
| 93 | 3300046542 | Ga0495597_0076953 | Ga0495597_0076953_290_1096 | 268 |
| 94 | 3300047320 | Ga0495672_0009929 | Ga0495672_0009929_164_970 | 268 |
| 95 | 3300047469 | Ga0495673_0015115 | Ga0495673_0015115_263_1069 | 268 |
| 96 | 3300049459 | Ga0495678_087455 | Ga0495678_087455_242_1048 | 268 |
| 97 | iso_pu_bacteria | 2511231007 | 2511274763 | 268 |
| 98 | 3300017792 | Ga0163161_10480608 | Ga0163161_104806081 | 269 |
| 99 | 3300017792 | Ga0163161_10650166 | Ga0163161_106501661 | 269 |
| 100 | 3300025728 | Ga0207655_1036123 | Ga0207655_10361232 | 269 |
| 101 | 3300025735 | Ga0207713_1099267 | Ga0207713_10992672 | 269 |
| 102 | 3300046458 | Ga0495591_032037 | Ga0495591_032037_636_1472 | 269 |
| 103 | 3300046506 | Ga0495583_0033633 | Ga0495583_0033633_126_962 | 269 |
| 104 | 3300046512 | Ga0495610_0014630 | Ga0495610_0014630_200_1036 | 269 |
| 105 | 3300046530 | Ga0495654_0030401 | Ga0495654_0030401_1710_2546 | 269 |
| 106 | 3300046557 | Ga0495622_0033120 | Ga0495622_0033120_205_1041 | 269 |
| 107 | 3300046674 | Ga0495588_0004408 | Ga0495588_0004408_4853_5689 | 269 |
| 108 | 3300046692 | Ga0495671_0030860 | Ga0495671_0030860_274_1110 | 269 |
| 109 | 3300046692 | Ga0495671_0054151 | Ga0495671_0054151_206_1042 | 269 |
| 110 | 3300046692 | Ga0495671_0108233 | Ga0495671_0108233_332_1177 | 269 |
| 111 | 3300046694 | Ga0495649_0014802 | Ga0495649_0014802_3584_4420 | 269 |
| 112 | 3300046810 | Ga0495660_0184313 | Ga0495660_0184313_179_988 | 269 |
| 113 | 3300047320 | Ga0495672_0069409 | Ga0495672_0069409_342_1178 | 269 |
| 114 | 3300047446 | Ga0495679_018778 | Ga0495679_018778_1465_2274 | 269 |
| 115 | 3300048091 | Ga0495626_0001069 | Ga0495626_0001069_22273_23109 | 269 |
| 116 | 3300048091 | Ga0495626_0002207 | Ga0495626_0002207_12385_13221 | 269 |
| 117 | 3300048905 | Ga0496102_0000649 | Ga0496102_0000649_192_1028 | 269 |
| 118 | 3300048905 | Ga0496102_0223409 | Ga0496102_0223409_760_1596 | 269 |
| 119 | 3300048920 | Ga0496117_0071466 | Ga0496117_0071466_1199_2035 | 269 |
| 120 | 3300048921 | Ga0496118_0063795 | Ga0496118_0063795_689_1525 | 269 |
| 121 | iso_pu_bacteria | 2511231011 | 2511294090 | 269 |
| 122 | iso_pu_bacteria | 2511231014 | 2511314177 | 269 |
| 123 | iso_pu_bacteria | 2511231023 | 2511371099 | 269 |
| 124 | iso_pu_bacteria | 2599185185 | 2599484025 | 269 |
| 125 | iso_pu_bacteria | 2713897148 | 2715751326 | 269 |
| 126 | iso_pu_bacteria | 2718217725 | 2718635263 | 269 |
| 127 | iso_pu_bacteria | 2773857673 | 2774132921 | 269 |
| 128 | iso_pu_bacteria | 2784132063 | 2784263216 | 269 |
| 129 | iso_pu_bacteria | 2818991456 | 2819655758 | 269 |
| 130 | iso_pu_bacteria | 2842832357 | 2842836619 | 269 |
| 131 | iso_pu_bacteria | 2842843487 | 2842844732 | 269 |
| 132 | iso_pu_bacteria | 2852657418 | 2852663026 | 269 |
| 133 | iso_pu_bacteria | 2880230671 | 2880234622 | 269 |
| 134 | iso_pu_bacteria | 2904518522 | 2904521239 | 269 |
| 135 | iso_pu_bacteria | 2919385768 | 2919388098 | 269 |
| 136 | iso_pu_bacteria | 2919487758 | 2919489716 | 269 |
| 137 | iso_pu_bacteria | 2969304461 | 2969308775 | 269 |
| 138 | iso_pu_bacteria | 2974289157 | 2974289841 | 269 |
| 139 | iso_pu_bacteria | 2998139840 | 2998144079 | 269 |
| 140 | iso_pu_bacteria | 3007614139 | 3007617872 | 269 |
| 141 | iso_pu_bacteria | 3007855910 | 3007858934 | 269 |
| 142 | iso_pu_bacteria | 3007861166 | 3007865510 | 269 |
| 143 | iso_pu_bacteria | 8029995093 | 8029996799 | 269 |
| 144 | iso_pu_bacteria | 8056166840 | 8056167203 | 269 |
| 145 | iso_pu_bacteria | 8056569372 | 8056572819 | 269 |
| 146 | 3300005331 | Ga0070670_100008399 | Ga0070670_1000083992 | 270 |
| 147 | 3300025925 | Ga0207650_10000610 | Ga0207650_1000061010 | 270 |
| 148 | 3300047673 | Ga0495593_0055691 | Ga0495593_0055691_67_879 | 270 |
| 149 | iso_pu_bacteria | 2511231006 | 2511266763 | 270 |
| 150 | iso_pu_bacteria | 2511231008 | 2511277717 | 270 |
| 151 | iso_pu_bacteria | 2512047018 | 2512329435 | 270 |
| 152 | iso_pu_bacteria | 2554235341 | 2555668799 | 270 |
| 153 | iso_pu_bacteria | 2582580891 | 2583791183 | 270 |
| 154 | iso_pu_bacteria | 2597489887 | 2597857001 | 270 |
| 155 | iso_pu_bacteria | 2599185160 | 2599357176 | 270 |
| 156 | iso_pu_bacteria | 2599185161 | 2599362037 | 270 |
| 157 | iso_pu_bacteria | 2599185162 | 2599368357 | 270 |
| 158 | iso_pu_bacteria | 2599185163 | 2599375146 | 270 |
| 159 | iso_pu_bacteria | 2599185164 | 2599382281 | 270 |
| 160 | iso_pu_bacteria | 2599185165 | 2599388728 | 270 |
| 161 | iso_pu_bacteria | 2599185166 | 2599394004 | 270 |
| 162 | iso_pu_bacteria | 2599185168 | 2599405769 | 270 |
| 163 | iso_pu_bacteria | 2599185181 | 2599464323 | 270 |
| 164 | iso_pu_bacteria | 2599185182 | 2599468643 | 270 |
| 165 | iso_pu_bacteria | 2599185186 | 2599493342 | 270 |
| 166 | iso_pu_bacteria | 2599185188 | 2599504347 | 270 |
| 167 | iso_pu_bacteria | 2599185212 | 2599615835 | 270 |
| 168 | iso_pu_bacteria | 2599185248 | 2599773012 | 270 |
| 169 | iso_pu_bacteria | 2599185257 | 2599801676 | 270 |
| 170 | iso_pu_bacteria | 2599185289 | 2599889379 | 270 |
| 171 | iso_pu_bacteria | 2599185291 | 2599900777 | 270 |
| 172 | iso_pu_bacteria | 2599185300 | 2599933392 | 270 |
| 173 | iso_pu_bacteria | 2599185302 | 2599944156 | 270 |
| 174 | iso_pu_bacteria | 2599185304 | 2599956374 | 270 |
| 175 | iso_pu_bacteria | 2599185305 | 2599963402 | 270 |
| 176 | iso_pu_bacteria | 2599185306 | 2599966532 | 270 |
| 177 | iso_pu_bacteria | 2599185308 | 2599977669 | 270 |
| 178 | iso_pu_bacteria | 2599185309 | 2599985068 | 270 |
| 179 | iso_pu_bacteria | 2599185310 | 2599989306 | 270 |
| 180 | iso_pu_bacteria | 2599185311 | 2599994220 | 270 |
| 181 | iso_pu_bacteria | 2599185312 | 2600000298 | 270 |
| 182 | iso_pu_bacteria | 2599185313 | 2600008160 | 270 |
| 183 | iso_pu_bacteria | 2599185314 | 2600011838 | 270 |
| 184 | iso_pu_bacteria | 2599185315 | 2600019347 | 270 |
| 185 | iso_pu_bacteria | 2599185316 | 2600025887 | 270 |
| 186 | iso_pu_bacteria | 2599185317 | 2600030684 | 270 |
| 187 | iso_pu_bacteria | 2599185318 | 2600037040 | 270 |
| 188 | iso_pu_bacteria | 2599185319 | 2600042464 | 270 |
| 189 | iso_pu_bacteria | 2599185320 | 2600049540 | 270 |
| 190 | iso_pu_bacteria | 2599185321 | 2600053857 | 270 |
| 191 | iso_pu_bacteria | 2599185322 | 2600062194 | 270 |
| 192 | iso_pu_bacteria | 2599185323 | 2600065626 | 270 |
| 193 | iso_pu_bacteria | 2599185324 | 2600070785 | 270 |
| 194 | iso_pu_bacteria | 2599185325 | 2600080024 | 270 |
| 195 | iso_pu_bacteria | 2599185356 | 2600216600 | 270 |
| 196 | iso_pu_bacteria | 2600254930 | 2600360491 | 270 |
| 197 | iso_pu_bacteria | 2600254931 | 2600365669 | 270 |
| 198 | iso_pu_bacteria | 2600255313 | 2601776807 | 270 |
| 199 | iso_pu_bacteria | 2643221650 | 2644286262 | 270 |
| 200 | iso_pu_bacteria | 2651869719 | 2652547959 | 270 |
| 201 | iso_pu_bacteria | 2667528170 | 2671093667 | 270 |
| 202 | iso_pu_bacteria | 2667528171 | 2671098676 | 270 |
| 203 | iso_pu_bacteria | 2667528176 | 2671130358 | 270 |
| 204 | iso_pu_bacteria | 2671180172 | 2671768625 | 270 |
| 205 | iso_pu_bacteria | 2675903515 | 2678264440 | 270 |
| 206 | iso_pu_bacteria | 2740892503 | 2743736418 | 270 |
| 207 | iso_pu_bacteria | 2744054620 | 2745004894 | 270 |
| 208 | iso_pu_bacteria | 2791355520 | 2794595971 | 270 |
| 209 | iso_pu_bacteria | 2808606361 | 2808856896 | 270 |
| 210 | iso_pu_bacteria | 2808606376 | 2808924270 | 270 |
| 211 | iso_pu_bacteria | 2808606377 | 2808930702 | 270 |
| 212 | iso_pu_bacteria | 2808606378 | 2808936967 | 270 |
| 213 | iso_pu_bacteria | 2808606380 | 2808946345 | 270 |
| 214 | iso_pu_bacteria | 2808606381 | 2808952824 | 270 |
| 215 | iso_pu_bacteria | 2808606383 | 2808965337 | 270 |
| 216 | iso_pu_bacteria | 2808606389 | 2809000175 | 270 |
| 217 | iso_pu_bacteria | 2818991464 | 2819703797 | 270 |
| 218 | iso_pu_bacteria | 2825651385 | 2825656618 | 270 |
| 219 | iso_pu_bacteria | 2842854478 | 2842859310 | 270 |
| 220 | iso_pu_bacteria | 2913036834 | 2913040917 | 270 |
| 221 | iso_pu_bacteria | 2917070673 | 2917072577 | 270 |
| 222 | iso_pu_bacteria | 2919481497 | 2919487284 | 270 |
| 223 | iso_pu_bacteria | 2923153595 | 2923155432 | 270 |
| 224 | iso_pu_bacteria | 2923586266 | 2923589954 | 270 |
| 225 | iso_pu_bacteria | 2929144301 | 2929148416 | 270 |
| 226 | iso_pu_bacteria | 2931369376 | 2931374168 | 270 |
| 227 | iso_pu_bacteria | 2935353572 | 2935354741 | 270 |
| 228 | iso_pu_bacteria | 2984286254 | 2984290592 | 270 |
| 229 | iso_pu_bacteria | 2988728565 | 2988730017 | 270 |
| 230 | iso_pu_bacteria | 3007395558 | 3007400982 | 270 |
| 231 | iso_pu_bacteria | 3007866637 | 3007868147 | 270 |
| 232 | iso_pu_bacteria | 637000220 | 637319160 | 270 |
| 233 | iso_pu_bacteria | 8015687852 | 8015689658 | 270 |
| 234 | iso_pu_bacteria | 8019769354 | 8019772748 | 270 |
| 235 | iso_pu_bacteria | 8055770955 | 8055772796 | 270 |
| 236 | iso_pu_bacteria | 8056143049 | 8056144956 | 270 |
| 237 | iso_pu_bacteria | 8057798959 | 8057799217 | 270 |
| 238 | 2162886007 | SwRhRL2b_contig_113783 | SwRhRL2b_0709.00007790 | 271 |
| 239 | 3300002738 | JGI25154J39366_1005919 | JGI25154J39366_10059193 | 271 |
| 240 | 3300003751 | Ga0055538_1000027 | Ga0055538_100002710 | 271 |
| 241 | 3300003752 | Ga0055539_1000036 | Ga0055539_100003610 | 271 |
| 242 | 3300003756 | Ga0055533_1000046 | Ga0055533_100004610 | 271 |
| 243 | 3300003758 | Ga0055532_1000032 | Ga0055532_100003210 | 271 |
| 244 | 3300003759 | Ga0055525_1000145 | Ga0055525_100014510 | 271 |
| 245 | 3300003841 | Ga0055541_1000024 | Ga0055541_100002410 | 271 |
| 246 | 3300005288 | Ga0065714_10017841 | Ga0065714_100178412 | 271 |
| 247 | 3300005288 | Ga0065714_10085274 | Ga0065714_100852743 | 271 |
| 248 | 3300005290 | Ga0065712_10009700 | Ga0065712_100097002 | 271 |
| 249 | 3300005331 | Ga0070670_100009562 | Ga0070670_10000956210 | 271 |
| 250 | 3300005344 | Ga0070661_100000627 | Ga0070661_1000006278 | 271 |
| 251 | 3300005353 | Ga0070669_100021607 | Ga0070669_1000216073 | 271 |
| 252 | 3300005457 | Ga0070662_100000292 | Ga0070662_10000029211 | 271 |
| 253 | 3300005539 | Ga0068853_100009350 | Ga0068853_1000093503 | 271 |
| 254 | 3300005548 | Ga0070665_100226561 | Ga0070665_1002265613 | 271 |
| 255 | 3300005564 | Ga0070664_100000249 | Ga0070664_1000002493 | 271 |
| 256 | 3300005834 | Ga0068851_10000194 | Ga0068851_1000019423 | 271 |
| 257 | 3300009011 | Ga0105251_10001611 | Ga0105251_100016113 | 271 |
| 258 | 3300009011 | Ga0105251_10004174 | Ga0105251_1000417411 | 271 |
| 259 | 3300009011 | Ga0105251_10029716 | Ga0105251_100297162 | 271 |
| 260 | 3300009011 | Ga0105251_10114612 | Ga0105251_101146121 | 271 |
| 261 | 3300009036 | Ga0105244_10033499 | Ga0105244_100334992 | 271 |
| 262 | 3300009036 | Ga0105244_10033988 | Ga0105244_100339882 | 271 |
| 263 | 3300009092 | Ga0105250_10009453 | Ga0105250_100094533 | 271 |
| 264 | 3300009092 | Ga0105250_10010723 | Ga0105250_100107234 | 271 |
| 265 | 3300009148 | Ga0105243_10115829 | Ga0105243_101158292 | 271 |
| 266 | 3300009148 | Ga0105243_10140842 | Ga0105243_101408422 | 271 |
| 267 | 3300009176 | Ga0105242_10000347 | Ga0105242_1000034739 | 271 |
| 268 | 3300009545 | Ga0105237_10000279 | Ga0105237_1000027963 | 271 |
| 269 | 3300011119 | Ga0105246_10022009 | Ga0105246_100220093 | 271 |
| 270 | 3300013100 | Ga0157373_10068043 | Ga0157373_100680431 | 271 |
| 271 | 3300013100 | Ga0157373_10069991 | Ga0157373_100699913 | 271 |
| 272 | 3300013104 | Ga0157370_10051426 | Ga0157370_100514263 | 271 |
| 273 | 3300013105 | Ga0157369_10147135 | Ga0157369_101471353 | 271 |
| 274 | 3300013308 | Ga0157375_10142916 | Ga0157375_101429163 | 271 |
| 275 | 3300013308 | Ga0157375_10142969 | Ga0157375_101429692 | 271 |
| 276 | 3300013308 | Ga0157375_10146625 | Ga0157375_101466253 | 271 |
| 277 | 3300014497 | Ga0182008_10037548 | Ga0182008_100375482 | 271 |
| 278 | 3300014497 | Ga0182008_10216371 | Ga0182008_102163711 | 271 |
| 279 | 3300015261 | Ga0182006_1000648 | Ga0182006_10006483 | 271 |
| 280 | 3300015262 | Ga0182007_10006996 | Ga0182007_100069962 | 271 |
| 281 | 3300015265 | Ga0182005_1012188 | Ga0182005_10121883 | 271 |
| 282 | 3300015265 | Ga0182005_1023554 | Ga0182005_10235542 | 271 |
| 283 | 3300015265 | Ga0182005_1037233 | Ga0182005_10372332 | 271 |
| 284 | 3300015265 | Ga0182005_1053759 | Ga0182005_10537592 | 271 |
| 285 | 3300017792 | Ga0163161_10007368 | Ga0163161_100073688 | 271 |
| 286 | 3300017792 | Ga0163161_10012000 | Ga0163161_100120002 | 271 |
| 287 | 3300017792 | Ga0163161_10221423 | Ga0163161_102214233 | 271 |
| 288 | 3300025224 | Ga0209784_100017 | Ga0209784_100017437 | 271 |
| 289 | 3300025225 | Ga0209566_100014 | Ga0209566_100014437 | 271 |
| 290 | 3300025226 | Ga0209674_100028 | Ga0209674_100028437 | 271 |
| 291 | 3300025229 | Ga0209147_100038 | Ga0209147_100038292 | 271 |
| 292 | 3300025230 | Ga0209563_100032 | Ga0209563_100032437 | 271 |
| 293 | 3300025233 | Ga0209437_104655 | Ga0209437_1046553 | 271 |
| 294 | 3300025242 | Ga0209258_100212 | Ga0209258_10021298 | 271 |
| 295 | 3300025246 | Ga0209646_1000266 | Ga0209646_100026650 | 271 |
| 296 | 3300025253 | Ga0209677_100018 | Ga0209677_100018437 | 271 |
| 297 | 3300025256 | Ga0209759_1012322 | Ga0209759_10123223 | 271 |
| 298 | 3300025292 | Ga0209676_1001648 | Ga0209676_100164819 | 271 |
| 299 | 3300025298 | Ga0209050_1001348 | Ga0209050_10013482 | 271 |
| 300 | 3300025303 | Ga0209051_1014193 | Ga0209051_10141934 | 271 |
| 301 | 3300025321 | Ga0207656_10000200 | Ga0207656_1000020010 | 271 |
| 302 | 3300025711 | Ga0207696_1000321 | Ga0207696_10003219 | 271 |
| 303 | 3300025728 | Ga0207655_1000142 | Ga0207655_100014278 | 271 |
| 304 | 3300025728 | Ga0207655_1032951 | Ga0207655_10329511 | 271 |
| 305 | 3300025735 | Ga0207713_1001350 | Ga0207713_100135021 | 271 |
| 306 | 3300025735 | Ga0207713_1001775 | Ga0207713_10017753 | 271 |
| 307 | 3300025735 | Ga0207713_1009446 | Ga0207713_10094461 | 271 |
| 308 | 3300025735 | Ga0207713_1018496 | Ga0207713_10184963 | 271 |
| 309 | 3300025914 | Ga0207671_10000343 | Ga0207671_1000034359 | 271 |
| 310 | 3300025920 | Ga0207649_10000013 | Ga0207649_10000013136 | 271 |
| 311 | 3300025923 | Ga0207681_10000619 | Ga0207681_1000061923 | 271 |
| 312 | 3300025925 | Ga0207650_10000457 | Ga0207650_1000045730 | 271 |
| 313 | 3300025933 | Ga0207706_10000140 | Ga0207706_1000014086 | 271 |
| 314 | 3300025935 | Ga0207709_10245296 | Ga0207709_102452962 | 271 |
| 315 | 3300025945 | Ga0207679_10000005 | Ga0207679_10000005390 | 271 |
| 316 | 3300026041 | Ga0207639_10000714 | Ga0207639_1000071421 | 271 |
| 317 | 3300028786 | Ga0307517_10092459 | Ga0307517_100924592 | 271 |
| 318 | 3300031731 | Ga0307405_10002283 | Ga0307405_1000228310 | 271 |
| 319 | 3300042006 | Ga0439432_000345 | Ga0439432_000345_1045_1863 | 271 |
| 320 | 3300042010 | Ga0439452_011706 | Ga0439452_011706_287_1102 | 271 |
| 321 | 3300042115 | Ga0450911_004718 | Ga0450911_004718_1029_1844 | 271 |
| 322 | 3300042138 | Ga0450903_009006 | Ga0450903_009006_282_1097 | 271 |
| 323 | 3300046452 | Ga0495617_019300 | Ga0495617_019300_234_1067 | 271 |
| 324 | 3300046453 | Ga0495627_003622 | Ga0495627_003622_5643_6473 | 271 |
| 325 | 3300046453 | Ga0495627_018085 | Ga0495627_018085_1387_2202 | 271 |
| 326 | 3300046457 | Ga0495590_0022648 | Ga0495590_0022648_1199_2014 | 271 |
| 327 | 3300046458 | Ga0495591_018412 | Ga0495591_018412_169_984 | 271 |
| 328 | 3300046460 | Ga0495638_0001645 | Ga0495638_0001645_170_985 | 271 |
| 329 | 3300046491 | Ga0495584_0024517 | Ga0495584_0024517_1939_2754 | 271 |
| 330 | 3300046491 | Ga0495584_0198951 | Ga0495584_0198951_54_887 | 271 |
| 331 | 3300046492 | Ga0495585_0069803 | Ga0495585_0069803_1044_1877 | 271 |
| 332 | 3300046501 | Ga0495607_0051481 | Ga0495607_0051481_142_975 | 271 |
| 333 | 3300046501 | Ga0495607_0075994 | Ga0495607_0075994_781_1596 | 271 |
| 334 | 3300046506 | Ga0495583_0128898 | Ga0495583_0128898_37_855 | 271 |
| 335 | 3300046507 | Ga0495606_0006527 | Ga0495606_0006527_553_1368 | 271 |
| 336 | 3300046507 | Ga0495606_0014136 | Ga0495606_0014136_399_1232 | 271 |
| 337 | 3300046512 | Ga0495610_0039584 | Ga0495610_0039584_149_985 | 271 |
| 338 | 3300046513 | Ga0495616_0012166 | Ga0495616_0012166_204_1037 | 271 |
| 339 | 3300046515 | Ga0495620_0004628 | Ga0495620_0004628_6648_7463 | 271 |
| 340 | 3300046515 | Ga0495620_0010406 | Ga0495620_0010406_210_1043 | 271 |
| 341 | 3300046518 | Ga0495631_0000173 | Ga0495631_0000173_1072_1905 | 271 |
| 342 | 3300046518 | Ga0495631_0006959 | Ga0495631_0006959_273_1103 | 271 |
| 343 | 3300046519 | Ga0495632_0005144 | Ga0495632_0005144_346_1200 | 271 |
| 344 | 3300046519 | Ga0495632_0039979 | Ga0495632_0039979_1386_2201 | 271 |
| 345 | 3300046519 | Ga0495632_0041919 | Ga0495632_0041919_1250_2065 | 271 |
| 346 | 3300046519 | Ga0495632_0047694 | Ga0495632_0047694_283_1113 | 271 |
| 347 | 3300046519 | Ga0495632_0127005 | Ga0495632_0127005_314_1129 | 271 |
| 348 | 3300046523 | Ga0495644_0003427 | Ga0495644_0003427_284_1099 | 271 |
| 349 | 3300046524 | Ga0495648_0014300 | Ga0495648_0014300_44_877 | 271 |
| 350 | 3300046530 | Ga0495654_0028554 | Ga0495654_0028554_1667_2497 | 271 |
| 351 | 3300046530 | Ga0495654_0035550 | Ga0495654_0035550_1469_2287 | 271 |
| 352 | 3300046530 | Ga0495654_0038136 | Ga0495654_0038136_516_1349 | 271 |
| 353 | 3300046660 | Ga0495625_0057291 | Ga0495625_0057291_580_1413 | 271 |
| 354 | 3300046665 | Ga0495661_0054952 | Ga0495661_0054952_1388_2203 | 271 |
| 355 | 3300046692 | Ga0495671_0055953 | Ga0495671_0055953_526_1356 | 271 |
| 356 | 3300046692 | Ga0495671_0088566 | Ga0495671_0088566_142_957 | 271 |
| 357 | 3300046694 | Ga0495649_0049666 | Ga0495649_0049666_195_1010 | 271 |
| 358 | 3300046794 | Ga0495589_0042552 | Ga0495589_0042552_1252_2067 | 271 |
| 359 | 3300046810 | Ga0495660_0052062 | Ga0495660_0052062_1223_2038 | 271 |
| 360 | 3300047320 | Ga0495672_0024418 | Ga0495672_0024418_2882_3697 | 271 |
| 361 | 3300047320 | Ga0495672_0031265 | Ga0495672_0031265_282_1112 | 271 |
| 362 | 3300047323 | Ga0495683_0021324 | Ga0495683_0021324_1088_1921 | 271 |
| 363 | 3300047446 | Ga0495679_031797 | Ga0495679_031797_20_874 | 271 |
| 364 | 3300047469 | Ga0495673_0000986 | Ga0495673_0000986_1715_2548 | 271 |
| 365 | 3300047470 | Ga0495681_0084662 | Ga0495681_0084662_209_1042 | 271 |
| 366 | 3300047472 | Ga0495686_0209630 | Ga0495686_0209630_171_1004 | 271 |
| 367 | 3300048920 | Ga0496117_0062740 | Ga0496117_0062740_1509_2324 | 271 |
| 368 | 3300048920 | Ga0496117_0092404 | Ga0496117_0092404_1021_1887 | 271 |
| 369 | 3300048921 | Ga0496118_0239916 | Ga0496118_0239916_37_903 | 271 |
| 370 | 3300048923 | Ga0496120_0047072 | Ga0496120_0047072_1498_2313 | 271 |
| 371 | 3300048924 | Ga0496121_0371822 | Ga0496121_0371822_29_895 | 271 |
| 372 | 3300048927 | Ga0496124_0013704 | Ga0496124_0013704_5888_6703 | 271 |
| 373 | 3300048927 | Ga0496124_0066112 | Ga0496124_0066112_184_999 | 271 |
| 374 | 3300048927 | Ga0496124_0172177 | Ga0496124_0172177_131_964 | 271 |
| 375 | 3300048928 | Ga0496125_0000451 | Ga0496125_0000451_196_1011 | 271 |
| 376 | 3300048928 | Ga0496125_0073794 | Ga0496125_0073794_384_1199 | 271 |
| 377 | 3300048928 | Ga0496125_0105966 | Ga0496125_0105966_192_1025 | 271 |
| 378 | 3300048928 | Ga0496125_0153073 | Ga0496125_0153073_63_929 | 271 |
| 379 | 3300048929 | Ga0496126_0161159 | Ga0496126_0161159_56_922 | 271 |
| 380 | 3300048929 | Ga0496126_0411830 | Ga0496126_0411830_33_851 | 271 |
| 381 | 3300049459 | Ga0495678_023876 | Ga0495678_023876_1778_2593 | 271 |
| 382 | iso_pu_bacteria | 2511231012 | 2511301206 | 271 |
| 383 | iso_pu_bacteria | 2511231015 | 2511323240 | 271 |
| 384 | iso_pu_bacteria | 2511231020 | 2511350682 | 271 |
| 385 | iso_pu_bacteria | 2511231031 | 2511410736 | 271 |
| 386 | iso_pu_bacteria | 2643221565 | 2643845725 | 271 |
| 387 | iso_pu_bacteria | 2643221571 | 2643869480 | 271 |
| 388 | iso_pu_bacteria | 2738543004 | 2739197071 | 271 |
| 389 | iso_pu_bacteria | 2738543015 | 2739259136 | 271 |
| 390 | iso_pu_bacteria | 2738543025 | 2739315051 | 271 |
| 391 | iso_pu_bacteria | 2860339153 | 2860340923 | 271 |
| 392 | iso_pu_bacteria | 2904550169 | 2904555294 | 271 |
| 393 | iso_pu_bacteria | 2931396565 | 2931396665 | 271 |
| 394 | iso_pu_bacteria | 2939636861 | 2939637528 | 271 |
| 395 | iso_pu_bacteria | 2946027586 | 2946032436 | 271 |
| 396 | iso_pu_bacteria | 3007511990 | 3007515719 | 271 |
| 397 | iso_pu_bacteria | 3007619802 | 3007621325 | 271 |
| 398 | iso_pu_bacteria | 8056125926 | 8056127476 | 271 |
| 399 | iso_pu_bacteria | 8056148874 | 8056150002 | 271 |
| 400 | 3300046474 | Ga0495605_0034473 | Ga0495605_0034473_220_1047 | 272 |
| 401 | 3300046660 | Ga0495625_0045098 | Ga0495625_0045098_201_1019 | 272 |
| 402 | 3300002737 | JGI25162J39368_1000042 | JGI25162J39368_10000423 | 273 |
| 403 | 3300002771 | JGI25163J39215_1000761 | JGI25163J39215_100076110 | 273 |
| 404 | 3300002772 | JGI25164J39214_1000023 | JGI25164J39214_1000023164 | 273 |
| 405 | 3300003214 | JGI25165J46597_1000083 | JGI25165J46597_1000083171 | 273 |
| 406 | 3300003781 | Ga0055536_1000246 | Ga0055536_10002463 | 273 |
| 407 | 3300005548 | Ga0070665_100060434 | Ga0070665_1000604343 | 273 |
| 408 | 3300006946 | Ga0079104_1013365 | Ga0079104_10133652 | 273 |
| 409 | 3300009092 | Ga0105250_10013833 | Ga0105250_100138334 | 273 |
| 410 | 3300013100 | Ga0157373_10019698 | Ga0157373_100196982 | 273 |
| 411 | 3300013102 | Ga0157371_10011042 | Ga0157371_100110428 | 273 |
| 412 | 3300013104 | Ga0157370_10180128 | Ga0157370_101801283 | 273 |
| 413 | 3300013105 | Ga0157369_10032034 | Ga0157369_100320341 | 273 |
| 414 | 3300013307 | Ga0157372_10001795 | Ga0157372_1000179523 | 273 |
| 415 | 3300014497 | Ga0182008_10005978 | Ga0182008_100059782 | 273 |
| 416 | 3300015261 | Ga0182006_1011183 | Ga0182006_10111831 | 273 |
| 417 | 3300015261 | Ga0182006_1026114 | Ga0182006_10261141 | 273 |
| 418 | 3300025207 | Ga0209760_100114 | Ga0209760_10011417 | 273 |
| 419 | 3300025230 | Ga0209563_100888 | Ga0209563_1008886 | 273 |
| 420 | 3300025231 | Ga0207427_100008 | Ga0207427_100008457 | 273 |
| 421 | 3300025233 | Ga0209437_100014 | Ga0209437_100014254 | 273 |
| 422 | 3300025261 | Ga0209233_1000008 | Ga0209233_1000008254 | 273 |
| 423 | 3300025292 | Ga0209676_1000345 | Ga0209676_100034537 | 273 |
| 424 | 3300025711 | Ga0207696_1000097 | Ga0207696_100009758 | 273 |
| 425 | 3300025711 | Ga0207696_1001961 | Ga0207696_10019612 | 273 |
| 426 | 3300025728 | Ga0207655_1003503 | Ga0207655_100350314 | 273 |
| 427 | 3300025735 | Ga0207713_1003692 | Ga0207713_100369214 | 273 |
| 428 | 3300025933 | Ga0207706_10004624 | Ga0207706_1000462416 | 273 |
| 429 | 3300026067 | Ga0207678_10230949 | Ga0207678_102309491 | 273 |
| 430 | 3300027111 | Ga0209281_1002280 | Ga0209281_10022807 | 273 |
| 431 | 3300027111 | Ga0209281_1020846 | Ga0209281_10208462 | 273 |
| 432 | 3300028379 | Ga0268266_10014563 | Ga0268266_100145638 | 273 |
| 433 | 3300030521 | Ga0307511_10038433 | Ga0307511_100384332 | 273 |
| 434 | 3300030735 | Ga0316178_1165151 | Ga0316178_11651514 | 273 |
| 435 | 3300031548 | Ga0307408_100420348 | Ga0307408_1004203482 | 273 |
| 436 | 3300031995 | Ga0307409_100126984 | Ga0307409_1001269841 | 273 |
| 437 | 3300032002 | Ga0307416_100256312 | Ga0307416_1002563123 | 273 |
| 438 | 3300032004 | Ga0307414_10096067 | Ga0307414_100960672 | 273 |
| 439 | 3300032005 | Ga0307411_10026068 | Ga0307411_100260684 | 273 |
| 440 | 3300041405 | Ga0439438_053841 | Ga0439438_053841_31_900 | 273 |
| 441 | 3300041407 | Ga0439447_003217 | Ga0439447_003217_2831_3682 | 273 |
| 442 | 3300042006 | Ga0439432_002044 | Ga0439432_002044_6649_7518 | 273 |
| 443 | 3300042006 | Ga0439432_078328 | Ga0439432_078328_36_905 | 273 |
| 444 | 3300042009 | Ga0439451_002939 | Ga0439451_002939_335_1183 | 273 |
| 445 | 3300042009 | Ga0439451_030333 | Ga0439451_030333_58_909 | 273 |
| 446 | 3300042010 | Ga0439452_000369 | Ga0439452_000369_26292_27161 | 273 |
| 447 | 3300042013 | Ga0439456_002240 | Ga0439456_002240_2914_3783 | 273 |
| 448 | 3300042115 | Ga0450911_002783 | Ga0450911_002783_121_990 | 273 |
| 449 | 3300042137 | Ga0450902_004206 | Ga0450902_004206_1219_2088 | 273 |
| 450 | 3300042145 | Ga0450906_006810 | Ga0450906_006810_124_993 | 273 |
| 451 | 3300042532 | Ga0450893_0027592 | Ga0450893_0027592_84_905 | 273 |
| 452 | 3300046452 | Ga0495617_004893 | Ga0495617_004893_203_1024 | 273 |
| 453 | 3300046452 | Ga0495617_052857 | Ga0495617_052857_79_900 | 273 |
| 454 | 3300046453 | Ga0495627_069838 | Ga0495627_069838_156_977 | 273 |
| 455 | 3300046458 | Ga0495591_004686 | Ga0495591_004686_4009_4830 | 273 |
| 456 | 3300046458 | Ga0495591_031550 | Ga0495591_031550_154_975 | 273 |
| 457 | 3300046460 | Ga0495638_0016495 | Ga0495638_0016495_229_1050 | 273 |
| 458 | 3300046463 | Ga0495653_0237520 | Ga0495653_0237520_156_977 | 273 |
| 459 | 3300046463 | Ga0495653_0274265 | Ga0495653_0274265_193_1014 | 273 |
| 460 | 3300046474 | Ga0495605_0145234 | Ga0495605_0145234_51_872 | 273 |
| 461 | 3300046491 | Ga0495584_0155476 | Ga0495584_0155476_90_911 | 273 |
| 462 | 3300046492 | Ga0495585_0010143 | Ga0495585_0010143_4670_5491 | 273 |
| 463 | 3300046492 | Ga0495585_0053129 | Ga0495585_0053129_1342_2163 | 273 |
| 464 | 3300046492 | Ga0495585_0093000 | Ga0495585_0093000_193_1014 | 273 |
| 465 | 3300046501 | Ga0495607_0046364 | Ga0495607_0046364_1673_2494 | 273 |
| 466 | 3300046501 | Ga0495607_0054684 | Ga0495607_0054684_128_949 | 273 |
| 467 | 3300046507 | Ga0495606_0055497 | Ga0495606_0055497_226_1047 | 273 |
| 468 | 3300046512 | Ga0495610_0129395 | Ga0495610_0129395_50_871 | 273 |
| 469 | 3300046512 | Ga0495610_0146478 | Ga0495610_0146478_96_965 | 273 |
| 470 | 3300046513 | Ga0495616_0146811 | Ga0495616_0146811_198_1019 | 273 |
| 471 | 3300046515 | Ga0495620_0025156 | Ga0495620_0025156_162_983 | 273 |
| 472 | 3300046518 | Ga0495631_0006792 | Ga0495631_0006792_195_1016 | 273 |
| 473 | 3300046518 | Ga0495631_0165296 | Ga0495631_0165296_11_832 | 273 |
| 474 | 3300046519 | Ga0495632_0020071 | Ga0495632_0020071_156_977 | 273 |
| 475 | 3300046519 | Ga0495632_0051408 | Ga0495632_0051408_1043_1864 | 273 |
| 476 | 3300046519 | Ga0495632_0051723 | Ga0495632_0051723_1038_1859 | 273 |
| 477 | 3300046520 | Ga0495637_0030403 | Ga0495637_0030403_1497_2318 | 273 |
| 478 | 3300046520 | Ga0495637_0031571 | Ga0495637_0031571_1360_2229 | 273 |
| 479 | 3300046520 | Ga0495637_0037686 | Ga0495637_0037686_138_965 | 273 |
| 480 | 3300046530 | Ga0495654_0005559 | Ga0495654_0005559_1555_2376 | 273 |
| 481 | 3300046530 | Ga0495654_0045923 | Ga0495654_0045923_38_859 | 273 |
| 482 | 3300046538 | Ga0495609_0000558 | Ga0495609_0000558_193_1014 | 273 |
| 483 | 3300046538 | Ga0495609_0033331 | Ga0495609_0033331_1387_2256 | 273 |
| 484 | 3300046542 | Ga0495597_0006879 | Ga0495597_0006879_160_981 | 273 |
| 485 | 3300046557 | Ga0495622_0004298 | Ga0495622_0004298_953_1774 | 273 |
| 486 | 3300046558 | Ga0495633_0008368 | Ga0495633_0008368_166_987 | 273 |
| 487 | 3300046616 | Ga0495668_0012891 | Ga0495668_0012891_244_1065 | 273 |
| 488 | 3300046648 | Ga0495611_0119780 | Ga0495611_0119780_53_874 | 273 |
| 489 | 3300046660 | Ga0495625_0015972 | Ga0495625_0015972_178_999 | 273 |
| 490 | 3300046665 | Ga0495661_0133245 | Ga0495661_0133245_102_923 | 273 |
| 491 | 3300046680 | Ga0495646_0010200 | Ga0495646_0010200_5012_5833 | 273 |
| 492 | 3300046689 | Ga0495613_0092226 | Ga0495613_0092226_150_971 | 273 |
| 493 | 3300046690 | Ga0495624_0009404 | Ga0495624_0009404_220_1041 | 273 |
| 494 | 3300046692 | Ga0495671_0036366 | Ga0495671_0036366_169_990 | 273 |
| 495 | 3300046692 | Ga0495671_0036385 | Ga0495671_0036385_160_981 | 273 |
| 496 | 3300046694 | Ga0495649_0051795 | Ga0495649_0051795_1189_2010 | 273 |
| 497 | 3300046809 | Ga0495600_0067995 | Ga0495600_0067995_1332_2153 | 273 |
| 498 | 3300046810 | Ga0495660_0000599 | Ga0495660_0000599_222_1043 | 273 |
| 499 | 3300046810 | Ga0495660_0056765 | Ga0495660_0056765_1151_1972 | 273 |
| 500 | 3300046810 | Ga0495660_0112082 | Ga0495660_0112082_197_1018 | 273 |
| 501 | 3300047317 | Ga0495604_0094517 | Ga0495604_0094517_1216_2037 | 273 |
| 502 | 3300047320 | Ga0495672_0010213 | Ga0495672_0010213_195_1016 | 273 |
| 503 | 3300047320 | Ga0495672_0012956 | Ga0495672_0012956_4856_5677 | 273 |
| 504 | 3300047321 | Ga0495676_0101965 | Ga0495676_0101965_1131_1952 | 273 |
| 505 | 3300047321 | Ga0495676_0122278 | Ga0495676_0122278_937_1758 | 273 |
| 506 | 3300047323 | Ga0495683_0176616 | Ga0495683_0176616_91_912 | 273 |
| 507 | 3300047446 | Ga0495679_017612 | Ga0495679_017612_198_1019 | 273 |
| 508 | 3300047469 | Ga0495673_0029872 | Ga0495673_0029872_195_1016 | 273 |
| 509 | 3300047470 | Ga0495681_0001733 | Ga0495681_0001733_14110_14946 | 273 |
| 510 | 3300047470 | Ga0495681_0094371 | Ga0495681_0094371_361_1182 | 273 |
| 511 | 3300047471 | Ga0495684_0053962 | Ga0495684_0053962_77_898 | 273 |
| 512 | 3300047673 | Ga0495593_0123199 | Ga0495593_0123199_175_996 | 273 |
| 513 | 3300048088 | Ga0495602_0021303 | Ga0495602_0021303_165_986 | 273 |
| 514 | 3300048091 | Ga0495626_0007710 | Ga0495626_0007710_4947_5768 | 273 |
| 515 | 3300048091 | Ga0495626_0137805 | Ga0495626_0137805_102_971 | 273 |
| 516 | 3300048915 | Ga0496112_0458980 | Ga0496112_0458980_178_1074 | 273 |
| 517 | 3300048919 | Ga0496116_0065459 | Ga0496116_0065459_158_979 | 273 |
| 518 | 3300048921 | Ga0496118_0015623 | Ga0496118_0015623_6029_6850 | 273 |
| 519 | 3300048922 | Ga0496119_0082598 | Ga0496119_0082598_870_1691 | 273 |
| 520 | 3300048923 | Ga0496120_0056973 | Ga0496120_0056973_268_1089 | 273 |
| 521 | 3300048924 | Ga0496121_0149779 | Ga0496121_0149779_122_943 | 273 |
| 522 | 3300048925 | Ga0496122_0020247 | Ga0496122_0020247_155_976 | 273 |
| 523 | 3300048927 | Ga0496124_0098956 | Ga0496124_0098956_1126_1947 | 273 |
| 524 | 3300049459 | Ga0495678_094727 | Ga0495678_094727_150_1019 | 273 |
| 525 | 3300049459 | Ga0495678_113799 | Ga0495678_113799_16_837 | 273 |
| 526 | 3300049460 | Ga0495682_0021588 | Ga0495682_0021588_1431_2252 | 273 |
| 527 | 3300049758 | Ga0501241_005473 | Ga0501241_005473_1463_2284 | 273 |
| 528 | 3300049766 | Ga0501269_002297 | Ga0501269_002297_170_991 | 273 |
| 529 | 3300053111 | Ga0500572_002052 | Ga0500572_002052_86_955 | 273 |
| 530 | iso_pu_bacteria | 2808606445 | 2809218864 | 273 |
| 531 | iso_pu_bacteria | 8056172158 | 8056173171 | 273 |
| 532 | 3300002737 | JGI25162J39368_1000080 | JGI25162J39368_10000803 | 274 |
| 533 | 3300002771 | JGI25163J39215_1000372 | JGI25163J39215_100037217 | 274 |
| 534 | 3300002772 | JGI25164J39214_1000073 | JGI25164J39214_100007389 | 274 |
| 535 | 3300003214 | JGI25165J46597_1000152 | JGI25165J46597_1000152101 | 274 |
| 536 | 3300003781 | Ga0055536_1000233 | Ga0055536_10002333 | 274 |
| 537 | 3300003791 | Ga0055530_10000120 | Ga0055530_100001203 | 274 |
| 538 | 3300003791 | Ga0055530_10000240 | Ga0055530_1000024020 | 274 |
| 539 | 3300003792 | Ga0055540_1000074 | Ga0055540_10000742 | 274 |
| 540 | 3300003792 | Ga0055540_1000248 | Ga0055540_100024820 | 274 |
| 541 | 3300005288 | Ga0065714_10002428 | Ga0065714_100024288 | 274 |
| 542 | 3300005288 | Ga0065714_10077206 | Ga0065714_100772061 | 274 |
| 543 | 3300005289 | Ga0065704_10070222 | Ga0065704_1007022251 | 274 |
| 544 | 3300006051 | Ga0075364_10171564 | Ga0075364_101715642 | 274 |
| 545 | 3300006058 | Ga0075432_10010646 | Ga0075432_100106464 | 274 |
| 546 | 3300006914 | Ga0075436_100074505 | Ga0075436_1000745053 | 274 |
| 547 | 3300006946 | Ga0079104_1000094 | Ga0079104_100009496 | 274 |
| 548 | 3300006948 | Ga0099826_10011129 | Ga0099826_100111297 | 274 |
| 549 | 3300009553 | Ga0105249_10522156 | Ga0105249_105221561 | 274 |
| 550 | 3300013100 | Ga0157373_10009493 | Ga0157373_100094934 | 274 |
| 551 | 3300013102 | Ga0157371_10003771 | Ga0157371_100037712 | 274 |
| 552 | 3300014497 | Ga0182008_10001585 | Ga0182008_100015853 | 274 |
| 553 | 3300017792 | Ga0163161_10072891 | Ga0163161_100728913 | 274 |
| 554 | 3300025207 | Ga0209760_100200 | Ga0209760_10020023 | 274 |
| 555 | 3300025231 | Ga0207427_100001 | Ga0207427_1000011063 | 274 |
| 556 | 3300025233 | Ga0209437_100003 | Ga0209437_100003309 | 274 |
| 557 | 3300025261 | Ga0209233_1000007 | Ga0209233_10000071063 | 274 |
| 558 | 3300025292 | Ga0209676_1000021 | Ga0209676_1000021386 | 274 |
| 559 | 3300025298 | Ga0209050_1000162 | Ga0209050_100016243 | 274 |
| 560 | 3300025298 | Ga0209050_1000227 | Ga0209050_1000227105 | 274 |
| 561 | 3300025303 | Ga0209051_1000121 | Ga0209051_1000121109 | 274 |
| 562 | 3300025303 | Ga0209051_1000164 | Ga0209051_1000164106 | 274 |
| 563 | 3300025304 | Ga0209257_1006723 | Ga0209257_10067233 | 274 |
| 564 | 3300025935 | Ga0207709_10000210 | Ga0207709_1000021064 | 274 |
| 565 | 3300025961 | Ga0207712_10318413 | Ga0207712_103184132 | 274 |
| 566 | 3300027111 | Ga0209281_1000212 | Ga0209281_100021237 | 274 |
| 567 | 3300027907 | Ga0207428_10084262 | Ga0207428_100842623 | 274 |
| 568 | 3300027907 | Ga0207428_10105023 | Ga0207428_101050232 | 274 |
| 569 | 3300030744 | Ga0316181_1160091 | Ga0316181_11600914 | 274 |
| 570 | 3300031548 | Ga0307408_100003149 | Ga0307408_1000031492 | 274 |
| 571 | 3300031548 | Ga0307408_100160811 | Ga0307408_1001608112 | 274 |
| 572 | 3300031731 | Ga0307405_10008605 | Ga0307405_100086055 | 274 |
| 573 | 3300031731 | Ga0307405_10162262 | Ga0307405_101622622 | 274 |
| 574 | 3300031824 | Ga0307413_10020501 | Ga0307413_100205014 | 274 |
| 575 | 3300031824 | Ga0307413_10171673 | Ga0307413_101716732 | 274 |
| 576 | 3300031901 | Ga0307406_10023500 | Ga0307406_100235001 | 274 |
| 577 | 3300031911 | Ga0307412_10001838 | Ga0307412_1000183813 | 274 |
| 578 | 3300031911 | Ga0307412_10008886 | Ga0307412_100088862 | 274 |
| 579 | 3300031911 | Ga0307412_10028897 | Ga0307412_100288972 | 274 |
| 580 | 3300031995 | Ga0307409_100546422 | Ga0307409_1005464221 | 274 |
| 581 | 3300041405 | Ga0439438_005048 | Ga0439438_005048_1190_2014 | 274 |
| 582 | 3300041405 | Ga0439438_016637 | Ga0439438_016637_296_1120 | 274 |
| 583 | 3300041407 | Ga0439447_000211 | Ga0439447_000211_11782_12606 | 274 |
| 584 | 3300041407 | Ga0439447_013451 | Ga0439447_013451_76_957 | 274 |
| 585 | 3300041407 | Ga0439447_017022 | Ga0439447_017022_900_1724 | 274 |
| 586 | 3300041411 | Ga0439466_0013843 | Ga0439466_0013843_95_919 | 274 |
| 587 | 3300041411 | Ga0439466_0014054 | Ga0439466_0014054_169_1041 | 274 |
| 588 | 3300041411 | Ga0439466_0017878 | Ga0439466_0017878_1567_2448 | 274 |
| 589 | 3300041997 | Ga0439431_0007447 | Ga0439431_0007447_68_949 | 274 |
| 590 | 3300042004 | Ga0439445_0013932 | Ga0439445_0013932_86_967 | 274 |
| 591 | 3300042010 | Ga0439452_000260 | Ga0439452_000260_263_1087 | 274 |
| 592 | 3300042010 | Ga0439452_018057 | Ga0439452_018057_915_1796 | 274 |
| 593 | 3300042010 | Ga0439452_040714 | Ga0439452_040714_170_994 | 274 |
| 594 | 3300042016 | Ga0439463_006180 | Ga0439463_006180_145_1017 | 274 |
| 595 | 3300042137 | Ga0450902_001942 | Ga0450902_001942_474_1298 | 274 |
| 596 | 3300042137 | Ga0450902_002606 | Ga0450902_002606_363_1187 | 274 |
| 597 | 3300042137 | Ga0450902_025330 | Ga0450902_025330_33_857 | 274 |
| 598 | 3300042138 | Ga0450903_006114 | Ga0450903_006114_906_1730 | 274 |
| 599 | 3300042142 | Ga0450905_003581 | Ga0450905_003581_244_1068 | 274 |
| 600 | 3300042147 | Ga0450910_006369 | Ga0450910_006369_640_1521 | 274 |
| 601 | 3300042993 | Ga0439440_0027885 | Ga0439440_0027885_316_1188 | 274 |
| 602 | 3300046453 | Ga0495627_019510 | Ga0495627_019510_1272_2096 | 274 |
| 603 | 3300046457 | Ga0495590_0021767 | Ga0495590_0021767_1356_2186 | 274 |
| 604 | 3300046458 | Ga0495591_050811 | Ga0495591_050811_243_1067 | 274 |
| 605 | 3300046460 | Ga0495638_0195157 | Ga0495638_0195157_206_1030 | 274 |
| 606 | 3300046471 | Ga0495650_0008290 | Ga0495650_0008290_5162_5992 | 274 |
| 607 | 3300046474 | Ga0495605_0143964 | Ga0495605_0143964_12_836 | 274 |
| 608 | 3300046501 | Ga0495607_0001220 | Ga0495607_0001220_128_958 | 274 |
| 609 | 3300046501 | Ga0495607_0047077 | Ga0495607_0047077_207_1031 | 274 |
| 610 | 3300046507 | Ga0495606_0060789 | Ga0495606_0060789_157_981 | 274 |
| 611 | 3300046512 | Ga0495610_0036879 | Ga0495610_0036879_1463_2287 | 274 |
| 612 | 3300046513 | Ga0495616_0044339 | Ga0495616_0044339_1277_2107 | 274 |
| 613 | 3300046513 | Ga0495616_0149598 | Ga0495616_0149598_61_885 | 274 |
| 614 | 3300046515 | Ga0495620_0088474 | Ga0495620_0088474_232_1056 | 274 |
| 615 | 3300046516 | Ga0495628_0193347 | Ga0495628_0193347_520_1344 | 274 |
| 616 | 3300046518 | Ga0495631_0062922 | Ga0495631_0062922_179_1003 | 274 |
| 617 | 3300046519 | Ga0495632_0005190 | Ga0495632_0005190_245_1069 | 274 |
| 618 | 3300046520 | Ga0495637_0051769 | Ga0495637_0051769_197_1021 | 274 |
| 619 | 3300046523 | Ga0495644_0045490 | Ga0495644_0045490_213_1037 | 274 |
| 620 | 3300046524 | Ga0495648_0000330 | Ga0495648_0000330_386_1258 | 274 |
| 621 | 3300046542 | Ga0495597_0031941 | Ga0495597_0031941_153_977 | 274 |
| 622 | 3300046691 | Ga0495670_0088772 | Ga0495670_0088772_548_1372 | 274 |
| 623 | 3300046692 | Ga0495671_0121954 | Ga0495671_0121954_205_1029 | 274 |
| 624 | 3300046692 | Ga0495671_0151128 | Ga0495671_0151128_153_977 | 274 |
| 625 | 3300047320 | Ga0495672_0020849 | Ga0495672_0020849_1633_2457 | 274 |
| 626 | 3300047469 | Ga0495673_0115602 | Ga0495673_0115602_115_939 | 274 |
| 627 | 3300047470 | Ga0495681_0002261 | Ga0495681_0002261_12864_13694 | 274 |
| 628 | 3300047470 | Ga0495681_0038747 | Ga0495681_0038747_1307_2134 | 274 |
| 629 | 3300047470 | Ga0495681_0060221 | Ga0495681_0060221_157_981 | 274 |
| 630 | 3300048091 | Ga0495626_0031169 | Ga0495626_0031169_1503_2327 | 274 |
| 631 | 3300048919 | Ga0496116_0000185 | Ga0496116_0000185_122018_122842 | 274 |
| 632 | 3300048920 | Ga0496117_0004272 | Ga0496117_0004272_14058_14882 | 274 |
| 633 | 3300048921 | Ga0496118_0028863 | Ga0496118_0028863_236_1060 | 274 |
| 634 | 3300048924 | Ga0496121_0001963 | Ga0496121_0001963_30899_31723 | 274 |
| 635 | 3300048925 | Ga0496122_0029988 | Ga0496122_0029988_142_966 | 274 |
| 636 | 3300048926 | Ga0496123_0159475 | Ga0496123_0159475_200_1024 | 274 |
| 637 | 3300050491 | nmdc:mga00v17_172740_c1 | nmdc:mga00v17_172740_c1_156_980 | 274 |
| 638 | 3300050514 | nmdc:mga08x19_77137_c1 | nmdc:mga08x19_77137_c1_1092_1928 | 274 |
| 639 | iso_pu_bacteria | 2511231004 | 2511256737 | 274 |
| 640 | iso_pu_bacteria | 2511231010 | 2511287662 | 274 |
| 641 | iso_pu_bacteria | 2511231016 | 2511327721 | 274 |
| 642 | iso_pu_bacteria | 2511231017 | 2511331600 | 274 |
| 643 | iso_pu_bacteria | 2511231018 | 2511340323 | 274 |
| 644 | iso_pu_bacteria | 2511231019 | 2511344947 | 274 |
| 645 | iso_pu_bacteria | 2511231022 | 2511364042 | 274 |
| 646 | iso_pu_bacteria | 2600255318 | 2601796369 | 274 |
| 647 | iso_pu_bacteria | 2603880185 | 2606073519 | 274 |
| 648 | iso_pu_bacteria | 2603880199 | 2606126837 | 274 |
| 649 | iso_pu_bacteria | 2623620443 | 2624482020 | 274 |
| 650 | iso_pu_bacteria | 2623620446 | 2624490899 | 274 |
| 651 | iso_pu_bacteria | 2643221589 | 2643956593 | 274 |
| 652 | iso_pu_bacteria | 2643221602 | 2644025364 | 274 |
| 653 | iso_pu_bacteria | 2643221633 | 2644189531 | 274 |
| 654 | iso_pu_bacteria | 2713897149 | 2715758322 | 274 |
| 655 | iso_pu_bacteria | 2773857670 | 2774122735 | 274 |
| 656 | iso_pu_bacteria | 2784132072 | 2784317622 | 274 |
| 657 | iso_pu_bacteria | 2808606382 | 2808957236 | 274 |
| 658 | iso_pu_bacteria | 2878029506 | 2878034002 | 274 |
| 659 | iso_pu_bacteria | 2919063839 | 2919069381 | 274 |
| 660 | iso_pu_bacteria | 2919697872 | 2919701891 | 274 |
| 661 | iso_pu_bacteria | 3007718800 | 3007719010 | 274 |
| 662 | iso_pu_bacteria | 8019775933 | 8019779374 | 274 |
| 663 | iso_pu_bacteria | 8056155041 | 8056155131 | 274 |
| 664 | 3300005288 | Ga0065714_10003367 | Ga0065714_100033671 | 275 |
| 665 | 3300006058 | Ga0075432_10017884 | Ga0075432_100178842 | 275 |
| 666 | 3300006058 | Ga0075432_10080050 | Ga0075432_100800502 | 275 |
| 667 | 3300006177 | Ga0075362_10067080 | Ga0075362_100670802 | 275 |
| 668 | 3300006177 | Ga0075362_10084406 | Ga0075362_100844062 | 275 |
| 669 | 3300006186 | Ga0075369_10112894 | Ga0075369_101128941 | 275 |
| 670 | 3300006914 | Ga0075436_100134149 | Ga0075436_1001341493 | 275 |
| 671 | 3300009036 | Ga0105244_10112289 | Ga0105244_101122891 | 275 |
| 672 | 3300009036 | Ga0105244_10179488 | Ga0105244_101794881 | 275 |
| 673 | 3300013104 | Ga0157370_10021831 | Ga0157370_100218318 | 275 |
| 674 | 3300013306 | Ga0163162_10000298 | Ga0163162_100002982 | 275 |
| 675 | 3300017792 | Ga0163161_10058743 | Ga0163161_100587434 | 275 |
| 676 | 3300017792 | Ga0163161_10085338 | Ga0163161_100853383 | 275 |
| 677 | 3300025711 | Ga0207696_1022273 | Ga0207696_10222733 | 275 |
| 678 | 3300025728 | Ga0207655_1027723 | Ga0207655_10277231 | 275 |
| 679 | 3300025735 | Ga0207713_1033067 | Ga0207713_10330672 | 275 |
| 680 | 3300027907 | Ga0207428_10034127 | Ga0207428_100341271 | 275 |
| 681 | 3300027907 | Ga0207428_10101690 | Ga0207428_101016903 | 275 |
| 682 | 3300033180 | Ga0307510_10000361 | Ga0307510_1000036136 | 275 |
| 683 | 3300041405 | Ga0439438_002777 | Ga0439438_002777_4950_5789 | 275 |
| 684 | 3300041405 | Ga0439438_012140 | Ga0439438_012140_332_1168 | 275 |
| 685 | 3300041407 | Ga0439447_002131 | Ga0439447_002131_308_1147 | 275 |
| 686 | 3300042006 | Ga0439432_022050 | Ga0439432_022050_687_1523 | 275 |
| 687 | 3300042010 | Ga0439452_002426 | Ga0439452_002426_5704_6540 | 275 |
| 688 | 3300042013 | Ga0439456_010385 | Ga0439456_010385_752_1588 | 275 |
| 689 | 3300042013 | Ga0439456_038260 | Ga0439456_038260_29_856 | 275 |
| 690 | 3300042121 | Ga0450919_002565 | Ga0450919_002565_1392_2231 | 275 |
| 691 | 3300042122 | Ga0450920_002530 | Ga0450920_002530_2042_2881 | 275 |
| 692 | 3300042124 | Ga0450922_000230 | Ga0450922_000230_5136_5975 | 275 |
| 693 | 3300042145 | Ga0450906_006196 | Ga0450906_006196_211_1050 | 275 |
| 694 | 3300042146 | Ga0450907_018419 | Ga0450907_018419_296_1135 | 275 |
| 695 | 3300042461 | Ga0439460_0000623 | Ga0439460_0000623_293_1129 | 275 |
| 696 | 3300046452 | Ga0495617_006203 | Ga0495617_006203_3115_3942 | 275 |
| 697 | 3300046452 | Ga0495617_011129 | Ga0495617_011129_1934_2773 | 275 |
| 698 | 3300046452 | Ga0495617_033290 | Ga0495617_033290_724_1551 | 275 |
| 699 | 3300046452 | Ga0495617_036969 | Ga0495617_036969_96_932 | 275 |
| 700 | 3300046453 | Ga0495627_000566 | Ga0495627_000566_29140_29973 | 275 |
| 701 | 3300046453 | Ga0495627_018425 | Ga0495627_018425_181_1008 | 275 |
| 702 | 3300046455 | Ga0495603_0002139 | Ga0495603_0002139_10733_11560 | 275 |
| 703 | 3300046458 | Ga0495591_000311 | Ga0495591_000311_43111_43938 | 275 |
| 704 | 3300046458 | Ga0495591_017921 | Ga0495591_017921_163_996 | 275 |
| 705 | 3300046460 | Ga0495638_0006372 | Ga0495638_0006372_25_867 | 275 |
| 706 | 3300046460 | Ga0495638_0022326 | Ga0495638_0022326_295_1122 | 275 |
| 707 | 3300046460 | Ga0495638_0036824 | Ga0495638_0036824_1930_2757 | 275 |
| 708 | 3300046460 | Ga0495638_0059844 | Ga0495638_0059844_1331_2167 | 275 |
| 709 | 3300046460 | Ga0495638_0089285 | Ga0495638_0089285_906_1742 | 275 |
| 710 | 3300046471 | Ga0495650_0004955 | Ga0495650_0004955_7761_8588 | 275 |
| 711 | 3300046474 | Ga0495605_0082376 | Ga0495605_0082376_513_1340 | 275 |
| 712 | 3300046475 | Ga0495639_0149700 | Ga0495639_0149700_224_1051 | 275 |
| 713 | 3300046491 | Ga0495584_0077702 | Ga0495584_0077702_711_1538 | 275 |
| 714 | 3300046491 | Ga0495584_0193946 | Ga0495584_0193946_65_898 | 275 |
| 715 | 3300046492 | Ga0495585_0049777 | Ga0495585_0049777_115_957 | 275 |
| 716 | 3300046492 | Ga0495585_0079685 | Ga0495585_0079685_169_996 | 275 |
| 717 | 3300046500 | Ga0495596_0000158 | Ga0495596_0000158_3450_4277 | 275 |
| 718 | 3300046500 | Ga0495596_0070917 | Ga0495596_0070917_368_1201 | 275 |
| 719 | 3300046500 | Ga0495596_0147041 | Ga0495596_0147041_33_866 | 275 |
| 720 | 3300046501 | Ga0495607_0012496 | Ga0495607_0012496_60_887 | 275 |
| 721 | 3300046501 | Ga0495607_0067582 | Ga0495607_0067582_66_899 | 275 |
| 722 | 3300046501 | Ga0495607_0103650 | Ga0495607_0103650_502_1338 | 275 |
| 723 | 3300046507 | Ga0495606_0024688 | Ga0495606_0024688_221_1057 | 275 |
| 724 | 3300046512 | Ga0495610_0008339 | Ga0495610_0008339_290_1117 | 275 |
| 725 | 3300046512 | Ga0495610_0039525 | Ga0495610_0039525_1424_2257 | 275 |
| 726 | 3300046512 | Ga0495610_0121970 | Ga0495610_0121970_111_938 | 275 |
| 727 | 3300046512 | Ga0495610_0124852 | Ga0495610_0124852_42_884 | 275 |
| 728 | 3300046513 | Ga0495616_0015155 | Ga0495616_0015155_3162_3989 | 275 |
| 729 | 3300046513 | Ga0495616_0043391 | Ga0495616_0043391_1382_2215 | 275 |
| 730 | 3300046515 | Ga0495620_0033137 | Ga0495620_0033137_273_1109 | 275 |
| 731 | 3300046515 | Ga0495620_0034818 | Ga0495620_0034818_112_939 | 275 |
| 732 | 3300046518 | Ga0495631_0032137 | Ga0495631_0032137_216_1052 | 275 |
| 733 | 3300046519 | Ga0495632_0020584 | Ga0495632_0020584_2602_3435 | 275 |
| 734 | 3300046519 | Ga0495632_0041174 | Ga0495632_0041174_115_957 | 275 |
| 735 | 3300046519 | Ga0495632_0057419 | Ga0495632_0057419_60_887 | 275 |
| 736 | 3300046519 | Ga0495632_0064272 | Ga0495632_0064272_266_1102 | 275 |
| 737 | 3300046519 | Ga0495632_0077040 | Ga0495632_0077040_490_1317 | 275 |
| 738 | 3300046519 | Ga0495632_0098901 | Ga0495632_0098901_532_1365 | 275 |
| 739 | 3300046520 | Ga0495637_0000228 | Ga0495637_0000228_42468_43295 | 275 |
| 740 | 3300046520 | Ga0495637_0010815 | Ga0495637_0010815_3429_4262 | 275 |
| 741 | 3300046520 | Ga0495637_0012084 | Ga0495637_0012084_113_955 | 275 |
| 742 | 3300046520 | Ga0495637_0023417 | Ga0495637_0023417_162_989 | 275 |
| 743 | 3300046520 | Ga0495637_0031187 | Ga0495637_0031187_283_1119 | 275 |
| 744 | 3300046520 | Ga0495637_0033844 | Ga0495637_0033844_388_1215 | 275 |
| 745 | 3300046522 | Ga0495643_0018488 | Ga0495643_0018488_60_887 | 275 |
| 746 | 3300046522 | Ga0495643_0041904 | Ga0495643_0041904_118_951 | 275 |
| 747 | 3300046522 | Ga0495643_0047318 | Ga0495643_0047318_119_952 | 275 |
| 748 | 3300046522 | Ga0495643_0062338 | Ga0495643_0062338_951_1787 | 275 |
| 749 | 3300046523 | Ga0495644_0000263 | Ga0495644_0000263_23125_23952 | 275 |
| 750 | 3300046523 | Ga0495644_0007693 | Ga0495644_0007693_294_1121 | 275 |
| 751 | 3300046524 | Ga0495648_0010552 | Ga0495648_0010552_5909_6736 | 275 |
| 752 | 3300046524 | Ga0495648_0014408 | Ga0495648_0014408_140_973 | 275 |
| 753 | 3300046524 | Ga0495648_0050867 | Ga0495648_0050867_1368_2204 | 275 |
| 754 | 3300046524 | Ga0495648_0055177 | Ga0495648_0055177_139_972 | 275 |
| 755 | 3300046524 | Ga0495648_0057960 | Ga0495648_0057960_139_966 | 275 |
| 756 | 3300046530 | Ga0495654_0005639 | Ga0495654_0005639_291_1118 | 275 |
| 757 | 3300046530 | Ga0495654_0009777 | Ga0495654_0009777_4008_4835 | 275 |
| 758 | 3300046530 | Ga0495654_0064574 | Ga0495654_0064574_189_1016 | 275 |
| 759 | 3300046530 | Ga0495654_0091559 | Ga0495654_0091559_528_1355 | 275 |
| 760 | 3300046538 | Ga0495609_0009321 | Ga0495609_0009321_3803_4636 | 275 |
| 761 | 3300046538 | Ga0495609_0031071 | Ga0495609_0031071_276_1103 | 275 |
| 762 | 3300046542 | Ga0495597_0011910 | Ga0495597_0011910_168_995 | 275 |
| 763 | 3300046542 | Ga0495597_0055168 | Ga0495597_0055168_857_1693 | 275 |
| 764 | 3300046542 | Ga0495597_0122675 | Ga0495597_0122675_130_972 | 275 |
| 765 | 3300046557 | Ga0495622_0023025 | Ga0495622_0023025_226_1053 | 275 |
| 766 | 3300046616 | Ga0495668_0017547 | Ga0495668_0017547_289_1116 | 275 |
| 767 | 3300046616 | Ga0495668_0175663 | Ga0495668_0175663_219_1052 | 275 |
| 768 | 3300046648 | Ga0495611_0000355 | Ga0495611_0000355_28968_29801 | 275 |
| 769 | 3300046660 | Ga0495625_0071664 | Ga0495625_0071664_1425_2258 | 275 |
| 770 | 3300046660 | Ga0495625_0080452 | Ga0495625_0080452_1265_2092 | 275 |
| 771 | 3300046665 | Ga0495661_0020091 | Ga0495661_0020091_3366_4193 | 275 |
| 772 | 3300046665 | Ga0495661_0075465 | Ga0495661_0075465_929_1765 | 275 |
| 773 | 3300046665 | Ga0495661_0104795 | Ga0495661_0104795_64_891 | 275 |
| 774 | 3300046691 | Ga0495670_0006310 | Ga0495670_0006310_4854_5687 | 275 |
| 775 | 3300046691 | Ga0495670_0023283 | Ga0495670_0023283_170_997 | 275 |
| 776 | 3300046691 | Ga0495670_0037601 | Ga0495670_0037601_109_936 | 275 |
| 777 | 3300046691 | Ga0495670_0068211 | Ga0495670_0068211_258_1094 | 275 |
| 778 | 3300046692 | Ga0495671_0014700 | Ga0495671_0014700_340_1167 | 275 |
| 779 | 3300046692 | Ga0495671_0038266 | Ga0495671_0038266_1392_2228 | 275 |
| 780 | 3300046692 | Ga0495671_0041772 | Ga0495671_0041772_1393_2226 | 275 |
| 781 | 3300046694 | Ga0495649_0006623 | Ga0495649_0006623_6078_6914 | 275 |
| 782 | 3300046694 | Ga0495649_0055951 | Ga0495649_0055951_1013_1840 | 275 |
| 783 | 3300046694 | Ga0495649_0064181 | Ga0495649_0064181_119_946 | 275 |
| 784 | 3300046794 | Ga0495589_0005113 | Ga0495589_0005113_5900_6733 | 275 |
| 785 | 3300046794 | Ga0495589_0005201 | Ga0495589_0005201_72_899 | 275 |
| 786 | 3300046794 | Ga0495589_0038432 | Ga0495589_0038432_215_1051 | 275 |
| 787 | 3300046810 | Ga0495660_0087999 | Ga0495660_0087999_645_1472 | 275 |
| 788 | 3300047323 | Ga0495683_0005619 | Ga0495683_0005619_5857_6693 | 275 |
| 789 | 3300047323 | Ga0495683_0040157 | Ga0495683_0040157_1419_2246 | 275 |
| 790 | 3300047443 | Ga0495687_030540 | Ga0495687_030540_249_1085 | 275 |
| 791 | 3300047469 | Ga0495673_0012503 | Ga0495673_0012503_288_1115 | 275 |
| 792 | 3300047469 | Ga0495673_0019229 | Ga0495673_0019229_212_1039 | 275 |
| 793 | 3300047469 | Ga0495673_0027043 | Ga0495673_0027043_331_1170 | 275 |
| 794 | 3300047469 | Ga0495673_0031370 | Ga0495673_0031370_1549_2388 | 275 |
| 795 | 3300047470 | Ga0495681_0002319 | Ga0495681_0002319_12671_13498 | 275 |
| 796 | 3300047470 | Ga0495681_0010043 | Ga0495681_0010043_137_970 | 275 |
| 797 | 3300047470 | Ga0495681_0017951 | Ga0495681_0017951_2911_3738 | 275 |
| 798 | 3300047470 | Ga0495681_0021905 | Ga0495681_0021905_2342_3178 | 275 |
| 799 | 3300047470 | Ga0495681_0043515 | Ga0495681_0043515_325_1152 | 275 |
| 800 | 3300047470 | Ga0495681_0099819 | Ga0495681_0099819_323_1150 | 275 |
| 801 | 3300047472 | Ga0495686_0017289 | Ga0495686_0017289_230_1066 | 275 |
| 802 | 3300047472 | Ga0495686_0048581 | Ga0495686_0048581_266_1093 | 275 |
| 803 | 3300047472 | Ga0495686_0057325 | Ga0495686_0057325_224_1057 | 275 |
| 804 | 3300047472 | Ga0495686_0065359 | Ga0495686_0065359_1304_2146 | 275 |
| 805 | 3300048091 | Ga0495626_0000416 | Ga0495626_0000416_42462_43289 | 275 |
| 806 | 3300048091 | Ga0495626_0072382 | Ga0495626_0072382_35_871 | 275 |
| 807 | 3300048919 | Ga0496116_0008290 | Ga0496116_0008290_7135_7968 | 275 |
| 808 | 3300048919 | Ga0496116_0022008 | Ga0496116_0022008_131_961 | 275 |
| 809 | 3300048920 | Ga0496117_0024130 | Ga0496117_0024130_137_967 | 275 |
| 810 | 3300048921 | Ga0496118_0020864 | Ga0496118_0020864_4768_5598 | 275 |
| 811 | 3300048924 | Ga0496121_0061053 | Ga0496121_0061053_202_1029 | 275 |
| 812 | 3300048926 | Ga0496123_0022696 | Ga0496123_0022696_171_1001 | 275 |
| 813 | 3300049460 | Ga0495682_0116906 | Ga0495682_0116906_64_897 | 275 |
| 814 | 3300050516 | nmdc:mga0sz30_22252_c1 | nmdc:mga0sz30_22252_c1_1659_2498 | 275 |
| 815 | iso_pu_bacteria | 8056177738 | 8056179365 | 275 |
| 816 | 3300003781 | Ga0055536_1000579 | Ga0055536_100057923 | 276 |
| 817 | 3300003791 | Ga0055530_10001021 | Ga0055530_100010213 | 276 |
| 818 | 3300003792 | Ga0055540_1000633 | Ga0055540_100063323 | 276 |
| 819 | 3300003794 | Ga0055531_10000342 | Ga0055531_1000034237 | 276 |
| 820 | 3300005353 | Ga0070669_100017216 | Ga0070669_1000172164 | 276 |
| 821 | 3300025292 | Ga0209676_1000010 | Ga0209676_1000010209 | 276 |
| 822 | 3300025298 | Ga0209050_1000081 | Ga0209050_100008141 | 276 |
| 823 | 3300025303 | Ga0209051_1000104 | Ga0209051_100010446 | 276 |
| 824 | 3300025304 | Ga0209257_1000040 | Ga0209257_1000040316 | 276 |
| 825 | 3300025711 | Ga0207696_1014946 | Ga0207696_10149464 | 276 |
| 826 | 3300025735 | Ga0207713_1000721 | Ga0207713_100072126 | 276 |
| 827 | 3300025735 | Ga0207713_1003762 | Ga0207713_100376212 | 276 |
| 828 | 3300025923 | Ga0207681_10011889 | Ga0207681_100118893 | 276 |
| 829 | 2124908027 | MRS2a_Contig_380 | MRS2a_00272140 | 278 |
| 830 | 3300005288 | Ga0065714_10007950 | Ga0065714_100079504 | 278 |
| 831 | 3300005288 | Ga0065714_10020066 | Ga0065714_100200662 | 278 |
| 832 | 3300005290 | Ga0065712_10001182 | Ga0065712_100011823 | 278 |
| 833 | 3300006058 | Ga0075432_10012745 | Ga0075432_100127453 | 278 |
| 834 | 3300006058 | Ga0075432_10019216 | Ga0075432_100192162 | 278 |
| 835 | 3300006946 | Ga0079104_1000115 | Ga0079104_100011598 | 278 |
| 836 | 3300009036 | Ga0105244_10004412 | Ga0105244_1000441210 | 278 |
| 837 | 3300009148 | Ga0105243_10000355 | Ga0105243_1000035538 | 278 |
| 838 | 3300009176 | Ga0105242_10327486 | Ga0105242_103274862 | 278 |
| 839 | 3300011119 | Ga0105246_10005168 | Ga0105246_100051683 | 278 |
| 840 | 3300013100 | Ga0157373_10089816 | Ga0157373_100898162 | 278 |
| 841 | 3300013102 | Ga0157371_10070678 | Ga0157371_100706782 | 278 |
| 842 | 3300013104 | Ga0157370_10128484 | Ga0157370_101284843 | 278 |
| 843 | 3300013104 | Ga0157370_10376429 | Ga0157370_103764292 | 278 |
| 844 | 3300015261 | Ga0182006_1042720 | Ga0182006_10427202 | 278 |
| 845 | 3300015261 | Ga0182006_1083250 | Ga0182006_10832501 | 278 |
| 846 | 3300015262 | Ga0182007_10000381 | Ga0182007_100003812 | 278 |
| 847 | 3300015265 | Ga0182005_1000394 | Ga0182005_10003942 | 278 |
| 848 | 3300025711 | Ga0207696_1002724 | Ga0207696_10027243 | 278 |
| 849 | 3300025728 | Ga0207655_1000622 | Ga0207655_100062237 | 278 |
| 850 | 3300025728 | Ga0207655_1000772 | Ga0207655_100077210 | 278 |
| 851 | 3300025735 | Ga0207713_1009390 | Ga0207713_10093907 | 278 |
| 852 | 3300025935 | Ga0207709_10000035 | Ga0207709_10000035207 | 278 |
| 853 | 3300027111 | Ga0209281_1000077 | Ga0209281_1000077200 | 278 |
| 854 | 3300038705 | Ga0237819_00664 | Ga0237819_00664_3555_4391 | 278 |
| 855 | 3300041407 | Ga0439447_006680 | Ga0439447_006680_1700_2536 | 278 |
| 856 | 3300041407 | Ga0439447_008087 | Ga0439447_008087_1071_1907 | 278 |
| 857 | 3300041411 | Ga0439466_0001699 | Ga0439466_0001699_1130_1966 | 278 |
| 858 | 3300041413 | Ga0439465_0016959 | Ga0439465_0016959_1233_2069 | 278 |
| 859 | 3300042006 | Ga0439432_024206 | Ga0439432_024206_327_1163 | 278 |
| 860 | 3300042006 | Ga0439432_052842 | Ga0439432_052842_356_1192 | 278 |
| 861 | 3300042009 | Ga0439451_007175 | Ga0439451_007175_1102_1938 | 278 |
| 862 | 3300042009 | Ga0439451_010953 | Ga0439451_010953_669_1505 | 278 |
| 863 | 3300042010 | Ga0439452_015355 | Ga0439452_015355_111_947 | 278 |
| 864 | 3300042010 | Ga0439452_021515 | Ga0439452_021515_737_1573 | 278 |
| 865 | 3300042013 | Ga0439456_005623 | Ga0439456_005623_1601_2437 | 278 |
| 866 | 3300042115 | Ga0450911_004090 | Ga0450911_004090_1368_2204 | 278 |
| 867 | 3300042121 | Ga0450919_001084 | Ga0450919_001084_1580_2416 | 278 |
| 868 | 3300042124 | Ga0450922_003980 | Ga0450922_003980_283_1119 | 278 |
| 869 | 3300042127 | Ga0450890_000462 | Ga0450890_000462_237_1073 | 278 |
| 870 | 3300042138 | Ga0450903_012540 | Ga0450903_012540_356_1192 | 278 |
| 871 | 3300042145 | Ga0450906_003853 | Ga0450906_003853_1971_2807 | 278 |
| 872 | 3300042146 | Ga0450907_000091 | Ga0450907_000091_1061_1897 | 278 |
| 873 | 3300042146 | Ga0450907_009673 | Ga0450907_009673_381_1217 | 278 |
| 874 | 3300042156 | Ga0439446_0010173 | Ga0439446_0010173_1469_2305 | 278 |
| 875 | 3300042156 | Ga0439446_0037314 | Ga0439446_0037314_374_1210 | 278 |
| 876 | 3300042184 | Ga0450908_004255 | Ga0450908_004255_1770_2669 | 278 |
| 877 | 3300042185 | Ga0450909_000736 | Ga0450909_000736_1608_2444 | 278 |
| 878 | 3300042185 | Ga0450909_002924 | Ga0450909_002924_1355_2191 | 278 |
| 879 | 3300042435 | Ga0439434_0019081 | Ga0439434_0019081_254_1090 | 278 |
| 880 | 3300042439 | Ga0439464_0016259 | Ga0439464_0016259_123_1022 | 278 |
| 881 | 3300042461 | Ga0439460_0004129 | Ga0439460_0004129_2451_3287 | 278 |
| 882 | 3300042531 | Ga0450918_003883 | Ga0450918_003883_1763_2599 | 278 |
| 883 | 3300042993 | Ga0439440_0007359 | Ga0439440_0007359_237_1073 | 278 |
| 884 | 3300042993 | Ga0439440_0027862 | Ga0439440_0027862_240_1076 | 278 |
| 885 | 3300046452 | Ga0495617_000364 | Ga0495617_000364_22904_23824 | 278 |
| 886 | 3300046452 | Ga0495617_066684 | Ga0495617_066684_235_1071 | 278 |
| 887 | 3300046455 | Ga0495603_0111872 | Ga0495603_0111872_546_1382 | 278 |
| 888 | 3300046457 | Ga0495590_0004085 | Ga0495590_0004085_192_1040 | 278 |
| 889 | 3300046457 | Ga0495590_0017315 | Ga0495590_0017315_1493_2413 | 278 |
| 890 | 3300046457 | Ga0495590_0042034 | Ga0495590_0042034_101_937 | 278 |
| 891 | 3300046458 | Ga0495591_023799 | Ga0495591_023799_240_1076 | 278 |
| 892 | 3300046460 | Ga0495638_0057833 | Ga0495638_0057833_1386_2231 | 278 |
| 893 | 3300046463 | Ga0495653_0042046 | Ga0495653_0042046_2551_3387 | 278 |
| 894 | 3300046471 | Ga0495650_0029443 | Ga0495650_0029443_1358_2194 | 278 |
| 895 | 3300046471 | Ga0495650_0043402 | Ga0495650_0043402_178_1098 | 278 |
| 896 | 3300046474 | Ga0495605_0000464 | Ga0495605_0000464_35217_36065 | 278 |
| 897 | 3300046474 | Ga0495605_0034666 | Ga0495605_0034666_349_1185 | 278 |
| 898 | 3300046474 | Ga0495605_0035876 | Ga0495605_0035876_76_996 | 278 |
| 899 | 3300046474 | Ga0495605_0058365 | Ga0495605_0058365_165_1001 | 278 |
| 900 | 3300046475 | Ga0495639_0000126 | Ga0495639_0000126_1073_1921 | 278 |
| 901 | 3300046475 | Ga0495639_0181761 | Ga0495639_0181761_15_851 | 278 |
| 902 | 3300046491 | Ga0495584_0012814 | Ga0495584_0012814_2307_3143 | 278 |
| 903 | 3300046491 | Ga0495584_0033055 | Ga0495584_0033055_180_1100 | 278 |
| 904 | 3300046491 | Ga0495584_0035561 | Ga0495584_0035561_311_1147 | 278 |
| 905 | 3300046492 | Ga0495585_0053263 | Ga0495585_0053263_350_1186 | 278 |
| 906 | 3300046492 | Ga0495585_0060099 | Ga0495585_0060099_203_1039 | 278 |
| 907 | 3300046499 | Ga0495594_0029492 | Ga0495594_0029492_2009_2845 | 278 |
| 908 | 3300046499 | Ga0495594_0071648 | Ga0495594_0071648_103_939 | 278 |
| 909 | 3300046501 | Ga0495607_0008515 | Ga0495607_0008515_997_1917 | 278 |
| 910 | 3300046501 | Ga0495607_0009108 | Ga0495607_0009108_609_1457 | 278 |
| 911 | 3300046506 | Ga0495583_0032884 | Ga0495583_0032884_245_1081 | 278 |
| 912 | 3300046512 | Ga0495610_0092479 | Ga0495610_0092479_156_1004 | 278 |
| 913 | 3300046513 | Ga0495616_0000456 | Ga0495616_0000456_29958_30878 | 278 |
| 914 | 3300046518 | Ga0495631_0148495 | Ga0495631_0148495_132_980 | 278 |
| 915 | 3300046519 | Ga0495632_0000427 | Ga0495632_0000427_176_1096 | 278 |
| 916 | 3300046519 | Ga0495632_0037048 | Ga0495632_0037048_1389_2225 | 278 |
| 917 | 3300046520 | Ga0495637_0026080 | Ga0495637_0026080_1694_2530 | 278 |
| 918 | 3300046520 | Ga0495637_0051574 | Ga0495637_0051574_115_1035 | 278 |
| 919 | 3300046522 | Ga0495643_0092879 | Ga0495643_0092879_345_1181 | 278 |
| 920 | 3300046523 | Ga0495644_0111029 | Ga0495644_0111029_102_938 | 278 |
| 921 | 3300046524 | Ga0495648_0153126 | Ga0495648_0153126_147_983 | 278 |
| 922 | 3300046526 | Ga0495666_0083334 | Ga0495666_0083334_85_933 | 278 |
| 923 | 3300046528 | Ga0495642_0000230 | Ga0495642_0000230_176_1024 | 278 |
| 924 | 3300046528 | Ga0495642_0020713 | Ga0495642_0020713_1517_2437 | 278 |
| 925 | 3300046528 | Ga0495642_0021576 | Ga0495642_0021576_327_1163 | 278 |
| 926 | 3300046530 | Ga0495654_0041762 | Ga0495654_0041762_86_934 | 278 |
| 927 | 3300046530 | Ga0495654_0061452 | Ga0495654_0061452_152_1072 | 278 |
| 928 | 3300046536 | Ga0495587_0027521 | Ga0495587_0027521_222_1061 | 278 |
| 929 | 3300046538 | Ga0495609_0027600 | Ga0495609_0027600_182_1102 | 278 |
| 930 | 3300046538 | Ga0495609_0038753 | Ga0495609_0038753_245_1081 | 278 |
| 931 | 3300046538 | Ga0495609_0117406 | Ga0495609_0117406_172_1017 | 278 |
| 932 | 3300046542 | Ga0495597_0025461 | Ga0495597_0025461_170_1090 | 278 |
| 933 | 3300046542 | Ga0495597_0030943 | Ga0495597_0030943_1382_2218 | 278 |
| 934 | 3300046557 | Ga0495622_0001469 | Ga0495622_0001469_244_1092 | 278 |
| 935 | 3300046557 | Ga0495622_0006301 | Ga0495622_0006301_241_1077 | 278 |
| 936 | 3300046615 | Ga0495656_0014942 | Ga0495656_0014942_669_1505 | 278 |
| 937 | 3300046642 | Ga0495634_0043051 | Ga0495634_0043051_182_1018 | 278 |
| 938 | 3300046648 | Ga0495611_0134168 | Ga0495611_0134168_65_985 | 278 |
| 939 | 3300046663 | Ga0495635_0003528 | Ga0495635_0003528_167_1006 | 278 |
| 940 | 3300046664 | Ga0495659_0000468 | Ga0495659_0000468_775_1623 | 278 |
| 941 | 3300046665 | Ga0495661_0036064 | Ga0495661_0036064_2087_2935 | 278 |
| 942 | 3300046674 | Ga0495588_0048602 | Ga0495588_0048602_191_1027 | 278 |
| 943 | 3300046674 | Ga0495588_0056486 | Ga0495588_0056486_155_1003 | 278 |
| 944 | 3300046675 | Ga0495657_0087236 | Ga0495657_0087236_213_1049 | 278 |
| 945 | 3300046679 | Ga0495623_0057376 | Ga0495623_0057376_181_1017 | 278 |
| 946 | 3300046684 | Ga0495669_0010984 | Ga0495669_0010984_76_924 | 278 |
| 947 | 3300046684 | Ga0495669_0036043 | Ga0495669_0036043_1278_2114 | 278 |
| 948 | 3300046691 | Ga0495670_0006336 | Ga0495670_0006336_165_1010 | 278 |
| 949 | 3300046691 | Ga0495670_0012400 | Ga0495670_0012400_2423_3271 | 278 |
| 950 | 3300046692 | Ga0495671_0011783 | Ga0495671_0011783_1894_2730 | 278 |
| 951 | 3300046692 | Ga0495671_0019126 | Ga0495671_0019126_276_1112 | 278 |
| 952 | 3300046694 | Ga0495649_0001671 | Ga0495649_0001671_961_1881 | 278 |
| 953 | 3300046694 | Ga0495649_0043997 | Ga0495649_0043997_142_990 | 278 |
| 954 | 3300046694 | Ga0495649_0107469 | Ga0495649_0107469_431_1279 | 278 |
| 955 | 3300046794 | Ga0495589_0006828 | Ga0495589_0006828_1002_1922 | 278 |
| 956 | 3300046794 | Ga0495589_0035101 | Ga0495589_0035101_1403_2251 | 278 |
| 957 | 3300046794 | Ga0495589_0046978 | Ga0495589_0046978_1278_2114 | 278 |
| 958 | 3300047315 | Ga0495581_0048449 | Ga0495581_0048449_222_1142 | 278 |
| 959 | 3300047317 | Ga0495604_0083241 | Ga0495604_0083241_1374_2210 | 278 |
| 960 | 3300047318 | Ga0495636_0003818 | Ga0495636_0003818_176_1096 | 278 |
| 961 | 3300047318 | Ga0495636_0138033 | Ga0495636_0138033_32_868 | 278 |
| 962 | 3300047318 | Ga0495636_0195964 | Ga0495636_0195964_24_860 | 278 |
| 963 | 3300047319 | Ga0495674_0112698 | Ga0495674_0112698_1270_2109 | 278 |
| 964 | 3300047320 | Ga0495672_0010958 | Ga0495672_0010958_1011_1931 | 278 |
| 965 | 3300047320 | Ga0495672_0011169 | Ga0495672_0011169_180_1028 | 278 |
| 966 | 3300047320 | Ga0495672_0068758 | Ga0495672_0068758_985_1833 | 278 |
| 967 | 3300047320 | Ga0495672_0075812 | Ga0495672_0075812_973_1818 | 278 |
| 968 | 3300047320 | Ga0495672_0123491 | Ga0495672_0123491_219_1055 | 278 |
| 969 | 3300047323 | Ga0495683_0063581 | Ga0495683_0063581_135_971 | 278 |
| 970 | 3300047323 | Ga0495683_0064867 | Ga0495683_0064867_530_1378 | 278 |
| 971 | 3300047323 | Ga0495683_0114668 | Ga0495683_0114668_327_1163 | 278 |
| 972 | 3300047443 | Ga0495687_005757 | Ga0495687_005757_1111_2031 | 278 |
| 973 | 3300047443 | Ga0495687_022403 | Ga0495687_022403_1966_2811 | 278 |
| 974 | 3300047443 | Ga0495687_045587 | Ga0495687_045587_473_1321 | 278 |
| 975 | 3300047445 | Ga0495677_0003786 | Ga0495677_0003786_4760_5596 | 278 |
| 976 | 3300047447 | Ga0495685_023507 | Ga0495685_023507_1214_2050 | 278 |
| 977 | 3300047447 | Ga0495685_057075 | Ga0495685_057075_294_1214 | 278 |
| 978 | 3300047469 | Ga0495673_0001019 | Ga0495673_0001019_23538_24374 | 278 |
| 979 | 3300047469 | Ga0495673_0029074 | Ga0495673_0029074_1517_2437 | 278 |
| 980 | 3300047469 | Ga0495673_0038111 | Ga0495673_0038111_1269_2105 | 278 |
| 981 | 3300047673 | Ga0495593_0041077 | Ga0495593_0041077_1397_2317 | 278 |
| 982 | 3300047673 | Ga0495593_0174330 | Ga0495593_0174330_166_1005 | 278 |
| 983 | 3300048091 | Ga0495626_0002043 | Ga0495626_0002043_156_1076 | 278 |
| 984 | 3300048091 | Ga0495626_0116140 | Ga0495626_0116140_92_928 | 278 |
| 985 | 3300048091 | Ga0495626_0120786 | Ga0495626_0120786_115_1035 | 278 |
| 986 | 3300048905 | Ga0496102_0556469 | Ga0496102_0556469_149_985 | 278 |
| 987 | 3300048906 | Ga0496103_0079918 | Ga0496103_0079918_1022_1858 | 278 |
| 988 | 3300048913 | Ga0496110_0113655 | Ga0496110_0113655_1380_2216 | 278 |
| 989 | 3300048914 | Ga0496111_0226886 | Ga0496111_0226886_178_1014 | 278 |
| 990 | 3300048919 | Ga0496116_0003783 | Ga0496116_0003783_649_1497 | 278 |
| 991 | 3300048919 | Ga0496116_0190307 | Ga0496116_0190307_177_1013 | 278 |
| 992 | 3300048920 | Ga0496117_0082349 | Ga0496117_0082349_1115_1963 | 278 |
| 993 | 3300048921 | Ga0496118_0148079 | Ga0496118_0148079_546_1394 | 278 |
| 994 | 3300048925 | Ga0496122_0014568 | Ga0496122_0014568_6552_7400 | 278 |
| 995 | 3300048927 | Ga0496124_0104339 | Ga0496124_0104339_1294_2130 | 278 |
| 996 | 3300048928 | Ga0496125_0083020 | Ga0496125_0083020_1409_2245 | 278 |
| 997 | 3300049459 | Ga0495678_006332 | Ga0495678_006332_5228_6148 | 278 |
| 998 | 3300049459 | Ga0495678_021911 | Ga0495678_021911_1726_2562 | 278 |
| 999 | 3300049460 | Ga0495682_0019588 | Ga0495682_0019588_343_1188 | 278 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gpm-assembly1.cif.gz_A | crystal structure of domain 2 from tmargbp | 0.8297 | 120 | 208 |
| 6gpc-assembly1.cif.gz_A | crystal structure of the arginine-bound form of domain 1 from tmargbp | 0.822 | 29 | 116 |
| 7a99-assembly1.cif.gz_A | crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp | 0.8203 | 29 | 113 |
| 6mld-assembly1.cif.gz_A | crystal structure of the periplasmic lysine-, arginine-, ornithine-binding protein (lao) f52a mutant from salmonella typhimurium | 0.8101 | 29 | 256 |
| 2o1m-assembly1.cif.gz_A | crystal structure of the probable amino-acid abc transporter extracellular-binding protein ytmk from bacillus subtilis. northeast structural genomics consortium target sr572 | 0.7897 | 27 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mplA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8571 | 29 | 116 | 3.40.190.10 |
| af_P0AEU0_25_107_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8511 | 29 | 106 | 3.40.190.10 |
| 3h7mA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8458 | 27 | 256 | 3.40.190.10 |
| 4kqpA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8421 | 27 | 257 | 3.40.190.10 |
| 3kzgC01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8391 | 30 | 113 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5K7TV47-F1-model_v4 | ABC transporter substrate-binding protein | 0.9383 | 15 | 270 |
|
| AF-A0A258C513-F1-model_v4 | Amino acid ABC transporter substrate-binding protein | 0.9343 | 18 | 264 |
|
| AF-S6VFC3-F1-model_v4 | Uncharacterized protein | 0.9266 | 68 | 278 |
|
| AF-S6VFC3-F1-model_v4 | Uncharacterized protein | 0.9181 | 68 | 278 |
|
| AF-A0A0L6FVI0-F1-model_v4 | deleted | 0.9153 | 15 | 278 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar