F487836

General Info

Members Datasets Scaffolds Average Seq Length
999 450 789 276

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100008399|Ga0070670_1000083992
Length 270
Sequence MELRPWALLLGLSLLPGLALAAGKCERLVITGSPDTPPLLWRDPQDPTHLIGATADVLQQVTKDLGVKIDLLYGGNRSMALDEVRSGRMDIFADAPLNHAQLGNFDYIHPALVQTDYRVWTRTDSALVYASATDLQGFKGAASERARLSQGFETLAQHLTLQRFPSLTPAFQKLLLGEVDYVLAGRYSGMAMAQTLGMSNDLIARDTPVDQAGLHLAISHNSACNDPWLRGQLAKKMTELPGSGVTEAALQRNLERWKAQLQQPVGTPTQ

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231031 Pseudomonas sp. GM16 Isolate Nodule
21 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
22 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
23 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
24 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
25 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
26 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
27 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
28 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
29 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
30 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
31 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
32 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
33 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
34 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
35 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
36 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
37 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
38 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
39 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
40 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
41 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
42 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
43 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
44 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
45 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
46 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
47 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
48 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
49 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
50 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
51 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
52 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
53 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
54 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
55 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
56 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
57 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
58 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
59 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
60 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
61 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
62 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
63 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
64 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
65 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
66 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
67 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
68 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
69 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
70 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
71 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
72 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
73 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
74 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
75 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
76 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
77 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
78 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
79 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
80 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
81 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
82 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
83 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
84 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
85 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
86 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
87 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
88 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
89 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
90 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
91 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
92 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
93 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
94 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
95 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
96 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
97 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
98 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
99 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
100 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
101 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
102 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
103 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
104 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
105 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
106 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
107 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
108 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
109 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
110 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
111 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
112 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
113 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
114 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
115 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
116 2773857670 Pseudomonas sp. 478 Isolate Unclassified
117 2773857673 Pseudomonas sp. 443 Isolate Unclassified
118 2784132063 Pseudomonas sp. 424 Isolate Unclassified
119 2784132072 Pseudomonas sp. 460 Isolate Unclassified
120 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
121 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
122 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
123 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
124 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
125 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
126 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
127 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
128 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
129 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
130 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
131 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
132 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
133 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
134 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
135 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
136 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
137 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
138 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
139 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
140 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
141 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
142 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
143 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
144 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
145 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
146 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
147 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
148 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
149 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
150 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
151 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
152 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
153 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
154 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
155 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
156 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
157 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
158 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
159 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
160 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
161 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
162 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
163 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
164 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
165 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
166 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
167 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
168 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
169 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
170 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
171 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
172 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
173 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
174 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
175 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
176 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
177 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
178 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
179 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
180 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
181 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
182 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
183 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
184 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
185 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
186 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
187 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
188 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
189 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
190 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
191 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
192 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
193 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
194 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
195 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
196 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
197 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
198 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
199 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
200 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
201 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
202 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
203 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
204 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
205 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
206 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
207 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
208 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
209 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
210 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
211 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
212 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
213 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
214 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
215 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
216 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
217 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
218 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
219 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
220 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
221 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
222 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
223 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
224 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
225 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
226 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
227 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
228 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
229 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
230 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
231 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
232 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
233 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
234 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
235 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
236 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
237 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
238 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
239 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
240 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
241 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
242 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
243 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
244 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
245 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
251 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
252 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
254 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
256 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
257 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
276 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
277 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
279 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
280 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
281 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
282 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
283 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
284 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
285 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
286 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
287 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
288 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
289 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
290 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
291 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
292 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
293 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
294 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
295 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
296 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
297 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
298 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
299 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
300 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
301 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
302 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
303 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
304 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
305 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
306 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
307 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
308 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
309 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
310 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
311 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
312 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
313 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
314 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
315 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
316 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
317 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
318 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
319 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
320 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
321 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
322 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
323 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
324 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
325 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
326 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
327 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
328 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
329 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
330 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
331 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
332 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
333 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
334 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
335 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
336 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
337 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
340 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
341 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
342 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
343 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
344 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
345 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
346 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
347 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
348 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
349 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
350 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
351 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
352 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
353 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
354 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
355 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
356 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
357 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
358 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
359 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
360 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
361 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
362 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
363 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
364 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
365 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
366 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
367 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
368 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
369 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
370 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
371 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
374 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
375 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
376 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
377 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
378 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
379 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
380 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
381 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
382 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
383 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
384 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
385 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
386 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
387 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
388 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
389 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
390 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
391 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
392 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
393 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
394 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
395 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
396 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
397 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
398 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
399 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
400 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
401 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
402 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
403 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
404 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
405 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
406 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
407 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
408 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
409 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
410 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
411 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
412 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
413 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
414 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
415 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
416 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
417 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
418 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
419 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
420 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
421 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
422 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
423 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
424 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
425 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
426 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
427 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
428 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
429 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
430 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
431 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
432 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
433 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
434 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
435 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
436 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
437 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
438 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
439 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
440 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
441 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
442 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
443 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
444 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
445 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
446 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
447 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
448 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
449 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
450 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.98
Metatranscriptomes 0
Isolates 21.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.31
Nodule 2.7
Rhizoplane 6.91
Rhizosphere 73.77
Stem 0
Stem Tuber 0
Unclassified 10.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_380 2124908027 Bacteria 6217
2 SwRhRL2b_contig_113783 2162886007 Bacteria 2361
3 JGI25162J39368_1000042 3300002737 Bacteria 173466
4 JGI25162J39368_1000080 3300002737 Bacteria 113071
5 JGI25154J39366_1005919 3300002738 Bacteria 1868
6 JGI25163J39215_1000372 3300002771 Bacteria 14501
7 JGI25163J39215_1000761 3300002771 Bacteria 8009
8 JGI25164J39214_1000023 3300002772 Bacteria 165681
9 JGI25164J39214_1000073 3300002772 Bacteria 98902
10 JGI25165J46597_1000083 3300003214 Bacteria 173466
11 JGI25165J46597_1000152 3300003214 Bacteria 113071
12 Ga0055538_1000027 3300003751 Bacteria 216576
13 Ga0055539_1000036 3300003752 Bacteria 216576
14 Ga0055533_1000046 3300003756 Bacteria 216576
15 Ga0055532_1000032 3300003758 Bacteria 216568
16 Ga0055525_1000145 3300003759 Bacteria 98169
17 Ga0055536_1000233 3300003781 Bacteria 44539
18 Ga0055536_1000246 3300003781 Bacteria 43104
19 Ga0055536_1000579 3300003781 Bacteria 24926
20 Ga0055530_10000120 3300003791 Bacteria 67749
21 Ga0055530_10000240 3300003791 Bacteria 49322
22 Ga0055530_10001021 3300003791 Bacteria 22378
23 Ga0055540_1000074 3300003792 Bacteria 116719
24 Ga0055540_1000248 3300003792 Bacteria 49322
25 Ga0055540_1000633 3300003792 Bacteria 24956
26 Ga0055531_10000342 3300003794 Bacteria 45796
27 Ga0055541_1000024 3300003841 Bacteria 216576
28 Ga0065714_10002428 3300005288 Bacteria 23357
29 Ga0065714_10003367 3300005288 Bacteria 11473
30 Ga0065714_10007950 3300005288 Bacteria 2844
31 Ga0065714_10017841 3300005288 Bacteria 2302
32 Ga0065714_10020066 3300005288 Bacteria 1167
33 Ga0065714_10077206 3300005288 Bacteria 2709
34 Ga0065714_10085274 3300005288 Bacteria 2156
35 Ga0065704_10070222 3300005289 Bacteria 63342
36 Ga0065712_10001182 3300005290 Bacteria 6542
37 Ga0065712_10009700 3300005290 Bacteria 2811
38 Ga0070670_100008399 3300005331 Bacteria 8803
39 Ga0070670_100009562 3300005331 Bacteria 8275
40 Ga0070661_100000627 3300005344 Bacteria 26263
41 Ga0070669_100017216 3300005353 Bacteria 5156
42 Ga0070669_100021607 3300005353 Bacteria 4599
43 Ga0070662_100000292 3300005457 Bacteria 29603
44 Ga0068853_100009350 3300005539 Bacteria 7902
45 Ga0070665_100060434 3300005548 Bacteria 3798
46 Ga0070665_100226561 3300005548 Bacteria 1869
47 Ga0070664_100000249 3300005564 Bacteria 38905
48 Ga0068851_10000194 3300005834 Bacteria 29920
49 Ga0075364_10171564 3300006051 Bacteria 1466
50 Ga0075432_10010646 3300006058 Bacteria 3125
51 Ga0075432_10012745 3300006058 Bacteria 2856
52 Ga0075432_10017884 3300006058 Bacteria 2417
53 Ga0075432_10019216 3300006058 Bacteria 2332
54 Ga0075432_10080050 3300006058 Bacteria 1183
55 Ga0075362_10067080 3300006177 Bacteria 1632
56 Ga0075362_10084406 3300006177 Bacteria 1467
57 Ga0075369_10112894 3300006186 Bacteria 1226
58 Ga0075436_100074505 3300006914 Bacteria 2350
59 Ga0075436_100134149 3300006914 Bacteria 1738
60 Ga0079104_1000094 3300006946 Bacteria 130202
61 Ga0079104_1000115 3300006946 Bacteria 115517
62 Ga0079104_1013365 3300006946 Bacteria 2532
63 Ga0099826_10011129 3300006948 Bacteria 6763
64 Ga0105251_10000018 3300009011 Bacteria 142493
65 Ga0105251_10001611 3300009011 Bacteria 19183
66 Ga0105251_10002244 3300009011 Bacteria 15382
67 Ga0105251_10002881 3300009011 Bacteria 12963
68 Ga0105251_10004174 3300009011 Bacteria 10025
69 Ga0105251_10029716 3300009011 Bacteria 2750
70 Ga0105251_10055966 3300009011 Bacteria 1869
71 Ga0105251_10114612 3300009011 Bacteria 1226
72 Ga0105244_10004412 3300009036 Bacteria 9699
73 Ga0105244_10026037 3300009036 Bacteria 3170
74 Ga0105244_10033499 3300009036 Bacteria 2707
75 Ga0105244_10033988 3300009036 Bacteria 2686
76 Ga0105244_10112289 3300009036 Bacteria 1325
77 Ga0105244_10179488 3300009036 Bacteria 1005
78 Ga0105250_10009453 3300009092 Bacteria 4102
79 Ga0105250_10010723 3300009092 Bacteria 3813
80 Ga0105250_10013833 3300009092 Bacteria 3324
81 Ga0105250_10016874 3300009092 Bacteria 2972
82 Ga0105243_10000355 3300009148 Bacteria 48942
83 Ga0105243_10115829 3300009148 Bacteria 2251
84 Ga0105243_10140842 3300009148 Bacteria 2058
85 Ga0105242_10000347 3300009176 Bacteria 37208
86 Ga0105242_10327486 3300009176 Bacteria 1407
87 Ga0105237_10000279 3300009545 Bacteria 71168
88 Ga0105249_10522156 3300009553 Bacteria 1235
89 Ga0105246_10005168 3300011119 Bacteria 7929
90 Ga0105246_10022009 3300011119 Bacteria 4111
91 Ga0157373_10009493 3300013100 Bacteria 7187
92 Ga0157373_10019698 3300013100 Bacteria 4908
93 Ga0157373_10068043 3300013100 Bacteria 2518
94 Ga0157373_10069991 3300013100 Bacteria 2480
95 Ga0157373_10089816 3300013100 Bacteria 2164
96 Ga0157371_10003771 3300013102 Bacteria 13565
97 Ga0157371_10011042 3300013102 Bacteria 6996
98 Ga0157371_10070678 3300013102 Bacteria 2471
99 Ga0157371_10274987 3300013102 Bacteria 1216
100 Ga0157370_10021831 3300013104 Bacteria 6377
101 Ga0157370_10051426 3300013104 Bacteria 3936
102 Ga0157370_10128484 3300013104 Bacteria 2365
103 Ga0157370_10180128 3300013104 Bacteria 1964
104 Ga0157370_10376429 3300013104 Bacteria 1308
105 Ga0157369_10032034 3300013105 Bacteria 5783
106 Ga0157369_10147135 3300013105 Bacteria 2490
107 Ga0163162_10000298 3300013306 Bacteria 45571
108 Ga0157372_10001795 3300013307 Bacteria 23304
109 Ga0157375_10142916 3300013308 Bacteria 2521
110 Ga0157375_10142969 3300013308 Bacteria 2521
111 Ga0157375_10146625 3300013308 Bacteria 2491
112 Ga0182008_10001585 3300014497 Bacteria 15142
113 Ga0182008_10005978 3300014497 Bacteria 6853
114 Ga0182008_10037548 3300014497 Bacteria 2424
115 Ga0182008_10040067 3300014497 Bacteria 2340
116 Ga0182008_10216371 3300014497 Bacteria 979
117 Ga0182006_1000648 3300015261 Bacteria 24701
118 Ga0182006_1011183 3300015261 Bacteria 3962
119 Ga0182006_1026114 3300015261 Bacteria 2394
120 Ga0182006_1042720 3300015261 Bacteria 1774
121 Ga0182006_1083250 3300015261 Bacteria 1164
122 Ga0182007_10000381 3300015262 Bacteria 27915
123 Ga0182007_10006996 3300015262 Bacteria 4785
124 Ga0182005_1000394 3300015265 Bacteria 23798
125 Ga0182005_1012188 3300015265 Bacteria 2434
126 Ga0182005_1023554 3300015265 Bacteria 1682
127 Ga0182005_1037233 3300015265 Bacteria 1323
128 Ga0182005_1053759 3300015265 Bacteria 1096
129 Ga0163161_10007368 3300017792 Bacteria 7596
130 Ga0163161_10012000 3300017792 Bacteria 6011
131 Ga0163161_10058743 3300017792 Bacteria 2796
132 Ga0163161_10072891 3300017792 Bacteria 2515
133 Ga0163161_10085338 3300017792 Bacteria 2329
134 Ga0163161_10221423 3300017792 Bacteria 1465
135 Ga0163161_10480608 3300017792 Bacteria 1009
136 Ga0163161_10650166 3300017792 Bacteria 874
137 Ga0209760_100114 3300025207 Bacteria 57573
138 Ga0209760_100200 3300025207 Bacteria 28448
139 Ga0209784_100017 3300025224 Bacteria 472003
140 Ga0209566_100014 3300025225 Bacteria 472003
141 Ga0209674_100028 3300025226 Bacteria 472003
142 Ga0209147_100038 3300025229 Bacteria 314497
143 Ga0209563_100032 3300025230 Bacteria 472003
144 Ga0209563_100888 3300025230 Bacteria 8857
145 Ga0207427_100001 3300025231 Bacteria 1410763
146 Ga0207427_100008 3300025231 Bacteria 740731
147 Ga0209437_100003 3300025233 Bacteria 1517827
148 Ga0209437_100014 3300025233 Bacteria 740714
149 Ga0209437_104655 3300025233 Bacteria 2394
150 Ga0209258_100212 3300025242 Bacteria 116067
151 Ga0209646_1000266 3300025246 Bacteria 49739
152 Ga0209677_100018 3300025253 Bacteria 472003
153 Ga0209759_1012322 3300025256 Bacteria 2375
154 Ga0209233_1000007 3300025261 Bacteria 1411234
155 Ga0209233_1000008 3300025261 Bacteria 1356712
156 Ga0209676_1000010 3300025292 Bacteria 954025
157 Ga0209676_1000021 3300025292 Bacteria 609534
158 Ga0209676_1000345 3300025292 Bacteria 88051
159 Ga0209676_1001648 3300025292 Bacteria 19583
160 Ga0209050_1000081 3300025298 Bacteria 267533
161 Ga0209050_1000162 3300025298 Bacteria 155309
162 Ga0209050_1000227 3300025298 Bacteria 123743
163 Ga0209050_1001348 3300025298 Bacteria 27074
164 Ga0209051_1000104 3300025303 Bacteria 161001
165 Ga0209051_1000121 3300025303 Bacteria 146477
166 Ga0209051_1000164 3300025303 Bacteria 124186
167 Ga0209051_1014193 3300025303 Bacteria 3730
168 Ga0209257_1000040 3300025304 Bacteria 538759
169 Ga0209257_1006723 3300025304 Bacteria 7268
170 Ga0207656_10000200 3300025321 Bacteria 21415
171 Ga0207696_1000097 3300025711 Bacteria 175696
172 Ga0207696_1000152 3300025711 Bacteria 119512
173 Ga0207696_1000321 3300025711 Bacteria 51398
174 Ga0207696_1001961 3300025711 Bacteria 10438
175 Ga0207696_1002724 3300025711 Bacteria 8419
176 Ga0207696_1014946 3300025711 Bacteria 2645
177 Ga0207696_1022273 3300025711 Bacteria 2016
178 Ga0207655_1000005 3300025728 Bacteria 917277
179 Ga0207655_1000142 3300025728 Bacteria 137562
180 Ga0207655_1000622 3300025728 Bacteria 42525
181 Ga0207655_1000772 3300025728 Bacteria 35772
182 Ga0207655_1003503 3300025728 Bacteria 11640
183 Ga0207655_1027723 3300025728 Bacteria 2691
184 Ga0207655_1032951 3300025728 Bacteria 2358
185 Ga0207655_1036123 3300025728 Bacteria 2196
186 Ga0207713_1000009 3300025735 Bacteria 551314
187 Ga0207713_1000721 3300025735 Bacteria 30937
188 Ga0207713_1001350 3300025735 Bacteria 20006
189 Ga0207713_1001775 3300025735 Bacteria 16499
190 Ga0207713_1003692 3300025735 Bacteria 10291
191 Ga0207713_1003762 3300025735 Bacteria 10187
192 Ga0207713_1009390 3300025735 Bacteria 5513
193 Ga0207713_1009446 3300025735 Bacteria 5495
194 Ga0207713_1014802 3300025735 Bacteria 4029
195 Ga0207713_1018496 3300025735 Bacteria 3448
196 Ga0207713_1030410 3300025735 Bacteria 2405
197 Ga0207713_1033067 3300025735 Bacteria 2263
198 Ga0207713_1099267 3300025735 Bacteria 1008
199 Ga0207671_10000343 3300025914 Bacteria 68390
200 Ga0207649_10000013 3300025920 Bacteria 255009
201 Ga0207681_10000619 3300025923 Bacteria 23732
202 Ga0207681_10011889 3300025923 Bacteria 5359
203 Ga0207650_10000457 3300025925 Bacteria 34586
204 Ga0207650_10000610 3300025925 Bacteria 28544
205 Ga0207706_10000140 3300025933 Bacteria 78477
206 Ga0207706_10004624 3300025933 Bacteria 12905
207 Ga0207709_10000035 3300025935 Bacteria 300968
208 Ga0207709_10000210 3300025935 Bacteria 75685
209 Ga0207709_10245296 3300025935 Bacteria 1305
210 Ga0207679_10000005 3300025945 Bacteria 525011
211 Ga0207712_10318413 3300025961 Bacteria 1282
212 Ga0207639_10000714 3300026041 Bacteria 22749
213 Ga0207678_10230949 3300026067 Bacteria 1584
214 Ga0209281_1000077 3300027111 Bacteria 262887
215 Ga0209281_1000212 3300027111 Bacteria 130216
216 Ga0209281_1002280 3300027111 Bacteria 8087
217 Ga0209281_1020846 3300027111 Bacteria 1275
218 Ga0207428_10034127 3300027907 Bacteria 4173
219 Ga0207428_10084262 3300027907 Bacteria 2478
220 Ga0207428_10101690 3300027907 Bacteria 2221
221 Ga0207428_10105023 3300027907 Bacteria 2179
222 Ga0268266_10014563 3300028379 Bacteria 6758
223 Ga0307517_10092459 3300028786 Bacteria 2461
224 Ga0307511_10038433 3300030521 Bacteria 4109
225 Ga0316178_1165151 3300030735 Bacteria 5036
226 Ga0316181_1160091 3300030744 Bacteria 4244
227 Ga0307408_100003149 3300031548 Bacteria 11367
228 Ga0307408_100160811 3300031548 Bacteria 1783
229 Ga0307408_100420348 3300031548 Bacteria 1152
230 Ga0307405_10002283 3300031731 Bacteria 8401
231 Ga0307405_10008605 3300031731 Bacteria 5183
232 Ga0307405_10162262 3300031731 Bacteria 1584
233 Ga0307413_10020501 3300031824 Bacteria 3517
234 Ga0307413_10171673 3300031824 Bacteria 1535
235 Ga0307406_10023500 3300031901 Bacteria 3668
236 Ga0307412_10001838 3300031911 Bacteria 11763
237 Ga0307412_10008886 3300031911 Bacteria 5755
238 Ga0307412_10028897 3300031911 Bacteria 3475
239 Ga0307409_100126984 3300031995 Bacteria 2171
240 Ga0307409_100546422 3300031995 Bacteria 1136
241 Ga0307416_100256312 3300032002 Bacteria 1706
242 Ga0307414_10096067 3300032004 Bacteria 2216
243 Ga0307411_10026068 3300032005 Bacteria 3513
244 Ga0307510_10000361 3300033180 Bacteria 42879
245 Ga0237819_00664 3300038705 Bacteria 11188
246 Ga0439438_002777 3300041405 Bacteria 7329
247 Ga0439438_005048 3300041405 Bacteria 4921
248 Ga0439438_012140 3300041405 Bacteria 2653
249 Ga0439438_016637 3300041405 Bacteria 2136
250 Ga0439438_053841 3300041405 Bacteria 1018
251 Ga0439447_000211 3300041407 Bacteria 20579
252 Ga0439447_002131 3300041407 Bacteria 7263
253 Ga0439447_003217 3300041407 Bacteria 5816
254 Ga0439447_006680 3300041407 Bacteria 3720
255 Ga0439447_008087 3300041407 Bacteria 3280
256 Ga0439447_013451 3300041407 Bacteria 2320
257 Ga0439447_017022 3300041407 Bacteria 1985
258 Ga0439466_0001699 3300041411 Bacteria 8595
259 Ga0439466_0013843 3300041411 Bacteria 2947
260 Ga0439466_0014054 3300041411 Bacteria 2921
261 Ga0439466_0017878 3300041411 Bacteria 2549
262 Ga0439465_0016959 3300041413 Bacteria 2273
263 Ga0439431_0007447 3300041997 Bacteria 2441
264 Ga0439445_0013932 3300042004 Bacteria 1952
265 Ga0439432_000345 3300042006 Bacteria 16944
266 Ga0439432_002044 3300042006 Bacteria 7632
267 Ga0439432_022050 3300042006 Bacteria 2105
268 Ga0439432_024206 3300042006 Bacteria 1996
269 Ga0439432_052842 3300042006 Bacteria 1264
270 Ga0439432_078328 3300042006 Bacteria 1003
271 Ga0439451_002939 3300042009 Bacteria 3465
272 Ga0439451_007175 3300042009 Bacteria 2275
273 Ga0439451_010953 3300042009 Bacteria 1828
274 Ga0439451_030333 3300042009 Bacteria 1087
275 Ga0439452_000260 3300042010 Bacteria 35564
276 Ga0439452_000369 3300042010 Bacteria 27281
277 Ga0439452_002426 3300042010 Bacteria 6875
278 Ga0439452_011706 3300042010 Bacteria 2512
279 Ga0439452_015355 3300042010 Bacteria 2104
280 Ga0439452_018057 3300042010 Bacteria 1885
281 Ga0439452_021515 3300042010 Bacteria 1679
282 Ga0439452_040714 3300042010 Bacteria 1095
283 Ga0439456_000020 3300042013 Bacteria 60976
284 Ga0439456_002240 3300042013 Bacteria 3894
285 Ga0439456_005623 3300042013 Bacteria 2547
286 Ga0439456_010385 3300042013 Bacteria 1923
287 Ga0439456_038260 3300042013 Bacteria 1037
288 Ga0439463_006180 3300042016 Bacteria 2970
289 Ga0450911_002783 3300042115 Bacteria 3303
290 Ga0450911_004090 3300042115 Bacteria 2441
291 Ga0450911_004718 3300042115 Bacteria 2200
292 Ga0450919_001084 3300042121 Bacteria 3541
293 Ga0450919_002565 3300042121 Bacteria 2351
294 Ga0450920_002530 3300042122 Bacteria 3117
295 Ga0450922_000230 3300042124 Bacteria 6028
296 Ga0450922_003980 3300042124 Bacteria 1358
297 Ga0450890_000462 3300042127 Bacteria 5953
298 Ga0450902_001942 3300042137 Bacteria 2882
299 Ga0450902_002606 3300042137 Bacteria 2566
300 Ga0450902_004206 3300042137 Bacteria 2135
301 Ga0450902_025330 3300042137 Bacteria 990
302 Ga0450903_006114 3300042138 Bacteria 2009
303 Ga0450903_009006 3300042138 Bacteria 1630
304 Ga0450903_012540 3300042138 Bacteria 1353
305 Ga0450905_003581 3300042142 Bacteria 2042
306 Ga0450906_003853 3300042145 Bacteria 3187
307 Ga0450906_006196 3300042145 Bacteria 2422
308 Ga0450906_006810 3300042145 Bacteria 2289
309 Ga0450907_000091 3300042146 Bacteria 35679
310 Ga0450907_009673 3300042146 Bacteria 1599
311 Ga0450907_018419 3300042146 Bacteria 1168
312 Ga0450910_006369 3300042147 Bacteria 1627
313 Ga0439446_0010173 3300042156 Bacteria 2530
314 Ga0439446_0037314 3300042156 Bacteria 1422
315 Ga0450908_004255 3300042184 Bacteria 2765
316 Ga0450909_000736 3300042185 Bacteria 4414
317 Ga0450909_002924 3300042185 Bacteria 2425
318 Ga0439434_0019081 3300042435 Bacteria 2056
319 Ga0439464_0016259 3300042439 Bacteria 2010
320 Ga0439460_0000623 3300042461 Bacteria 7816
321 Ga0439460_0004129 3300042461 Bacteria 3530
322 Ga0450918_003883 3300042531 Bacteria 2752
323 Ga0450893_0027592 3300042532 Bacteria 1001
324 Ga0439440_0007359 3300042993 Bacteria 2235
325 Ga0439440_0027862 3300042993 Bacteria 1315
326 Ga0439440_0027885 3300042993 Bacteria 1315
327 Ga0495617_000364 3300046452 Bacteria 24979
328 Ga0495617_004893 3300046452 Bacteria 4815
329 Ga0495617_006203 3300046452 Bacteria 4207
330 Ga0495617_011129 3300046452 Bacteria 3075
331 Ga0495617_019300 3300046452 Bacteria 2305
332 Ga0495617_033290 3300046452 Bacteria 1729
333 Ga0495617_036969 3300046452 Bacteria 1636
334 Ga0495617_052857 3300046452 Bacteria 1349
335 Ga0495617_066684 3300046452 Bacteria 1185
336 Ga0495627_000566 3300046453 Bacteria 30110
337 Ga0495627_003622 3300046453 Bacteria 6721
338 Ga0495627_018085 3300046453 Bacteria 2384
339 Ga0495627_018425 3300046453 Bacteria 2354
340 Ga0495627_019510 3300046453 Bacteria 2273
341 Ga0495627_069838 3300046453 Bacteria 1027
342 Ga0495603_0002139 3300046455 Bacteria 11624
343 Ga0495603_0111872 3300046455 Bacteria 1592
344 Ga0495590_0004085 3300046457 Bacteria 5917
345 Ga0495590_0017315 3300046457 Bacteria 2594
346 Ga0495590_0021767 3300046457 Bacteria 2270
347 Ga0495590_0022648 3300046457 Bacteria 2221
348 Ga0495590_0042034 3300046457 Bacteria 1593
349 Ga0495591_000311 3300046458 Bacteria 44231
350 Ga0495591_004686 3300046458 Bacteria 6569
351 Ga0495591_017921 3300046458 Bacteria 2415
352 Ga0495591_018412 3300046458 Bacteria 2369
353 Ga0495591_020351 3300046458 Bacteria 2194
354 Ga0495591_023799 3300046458 Bacteria 1954
355 Ga0495591_031550 3300046458 Bacteria 1588
356 Ga0495591_032037 3300046458 Bacteria 1569
357 Ga0495591_050811 3300046458 Bacteria 1133
358 Ga0495629_0083244 3300046459 Bacteria 2233
359 Ga0495638_0001645 3300046460 Bacteria 19832
360 Ga0495638_0006372 3300046460 Bacteria 8596
361 Ga0495638_0009417 3300046460 Bacteria 6861
362 Ga0495638_0013324 3300046460 Bacteria 5602
363 Ga0495638_0016495 3300046460 Bacteria 4946
364 Ga0495638_0022326 3300046460 Bacteria 4155
365 Ga0495638_0036824 3300046460 Bacteria 3114
366 Ga0495638_0057833 3300046460 Bacteria 2404
367 Ga0495638_0059844 3300046460 Bacteria 2357
368 Ga0495638_0089285 3300046460 Bacteria 1859
369 Ga0495638_0195157 3300046460 Bacteria 1146
370 Ga0495653_0042046 3300046463 Bacteria 3562
371 Ga0495653_0237520 3300046463 Bacteria 1216
372 Ga0495653_0274265 3300046463 Bacteria 1110
373 Ga0495650_0004955 3300046471 Bacteria 8878
374 Ga0495650_0008290 3300046471 Bacteria 6087
375 Ga0495650_0029443 3300046471 Bacteria 2502
376 Ga0495650_0043402 3300046471 Bacteria 1908
377 Ga0495650_0142911 3300046471 Bacteria 864
378 Ga0495582_0011175 3300046473 Bacteria 4945
379 Ga0495605_0000464 3300046474 Bacteria 36246
380 Ga0495605_0034473 3300046474 Bacteria 2562
381 Ga0495605_0034666 3300046474 Bacteria 2555
382 Ga0495605_0035876 3300046474 Bacteria 2503
383 Ga0495605_0058365 3300046474 Bacteria 1855
384 Ga0495605_0082376 3300046474 Bacteria 1503
385 Ga0495605_0143964 3300046474 Bacteria 1067
386 Ga0495605_0145234 3300046474 Bacteria 1061
387 Ga0495639_0000126 3300046475 Bacteria 39275
388 Ga0495639_0149700 3300046475 Bacteria 1125
389 Ga0495639_0181761 3300046475 Bacteria 1024
390 Ga0495584_0012814 3300046491 Bacteria 4278
391 Ga0495584_0024517 3300046491 Bacteria 3059
392 Ga0495584_0033055 3300046491 Bacteria 2616
393 Ga0495584_0035561 3300046491 Bacteria 2517
394 Ga0495584_0077702 3300046491 Bacteria 1669
395 Ga0495584_0155476 3300046491 Bacteria 1162
396 Ga0495584_0193946 3300046491 Bacteria 1032
397 Ga0495584_0198951 3300046491 Bacteria 1018
398 Ga0495585_0000731 3300046492 Bacteria 29294
399 Ga0495585_0009157 3300046492 Bacteria 5958
400 Ga0495585_0010143 3300046492 Bacteria 5626
401 Ga0495585_0049777 3300046492 Bacteria 2325
402 Ga0495585_0053129 3300046492 Bacteria 2242
403 Ga0495585_0053263 3300046492 Bacteria 2239
404 Ga0495585_0060099 3300046492 Bacteria 2092
405 Ga0495585_0069803 3300046492 Bacteria 1917
406 Ga0495585_0079685 3300046492 Bacteria 1776
407 Ga0495585_0093000 3300046492 Bacteria 1622
408 Ga0495594_0029492 3300046499 Bacteria 2965
409 Ga0495594_0071648 3300046499 Bacteria 1927
410 Ga0495596_0000158 3300046500 Bacteria 47438
411 Ga0495596_0070917 3300046500 Bacteria 1353
412 Ga0495596_0147041 3300046500 Bacteria 915
413 Ga0495607_0001220 3300046501 Bacteria 23108
414 Ga0495607_0008515 3300046501 Bacteria 7010
415 Ga0495607_0009108 3300046501 Bacteria 6748
416 Ga0495607_0012496 3300046501 Bacteria 5601
417 Ga0495607_0046364 3300046501 Bacteria 2553
418 Ga0495607_0047077 3300046501 Bacteria 2528
419 Ga0495607_0051481 3300046501 Bacteria 2391
420 Ga0495607_0054684 3300046501 Bacteria 2299
421 Ga0495607_0067582 3300046501 Bacteria 2007
422 Ga0495607_0072384 3300046501 Bacteria 1919
423 Ga0495607_0075994 3300046501 Bacteria 1859
424 Ga0495607_0103650 3300046501 Bacteria 1519
425 Ga0495583_0032884 3300046506 Bacteria 2499
426 Ga0495583_0033633 3300046506 Bacteria 2464
427 Ga0495583_0128898 3300046506 Bacteria 1059
428 Ga0495606_0006527 3300046507 Bacteria 10730
429 Ga0495606_0014136 3300046507 Bacteria 6249
430 Ga0495606_0024688 3300046507 Bacteria 4324
431 Ga0495606_0055497 3300046507 Bacteria 2561
432 Ga0495606_0060789 3300046507 Bacteria 2418
433 Ga0495610_0008339 3300046512 Bacteria 6724
434 Ga0495610_0014630 3300046512 Bacteria 4600
435 Ga0495610_0036879 3300046512 Bacteria 2494
436 Ga0495610_0039525 3300046512 Bacteria 2384
437 Ga0495610_0039584 3300046512 Bacteria 2382
438 Ga0495610_0092479 3300046512 Bacteria 1368
439 Ga0495610_0121970 3300046512 Bacteria 1141
440 Ga0495610_0124852 3300046512 Bacteria 1123
441 Ga0495610_0129395 3300046512 Bacteria 1097
442 Ga0495610_0146478 3300046512 Bacteria 1011
443 Ga0495616_0000456 3300046513 Bacteria 31180
444 Ga0495616_0012166 3300046513 Bacteria 4897
445 Ga0495616_0015155 3300046513 Bacteria 4289
446 Ga0495616_0043391 3300046513 Bacteria 2285
447 Ga0495616_0044339 3300046513 Bacteria 2255
448 Ga0495616_0049852 3300046513 Bacteria 2096
449 Ga0495616_0146811 3300046513 Bacteria 1069
450 Ga0495616_0149598 3300046513 Bacteria 1057
451 Ga0495620_0004628 3300046515 Bacteria 7734
452 Ga0495620_0010406 3300046515 Bacteria 4909
453 Ga0495620_0025156 3300046515 Bacteria 2821
454 Ga0495620_0033137 3300046515 Bacteria 2347
455 Ga0495620_0034818 3300046515 Bacteria 2271
456 Ga0495620_0088474 3300046515 Bacteria 1244
457 Ga0495628_0193347 3300046516 Bacteria 1536
458 Ga0495630_0012487 3300046517 Bacteria 6168
459 Ga0495631_0000173 3300046518 Bacteria 43899
460 Ga0495631_0006792 3300046518 Bacteria 5872
461 Ga0495631_0006959 3300046518 Bacteria 5789
462 Ga0495631_0032137 3300046518 Bacteria 2367
463 Ga0495631_0062922 3300046518 Bacteria 1607
464 Ga0495631_0148495 3300046518 Bacteria 1006
465 Ga0495631_0165296 3300046518 Bacteria 949
466 Ga0495632_0000427 3300046519 Bacteria 40066
467 Ga0495632_0005144 3300046519 Bacteria 8731
468 Ga0495632_0005190 3300046519 Bacteria 8686
469 Ga0495632_0020071 3300046519 Bacteria 3627
470 Ga0495632_0020584 3300046519 Bacteria 3568
471 Ga0495632_0037048 3300046519 Bacteria 2478
472 Ga0495632_0039979 3300046519 Bacteria 2364
473 Ga0495632_0041174 3300046519 Bacteria 2322
474 Ga0495632_0041919 3300046519 Bacteria 2297
475 Ga0495632_0047694 3300046519 Bacteria 2123
476 Ga0495632_0051408 3300046519 Bacteria 2029
477 Ga0495632_0051723 3300046519 Bacteria 2021
478 Ga0495632_0057419 3300046519 Bacteria 1899
479 Ga0495632_0064272 3300046519 Bacteria 1775
480 Ga0495632_0077040 3300046519 Bacteria 1594
481 Ga0495632_0098901 3300046519 Bacteria 1376
482 Ga0495632_0127005 3300046519 Bacteria 1188
483 Ga0495637_0000228 3300046520 Bacteria 43608
484 Ga0495637_0010815 3300046520 Bacteria 4399
485 Ga0495637_0012084 3300046520 Bacteria 4135
486 Ga0495637_0023417 3300046520 Bacteria 2807
487 Ga0495637_0026080 3300046520 Bacteria 2628
488 Ga0495637_0030403 3300046520 Bacteria 2396
489 Ga0495637_0031187 3300046520 Bacteria 2359
490 Ga0495637_0031571 3300046520 Bacteria 2341
491 Ga0495637_0033844 3300046520 Bacteria 2241
492 Ga0495637_0037686 3300046520 Bacteria 2097
493 Ga0495637_0051574 3300046520 Bacteria 1721
494 Ga0495637_0051769 3300046520 Bacteria 1716
495 Ga0495643_0018488 3300046522 Bacteria 4048
496 Ga0495643_0041904 3300046522 Bacteria 2495
497 Ga0495643_0047318 3300046522 Bacteria 2329
498 Ga0495643_0062338 3300046522 Bacteria 1974
499 Ga0495643_0092879 3300046522 Bacteria 1554
500 Ga0495644_0000263 3300046523 Bacteria 24138
501 Ga0495644_0003427 3300046523 Bacteria 6276
502 Ga0495644_0007693 3300046523 Bacteria 4154
503 Ga0495644_0026376 3300046523 Bacteria 2205
504 Ga0495644_0045490 3300046523 Bacteria 1651
505 Ga0495644_0111029 3300046523 Bacteria 1040
506 Ga0495648_0000330 3300046524 Bacteria 52286
507 Ga0495648_0010552 3300046524 Bacteria 7023
508 Ga0495648_0014300 3300046524 Bacteria 5818
509 Ga0495648_0014408 3300046524 Bacteria 5789
510 Ga0495648_0050867 3300046524 Bacteria 2528
511 Ga0495648_0055177 3300046524 Bacteria 2396
512 Ga0495648_0057960 3300046524 Bacteria 2319
513 Ga0495648_0153126 3300046524 Bacteria 1200
514 Ga0495666_0083334 3300046526 Bacteria 1511
515 Ga0495666_0112594 3300046526 Bacteria 1277
516 Ga0495642_0000230 3300046528 Bacteria 31990
517 Ga0495642_0020713 3300046528 Bacteria 2584
518 Ga0495642_0021576 3300046528 Bacteria 2533
519 Ga0495654_0005559 3300046530 Bacteria 7299
520 Ga0495654_0005639 3300046530 Bacteria 7240
521 Ga0495654_0009777 3300046530 Bacteria 5243
522 Ga0495654_0028554 3300046530 Bacteria 2852
523 Ga0495654_0030401 3300046530 Bacteria 2748
524 Ga0495654_0035550 3300046530 Bacteria 2507
525 Ga0495654_0038136 3300046530 Bacteria 2405
526 Ga0495654_0041762 3300046530 Bacteria 2279
527 Ga0495654_0045923 3300046530 Bacteria 2153
528 Ga0495654_0061452 3300046530 Bacteria 1803
529 Ga0495654_0064574 3300046530 Bacteria 1749
530 Ga0495654_0091559 3300046530 Bacteria 1410
531 Ga0495654_0144181 3300046530 Bacteria 1058
532 Ga0495586_0042579 3300046535 Bacteria 2445
533 Ga0495587_0009787 3300046536 Bacteria 6126
534 Ga0495587_0027521 3300046536 Bacteria 3461
535 Ga0495609_0000558 3300046538 Bacteria 29364
536 Ga0495609_0009321 3300046538 Bacteria 4755
537 Ga0495609_0027600 3300046538 Bacteria 2593
538 Ga0495609_0031071 3300046538 Bacteria 2429
539 Ga0495609_0033331 3300046538 Bacteria 2338
540 Ga0495609_0038753 3300046538 Bacteria 2147
541 Ga0495609_0069762 3300046538 Bacteria 1545
542 Ga0495609_0117406 3300046538 Bacteria 1145
543 Ga0495597_0006879 3300046542 Bacteria 5838
544 Ga0495597_0011910 3300046542 Bacteria 4206
545 Ga0495597_0025461 3300046542 Bacteria 2723
546 Ga0495597_0030943 3300046542 Bacteria 2437
547 Ga0495597_0031941 3300046542 Bacteria 2392
548 Ga0495597_0055168 3300046542 Bacteria 1743
549 Ga0495597_0076953 3300046542 Bacteria 1430
550 Ga0495597_0122675 3300046542 Bacteria 1082
551 Ga0495622_0001469 3300046557 Bacteria 11845
552 Ga0495622_0004298 3300046557 Bacteria 6632
553 Ga0495622_0006301 3300046557 Bacteria 5509
554 Ga0495622_0023025 3300046557 Bacteria 2903
555 Ga0495622_0033120 3300046557 Bacteria 2412
556 Ga0495633_0008368 3300046558 Bacteria 5836
557 Ga0495656_0014942 3300046615 Bacteria 2920
558 Ga0495668_0012891 3300046616 Bacteria 4949
559 Ga0495668_0017547 3300046616 Bacteria 4149
560 Ga0495668_0175663 3300046616 Bacteria 1173
561 Ga0495634_0043051 3300046642 Bacteria 3061
562 Ga0495611_0000355 3300046648 Bacteria 29951
563 Ga0495611_0119780 3300046648 Bacteria 1227
564 Ga0495611_0134168 3300046648 Bacteria 1155
565 Ga0495625_0015972 3300046660 Bacteria 5922
566 Ga0495625_0045098 3300046660 Bacteria 3189
567 Ga0495625_0057291 3300046660 Bacteria 2772
568 Ga0495625_0071664 3300046660 Bacteria 2432
569 Ga0495625_0080452 3300046660 Bacteria 2269
570 Ga0495635_0002382 3300046663 Bacteria 12802
571 Ga0495635_0003528 3300046663 Bacteria 10822
572 Ga0495659_0000468 3300046664 Bacteria 15048
573 Ga0495661_0020091 3300046665 Bacteria 4367
574 Ga0495661_0036064 3300046665 Bacteria 3099
575 Ga0495661_0054952 3300046665 Bacteria 2389
576 Ga0495661_0075465 3300046665 Bacteria 1959
577 Ga0495661_0104795 3300046665 Bacteria 1585
578 Ga0495661_0133245 3300046665 Bacteria 1359
579 Ga0495588_0004408 3300046674 Bacteria 6218
580 Ga0495588_0048602 3300046674 Bacteria 2179
581 Ga0495588_0056486 3300046674 Bacteria 2027
582 Ga0495657_0087236 3300046675 Bacteria 2008
583 Ga0495623_0057376 3300046679 Bacteria 2449
584 Ga0495646_0010200 3300046680 Bacteria 5973
585 Ga0495669_0010984 3300046684 Bacteria 3834
586 Ga0495669_0036043 3300046684 Bacteria 2185
587 Ga0495613_0001979 3300046689 Bacteria 15554
588 Ga0495613_0092226 3300046689 Bacteria 2193
589 Ga0495624_0009404 3300046690 Bacteria 6771
590 Ga0495670_0006310 3300046691 Bacteria 5822
591 Ga0495670_0006336 3300046691 Bacteria 5812
592 Ga0495670_0012400 3300046691 Bacteria 4190
593 Ga0495670_0023283 3300046691 Bacteria 3057
594 Ga0495670_0037601 3300046691 Bacteria 2412
595 Ga0495670_0068211 3300046691 Bacteria 1796
596 Ga0495670_0088772 3300046691 Bacteria 1580
597 Ga0495671_0011783 3300046692 Bacteria 4792
598 Ga0495671_0014700 3300046692 Bacteria 4206
599 Ga0495671_0019126 3300046692 Bacteria 3624
600 Ga0495671_0030860 3300046692 Bacteria 2742
601 Ga0495671_0036366 3300046692 Bacteria 2494
602 Ga0495671_0036385 3300046692 Bacteria 2493
603 Ga0495671_0038266 3300046692 Bacteria 2424
604 Ga0495671_0041772 3300046692 Bacteria 2307
605 Ga0495671_0054151 3300046692 Bacteria 1989
606 Ga0495671_0055953 3300046692 Bacteria 1953
607 Ga0495671_0088566 3300046692 Bacteria 1515
608 Ga0495671_0108233 3300046692 Bacteria 1357
609 Ga0495671_0121954 3300046692 Bacteria 1271
610 Ga0495671_0137699 3300046692 Bacteria 1190
611 Ga0495671_0151128 3300046692 Bacteria 1130
612 Ga0495649_0001671 3300046694 Bacteria 16475
613 Ga0495649_0006623 3300046694 Bacteria 7199
614 Ga0495649_0014802 3300046694 Bacteria 4457
615 Ga0495649_0043997 3300046694 Bacteria 2437
616 Ga0495649_0049666 3300046694 Bacteria 2278
617 Ga0495649_0051795 3300046694 Bacteria 2225
618 Ga0495649_0055951 3300046694 Bacteria 2130
619 Ga0495649_0064181 3300046694 Bacteria 1972
620 Ga0495649_0107469 3300046694 Bacteria 1480
621 Ga0495589_0005113 3300046794 Bacteria 6940
622 Ga0495589_0005201 3300046794 Bacteria 6883
623 Ga0495589_0006828 3300046794 Bacteria 6001
624 Ga0495589_0035101 3300046794 Bacteria 2515
625 Ga0495589_0038432 3300046794 Bacteria 2395
626 Ga0495589_0042552 3300046794 Bacteria 2263
627 Ga0495589_0046978 3300046794 Bacteria 2140
628 Ga0495600_0067995 3300046809 Bacteria 2328
629 Ga0495660_0000599 3300046810 Bacteria 28455
630 Ga0495660_0052062 3300046810 Bacteria 2226
631 Ga0495660_0056765 3300046810 Bacteria 2114
632 Ga0495660_0087999 3300046810 Bacteria 1619
633 Ga0495660_0112082 3300046810 Bacteria 1390
634 Ga0495660_0184313 3300046810 Bacteria 1007
635 Ga0495581_0048449 3300047315 Bacteria 2454
636 Ga0495604_0001530 3300047317 Bacteria 19039
637 Ga0495604_0083241 3300047317 Bacteria 2391
638 Ga0495604_0094517 3300047317 Bacteria 2209
639 Ga0495636_0003818 3300047318 Bacteria 5869
640 Ga0495636_0138033 3300047318 Bacteria 1087
641 Ga0495636_0195964 3300047318 Bacteria 921
642 Ga0495674_0112698 3300047319 Bacteria 2304
643 Ga0495672_0009929 3300047320 Bacteria 6838
644 Ga0495672_0010213 3300047320 Bacteria 6709
645 Ga0495672_0010958 3300047320 Bacteria 6428
646 Ga0495672_0011169 3300047320 Bacteria 6349
647 Ga0495672_0012956 3300047320 Bacteria 5780
648 Ga0495672_0020849 3300047320 Bacteria 4286
649 Ga0495672_0024418 3300047320 Bacteria 3893
650 Ga0495672_0031265 3300047320 Bacteria 3325
651 Ga0495672_0068758 3300047320 Bacteria 2012
652 Ga0495672_0069409 3300047320 Bacteria 2000
653 Ga0495672_0075812 3300047320 Bacteria 1890
654 Ga0495672_0123491 3300047320 Bacteria 1372
655 Ga0495676_0101965 3300047321 Bacteria 2121
656 Ga0495676_0122278 3300047321 Bacteria 1891
657 Ga0495680_0216629 3300047322 Bacteria 1368
658 Ga0495683_0005619 3300047323 Bacteria 6942
659 Ga0495683_0021324 3300047323 Bacteria 3338
660 Ga0495683_0040157 3300047323 Bacteria 2364
661 Ga0495683_0063581 3300047323 Bacteria 1823
662 Ga0495683_0064867 3300047323 Bacteria 1802
663 Ga0495683_0114668 3300047323 Bacteria 1283
664 Ga0495683_0176616 3300047323 Bacteria 978
665 Ga0495687_005757 3300047443 Bacteria 7786
666 Ga0495687_022403 3300047443 Bacteria 3032
667 Ga0495687_030540 3300047443 Bacteria 2480
668 Ga0495687_045587 3300047443 Bacteria 1897
669 Ga0495675_0002521 3300047444 Bacteria 10970
670 Ga0495677_0003786 3300047445 Bacteria 5849
671 Ga0495679_017612 3300047446 Bacteria 2554
672 Ga0495679_018778 3300047446 Bacteria 2444
673 Ga0495679_031797 3300047446 Bacteria 1699
674 Ga0495685_023507 3300047447 Bacteria 2122
675 Ga0495685_057075 3300047447 Bacteria 1319
676 Ga0495673_0000986 3300047469 Bacteria 25501
677 Ga0495673_0001019 3300047469 Bacteria 24721
678 Ga0495673_0012503 3300047469 Bacteria 4497
679 Ga0495673_0015115 3300047469 Bacteria 3988
680 Ga0495673_0019229 3300047469 Bacteria 3425
681 Ga0495673_0027043 3300047469 Bacteria 2734
682 Ga0495673_0029074 3300047469 Bacteria 2611
683 Ga0495673_0029872 3300047469 Bacteria 2568
684 Ga0495673_0031370 3300047469 Bacteria 2488
685 Ga0495673_0038111 3300047469 Bacteria 2189
686 Ga0495673_0115602 3300047469 Bacteria 1067
687 Ga0495681_0001733 3300047470 Bacteria 16133
688 Ga0495681_0002261 3300047470 Bacteria 13848
689 Ga0495681_0002319 3300047470 Bacteria 13683
690 Ga0495681_0010043 3300047470 Bacteria 5764
691 Ga0495681_0017951 3300047470 Bacteria 3914
692 Ga0495681_0021905 3300047470 Bacteria 3432
693 Ga0495681_0038747 3300047470 Bacteria 2333
694 Ga0495681_0043515 3300047470 Bacteria 2164
695 Ga0495681_0060221 3300047470 Bacteria 1752
696 Ga0495681_0084662 3300047470 Bacteria 1409
697 Ga0495681_0094371 3300047470 Bacteria 1316
698 Ga0495681_0099819 3300047470 Bacteria 1270
699 Ga0495684_0053962 3300047471 Bacteria 3066
700 Ga0495686_0017289 3300047472 Bacteria 4862
701 Ga0495686_0048581 3300047472 Bacteria 2674
702 Ga0495686_0057325 3300047472 Bacteria 2431
703 Ga0495686_0065359 3300047472 Bacteria 2248
704 Ga0495686_0209630 3300047472 Bacteria 1114
705 Ga0495593_0041077 3300047673 Bacteria 2488
706 Ga0495593_0055691 3300047673 Bacteria 2080
707 Ga0495593_0123199 3300047673 Bacteria 1318
708 Ga0495593_0174330 3300047673 Bacteria 1083
709 Ga0495602_0021303 3300048088 Bacteria 6385
710 Ga0495626_0000416 3300048091 Bacteria 43594
711 Ga0495626_0001069 3300048091 Bacteria 23398
712 Ga0495626_0002043 3300048091 Bacteria 14773
713 Ga0495626_0002207 3300048091 Bacteria 13956
714 Ga0495626_0007710 3300048091 Bacteria 5964
715 Ga0495626_0031169 3300048091 Bacteria 2567
716 Ga0495626_0072382 3300048091 Bacteria 1546
717 Ga0495626_0116140 3300048091 Bacteria 1154
718 Ga0495626_0120786 3300048091 Bacteria 1126
719 Ga0495626_0137805 3300048091 Bacteria 1036
720 Ga0496102_0000649 3300048905 Bacteria 35082
721 Ga0496102_0223409 3300048905 Bacteria 1776
722 Ga0496102_0556469 3300048905 Bacteria 1070
723 Ga0496103_0079918 3300048906 Bacteria 2055
724 Ga0496110_0113655 3300048913 Bacteria 2435
725 Ga0496111_0226886 3300048914 Bacteria 1387
726 Ga0496112_0458980 3300048915 Bacteria 1211
727 Ga0496116_0000185 3300048919 Bacteria 123912
728 Ga0496116_0003783 3300048919 Bacteria 14790
729 Ga0496116_0008290 3300048919 Bacteria 9033
730 Ga0496116_0022008 3300048919 Bacteria 4794
731 Ga0496116_0065459 3300048919 Bacteria 2331
732 Ga0496116_0190307 3300048919 Bacteria 1087
733 Ga0496117_0004272 3300048920 Bacteria 15923
734 Ga0496117_0024130 3300048920 Bacteria 4821
735 Ga0496117_0062740 3300048920 Bacteria 2545
736 Ga0496117_0071466 3300048920 Bacteria 2325
737 Ga0496117_0082349 3300048920 Bacteria 2108
738 Ga0496117_0092404 3300048920 Bacteria 1943
739 Ga0496118_0015623 3300048921 Bacteria 7016
740 Ga0496118_0020864 3300048921 Bacteria 5795
741 Ga0496118_0028863 3300048921 Bacteria 4663
742 Ga0496118_0063795 3300048921 Bacteria 2708
743 Ga0496118_0148079 3300048921 Bacteria 1474
744 Ga0496118_0239916 3300048921 Bacteria 1039
745 Ga0496119_0082598 3300048922 Bacteria 1847
746 Ga0496120_0047072 3300048923 Bacteria 2488
747 Ga0496120_0056973 3300048923 Bacteria 2202
748 Ga0496121_0001963 3300048924 Bacteria 32764
749 Ga0496121_0061053 3300048924 Bacteria 3096
750 Ga0496121_0149779 3300048924 Bacteria 1718
751 Ga0496121_0371822 3300048924 Bacteria 945
752 Ga0496122_0014568 3300048925 Bacteria 7590
753 Ga0496122_0020247 3300048925 Bacteria 6023
754 Ga0496122_0029988 3300048925 Bacteria 4569
755 Ga0496122_0289820 3300048925 Bacteria 889
756 Ga0496123_0022696 3300048926 Bacteria 4827
757 Ga0496123_0159475 3300048926 Bacteria 1204
758 Ga0496124_0013704 3300048927 Bacteria 7896
759 Ga0496124_0066112 3300048927 Bacteria 3012
760 Ga0496124_0098956 3300048927 Bacteria 2365
761 Ga0496124_0104339 3300048927 Bacteria 2292
762 Ga0496124_0153710 3300048927 Bacteria 1802
763 Ga0496124_0172177 3300048927 Bacteria 1675
764 Ga0496125_0000451 3300048928 Bacteria 74695
765 Ga0496125_0014983 3300048928 Bacteria 7527
766 Ga0496125_0073794 3300048928 Bacteria 2649
767 Ga0496125_0083020 3300048928 Bacteria 2439
768 Ga0496125_0105966 3300048928 Bacteria 2053
769 Ga0496125_0153073 3300048928 Bacteria 1580
770 Ga0496125_0182236 3300048928 Bacteria 1397
771 Ga0496126_0161159 3300048929 Bacteria 1916
772 Ga0496126_0411830 3300048929 Bacteria 1094
773 Ga0495678_006332 3300049459 Bacteria 6313
774 Ga0495678_021911 3300049459 Bacteria 2804
775 Ga0495678_023876 3300049459 Bacteria 2649
776 Ga0495678_087455 3300049459 Bacteria 1105
777 Ga0495678_094727 3300049459 Bacteria 1045
778 Ga0495678_113799 3300049459 Bacteria 918
779 Ga0495682_0001023 3300049460 Bacteria 16581
780 Ga0495682_0019588 3300049460 Bacteria 2543
781 Ga0495682_0021588 3300049460 Bacteria 2411
782 Ga0495682_0116906 3300049460 Bacteria 955
783 Ga0501241_005473 3300049758 Bacteria 2365
784 Ga0501269_002297 3300049766 Bacteria 2370
785 nmdc:mga00v17_172740_c1 3300050491 Bacteria 1394
786 nmdc:mga08x19_77137_c1 3300050514 Bacteria 2182
787 nmdc:mga0sz30_22252_c1 3300050516 Bacteria 2571
788 Ga0500572_002052 3300053111 Bacteria 5005
789 Ga0500634_0168177 3300053161 Bacteria 1002

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009011 Ga0105251_10055966 Ga0105251_100559662 259
2 3300013102 Ga0157371_10274987 Ga0157371_102749872 259
3 3300048928 Ga0496125_0182236 Ga0496125_0182236_601_1386 261
4 3300048925 Ga0496122_0289820 Ga0496122_0289820_24_812 262
5 3300046538 Ga0495609_0069762 Ga0495609_0069762_728_1519 263
6 3300053161 Ga0500634_0168177 Ga0500634_0168177_23_838 263
7 3300046492 Ga0495585_0000731 Ga0495585_0000731_867_1661 264
8 3300048928 Ga0496125_0014983 Ga0496125_0014983_6470_7324 264
9 iso_pu_bacteria 3007419365 3007424327 264
10 3300046459 Ga0495629_0083244 Ga0495629_0083244_1283_2107 265
11 3300046473 Ga0495582_0011175 Ga0495582_0011175_4078_4902 265
12 3300046492 Ga0495585_0009157 Ga0495585_0009157_4937_5767 265
13 3300046517 Ga0495630_0012487 Ga0495630_0012487_5143_5967 265
14 3300046526 Ga0495666_0112594 Ga0495666_0112594_117_941 265
15 3300046535 Ga0495586_0042579 Ga0495586_0042579_1308_2132 265
16 3300046536 Ga0495587_0009787 Ga0495587_0009787_5014_5838 265
17 3300046663 Ga0495635_0002382 Ga0495635_0002382_11643_12467 265
18 3300046689 Ga0495613_0001979 Ga0495613_0001979_14716_15540 265
19 3300047317 Ga0495604_0001530 Ga0495604_0001530_832_1656 265
20 3300047322 Ga0495680_0216629 Ga0495680_0216629_338_1162 265
21 3300047444 Ga0495675_0002521 Ga0495675_0002521_9811_10635 265
22 iso_pu_bacteria 2511231156 2511826104 265
23 iso_pu_bacteria 2844665904 2844669305 265
24 iso_pu_bacteria 2908446538 2908451313 265
25 iso_pu_bacteria 2946006987 2946008200 265
26 3300046458 Ga0495591_020351 Ga0495591_020351_1366_2166 266
27 3300046471 Ga0495650_0142911 Ga0495650_0142911_51_851 266
28 3300046523 Ga0495644_0026376 Ga0495644_0026376_1374_2174 266
29 iso_pu_bacteria 8056131705 8056136123 266
30 3300014497 Ga0182008_10040067 Ga0182008_100400673 267
31 3300042013 Ga0439456_000020 Ga0439456_000020_4702_5526 267
32 3300046460 Ga0495638_0009417 Ga0495638_0009417_5707_6510 267
33 3300046460 Ga0495638_0013324 Ga0495638_0013324_4781_5584 267
34 3300046501 Ga0495607_0072384 Ga0495607_0072384_328_1152 267
35 3300046692 Ga0495671_0137699 Ga0495671_0137699_107_931 267
36 3300048927 Ga0496124_0153710 Ga0496124_0153710_742_1548 267
37 3300049460 Ga0495682_0001023 Ga0495682_0001023_15392_16198 267
38 iso_pu_bacteria 2511231021 2511357303 267
39 iso_pu_bacteria 2597489888 2597865422 267
40 iso_pu_bacteria 2597489889 2597871228 267
41 iso_pu_bacteria 2599185167 2599402053 267
42 iso_pu_bacteria 2599185179 2599454256 267
43 iso_pu_bacteria 2599185189 2599508445 267
44 iso_pu_bacteria 2599185190 2599512349 267
45 iso_pu_bacteria 2599185191 2599520452 267
46 iso_pu_bacteria 2599185288 2599884001 267
47 iso_pu_bacteria 2599185290 2599891025 267
48 iso_pu_bacteria 2599185303 2599947911 267
49 iso_pu_bacteria 2600255296 2601689381 267
50 iso_pu_bacteria 2619619299 2621298086 267
51 iso_pu_bacteria 2643221713 2644622205 267
52 iso_pu_bacteria 2675903420 2677900165 267
53 iso_pu_bacteria 2721755607 2723250133 267
54 iso_pu_bacteria 2738541265 2738671542 267
55 iso_pu_bacteria 2738541282 2738749936 267
56 iso_pu_bacteria 2738541294 2738808199 267
57 iso_pu_bacteria 2738541303 2738858976 267
58 iso_pu_bacteria 2738541309 2738895559 267
59 iso_pu_bacteria 2808606385 2808978076 267
60 iso_pu_bacteria 2808606388 2808993556 267
61 iso_pu_bacteria 2816332298 2817492775 267
62 iso_pu_bacteria 2834028612 2834031620 267
63 iso_pu_bacteria 2842826826 2842827413 267
64 iso_pu_bacteria 2842837860 2842842627 267
65 iso_pu_bacteria 2852612431 2852612855 267
66 iso_pu_bacteria 2852667396 2852669410 267
67 iso_pu_bacteria 2860867994 2860871864 267
68 iso_pu_bacteria 2912963787 2912965475 267
69 iso_pu_bacteria 2929189879 2929193943 267
70 iso_pu_bacteria 2931390751 2931395236 267
71 iso_pu_bacteria 2939651529 2939656180 267
72 iso_pu_bacteria 2945928738 2945932086 267
73 iso_pu_bacteria 2945961074 2945965292 267
74 iso_pu_bacteria 2947233263 2947239245 267
75 iso_pu_bacteria 8054285046 8054287089 267
76 iso_pu_bacteria 8054347763 8054350475 267
77 iso_pu_bacteria 8054503363 8054507733 267
78 iso_pu_bacteria 8055817908 8055822675 267
79 iso_pu_bacteria 8055878733 8055880420 267
80 iso_pu_bacteria 8056161164 8056162382 267
81 3300009011 Ga0105251_10000018 Ga0105251_1000001847 268
82 3300009011 Ga0105251_10002244 Ga0105251_1000224412 268
83 3300009011 Ga0105251_10002881 Ga0105251_100028812 268
84 3300009036 Ga0105244_10026037 Ga0105244_100260372 268
85 3300009092 Ga0105250_10016874 Ga0105250_100168744 268
86 3300025711 Ga0207696_1000152 Ga0207696_100015293 268
87 3300025728 Ga0207655_1000005 Ga0207655_1000005872 268
88 3300025735 Ga0207713_1000009 Ga0207713_1000009424 268
89 3300025735 Ga0207713_1014802 Ga0207713_10148024 268
90 3300025735 Ga0207713_1030410 Ga0207713_10304103 268
91 3300046513 Ga0495616_0049852 Ga0495616_0049852_1143_1949 268
92 3300046530 Ga0495654_0144181 Ga0495654_0144181_164_970 268
93 3300046542 Ga0495597_0076953 Ga0495597_0076953_290_1096 268
94 3300047320 Ga0495672_0009929 Ga0495672_0009929_164_970 268
95 3300047469 Ga0495673_0015115 Ga0495673_0015115_263_1069 268
96 3300049459 Ga0495678_087455 Ga0495678_087455_242_1048 268
97 iso_pu_bacteria 2511231007 2511274763 268
98 3300017792 Ga0163161_10480608 Ga0163161_104806081 269
99 3300017792 Ga0163161_10650166 Ga0163161_106501661 269
100 3300025728 Ga0207655_1036123 Ga0207655_10361232 269
101 3300025735 Ga0207713_1099267 Ga0207713_10992672 269
102 3300046458 Ga0495591_032037 Ga0495591_032037_636_1472 269
103 3300046506 Ga0495583_0033633 Ga0495583_0033633_126_962 269
104 3300046512 Ga0495610_0014630 Ga0495610_0014630_200_1036 269
105 3300046530 Ga0495654_0030401 Ga0495654_0030401_1710_2546 269
106 3300046557 Ga0495622_0033120 Ga0495622_0033120_205_1041 269
107 3300046674 Ga0495588_0004408 Ga0495588_0004408_4853_5689 269
108 3300046692 Ga0495671_0030860 Ga0495671_0030860_274_1110 269
109 3300046692 Ga0495671_0054151 Ga0495671_0054151_206_1042 269
110 3300046692 Ga0495671_0108233 Ga0495671_0108233_332_1177 269
111 3300046694 Ga0495649_0014802 Ga0495649_0014802_3584_4420 269
112 3300046810 Ga0495660_0184313 Ga0495660_0184313_179_988 269
113 3300047320 Ga0495672_0069409 Ga0495672_0069409_342_1178 269
114 3300047446 Ga0495679_018778 Ga0495679_018778_1465_2274 269
115 3300048091 Ga0495626_0001069 Ga0495626_0001069_22273_23109 269
116 3300048091 Ga0495626_0002207 Ga0495626_0002207_12385_13221 269
117 3300048905 Ga0496102_0000649 Ga0496102_0000649_192_1028 269
118 3300048905 Ga0496102_0223409 Ga0496102_0223409_760_1596 269
119 3300048920 Ga0496117_0071466 Ga0496117_0071466_1199_2035 269
120 3300048921 Ga0496118_0063795 Ga0496118_0063795_689_1525 269
121 iso_pu_bacteria 2511231011 2511294090 269
122 iso_pu_bacteria 2511231014 2511314177 269
123 iso_pu_bacteria 2511231023 2511371099 269
124 iso_pu_bacteria 2599185185 2599484025 269
125 iso_pu_bacteria 2713897148 2715751326 269
126 iso_pu_bacteria 2718217725 2718635263 269
127 iso_pu_bacteria 2773857673 2774132921 269
128 iso_pu_bacteria 2784132063 2784263216 269
129 iso_pu_bacteria 2818991456 2819655758 269
130 iso_pu_bacteria 2842832357 2842836619 269
131 iso_pu_bacteria 2842843487 2842844732 269
132 iso_pu_bacteria 2852657418 2852663026 269
133 iso_pu_bacteria 2880230671 2880234622 269
134 iso_pu_bacteria 2904518522 2904521239 269
135 iso_pu_bacteria 2919385768 2919388098 269
136 iso_pu_bacteria 2919487758 2919489716 269
137 iso_pu_bacteria 2969304461 2969308775 269
138 iso_pu_bacteria 2974289157 2974289841 269
139 iso_pu_bacteria 2998139840 2998144079 269
140 iso_pu_bacteria 3007614139 3007617872 269
141 iso_pu_bacteria 3007855910 3007858934 269
142 iso_pu_bacteria 3007861166 3007865510 269
143 iso_pu_bacteria 8029995093 8029996799 269
144 iso_pu_bacteria 8056166840 8056167203 269
145 iso_pu_bacteria 8056569372 8056572819 269
146 3300005331 Ga0070670_100008399 Ga0070670_1000083992 270
147 3300025925 Ga0207650_10000610 Ga0207650_1000061010 270
148 3300047673 Ga0495593_0055691 Ga0495593_0055691_67_879 270
149 iso_pu_bacteria 2511231006 2511266763 270
150 iso_pu_bacteria 2511231008 2511277717 270
151 iso_pu_bacteria 2512047018 2512329435 270
152 iso_pu_bacteria 2554235341 2555668799 270
153 iso_pu_bacteria 2582580891 2583791183 270
154 iso_pu_bacteria 2597489887 2597857001 270
155 iso_pu_bacteria 2599185160 2599357176 270
156 iso_pu_bacteria 2599185161 2599362037 270
157 iso_pu_bacteria 2599185162 2599368357 270
158 iso_pu_bacteria 2599185163 2599375146 270
159 iso_pu_bacteria 2599185164 2599382281 270
160 iso_pu_bacteria 2599185165 2599388728 270
161 iso_pu_bacteria 2599185166 2599394004 270
162 iso_pu_bacteria 2599185168 2599405769 270
163 iso_pu_bacteria 2599185181 2599464323 270
164 iso_pu_bacteria 2599185182 2599468643 270
165 iso_pu_bacteria 2599185186 2599493342 270
166 iso_pu_bacteria 2599185188 2599504347 270
167 iso_pu_bacteria 2599185212 2599615835 270
168 iso_pu_bacteria 2599185248 2599773012 270
169 iso_pu_bacteria 2599185257 2599801676 270
170 iso_pu_bacteria 2599185289 2599889379 270
171 iso_pu_bacteria 2599185291 2599900777 270
172 iso_pu_bacteria 2599185300 2599933392 270
173 iso_pu_bacteria 2599185302 2599944156 270
174 iso_pu_bacteria 2599185304 2599956374 270
175 iso_pu_bacteria 2599185305 2599963402 270
176 iso_pu_bacteria 2599185306 2599966532 270
177 iso_pu_bacteria 2599185308 2599977669 270
178 iso_pu_bacteria 2599185309 2599985068 270
179 iso_pu_bacteria 2599185310 2599989306 270
180 iso_pu_bacteria 2599185311 2599994220 270
181 iso_pu_bacteria 2599185312 2600000298 270
182 iso_pu_bacteria 2599185313 2600008160 270
183 iso_pu_bacteria 2599185314 2600011838 270
184 iso_pu_bacteria 2599185315 2600019347 270
185 iso_pu_bacteria 2599185316 2600025887 270
186 iso_pu_bacteria 2599185317 2600030684 270
187 iso_pu_bacteria 2599185318 2600037040 270
188 iso_pu_bacteria 2599185319 2600042464 270
189 iso_pu_bacteria 2599185320 2600049540 270
190 iso_pu_bacteria 2599185321 2600053857 270
191 iso_pu_bacteria 2599185322 2600062194 270
192 iso_pu_bacteria 2599185323 2600065626 270
193 iso_pu_bacteria 2599185324 2600070785 270
194 iso_pu_bacteria 2599185325 2600080024 270
195 iso_pu_bacteria 2599185356 2600216600 270
196 iso_pu_bacteria 2600254930 2600360491 270
197 iso_pu_bacteria 2600254931 2600365669 270
198 iso_pu_bacteria 2600255313 2601776807 270
199 iso_pu_bacteria 2643221650 2644286262 270
200 iso_pu_bacteria 2651869719 2652547959 270
201 iso_pu_bacteria 2667528170 2671093667 270
202 iso_pu_bacteria 2667528171 2671098676 270
203 iso_pu_bacteria 2667528176 2671130358 270
204 iso_pu_bacteria 2671180172 2671768625 270
205 iso_pu_bacteria 2675903515 2678264440 270
206 iso_pu_bacteria 2740892503 2743736418 270
207 iso_pu_bacteria 2744054620 2745004894 270
208 iso_pu_bacteria 2791355520 2794595971 270
209 iso_pu_bacteria 2808606361 2808856896 270
210 iso_pu_bacteria 2808606376 2808924270 270
211 iso_pu_bacteria 2808606377 2808930702 270
212 iso_pu_bacteria 2808606378 2808936967 270
213 iso_pu_bacteria 2808606380 2808946345 270
214 iso_pu_bacteria 2808606381 2808952824 270
215 iso_pu_bacteria 2808606383 2808965337 270
216 iso_pu_bacteria 2808606389 2809000175 270
217 iso_pu_bacteria 2818991464 2819703797 270
218 iso_pu_bacteria 2825651385 2825656618 270
219 iso_pu_bacteria 2842854478 2842859310 270
220 iso_pu_bacteria 2913036834 2913040917 270
221 iso_pu_bacteria 2917070673 2917072577 270
222 iso_pu_bacteria 2919481497 2919487284 270
223 iso_pu_bacteria 2923153595 2923155432 270
224 iso_pu_bacteria 2923586266 2923589954 270
225 iso_pu_bacteria 2929144301 2929148416 270
226 iso_pu_bacteria 2931369376 2931374168 270
227 iso_pu_bacteria 2935353572 2935354741 270
228 iso_pu_bacteria 2984286254 2984290592 270
229 iso_pu_bacteria 2988728565 2988730017 270
230 iso_pu_bacteria 3007395558 3007400982 270
231 iso_pu_bacteria 3007866637 3007868147 270
232 iso_pu_bacteria 637000220 637319160 270
233 iso_pu_bacteria 8015687852 8015689658 270
234 iso_pu_bacteria 8019769354 8019772748 270
235 iso_pu_bacteria 8055770955 8055772796 270
236 iso_pu_bacteria 8056143049 8056144956 270
237 iso_pu_bacteria 8057798959 8057799217 270
238 2162886007 SwRhRL2b_contig_113783 SwRhRL2b_0709.00007790 271
239 3300002738 JGI25154J39366_1005919 JGI25154J39366_10059193 271
240 3300003751 Ga0055538_1000027 Ga0055538_100002710 271
241 3300003752 Ga0055539_1000036 Ga0055539_100003610 271
242 3300003756 Ga0055533_1000046 Ga0055533_100004610 271
243 3300003758 Ga0055532_1000032 Ga0055532_100003210 271
244 3300003759 Ga0055525_1000145 Ga0055525_100014510 271
245 3300003841 Ga0055541_1000024 Ga0055541_100002410 271
246 3300005288 Ga0065714_10017841 Ga0065714_100178412 271
247 3300005288 Ga0065714_10085274 Ga0065714_100852743 271
248 3300005290 Ga0065712_10009700 Ga0065712_100097002 271
249 3300005331 Ga0070670_100009562 Ga0070670_10000956210 271
250 3300005344 Ga0070661_100000627 Ga0070661_1000006278 271
251 3300005353 Ga0070669_100021607 Ga0070669_1000216073 271
252 3300005457 Ga0070662_100000292 Ga0070662_10000029211 271
253 3300005539 Ga0068853_100009350 Ga0068853_1000093503 271
254 3300005548 Ga0070665_100226561 Ga0070665_1002265613 271
255 3300005564 Ga0070664_100000249 Ga0070664_1000002493 271
256 3300005834 Ga0068851_10000194 Ga0068851_1000019423 271
257 3300009011 Ga0105251_10001611 Ga0105251_100016113 271
258 3300009011 Ga0105251_10004174 Ga0105251_1000417411 271
259 3300009011 Ga0105251_10029716 Ga0105251_100297162 271
260 3300009011 Ga0105251_10114612 Ga0105251_101146121 271
261 3300009036 Ga0105244_10033499 Ga0105244_100334992 271
262 3300009036 Ga0105244_10033988 Ga0105244_100339882 271
263 3300009092 Ga0105250_10009453 Ga0105250_100094533 271
264 3300009092 Ga0105250_10010723 Ga0105250_100107234 271
265 3300009148 Ga0105243_10115829 Ga0105243_101158292 271
266 3300009148 Ga0105243_10140842 Ga0105243_101408422 271
267 3300009176 Ga0105242_10000347 Ga0105242_1000034739 271
268 3300009545 Ga0105237_10000279 Ga0105237_1000027963 271
269 3300011119 Ga0105246_10022009 Ga0105246_100220093 271
270 3300013100 Ga0157373_10068043 Ga0157373_100680431 271
271 3300013100 Ga0157373_10069991 Ga0157373_100699913 271
272 3300013104 Ga0157370_10051426 Ga0157370_100514263 271
273 3300013105 Ga0157369_10147135 Ga0157369_101471353 271
274 3300013308 Ga0157375_10142916 Ga0157375_101429163 271
275 3300013308 Ga0157375_10142969 Ga0157375_101429692 271
276 3300013308 Ga0157375_10146625 Ga0157375_101466253 271
277 3300014497 Ga0182008_10037548 Ga0182008_100375482 271
278 3300014497 Ga0182008_10216371 Ga0182008_102163711 271
279 3300015261 Ga0182006_1000648 Ga0182006_10006483 271
280 3300015262 Ga0182007_10006996 Ga0182007_100069962 271
281 3300015265 Ga0182005_1012188 Ga0182005_10121883 271
282 3300015265 Ga0182005_1023554 Ga0182005_10235542 271
283 3300015265 Ga0182005_1037233 Ga0182005_10372332 271
284 3300015265 Ga0182005_1053759 Ga0182005_10537592 271
285 3300017792 Ga0163161_10007368 Ga0163161_100073688 271
286 3300017792 Ga0163161_10012000 Ga0163161_100120002 271
287 3300017792 Ga0163161_10221423 Ga0163161_102214233 271
288 3300025224 Ga0209784_100017 Ga0209784_100017437 271
289 3300025225 Ga0209566_100014 Ga0209566_100014437 271
290 3300025226 Ga0209674_100028 Ga0209674_100028437 271
291 3300025229 Ga0209147_100038 Ga0209147_100038292 271
292 3300025230 Ga0209563_100032 Ga0209563_100032437 271
293 3300025233 Ga0209437_104655 Ga0209437_1046553 271
294 3300025242 Ga0209258_100212 Ga0209258_10021298 271
295 3300025246 Ga0209646_1000266 Ga0209646_100026650 271
296 3300025253 Ga0209677_100018 Ga0209677_100018437 271
297 3300025256 Ga0209759_1012322 Ga0209759_10123223 271
298 3300025292 Ga0209676_1001648 Ga0209676_100164819 271
299 3300025298 Ga0209050_1001348 Ga0209050_10013482 271
300 3300025303 Ga0209051_1014193 Ga0209051_10141934 271
301 3300025321 Ga0207656_10000200 Ga0207656_1000020010 271
302 3300025711 Ga0207696_1000321 Ga0207696_10003219 271
303 3300025728 Ga0207655_1000142 Ga0207655_100014278 271
304 3300025728 Ga0207655_1032951 Ga0207655_10329511 271
305 3300025735 Ga0207713_1001350 Ga0207713_100135021 271
306 3300025735 Ga0207713_1001775 Ga0207713_10017753 271
307 3300025735 Ga0207713_1009446 Ga0207713_10094461 271
308 3300025735 Ga0207713_1018496 Ga0207713_10184963 271
309 3300025914 Ga0207671_10000343 Ga0207671_1000034359 271
310 3300025920 Ga0207649_10000013 Ga0207649_10000013136 271
311 3300025923 Ga0207681_10000619 Ga0207681_1000061923 271
312 3300025925 Ga0207650_10000457 Ga0207650_1000045730 271
313 3300025933 Ga0207706_10000140 Ga0207706_1000014086 271
314 3300025935 Ga0207709_10245296 Ga0207709_102452962 271
315 3300025945 Ga0207679_10000005 Ga0207679_10000005390 271
316 3300026041 Ga0207639_10000714 Ga0207639_1000071421 271
317 3300028786 Ga0307517_10092459 Ga0307517_100924592 271
318 3300031731 Ga0307405_10002283 Ga0307405_1000228310 271
319 3300042006 Ga0439432_000345 Ga0439432_000345_1045_1863 271
320 3300042010 Ga0439452_011706 Ga0439452_011706_287_1102 271
321 3300042115 Ga0450911_004718 Ga0450911_004718_1029_1844 271
322 3300042138 Ga0450903_009006 Ga0450903_009006_282_1097 271
323 3300046452 Ga0495617_019300 Ga0495617_019300_234_1067 271
324 3300046453 Ga0495627_003622 Ga0495627_003622_5643_6473 271
325 3300046453 Ga0495627_018085 Ga0495627_018085_1387_2202 271
326 3300046457 Ga0495590_0022648 Ga0495590_0022648_1199_2014 271
327 3300046458 Ga0495591_018412 Ga0495591_018412_169_984 271
328 3300046460 Ga0495638_0001645 Ga0495638_0001645_170_985 271
329 3300046491 Ga0495584_0024517 Ga0495584_0024517_1939_2754 271
330 3300046491 Ga0495584_0198951 Ga0495584_0198951_54_887 271
331 3300046492 Ga0495585_0069803 Ga0495585_0069803_1044_1877 271
332 3300046501 Ga0495607_0051481 Ga0495607_0051481_142_975 271
333 3300046501 Ga0495607_0075994 Ga0495607_0075994_781_1596 271
334 3300046506 Ga0495583_0128898 Ga0495583_0128898_37_855 271
335 3300046507 Ga0495606_0006527 Ga0495606_0006527_553_1368 271
336 3300046507 Ga0495606_0014136 Ga0495606_0014136_399_1232 271
337 3300046512 Ga0495610_0039584 Ga0495610_0039584_149_985 271
338 3300046513 Ga0495616_0012166 Ga0495616_0012166_204_1037 271
339 3300046515 Ga0495620_0004628 Ga0495620_0004628_6648_7463 271
340 3300046515 Ga0495620_0010406 Ga0495620_0010406_210_1043 271
341 3300046518 Ga0495631_0000173 Ga0495631_0000173_1072_1905 271
342 3300046518 Ga0495631_0006959 Ga0495631_0006959_273_1103 271
343 3300046519 Ga0495632_0005144 Ga0495632_0005144_346_1200 271
344 3300046519 Ga0495632_0039979 Ga0495632_0039979_1386_2201 271
345 3300046519 Ga0495632_0041919 Ga0495632_0041919_1250_2065 271
346 3300046519 Ga0495632_0047694 Ga0495632_0047694_283_1113 271
347 3300046519 Ga0495632_0127005 Ga0495632_0127005_314_1129 271
348 3300046523 Ga0495644_0003427 Ga0495644_0003427_284_1099 271
349 3300046524 Ga0495648_0014300 Ga0495648_0014300_44_877 271
350 3300046530 Ga0495654_0028554 Ga0495654_0028554_1667_2497 271
351 3300046530 Ga0495654_0035550 Ga0495654_0035550_1469_2287 271
352 3300046530 Ga0495654_0038136 Ga0495654_0038136_516_1349 271
353 3300046660 Ga0495625_0057291 Ga0495625_0057291_580_1413 271
354 3300046665 Ga0495661_0054952 Ga0495661_0054952_1388_2203 271
355 3300046692 Ga0495671_0055953 Ga0495671_0055953_526_1356 271
356 3300046692 Ga0495671_0088566 Ga0495671_0088566_142_957 271
357 3300046694 Ga0495649_0049666 Ga0495649_0049666_195_1010 271
358 3300046794 Ga0495589_0042552 Ga0495589_0042552_1252_2067 271
359 3300046810 Ga0495660_0052062 Ga0495660_0052062_1223_2038 271
360 3300047320 Ga0495672_0024418 Ga0495672_0024418_2882_3697 271
361 3300047320 Ga0495672_0031265 Ga0495672_0031265_282_1112 271
362 3300047323 Ga0495683_0021324 Ga0495683_0021324_1088_1921 271
363 3300047446 Ga0495679_031797 Ga0495679_031797_20_874 271
364 3300047469 Ga0495673_0000986 Ga0495673_0000986_1715_2548 271
365 3300047470 Ga0495681_0084662 Ga0495681_0084662_209_1042 271
366 3300047472 Ga0495686_0209630 Ga0495686_0209630_171_1004 271
367 3300048920 Ga0496117_0062740 Ga0496117_0062740_1509_2324 271
368 3300048920 Ga0496117_0092404 Ga0496117_0092404_1021_1887 271
369 3300048921 Ga0496118_0239916 Ga0496118_0239916_37_903 271
370 3300048923 Ga0496120_0047072 Ga0496120_0047072_1498_2313 271
371 3300048924 Ga0496121_0371822 Ga0496121_0371822_29_895 271
372 3300048927 Ga0496124_0013704 Ga0496124_0013704_5888_6703 271
373 3300048927 Ga0496124_0066112 Ga0496124_0066112_184_999 271
374 3300048927 Ga0496124_0172177 Ga0496124_0172177_131_964 271
375 3300048928 Ga0496125_0000451 Ga0496125_0000451_196_1011 271
376 3300048928 Ga0496125_0073794 Ga0496125_0073794_384_1199 271
377 3300048928 Ga0496125_0105966 Ga0496125_0105966_192_1025 271
378 3300048928 Ga0496125_0153073 Ga0496125_0153073_63_929 271
379 3300048929 Ga0496126_0161159 Ga0496126_0161159_56_922 271
380 3300048929 Ga0496126_0411830 Ga0496126_0411830_33_851 271
381 3300049459 Ga0495678_023876 Ga0495678_023876_1778_2593 271
382 iso_pu_bacteria 2511231012 2511301206 271
383 iso_pu_bacteria 2511231015 2511323240 271
384 iso_pu_bacteria 2511231020 2511350682 271
385 iso_pu_bacteria 2511231031 2511410736 271
386 iso_pu_bacteria 2643221565 2643845725 271
387 iso_pu_bacteria 2643221571 2643869480 271
388 iso_pu_bacteria 2738543004 2739197071 271
389 iso_pu_bacteria 2738543015 2739259136 271
390 iso_pu_bacteria 2738543025 2739315051 271
391 iso_pu_bacteria 2860339153 2860340923 271
392 iso_pu_bacteria 2904550169 2904555294 271
393 iso_pu_bacteria 2931396565 2931396665 271
394 iso_pu_bacteria 2939636861 2939637528 271
395 iso_pu_bacteria 2946027586 2946032436 271
396 iso_pu_bacteria 3007511990 3007515719 271
397 iso_pu_bacteria 3007619802 3007621325 271
398 iso_pu_bacteria 8056125926 8056127476 271
399 iso_pu_bacteria 8056148874 8056150002 271
400 3300046474 Ga0495605_0034473 Ga0495605_0034473_220_1047 272
401 3300046660 Ga0495625_0045098 Ga0495625_0045098_201_1019 272
402 3300002737 JGI25162J39368_1000042 JGI25162J39368_10000423 273
403 3300002771 JGI25163J39215_1000761 JGI25163J39215_100076110 273
404 3300002772 JGI25164J39214_1000023 JGI25164J39214_1000023164 273
405 3300003214 JGI25165J46597_1000083 JGI25165J46597_1000083171 273
406 3300003781 Ga0055536_1000246 Ga0055536_10002463 273
407 3300005548 Ga0070665_100060434 Ga0070665_1000604343 273
408 3300006946 Ga0079104_1013365 Ga0079104_10133652 273
409 3300009092 Ga0105250_10013833 Ga0105250_100138334 273
410 3300013100 Ga0157373_10019698 Ga0157373_100196982 273
411 3300013102 Ga0157371_10011042 Ga0157371_100110428 273
412 3300013104 Ga0157370_10180128 Ga0157370_101801283 273
413 3300013105 Ga0157369_10032034 Ga0157369_100320341 273
414 3300013307 Ga0157372_10001795 Ga0157372_1000179523 273
415 3300014497 Ga0182008_10005978 Ga0182008_100059782 273
416 3300015261 Ga0182006_1011183 Ga0182006_10111831 273
417 3300015261 Ga0182006_1026114 Ga0182006_10261141 273
418 3300025207 Ga0209760_100114 Ga0209760_10011417 273
419 3300025230 Ga0209563_100888 Ga0209563_1008886 273
420 3300025231 Ga0207427_100008 Ga0207427_100008457 273
421 3300025233 Ga0209437_100014 Ga0209437_100014254 273
422 3300025261 Ga0209233_1000008 Ga0209233_1000008254 273
423 3300025292 Ga0209676_1000345 Ga0209676_100034537 273
424 3300025711 Ga0207696_1000097 Ga0207696_100009758 273
425 3300025711 Ga0207696_1001961 Ga0207696_10019612 273
426 3300025728 Ga0207655_1003503 Ga0207655_100350314 273
427 3300025735 Ga0207713_1003692 Ga0207713_100369214 273
428 3300025933 Ga0207706_10004624 Ga0207706_1000462416 273
429 3300026067 Ga0207678_10230949 Ga0207678_102309491 273
430 3300027111 Ga0209281_1002280 Ga0209281_10022807 273
431 3300027111 Ga0209281_1020846 Ga0209281_10208462 273
432 3300028379 Ga0268266_10014563 Ga0268266_100145638 273
433 3300030521 Ga0307511_10038433 Ga0307511_100384332 273
434 3300030735 Ga0316178_1165151 Ga0316178_11651514 273
435 3300031548 Ga0307408_100420348 Ga0307408_1004203482 273
436 3300031995 Ga0307409_100126984 Ga0307409_1001269841 273
437 3300032002 Ga0307416_100256312 Ga0307416_1002563123 273
438 3300032004 Ga0307414_10096067 Ga0307414_100960672 273
439 3300032005 Ga0307411_10026068 Ga0307411_100260684 273
440 3300041405 Ga0439438_053841 Ga0439438_053841_31_900 273
441 3300041407 Ga0439447_003217 Ga0439447_003217_2831_3682 273
442 3300042006 Ga0439432_002044 Ga0439432_002044_6649_7518 273
443 3300042006 Ga0439432_078328 Ga0439432_078328_36_905 273
444 3300042009 Ga0439451_002939 Ga0439451_002939_335_1183 273
445 3300042009 Ga0439451_030333 Ga0439451_030333_58_909 273
446 3300042010 Ga0439452_000369 Ga0439452_000369_26292_27161 273
447 3300042013 Ga0439456_002240 Ga0439456_002240_2914_3783 273
448 3300042115 Ga0450911_002783 Ga0450911_002783_121_990 273
449 3300042137 Ga0450902_004206 Ga0450902_004206_1219_2088 273
450 3300042145 Ga0450906_006810 Ga0450906_006810_124_993 273
451 3300042532 Ga0450893_0027592 Ga0450893_0027592_84_905 273
452 3300046452 Ga0495617_004893 Ga0495617_004893_203_1024 273
453 3300046452 Ga0495617_052857 Ga0495617_052857_79_900 273
454 3300046453 Ga0495627_069838 Ga0495627_069838_156_977 273
455 3300046458 Ga0495591_004686 Ga0495591_004686_4009_4830 273
456 3300046458 Ga0495591_031550 Ga0495591_031550_154_975 273
457 3300046460 Ga0495638_0016495 Ga0495638_0016495_229_1050 273
458 3300046463 Ga0495653_0237520 Ga0495653_0237520_156_977 273
459 3300046463 Ga0495653_0274265 Ga0495653_0274265_193_1014 273
460 3300046474 Ga0495605_0145234 Ga0495605_0145234_51_872 273
461 3300046491 Ga0495584_0155476 Ga0495584_0155476_90_911 273
462 3300046492 Ga0495585_0010143 Ga0495585_0010143_4670_5491 273
463 3300046492 Ga0495585_0053129 Ga0495585_0053129_1342_2163 273
464 3300046492 Ga0495585_0093000 Ga0495585_0093000_193_1014 273
465 3300046501 Ga0495607_0046364 Ga0495607_0046364_1673_2494 273
466 3300046501 Ga0495607_0054684 Ga0495607_0054684_128_949 273
467 3300046507 Ga0495606_0055497 Ga0495606_0055497_226_1047 273
468 3300046512 Ga0495610_0129395 Ga0495610_0129395_50_871 273
469 3300046512 Ga0495610_0146478 Ga0495610_0146478_96_965 273
470 3300046513 Ga0495616_0146811 Ga0495616_0146811_198_1019 273
471 3300046515 Ga0495620_0025156 Ga0495620_0025156_162_983 273
472 3300046518 Ga0495631_0006792 Ga0495631_0006792_195_1016 273
473 3300046518 Ga0495631_0165296 Ga0495631_0165296_11_832 273
474 3300046519 Ga0495632_0020071 Ga0495632_0020071_156_977 273
475 3300046519 Ga0495632_0051408 Ga0495632_0051408_1043_1864 273
476 3300046519 Ga0495632_0051723 Ga0495632_0051723_1038_1859 273
477 3300046520 Ga0495637_0030403 Ga0495637_0030403_1497_2318 273
478 3300046520 Ga0495637_0031571 Ga0495637_0031571_1360_2229 273
479 3300046520 Ga0495637_0037686 Ga0495637_0037686_138_965 273
480 3300046530 Ga0495654_0005559 Ga0495654_0005559_1555_2376 273
481 3300046530 Ga0495654_0045923 Ga0495654_0045923_38_859 273
482 3300046538 Ga0495609_0000558 Ga0495609_0000558_193_1014 273
483 3300046538 Ga0495609_0033331 Ga0495609_0033331_1387_2256 273
484 3300046542 Ga0495597_0006879 Ga0495597_0006879_160_981 273
485 3300046557 Ga0495622_0004298 Ga0495622_0004298_953_1774 273
486 3300046558 Ga0495633_0008368 Ga0495633_0008368_166_987 273
487 3300046616 Ga0495668_0012891 Ga0495668_0012891_244_1065 273
488 3300046648 Ga0495611_0119780 Ga0495611_0119780_53_874 273
489 3300046660 Ga0495625_0015972 Ga0495625_0015972_178_999 273
490 3300046665 Ga0495661_0133245 Ga0495661_0133245_102_923 273
491 3300046680 Ga0495646_0010200 Ga0495646_0010200_5012_5833 273
492 3300046689 Ga0495613_0092226 Ga0495613_0092226_150_971 273
493 3300046690 Ga0495624_0009404 Ga0495624_0009404_220_1041 273
494 3300046692 Ga0495671_0036366 Ga0495671_0036366_169_990 273
495 3300046692 Ga0495671_0036385 Ga0495671_0036385_160_981 273
496 3300046694 Ga0495649_0051795 Ga0495649_0051795_1189_2010 273
497 3300046809 Ga0495600_0067995 Ga0495600_0067995_1332_2153 273
498 3300046810 Ga0495660_0000599 Ga0495660_0000599_222_1043 273
499 3300046810 Ga0495660_0056765 Ga0495660_0056765_1151_1972 273
500 3300046810 Ga0495660_0112082 Ga0495660_0112082_197_1018 273
501 3300047317 Ga0495604_0094517 Ga0495604_0094517_1216_2037 273
502 3300047320 Ga0495672_0010213 Ga0495672_0010213_195_1016 273
503 3300047320 Ga0495672_0012956 Ga0495672_0012956_4856_5677 273
504 3300047321 Ga0495676_0101965 Ga0495676_0101965_1131_1952 273
505 3300047321 Ga0495676_0122278 Ga0495676_0122278_937_1758 273
506 3300047323 Ga0495683_0176616 Ga0495683_0176616_91_912 273
507 3300047446 Ga0495679_017612 Ga0495679_017612_198_1019 273
508 3300047469 Ga0495673_0029872 Ga0495673_0029872_195_1016 273
509 3300047470 Ga0495681_0001733 Ga0495681_0001733_14110_14946 273
510 3300047470 Ga0495681_0094371 Ga0495681_0094371_361_1182 273
511 3300047471 Ga0495684_0053962 Ga0495684_0053962_77_898 273
512 3300047673 Ga0495593_0123199 Ga0495593_0123199_175_996 273
513 3300048088 Ga0495602_0021303 Ga0495602_0021303_165_986 273
514 3300048091 Ga0495626_0007710 Ga0495626_0007710_4947_5768 273
515 3300048091 Ga0495626_0137805 Ga0495626_0137805_102_971 273
516 3300048915 Ga0496112_0458980 Ga0496112_0458980_178_1074 273
517 3300048919 Ga0496116_0065459 Ga0496116_0065459_158_979 273
518 3300048921 Ga0496118_0015623 Ga0496118_0015623_6029_6850 273
519 3300048922 Ga0496119_0082598 Ga0496119_0082598_870_1691 273
520 3300048923 Ga0496120_0056973 Ga0496120_0056973_268_1089 273
521 3300048924 Ga0496121_0149779 Ga0496121_0149779_122_943 273
522 3300048925 Ga0496122_0020247 Ga0496122_0020247_155_976 273
523 3300048927 Ga0496124_0098956 Ga0496124_0098956_1126_1947 273
524 3300049459 Ga0495678_094727 Ga0495678_094727_150_1019 273
525 3300049459 Ga0495678_113799 Ga0495678_113799_16_837 273
526 3300049460 Ga0495682_0021588 Ga0495682_0021588_1431_2252 273
527 3300049758 Ga0501241_005473 Ga0501241_005473_1463_2284 273
528 3300049766 Ga0501269_002297 Ga0501269_002297_170_991 273
529 3300053111 Ga0500572_002052 Ga0500572_002052_86_955 273
530 iso_pu_bacteria 2808606445 2809218864 273
531 iso_pu_bacteria 8056172158 8056173171 273
532 3300002737 JGI25162J39368_1000080 JGI25162J39368_10000803 274
533 3300002771 JGI25163J39215_1000372 JGI25163J39215_100037217 274
534 3300002772 JGI25164J39214_1000073 JGI25164J39214_100007389 274
535 3300003214 JGI25165J46597_1000152 JGI25165J46597_1000152101 274
536 3300003781 Ga0055536_1000233 Ga0055536_10002333 274
537 3300003791 Ga0055530_10000120 Ga0055530_100001203 274
538 3300003791 Ga0055530_10000240 Ga0055530_1000024020 274
539 3300003792 Ga0055540_1000074 Ga0055540_10000742 274
540 3300003792 Ga0055540_1000248 Ga0055540_100024820 274
541 3300005288 Ga0065714_10002428 Ga0065714_100024288 274
542 3300005288 Ga0065714_10077206 Ga0065714_100772061 274
543 3300005289 Ga0065704_10070222 Ga0065704_1007022251 274
544 3300006051 Ga0075364_10171564 Ga0075364_101715642 274
545 3300006058 Ga0075432_10010646 Ga0075432_100106464 274
546 3300006914 Ga0075436_100074505 Ga0075436_1000745053 274
547 3300006946 Ga0079104_1000094 Ga0079104_100009496 274
548 3300006948 Ga0099826_10011129 Ga0099826_100111297 274
549 3300009553 Ga0105249_10522156 Ga0105249_105221561 274
550 3300013100 Ga0157373_10009493 Ga0157373_100094934 274
551 3300013102 Ga0157371_10003771 Ga0157371_100037712 274
552 3300014497 Ga0182008_10001585 Ga0182008_100015853 274
553 3300017792 Ga0163161_10072891 Ga0163161_100728913 274
554 3300025207 Ga0209760_100200 Ga0209760_10020023 274
555 3300025231 Ga0207427_100001 Ga0207427_1000011063 274
556 3300025233 Ga0209437_100003 Ga0209437_100003309 274
557 3300025261 Ga0209233_1000007 Ga0209233_10000071063 274
558 3300025292 Ga0209676_1000021 Ga0209676_1000021386 274
559 3300025298 Ga0209050_1000162 Ga0209050_100016243 274
560 3300025298 Ga0209050_1000227 Ga0209050_1000227105 274
561 3300025303 Ga0209051_1000121 Ga0209051_1000121109 274
562 3300025303 Ga0209051_1000164 Ga0209051_1000164106 274
563 3300025304 Ga0209257_1006723 Ga0209257_10067233 274
564 3300025935 Ga0207709_10000210 Ga0207709_1000021064 274
565 3300025961 Ga0207712_10318413 Ga0207712_103184132 274
566 3300027111 Ga0209281_1000212 Ga0209281_100021237 274
567 3300027907 Ga0207428_10084262 Ga0207428_100842623 274
568 3300027907 Ga0207428_10105023 Ga0207428_101050232 274
569 3300030744 Ga0316181_1160091 Ga0316181_11600914 274
570 3300031548 Ga0307408_100003149 Ga0307408_1000031492 274
571 3300031548 Ga0307408_100160811 Ga0307408_1001608112 274
572 3300031731 Ga0307405_10008605 Ga0307405_100086055 274
573 3300031731 Ga0307405_10162262 Ga0307405_101622622 274
574 3300031824 Ga0307413_10020501 Ga0307413_100205014 274
575 3300031824 Ga0307413_10171673 Ga0307413_101716732 274
576 3300031901 Ga0307406_10023500 Ga0307406_100235001 274
577 3300031911 Ga0307412_10001838 Ga0307412_1000183813 274
578 3300031911 Ga0307412_10008886 Ga0307412_100088862 274
579 3300031911 Ga0307412_10028897 Ga0307412_100288972 274
580 3300031995 Ga0307409_100546422 Ga0307409_1005464221 274
581 3300041405 Ga0439438_005048 Ga0439438_005048_1190_2014 274
582 3300041405 Ga0439438_016637 Ga0439438_016637_296_1120 274
583 3300041407 Ga0439447_000211 Ga0439447_000211_11782_12606 274
584 3300041407 Ga0439447_013451 Ga0439447_013451_76_957 274
585 3300041407 Ga0439447_017022 Ga0439447_017022_900_1724 274
586 3300041411 Ga0439466_0013843 Ga0439466_0013843_95_919 274
587 3300041411 Ga0439466_0014054 Ga0439466_0014054_169_1041 274
588 3300041411 Ga0439466_0017878 Ga0439466_0017878_1567_2448 274
589 3300041997 Ga0439431_0007447 Ga0439431_0007447_68_949 274
590 3300042004 Ga0439445_0013932 Ga0439445_0013932_86_967 274
591 3300042010 Ga0439452_000260 Ga0439452_000260_263_1087 274
592 3300042010 Ga0439452_018057 Ga0439452_018057_915_1796 274
593 3300042010 Ga0439452_040714 Ga0439452_040714_170_994 274
594 3300042016 Ga0439463_006180 Ga0439463_006180_145_1017 274
595 3300042137 Ga0450902_001942 Ga0450902_001942_474_1298 274
596 3300042137 Ga0450902_002606 Ga0450902_002606_363_1187 274
597 3300042137 Ga0450902_025330 Ga0450902_025330_33_857 274
598 3300042138 Ga0450903_006114 Ga0450903_006114_906_1730 274
599 3300042142 Ga0450905_003581 Ga0450905_003581_244_1068 274
600 3300042147 Ga0450910_006369 Ga0450910_006369_640_1521 274
601 3300042993 Ga0439440_0027885 Ga0439440_0027885_316_1188 274
602 3300046453 Ga0495627_019510 Ga0495627_019510_1272_2096 274
603 3300046457 Ga0495590_0021767 Ga0495590_0021767_1356_2186 274
604 3300046458 Ga0495591_050811 Ga0495591_050811_243_1067 274
605 3300046460 Ga0495638_0195157 Ga0495638_0195157_206_1030 274
606 3300046471 Ga0495650_0008290 Ga0495650_0008290_5162_5992 274
607 3300046474 Ga0495605_0143964 Ga0495605_0143964_12_836 274
608 3300046501 Ga0495607_0001220 Ga0495607_0001220_128_958 274
609 3300046501 Ga0495607_0047077 Ga0495607_0047077_207_1031 274
610 3300046507 Ga0495606_0060789 Ga0495606_0060789_157_981 274
611 3300046512 Ga0495610_0036879 Ga0495610_0036879_1463_2287 274
612 3300046513 Ga0495616_0044339 Ga0495616_0044339_1277_2107 274
613 3300046513 Ga0495616_0149598 Ga0495616_0149598_61_885 274
614 3300046515 Ga0495620_0088474 Ga0495620_0088474_232_1056 274
615 3300046516 Ga0495628_0193347 Ga0495628_0193347_520_1344 274
616 3300046518 Ga0495631_0062922 Ga0495631_0062922_179_1003 274
617 3300046519 Ga0495632_0005190 Ga0495632_0005190_245_1069 274
618 3300046520 Ga0495637_0051769 Ga0495637_0051769_197_1021 274
619 3300046523 Ga0495644_0045490 Ga0495644_0045490_213_1037 274
620 3300046524 Ga0495648_0000330 Ga0495648_0000330_386_1258 274
621 3300046542 Ga0495597_0031941 Ga0495597_0031941_153_977 274
622 3300046691 Ga0495670_0088772 Ga0495670_0088772_548_1372 274
623 3300046692 Ga0495671_0121954 Ga0495671_0121954_205_1029 274
624 3300046692 Ga0495671_0151128 Ga0495671_0151128_153_977 274
625 3300047320 Ga0495672_0020849 Ga0495672_0020849_1633_2457 274
626 3300047469 Ga0495673_0115602 Ga0495673_0115602_115_939 274
627 3300047470 Ga0495681_0002261 Ga0495681_0002261_12864_13694 274
628 3300047470 Ga0495681_0038747 Ga0495681_0038747_1307_2134 274
629 3300047470 Ga0495681_0060221 Ga0495681_0060221_157_981 274
630 3300048091 Ga0495626_0031169 Ga0495626_0031169_1503_2327 274
631 3300048919 Ga0496116_0000185 Ga0496116_0000185_122018_122842 274
632 3300048920 Ga0496117_0004272 Ga0496117_0004272_14058_14882 274
633 3300048921 Ga0496118_0028863 Ga0496118_0028863_236_1060 274
634 3300048924 Ga0496121_0001963 Ga0496121_0001963_30899_31723 274
635 3300048925 Ga0496122_0029988 Ga0496122_0029988_142_966 274
636 3300048926 Ga0496123_0159475 Ga0496123_0159475_200_1024 274
637 3300050491 nmdc:mga00v17_172740_c1 nmdc:mga00v17_172740_c1_156_980 274
638 3300050514 nmdc:mga08x19_77137_c1 nmdc:mga08x19_77137_c1_1092_1928 274
639 iso_pu_bacteria 2511231004 2511256737 274
640 iso_pu_bacteria 2511231010 2511287662 274
641 iso_pu_bacteria 2511231016 2511327721 274
642 iso_pu_bacteria 2511231017 2511331600 274
643 iso_pu_bacteria 2511231018 2511340323 274
644 iso_pu_bacteria 2511231019 2511344947 274
645 iso_pu_bacteria 2511231022 2511364042 274
646 iso_pu_bacteria 2600255318 2601796369 274
647 iso_pu_bacteria 2603880185 2606073519 274
648 iso_pu_bacteria 2603880199 2606126837 274
649 iso_pu_bacteria 2623620443 2624482020 274
650 iso_pu_bacteria 2623620446 2624490899 274
651 iso_pu_bacteria 2643221589 2643956593 274
652 iso_pu_bacteria 2643221602 2644025364 274
653 iso_pu_bacteria 2643221633 2644189531 274
654 iso_pu_bacteria 2713897149 2715758322 274
655 iso_pu_bacteria 2773857670 2774122735 274
656 iso_pu_bacteria 2784132072 2784317622 274
657 iso_pu_bacteria 2808606382 2808957236 274
658 iso_pu_bacteria 2878029506 2878034002 274
659 iso_pu_bacteria 2919063839 2919069381 274
660 iso_pu_bacteria 2919697872 2919701891 274
661 iso_pu_bacteria 3007718800 3007719010 274
662 iso_pu_bacteria 8019775933 8019779374 274
663 iso_pu_bacteria 8056155041 8056155131 274
664 3300005288 Ga0065714_10003367 Ga0065714_100033671 275
665 3300006058 Ga0075432_10017884 Ga0075432_100178842 275
666 3300006058 Ga0075432_10080050 Ga0075432_100800502 275
667 3300006177 Ga0075362_10067080 Ga0075362_100670802 275
668 3300006177 Ga0075362_10084406 Ga0075362_100844062 275
669 3300006186 Ga0075369_10112894 Ga0075369_101128941 275
670 3300006914 Ga0075436_100134149 Ga0075436_1001341493 275
671 3300009036 Ga0105244_10112289 Ga0105244_101122891 275
672 3300009036 Ga0105244_10179488 Ga0105244_101794881 275
673 3300013104 Ga0157370_10021831 Ga0157370_100218318 275
674 3300013306 Ga0163162_10000298 Ga0163162_100002982 275
675 3300017792 Ga0163161_10058743 Ga0163161_100587434 275
676 3300017792 Ga0163161_10085338 Ga0163161_100853383 275
677 3300025711 Ga0207696_1022273 Ga0207696_10222733 275
678 3300025728 Ga0207655_1027723 Ga0207655_10277231 275
679 3300025735 Ga0207713_1033067 Ga0207713_10330672 275
680 3300027907 Ga0207428_10034127 Ga0207428_100341271 275
681 3300027907 Ga0207428_10101690 Ga0207428_101016903 275
682 3300033180 Ga0307510_10000361 Ga0307510_1000036136 275
683 3300041405 Ga0439438_002777 Ga0439438_002777_4950_5789 275
684 3300041405 Ga0439438_012140 Ga0439438_012140_332_1168 275
685 3300041407 Ga0439447_002131 Ga0439447_002131_308_1147 275
686 3300042006 Ga0439432_022050 Ga0439432_022050_687_1523 275
687 3300042010 Ga0439452_002426 Ga0439452_002426_5704_6540 275
688 3300042013 Ga0439456_010385 Ga0439456_010385_752_1588 275
689 3300042013 Ga0439456_038260 Ga0439456_038260_29_856 275
690 3300042121 Ga0450919_002565 Ga0450919_002565_1392_2231 275
691 3300042122 Ga0450920_002530 Ga0450920_002530_2042_2881 275
692 3300042124 Ga0450922_000230 Ga0450922_000230_5136_5975 275
693 3300042145 Ga0450906_006196 Ga0450906_006196_211_1050 275
694 3300042146 Ga0450907_018419 Ga0450907_018419_296_1135 275
695 3300042461 Ga0439460_0000623 Ga0439460_0000623_293_1129 275
696 3300046452 Ga0495617_006203 Ga0495617_006203_3115_3942 275
697 3300046452 Ga0495617_011129 Ga0495617_011129_1934_2773 275
698 3300046452 Ga0495617_033290 Ga0495617_033290_724_1551 275
699 3300046452 Ga0495617_036969 Ga0495617_036969_96_932 275
700 3300046453 Ga0495627_000566 Ga0495627_000566_29140_29973 275
701 3300046453 Ga0495627_018425 Ga0495627_018425_181_1008 275
702 3300046455 Ga0495603_0002139 Ga0495603_0002139_10733_11560 275
703 3300046458 Ga0495591_000311 Ga0495591_000311_43111_43938 275
704 3300046458 Ga0495591_017921 Ga0495591_017921_163_996 275
705 3300046460 Ga0495638_0006372 Ga0495638_0006372_25_867 275
706 3300046460 Ga0495638_0022326 Ga0495638_0022326_295_1122 275
707 3300046460 Ga0495638_0036824 Ga0495638_0036824_1930_2757 275
708 3300046460 Ga0495638_0059844 Ga0495638_0059844_1331_2167 275
709 3300046460 Ga0495638_0089285 Ga0495638_0089285_906_1742 275
710 3300046471 Ga0495650_0004955 Ga0495650_0004955_7761_8588 275
711 3300046474 Ga0495605_0082376 Ga0495605_0082376_513_1340 275
712 3300046475 Ga0495639_0149700 Ga0495639_0149700_224_1051 275
713 3300046491 Ga0495584_0077702 Ga0495584_0077702_711_1538 275
714 3300046491 Ga0495584_0193946 Ga0495584_0193946_65_898 275
715 3300046492 Ga0495585_0049777 Ga0495585_0049777_115_957 275
716 3300046492 Ga0495585_0079685 Ga0495585_0079685_169_996 275
717 3300046500 Ga0495596_0000158 Ga0495596_0000158_3450_4277 275
718 3300046500 Ga0495596_0070917 Ga0495596_0070917_368_1201 275
719 3300046500 Ga0495596_0147041 Ga0495596_0147041_33_866 275
720 3300046501 Ga0495607_0012496 Ga0495607_0012496_60_887 275
721 3300046501 Ga0495607_0067582 Ga0495607_0067582_66_899 275
722 3300046501 Ga0495607_0103650 Ga0495607_0103650_502_1338 275
723 3300046507 Ga0495606_0024688 Ga0495606_0024688_221_1057 275
724 3300046512 Ga0495610_0008339 Ga0495610_0008339_290_1117 275
725 3300046512 Ga0495610_0039525 Ga0495610_0039525_1424_2257 275
726 3300046512 Ga0495610_0121970 Ga0495610_0121970_111_938 275
727 3300046512 Ga0495610_0124852 Ga0495610_0124852_42_884 275
728 3300046513 Ga0495616_0015155 Ga0495616_0015155_3162_3989 275
729 3300046513 Ga0495616_0043391 Ga0495616_0043391_1382_2215 275
730 3300046515 Ga0495620_0033137 Ga0495620_0033137_273_1109 275
731 3300046515 Ga0495620_0034818 Ga0495620_0034818_112_939 275
732 3300046518 Ga0495631_0032137 Ga0495631_0032137_216_1052 275
733 3300046519 Ga0495632_0020584 Ga0495632_0020584_2602_3435 275
734 3300046519 Ga0495632_0041174 Ga0495632_0041174_115_957 275
735 3300046519 Ga0495632_0057419 Ga0495632_0057419_60_887 275
736 3300046519 Ga0495632_0064272 Ga0495632_0064272_266_1102 275
737 3300046519 Ga0495632_0077040 Ga0495632_0077040_490_1317 275
738 3300046519 Ga0495632_0098901 Ga0495632_0098901_532_1365 275
739 3300046520 Ga0495637_0000228 Ga0495637_0000228_42468_43295 275
740 3300046520 Ga0495637_0010815 Ga0495637_0010815_3429_4262 275
741 3300046520 Ga0495637_0012084 Ga0495637_0012084_113_955 275
742 3300046520 Ga0495637_0023417 Ga0495637_0023417_162_989 275
743 3300046520 Ga0495637_0031187 Ga0495637_0031187_283_1119 275
744 3300046520 Ga0495637_0033844 Ga0495637_0033844_388_1215 275
745 3300046522 Ga0495643_0018488 Ga0495643_0018488_60_887 275
746 3300046522 Ga0495643_0041904 Ga0495643_0041904_118_951 275
747 3300046522 Ga0495643_0047318 Ga0495643_0047318_119_952 275
748 3300046522 Ga0495643_0062338 Ga0495643_0062338_951_1787 275
749 3300046523 Ga0495644_0000263 Ga0495644_0000263_23125_23952 275
750 3300046523 Ga0495644_0007693 Ga0495644_0007693_294_1121 275
751 3300046524 Ga0495648_0010552 Ga0495648_0010552_5909_6736 275
752 3300046524 Ga0495648_0014408 Ga0495648_0014408_140_973 275
753 3300046524 Ga0495648_0050867 Ga0495648_0050867_1368_2204 275
754 3300046524 Ga0495648_0055177 Ga0495648_0055177_139_972 275
755 3300046524 Ga0495648_0057960 Ga0495648_0057960_139_966 275
756 3300046530 Ga0495654_0005639 Ga0495654_0005639_291_1118 275
757 3300046530 Ga0495654_0009777 Ga0495654_0009777_4008_4835 275
758 3300046530 Ga0495654_0064574 Ga0495654_0064574_189_1016 275
759 3300046530 Ga0495654_0091559 Ga0495654_0091559_528_1355 275
760 3300046538 Ga0495609_0009321 Ga0495609_0009321_3803_4636 275
761 3300046538 Ga0495609_0031071 Ga0495609_0031071_276_1103 275
762 3300046542 Ga0495597_0011910 Ga0495597_0011910_168_995 275
763 3300046542 Ga0495597_0055168 Ga0495597_0055168_857_1693 275
764 3300046542 Ga0495597_0122675 Ga0495597_0122675_130_972 275
765 3300046557 Ga0495622_0023025 Ga0495622_0023025_226_1053 275
766 3300046616 Ga0495668_0017547 Ga0495668_0017547_289_1116 275
767 3300046616 Ga0495668_0175663 Ga0495668_0175663_219_1052 275
768 3300046648 Ga0495611_0000355 Ga0495611_0000355_28968_29801 275
769 3300046660 Ga0495625_0071664 Ga0495625_0071664_1425_2258 275
770 3300046660 Ga0495625_0080452 Ga0495625_0080452_1265_2092 275
771 3300046665 Ga0495661_0020091 Ga0495661_0020091_3366_4193 275
772 3300046665 Ga0495661_0075465 Ga0495661_0075465_929_1765 275
773 3300046665 Ga0495661_0104795 Ga0495661_0104795_64_891 275
774 3300046691 Ga0495670_0006310 Ga0495670_0006310_4854_5687 275
775 3300046691 Ga0495670_0023283 Ga0495670_0023283_170_997 275
776 3300046691 Ga0495670_0037601 Ga0495670_0037601_109_936 275
777 3300046691 Ga0495670_0068211 Ga0495670_0068211_258_1094 275
778 3300046692 Ga0495671_0014700 Ga0495671_0014700_340_1167 275
779 3300046692 Ga0495671_0038266 Ga0495671_0038266_1392_2228 275
780 3300046692 Ga0495671_0041772 Ga0495671_0041772_1393_2226 275
781 3300046694 Ga0495649_0006623 Ga0495649_0006623_6078_6914 275
782 3300046694 Ga0495649_0055951 Ga0495649_0055951_1013_1840 275
783 3300046694 Ga0495649_0064181 Ga0495649_0064181_119_946 275
784 3300046794 Ga0495589_0005113 Ga0495589_0005113_5900_6733 275
785 3300046794 Ga0495589_0005201 Ga0495589_0005201_72_899 275
786 3300046794 Ga0495589_0038432 Ga0495589_0038432_215_1051 275
787 3300046810 Ga0495660_0087999 Ga0495660_0087999_645_1472 275
788 3300047323 Ga0495683_0005619 Ga0495683_0005619_5857_6693 275
789 3300047323 Ga0495683_0040157 Ga0495683_0040157_1419_2246 275
790 3300047443 Ga0495687_030540 Ga0495687_030540_249_1085 275
791 3300047469 Ga0495673_0012503 Ga0495673_0012503_288_1115 275
792 3300047469 Ga0495673_0019229 Ga0495673_0019229_212_1039 275
793 3300047469 Ga0495673_0027043 Ga0495673_0027043_331_1170 275
794 3300047469 Ga0495673_0031370 Ga0495673_0031370_1549_2388 275
795 3300047470 Ga0495681_0002319 Ga0495681_0002319_12671_13498 275
796 3300047470 Ga0495681_0010043 Ga0495681_0010043_137_970 275
797 3300047470 Ga0495681_0017951 Ga0495681_0017951_2911_3738 275
798 3300047470 Ga0495681_0021905 Ga0495681_0021905_2342_3178 275
799 3300047470 Ga0495681_0043515 Ga0495681_0043515_325_1152 275
800 3300047470 Ga0495681_0099819 Ga0495681_0099819_323_1150 275
801 3300047472 Ga0495686_0017289 Ga0495686_0017289_230_1066 275
802 3300047472 Ga0495686_0048581 Ga0495686_0048581_266_1093 275
803 3300047472 Ga0495686_0057325 Ga0495686_0057325_224_1057 275
804 3300047472 Ga0495686_0065359 Ga0495686_0065359_1304_2146 275
805 3300048091 Ga0495626_0000416 Ga0495626_0000416_42462_43289 275
806 3300048091 Ga0495626_0072382 Ga0495626_0072382_35_871 275
807 3300048919 Ga0496116_0008290 Ga0496116_0008290_7135_7968 275
808 3300048919 Ga0496116_0022008 Ga0496116_0022008_131_961 275
809 3300048920 Ga0496117_0024130 Ga0496117_0024130_137_967 275
810 3300048921 Ga0496118_0020864 Ga0496118_0020864_4768_5598 275
811 3300048924 Ga0496121_0061053 Ga0496121_0061053_202_1029 275
812 3300048926 Ga0496123_0022696 Ga0496123_0022696_171_1001 275
813 3300049460 Ga0495682_0116906 Ga0495682_0116906_64_897 275
814 3300050516 nmdc:mga0sz30_22252_c1 nmdc:mga0sz30_22252_c1_1659_2498 275
815 iso_pu_bacteria 8056177738 8056179365 275
816 3300003781 Ga0055536_1000579 Ga0055536_100057923 276
817 3300003791 Ga0055530_10001021 Ga0055530_100010213 276
818 3300003792 Ga0055540_1000633 Ga0055540_100063323 276
819 3300003794 Ga0055531_10000342 Ga0055531_1000034237 276
820 3300005353 Ga0070669_100017216 Ga0070669_1000172164 276
821 3300025292 Ga0209676_1000010 Ga0209676_1000010209 276
822 3300025298 Ga0209050_1000081 Ga0209050_100008141 276
823 3300025303 Ga0209051_1000104 Ga0209051_100010446 276
824 3300025304 Ga0209257_1000040 Ga0209257_1000040316 276
825 3300025711 Ga0207696_1014946 Ga0207696_10149464 276
826 3300025735 Ga0207713_1000721 Ga0207713_100072126 276
827 3300025735 Ga0207713_1003762 Ga0207713_100376212 276
828 3300025923 Ga0207681_10011889 Ga0207681_100118893 276
829 2124908027 MRS2a_Contig_380 MRS2a_00272140 278
830 3300005288 Ga0065714_10007950 Ga0065714_100079504 278
831 3300005288 Ga0065714_10020066 Ga0065714_100200662 278
832 3300005290 Ga0065712_10001182 Ga0065712_100011823 278
833 3300006058 Ga0075432_10012745 Ga0075432_100127453 278
834 3300006058 Ga0075432_10019216 Ga0075432_100192162 278
835 3300006946 Ga0079104_1000115 Ga0079104_100011598 278
836 3300009036 Ga0105244_10004412 Ga0105244_1000441210 278
837 3300009148 Ga0105243_10000355 Ga0105243_1000035538 278
838 3300009176 Ga0105242_10327486 Ga0105242_103274862 278
839 3300011119 Ga0105246_10005168 Ga0105246_100051683 278
840 3300013100 Ga0157373_10089816 Ga0157373_100898162 278
841 3300013102 Ga0157371_10070678 Ga0157371_100706782 278
842 3300013104 Ga0157370_10128484 Ga0157370_101284843 278
843 3300013104 Ga0157370_10376429 Ga0157370_103764292 278
844 3300015261 Ga0182006_1042720 Ga0182006_10427202 278
845 3300015261 Ga0182006_1083250 Ga0182006_10832501 278
846 3300015262 Ga0182007_10000381 Ga0182007_100003812 278
847 3300015265 Ga0182005_1000394 Ga0182005_10003942 278
848 3300025711 Ga0207696_1002724 Ga0207696_10027243 278
849 3300025728 Ga0207655_1000622 Ga0207655_100062237 278
850 3300025728 Ga0207655_1000772 Ga0207655_100077210 278
851 3300025735 Ga0207713_1009390 Ga0207713_10093907 278
852 3300025935 Ga0207709_10000035 Ga0207709_10000035207 278
853 3300027111 Ga0209281_1000077 Ga0209281_1000077200 278
854 3300038705 Ga0237819_00664 Ga0237819_00664_3555_4391 278
855 3300041407 Ga0439447_006680 Ga0439447_006680_1700_2536 278
856 3300041407 Ga0439447_008087 Ga0439447_008087_1071_1907 278
857 3300041411 Ga0439466_0001699 Ga0439466_0001699_1130_1966 278
858 3300041413 Ga0439465_0016959 Ga0439465_0016959_1233_2069 278
859 3300042006 Ga0439432_024206 Ga0439432_024206_327_1163 278
860 3300042006 Ga0439432_052842 Ga0439432_052842_356_1192 278
861 3300042009 Ga0439451_007175 Ga0439451_007175_1102_1938 278
862 3300042009 Ga0439451_010953 Ga0439451_010953_669_1505 278
863 3300042010 Ga0439452_015355 Ga0439452_015355_111_947 278
864 3300042010 Ga0439452_021515 Ga0439452_021515_737_1573 278
865 3300042013 Ga0439456_005623 Ga0439456_005623_1601_2437 278
866 3300042115 Ga0450911_004090 Ga0450911_004090_1368_2204 278
867 3300042121 Ga0450919_001084 Ga0450919_001084_1580_2416 278
868 3300042124 Ga0450922_003980 Ga0450922_003980_283_1119 278
869 3300042127 Ga0450890_000462 Ga0450890_000462_237_1073 278
870 3300042138 Ga0450903_012540 Ga0450903_012540_356_1192 278
871 3300042145 Ga0450906_003853 Ga0450906_003853_1971_2807 278
872 3300042146 Ga0450907_000091 Ga0450907_000091_1061_1897 278
873 3300042146 Ga0450907_009673 Ga0450907_009673_381_1217 278
874 3300042156 Ga0439446_0010173 Ga0439446_0010173_1469_2305 278
875 3300042156 Ga0439446_0037314 Ga0439446_0037314_374_1210 278
876 3300042184 Ga0450908_004255 Ga0450908_004255_1770_2669 278
877 3300042185 Ga0450909_000736 Ga0450909_000736_1608_2444 278
878 3300042185 Ga0450909_002924 Ga0450909_002924_1355_2191 278
879 3300042435 Ga0439434_0019081 Ga0439434_0019081_254_1090 278
880 3300042439 Ga0439464_0016259 Ga0439464_0016259_123_1022 278
881 3300042461 Ga0439460_0004129 Ga0439460_0004129_2451_3287 278
882 3300042531 Ga0450918_003883 Ga0450918_003883_1763_2599 278
883 3300042993 Ga0439440_0007359 Ga0439440_0007359_237_1073 278
884 3300042993 Ga0439440_0027862 Ga0439440_0027862_240_1076 278
885 3300046452 Ga0495617_000364 Ga0495617_000364_22904_23824 278
886 3300046452 Ga0495617_066684 Ga0495617_066684_235_1071 278
887 3300046455 Ga0495603_0111872 Ga0495603_0111872_546_1382 278
888 3300046457 Ga0495590_0004085 Ga0495590_0004085_192_1040 278
889 3300046457 Ga0495590_0017315 Ga0495590_0017315_1493_2413 278
890 3300046457 Ga0495590_0042034 Ga0495590_0042034_101_937 278
891 3300046458 Ga0495591_023799 Ga0495591_023799_240_1076 278
892 3300046460 Ga0495638_0057833 Ga0495638_0057833_1386_2231 278
893 3300046463 Ga0495653_0042046 Ga0495653_0042046_2551_3387 278
894 3300046471 Ga0495650_0029443 Ga0495650_0029443_1358_2194 278
895 3300046471 Ga0495650_0043402 Ga0495650_0043402_178_1098 278
896 3300046474 Ga0495605_0000464 Ga0495605_0000464_35217_36065 278
897 3300046474 Ga0495605_0034666 Ga0495605_0034666_349_1185 278
898 3300046474 Ga0495605_0035876 Ga0495605_0035876_76_996 278
899 3300046474 Ga0495605_0058365 Ga0495605_0058365_165_1001 278
900 3300046475 Ga0495639_0000126 Ga0495639_0000126_1073_1921 278
901 3300046475 Ga0495639_0181761 Ga0495639_0181761_15_851 278
902 3300046491 Ga0495584_0012814 Ga0495584_0012814_2307_3143 278
903 3300046491 Ga0495584_0033055 Ga0495584_0033055_180_1100 278
904 3300046491 Ga0495584_0035561 Ga0495584_0035561_311_1147 278
905 3300046492 Ga0495585_0053263 Ga0495585_0053263_350_1186 278
906 3300046492 Ga0495585_0060099 Ga0495585_0060099_203_1039 278
907 3300046499 Ga0495594_0029492 Ga0495594_0029492_2009_2845 278
908 3300046499 Ga0495594_0071648 Ga0495594_0071648_103_939 278
909 3300046501 Ga0495607_0008515 Ga0495607_0008515_997_1917 278
910 3300046501 Ga0495607_0009108 Ga0495607_0009108_609_1457 278
911 3300046506 Ga0495583_0032884 Ga0495583_0032884_245_1081 278
912 3300046512 Ga0495610_0092479 Ga0495610_0092479_156_1004 278
913 3300046513 Ga0495616_0000456 Ga0495616_0000456_29958_30878 278
914 3300046518 Ga0495631_0148495 Ga0495631_0148495_132_980 278
915 3300046519 Ga0495632_0000427 Ga0495632_0000427_176_1096 278
916 3300046519 Ga0495632_0037048 Ga0495632_0037048_1389_2225 278
917 3300046520 Ga0495637_0026080 Ga0495637_0026080_1694_2530 278
918 3300046520 Ga0495637_0051574 Ga0495637_0051574_115_1035 278
919 3300046522 Ga0495643_0092879 Ga0495643_0092879_345_1181 278
920 3300046523 Ga0495644_0111029 Ga0495644_0111029_102_938 278
921 3300046524 Ga0495648_0153126 Ga0495648_0153126_147_983 278
922 3300046526 Ga0495666_0083334 Ga0495666_0083334_85_933 278
923 3300046528 Ga0495642_0000230 Ga0495642_0000230_176_1024 278
924 3300046528 Ga0495642_0020713 Ga0495642_0020713_1517_2437 278
925 3300046528 Ga0495642_0021576 Ga0495642_0021576_327_1163 278
926 3300046530 Ga0495654_0041762 Ga0495654_0041762_86_934 278
927 3300046530 Ga0495654_0061452 Ga0495654_0061452_152_1072 278
928 3300046536 Ga0495587_0027521 Ga0495587_0027521_222_1061 278
929 3300046538 Ga0495609_0027600 Ga0495609_0027600_182_1102 278
930 3300046538 Ga0495609_0038753 Ga0495609_0038753_245_1081 278
931 3300046538 Ga0495609_0117406 Ga0495609_0117406_172_1017 278
932 3300046542 Ga0495597_0025461 Ga0495597_0025461_170_1090 278
933 3300046542 Ga0495597_0030943 Ga0495597_0030943_1382_2218 278
934 3300046557 Ga0495622_0001469 Ga0495622_0001469_244_1092 278
935 3300046557 Ga0495622_0006301 Ga0495622_0006301_241_1077 278
936 3300046615 Ga0495656_0014942 Ga0495656_0014942_669_1505 278
937 3300046642 Ga0495634_0043051 Ga0495634_0043051_182_1018 278
938 3300046648 Ga0495611_0134168 Ga0495611_0134168_65_985 278
939 3300046663 Ga0495635_0003528 Ga0495635_0003528_167_1006 278
940 3300046664 Ga0495659_0000468 Ga0495659_0000468_775_1623 278
941 3300046665 Ga0495661_0036064 Ga0495661_0036064_2087_2935 278
942 3300046674 Ga0495588_0048602 Ga0495588_0048602_191_1027 278
943 3300046674 Ga0495588_0056486 Ga0495588_0056486_155_1003 278
944 3300046675 Ga0495657_0087236 Ga0495657_0087236_213_1049 278
945 3300046679 Ga0495623_0057376 Ga0495623_0057376_181_1017 278
946 3300046684 Ga0495669_0010984 Ga0495669_0010984_76_924 278
947 3300046684 Ga0495669_0036043 Ga0495669_0036043_1278_2114 278
948 3300046691 Ga0495670_0006336 Ga0495670_0006336_165_1010 278
949 3300046691 Ga0495670_0012400 Ga0495670_0012400_2423_3271 278
950 3300046692 Ga0495671_0011783 Ga0495671_0011783_1894_2730 278
951 3300046692 Ga0495671_0019126 Ga0495671_0019126_276_1112 278
952 3300046694 Ga0495649_0001671 Ga0495649_0001671_961_1881 278
953 3300046694 Ga0495649_0043997 Ga0495649_0043997_142_990 278
954 3300046694 Ga0495649_0107469 Ga0495649_0107469_431_1279 278
955 3300046794 Ga0495589_0006828 Ga0495589_0006828_1002_1922 278
956 3300046794 Ga0495589_0035101 Ga0495589_0035101_1403_2251 278
957 3300046794 Ga0495589_0046978 Ga0495589_0046978_1278_2114 278
958 3300047315 Ga0495581_0048449 Ga0495581_0048449_222_1142 278
959 3300047317 Ga0495604_0083241 Ga0495604_0083241_1374_2210 278
960 3300047318 Ga0495636_0003818 Ga0495636_0003818_176_1096 278
961 3300047318 Ga0495636_0138033 Ga0495636_0138033_32_868 278
962 3300047318 Ga0495636_0195964 Ga0495636_0195964_24_860 278
963 3300047319 Ga0495674_0112698 Ga0495674_0112698_1270_2109 278
964 3300047320 Ga0495672_0010958 Ga0495672_0010958_1011_1931 278
965 3300047320 Ga0495672_0011169 Ga0495672_0011169_180_1028 278
966 3300047320 Ga0495672_0068758 Ga0495672_0068758_985_1833 278
967 3300047320 Ga0495672_0075812 Ga0495672_0075812_973_1818 278
968 3300047320 Ga0495672_0123491 Ga0495672_0123491_219_1055 278
969 3300047323 Ga0495683_0063581 Ga0495683_0063581_135_971 278
970 3300047323 Ga0495683_0064867 Ga0495683_0064867_530_1378 278
971 3300047323 Ga0495683_0114668 Ga0495683_0114668_327_1163 278
972 3300047443 Ga0495687_005757 Ga0495687_005757_1111_2031 278
973 3300047443 Ga0495687_022403 Ga0495687_022403_1966_2811 278
974 3300047443 Ga0495687_045587 Ga0495687_045587_473_1321 278
975 3300047445 Ga0495677_0003786 Ga0495677_0003786_4760_5596 278
976 3300047447 Ga0495685_023507 Ga0495685_023507_1214_2050 278
977 3300047447 Ga0495685_057075 Ga0495685_057075_294_1214 278
978 3300047469 Ga0495673_0001019 Ga0495673_0001019_23538_24374 278
979 3300047469 Ga0495673_0029074 Ga0495673_0029074_1517_2437 278
980 3300047469 Ga0495673_0038111 Ga0495673_0038111_1269_2105 278
981 3300047673 Ga0495593_0041077 Ga0495593_0041077_1397_2317 278
982 3300047673 Ga0495593_0174330 Ga0495593_0174330_166_1005 278
983 3300048091 Ga0495626_0002043 Ga0495626_0002043_156_1076 278
984 3300048091 Ga0495626_0116140 Ga0495626_0116140_92_928 278
985 3300048091 Ga0495626_0120786 Ga0495626_0120786_115_1035 278
986 3300048905 Ga0496102_0556469 Ga0496102_0556469_149_985 278
987 3300048906 Ga0496103_0079918 Ga0496103_0079918_1022_1858 278
988 3300048913 Ga0496110_0113655 Ga0496110_0113655_1380_2216 278
989 3300048914 Ga0496111_0226886 Ga0496111_0226886_178_1014 278
990 3300048919 Ga0496116_0003783 Ga0496116_0003783_649_1497 278
991 3300048919 Ga0496116_0190307 Ga0496116_0190307_177_1013 278
992 3300048920 Ga0496117_0082349 Ga0496117_0082349_1115_1963 278
993 3300048921 Ga0496118_0148079 Ga0496118_0148079_546_1394 278
994 3300048925 Ga0496122_0014568 Ga0496122_0014568_6552_7400 278
995 3300048927 Ga0496124_0104339 Ga0496124_0104339_1294_2130 278
996 3300048928 Ga0496125_0083020 Ga0496125_0083020_1409_2245 278
997 3300049459 Ga0495678_006332 Ga0495678_006332_5228_6148 278
998 3300049459 Ga0495678_021911 Ga0495678_021911_1726_2562 278
999 3300049460 Ga0495682_0019588 Ga0495682_0019588_343_1188 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

28

257

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gpm-assembly1.cif.gz_A crystal structure of domain 2 from tmargbp 0.8297 120 208
6gpc-assembly1.cif.gz_A crystal structure of the arginine-bound form of domain 1 from tmargbp 0.822 29 116
7a99-assembly1.cif.gz_A crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp 0.8203 29 113
6mld-assembly1.cif.gz_A crystal structure of the periplasmic lysine-, arginine-, ornithine-binding protein (lao) f52a mutant from salmonella typhimurium 0.8101 29 256
2o1m-assembly1.cif.gz_A crystal structure of the probable amino-acid abc transporter extracellular-binding protein ytmk from bacillus subtilis. northeast structural genomics consortium target sr572 0.7897 27 261
ID Description Score Start End Superfamily
3mplA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8571 29 116 3.40.190.10
af_P0AEU0_25_107_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8511 29 106 3.40.190.10
3h7mA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8458 27 256 3.40.190.10
4kqpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8421 27 257 3.40.190.10
3kzgC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8391 30 113 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5K7TV47-F1-model_v4 ABC transporter substrate-binding protein 0.9383 15 270
AF-A0A258C513-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9343 18 264
AF-S6VFC3-F1-model_v4 Uncharacterized protein 0.9266 68 278
AF-S6VFC3-F1-model_v4 Uncharacterized protein 0.9181 68 278
AF-A0A0L6FVI0-F1-model_v4 deleted 0.9153 15 278

Feature Viewer

pLDDT pTM Quality
89.48 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map