F487829

General Info

Members Datasets Scaffolds Average Seq Length
998 353 876 257

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0006685|Ga0495648_0006685_3687_4544
Length 285
Sequence LGHDLPPPGLDAGAPGNCLAEKEIEMSRTLARRYWLTGASSGIGAALAEEILKTGAHLAVSSRTVAPMKDLSLRYPGQVLVVAGDLTNSQTVREIGKQIAEDWGSLDTVILNAGTCEYVDAKQFDASIVEHVVRTNLLASSYCIDAALPLLRAGTAPHMVAMASTVTYLPLPKAEAYGASKAGLRYLFESLRIDLAPEGIELTVISPGFVETPLTEKNDFPMPLSWPVEKAARHIFEKLKERPLEIAFPAAFMGALWPLSKRPDQVKLEIGKRMVRSQPPIKDQP

Samples

Sample ID Description Type Environment
1 2511231010 Pseudomonas sp. GM25 Isolate Nodule
2 2511231011 Pseudomonas sp. GM30 Isolate Nodule
3 2511231012 Pseudomonas sp. GM33 Isolate Nodule
4 2511231014 Pseudomonas sp. GM48 Isolate Nodule
5 2511231015 Pseudomonas sp. GM49 Isolate Nodule
6 2511231017 Pseudomonas sp. GM55 Isolate Nodule
7 2511231018 Pseudomonas sp. GM60 Isolate Nodule
8 2511231019 Pseudomonas sp. GM67 Isolate Nodule
9 2511231020 Pseudomonas sp. GM74 Isolate Nodule
10 2511231021 Pseudomonas sp. GM78 Isolate Nodule
11 2511231023 Pseudomonas sp. GM80 Isolate Nodule
12 2511231031 Pseudomonas sp. GM16 Isolate Nodule
13 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
14 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
15 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
16 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
17 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
18 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
19 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
20 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
21 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
22 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
23 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
24 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
25 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
26 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
27 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
28 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
29 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
30 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
31 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
32 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
33 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
34 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
35 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
36 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
37 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
38 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
39 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
40 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
41 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
42 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
43 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
44 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
45 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
46 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
47 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
48 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
49 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
50 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
51 2773857673 Pseudomonas sp. 443 Isolate Unclassified
52 2784132063 Pseudomonas sp. 424 Isolate Unclassified
53 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
54 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
55 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
56 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
57 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
58 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
59 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
60 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
61 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
62 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
63 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
64 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
65 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
66 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
67 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
68 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
69 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
70 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
71 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
72 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
73 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
74 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
75 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
76 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
77 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
78 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
79 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
80 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
81 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
82 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
83 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
84 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
85 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
86 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
87 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
88 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
89 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
90 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
91 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
92 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
93 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
94 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
95 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
96 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
97 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
98 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
99 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
100 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
101 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
102 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
103 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
104 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
105 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
106 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
107 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
108 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
109 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
110 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
111 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
112 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
113 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
114 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
115 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
116 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
117 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
118 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
119 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
120 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
121 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
122 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
123 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
124 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
125 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
126 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
127 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
128 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
129 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
130 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
131 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
132 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
133 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
134 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
135 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
138 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
139 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
140 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
141 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
156 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
157 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
160 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
167 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
169 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
197 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
211 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
212 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
213 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
214 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
215 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
216 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
217 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
218 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
219 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
220 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
221 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
222 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
223 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
224 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
225 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
226 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
227 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
228 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
229 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
230 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
234 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
235 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
236 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
239 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
253 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
254 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
255 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
261 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
262 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
263 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
267 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
271 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
274 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
275 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
284 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
301 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
304 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
305 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
329 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
330 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
331 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
332 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
333 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
337 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
338 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
339 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
340 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
341 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
342 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
343 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
344 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
345 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
346 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
347 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
348 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
349 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
350 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
351 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
352 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
353 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.78
Metatranscriptomes 0
Isolates 12.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.51
Nodule 1.8
Rhizoplane 2.3
Rhizosphere 80.06
Stem 0
Stem Tuber 0
Unclassified 11.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10231886 3300003323 Bacteria 1733
2 Ga0055539_1000122 3300003752 Bacteria 83751
3 Ga0055533_1000130 3300003756 Bacteria 83751
4 Ga0055532_1000118 3300003758 Bacteria 83743
5 Ga0055525_1000295 3300003759 Bacteria 43955
6 Ga0055526_1003003 3300003771 Bacteria 11014
7 Ga0055524_1017203 3300003775 Bacteria 2559
8 Ga0055536_1000822 3300003781 Bacteria 20490
9 Ga0055536_1000831 3300003781 Bacteria 20372
10 Ga0055530_10001294 3300003791 Bacteria 18901
11 Ga0055530_10030209 3300003791 Bacteria 1439
12 Ga0055540_1000277 3300003792 Bacteria 46097
13 Ga0055531_10000123 3300003794 Bacteria 86722
14 Ga0055541_1000082 3300003841 Bacteria 83751
15 Ga0065714_10006536 3300005288 Bacteria 3204
16 Ga0065714_10064824 3300005288 Bacteria 17738
17 Ga0065714_10067473 3300005288 Bacteria 5476
18 Ga0065714_10069158 3300005288 Bacteria 4364
19 Ga0065714_10077980 3300005288 Bacteria 2640
20 Ga0065714_10187061 3300005288 Bacteria 941
21 Ga0065704_10085475 3300005289 Bacteria 3218
22 Ga0065712_10000180 3300005290 Bacteria 30902
23 Ga0065712_10083210 3300005290 Bacteria 2855
24 Ga0070670_100001337 3300005331 Bacteria 19702
25 Ga0070670_100002685 3300005331 Bacteria 14697
26 Ga0070661_100000550 3300005344 Bacteria 28767
27 Ga0070669_100000354 3300005353 Bacteria 35680
28 Ga0070669_100005412 3300005353 Bacteria 9209
29 Ga0070714_100149542 3300005435 Bacteria 2103
30 Ga0070662_100000402 3300005457 Bacteria 25749
31 Ga0070662_100006388 3300005457 Bacteria 7595
32 Ga0068853_100000188 3300005539 Bacteria 43513
33 Ga0070665_100064792 3300005548 Bacteria 3665
34 Ga0070665_100287362 3300005548 Bacteria 1647
35 Ga0070665_100354167 3300005548 Bacteria 1473
36 Ga0070664_100001098 3300005564 Bacteria 21382
37 Ga0070664_100138987 3300005564 Bacteria 2138
38 Ga0068854_100013770 3300005578 Bacteria 5317
39 Ga0068851_10000021 3300005834 Bacteria 132824
40 Ga0075364_10153213 3300006051 Bacteria 1554
41 Ga0075364_10172227 3300006051 Bacteria 1463
42 Ga0075364_10173924 3300006051 Bacteria 1456
43 Ga0075432_10019662 3300006058 Bacteria 2308
44 Ga0075432_10020489 3300006058 Bacteria 2261
45 Ga0075432_10046285 3300006058 Bacteria 1527
46 Ga0075432_10078449 3300006058 Bacteria 1194
47 Ga0075432_10081665 3300006058 Bacteria 1173
48 Ga0075432_10090150 3300006058 Bacteria 1121
49 Ga0075362_10003476 3300006177 Bacteria 5518
50 Ga0075362_10055628 3300006177 Bacteria 1780
51 Ga0075362_10149450 3300006177 Bacteria 1120
52 Ga0075436_100098389 3300006914 Bacteria 2036
53 Ga0079104_1000331 3300006946 Bacteria 57835
54 Ga0079104_1007406 3300006946 Bacteria 3986
55 Ga0105251_10000012 3300009011 Bacteria 167614
56 Ga0105251_10001226 3300009011 Bacteria 22233
57 Ga0105251_10002141 3300009011 Bacteria 15874
58 Ga0105251_10002793 3300009011 Bacteria 13258
59 Ga0105251_10005731 3300009011 Bacteria 8056
60 Ga0105251_10005928 3300009011 Bacteria 7897
61 Ga0105251_10032944 3300009011 Bacteria 2577
62 Ga0105251_10045588 3300009011 Bacteria 2113
63 Ga0105251_10060867 3300009011 Bacteria 1776
64 Ga0105251_10061882 3300009011 Bacteria 1759
65 Ga0105251_10075030 3300009011 Bacteria 1571
66 Ga0105244_10001648 3300009036 Bacteria 17680
67 Ga0105244_10001896 3300009036 Bacteria 16258
68 Ga0105244_10002038 3300009036 Bacteria 15563
69 Ga0105244_10003111 3300009036 Bacteria 12122
70 Ga0105244_10003864 3300009036 Bacteria 10554
71 Ga0105244_10008293 3300009036 Bacteria 6502
72 Ga0105244_10008504 3300009036 Bacteria 6403
73 Ga0105244_10021455 3300009036 Bacteria 3572
74 Ga0105244_10038592 3300009036 Bacteria 2490
75 Ga0105244_10122762 3300009036 Bacteria 1257
76 Ga0105250_10000637 3300009092 Bacteria 22489
77 Ga0105250_10001376 3300009092 Bacteria 13172
78 Ga0105250_10001848 3300009092 Bacteria 11042
79 Ga0105250_10002425 3300009092 Bacteria 9368
80 Ga0105250_10004161 3300009092 Bacteria 6711
81 Ga0105250_10011125 3300009092 Bacteria 3737
82 Ga0105250_10053048 3300009092 Bacteria 1627
83 Ga0105250_10060107 3300009092 Bacteria 1527
84 Ga0105250_10073235 3300009092 Bacteria 1385
85 Ga0105243_10000335 3300009148 Bacteria 51380
86 Ga0105243_10003629 3300009148 Bacteria 12427
87 Ga0105242_10001961 3300009176 Bacteria 16196
88 Ga0105237_10000547 3300009545 Bacteria 52763
89 Ga0105237_10223757 3300009545 Bacteria 1882
90 Ga0105246_10000484 3300011119 Bacteria 21488
91 Ga0105246_10000502 3300011119 Bacteria 21291
92 Ga0105246_10013025 3300011119 Bacteria 5203
93 Ga0105246_10037540 3300011119 Bacteria 3251
94 Ga0157345_1000093 3300012498 Bacteria 18946
95 Ga0157373_10001705 3300013100 Bacteria 16738
96 Ga0157373_10002281 3300013100 Bacteria 14532
97 Ga0157373_10009410 3300013100 Bacteria 7215
98 Ga0157373_10009411 3300013100 Bacteria 7215
99 Ga0157373_10010433 3300013100 Bacteria 6834
100 Ga0157373_10224821 3300013100 Bacteria 1325
101 Ga0157371_10001483 3300013102 Bacteria 24268
102 Ga0157371_10004812 3300013102 Bacteria 11615
103 Ga0157371_10130965 3300013102 Bacteria 1784
104 Ga0157371_10155754 3300013102 Bacteria 1630
105 Ga0157371_10352138 3300013102 Bacteria 1072
106 Ga0157371_10467986 3300013102 Bacteria 928
107 Ga0157370_10066856 3300013104 Bacteria 3398
108 Ga0157370_10131699 3300013104 Bacteria 2332
109 Ga0157370_10176346 3300013104 Bacteria 1987
110 Ga0157369_10003087 3300013105 Bacteria 19908
111 Ga0157369_10006204 3300013105 Bacteria 13870
112 Ga0157369_10010041 3300013105 Bacteria 10812
113 Ga0157369_10033590 3300013105 Bacteria 5637
114 Ga0157369_10037528 3300013105 Bacteria 5305
115 Ga0157369_10207009 3300013105 Bacteria 2057
116 Ga0163162_10001483 3300013306 Bacteria 21854
117 Ga0163162_10231494 3300013306 Bacteria 1978
118 Ga0157372_10005543 3300013307 Bacteria 13421
119 Ga0157375_10002693 3300013308 Bacteria 15384
120 Ga0157375_10003190 3300013308 Bacteria 14242
121 Ga0157375_10113335 3300013308 Bacteria 2813
122 Ga0157375_10143600 3300013308 Bacteria 2516
123 Ga0182008_10001390 3300014497 Bacteria 16366
124 Ga0182008_10002107 3300014497 Bacteria 12692
125 Ga0182008_10002532 3300014497 Bacteria 11387
126 Ga0182008_10007670 3300014497 Bacteria 5948
127 Ga0182008_10012213 3300014497 Bacteria 4538
128 Ga0182008_10013738 3300014497 Bacteria 4254
129 Ga0182008_10023214 3300014497 Bacteria 3171
130 Ga0182006_1001263 3300015261 Bacteria 15628
131 Ga0182006_1002219 3300015261 Bacteria 10766
132 Ga0182006_1002578 3300015261 Bacteria 9812
133 Ga0182006_1015139 3300015261 Bacteria 3310
134 Ga0182006_1016511 3300015261 Bacteria 3148
135 Ga0182006_1083925 3300015261 Bacteria 1158
136 Ga0182007_10003613 3300015262 Bacteria 7254
137 Ga0182007_10050793 3300015262 Bacteria 1369
138 Ga0182005_1001270 3300015265 Bacteria 10378
139 Ga0182005_1010960 3300015265 Bacteria 2596
140 Ga0163161_10002271 3300017792 Bacteria 13787
141 Ga0163161_10005421 3300017792 Bacteria 8855
142 Ga0163161_10007361 3300017792 Bacteria 7601
143 Ga0163161_10075584 3300017792 Bacteria 2472
144 Ga0163161_10102557 3300017792 Bacteria 2131
145 Ga0163161_10121576 3300017792 Bacteria 1962
146 Ga0163161_10535481 3300017792 Bacteria 958
147 Ga0209435_105928 3300025206 Bacteria 1366
148 Ga0209784_100093 3300025224 Bacteria 116198
149 Ga0209566_100109 3300025225 Bacteria 116198
150 Ga0209674_100133 3300025226 Bacteria 116198
151 Ga0209147_100140 3300025229 Bacteria 116198
152 Ga0209563_100124 3300025230 Bacteria 116198
153 Ga0209563_100745 3300025230 Bacteria 10006
154 Ga0209258_100301 3300025242 Bacteria 80162
155 Ga0209646_1000320 3300025246 Bacteria 36874
156 Ga0209677_100084 3300025253 Bacteria 116198
157 Ga0209759_1002581 3300025256 Bacteria 7834
158 Ga0209673_1001639 3300025273 Bacteria 19361
159 Ga0209675_1016529 3300025291 Bacteria 2144
160 Ga0209676_1000010 3300025292 Bacteria 954025
161 Ga0209676_1000350 3300025292 Bacteria 87204
162 Ga0209564_1000416 3300025295 Bacteria 74830
163 Ga0209050_1000019 3300025298 Bacteria 608757
164 Ga0209050_1002091 3300025298 Bacteria 18294
165 Ga0209256_1001705 3300025299 Bacteria 21152
166 Ga0209051_1000383 3300025303 Bacteria 62847
167 Ga0209051_1008648 3300025303 Bacteria 5361
168 Ga0209257_1000357 3300025304 Bacteria 93431
169 Ga0207656_10000020 3300025321 Bacteria 114666
170 Ga0207696_1000052 3300025711 Bacteria 272880
171 Ga0207696_1000138 3300025711 Bacteria 127572
172 Ga0207696_1000213 3300025711 Bacteria 87128
173 Ga0207696_1001517 3300025711 Bacteria 12461
174 Ga0207696_1004910 3300025711 Bacteria 5661
175 Ga0207696_1005481 3300025711 Bacteria 5258
176 Ga0207655_1000021 3300025728 Bacteria 518596
177 Ga0207655_1000328 3300025728 Bacteria 69613
178 Ga0207655_1000954 3300025728 Bacteria 29930
179 Ga0207655_1003342 3300025728 Bacteria 12014
180 Ga0207655_1003350 3300025728 Bacteria 11997
181 Ga0207655_1004455 3300025728 Bacteria 9930
182 Ga0207655_1005880 3300025728 Bacteria 8227
183 Ga0207655_1007456 3300025728 Bacteria 7094
184 Ga0207655_1034764 3300025728 Bacteria 2261
185 Ga0207655_1054512 3300025728 Bacteria 1589
186 Ga0207655_1088827 3300025728 Bacteria 1093
187 Ga0207713_1000080 3300025735 Bacteria 168403
188 Ga0207713_1000446 3300025735 Bacteria 43475
189 Ga0207713_1001355 3300025735 Bacteria 19964
190 Ga0207713_1001622 3300025735 Bacteria 17526
191 Ga0207713_1002469 3300025735 Bacteria 13448
192 Ga0207713_1003366 3300025735 Bacteria 10954
193 Ga0207713_1004556 3300025735 Bacteria 8973
194 Ga0207713_1007719 3300025735 Bacteria 6287
195 Ga0207713_1016382 3300025735 Bacteria 3762
196 Ga0207713_1027678 3300025735 Bacteria 2571
197 Ga0207671_10000091 3300025914 Bacteria 139661
198 Ga0207649_10000020 3300025920 Bacteria 211018
199 Ga0207681_10000312 3300025923 Bacteria 35505
200 Ga0207681_10002703 3300025923 Bacteria 11237
201 Ga0207650_10000520 3300025925 Bacteria 31632
202 Ga0207650_10000522 3300025925 Bacteria 31563
203 Ga0207664_10428477 3300025929 Bacteria 1179
204 Ga0207706_10001502 3300025933 Bacteria 23149
205 Ga0207706_10006616 3300025933 Bacteria 10731
206 Ga0207686_10003053 3300025934 Bacteria 9012
207 Ga0207709_10000189 3300025935 Bacteria 82404
208 Ga0207709_10004233 3300025935 Bacteria 8319
209 Ga0207709_10005416 3300025935 Bacteria 7254
210 Ga0207711_10043279 3300025941 Bacteria 3840
211 Ga0207679_10000023 3300025945 Bacteria 208356
212 Ga0207679_10212469 3300025945 Bacteria 1623
213 Ga0207639_10002127 3300026041 Bacteria 13339
214 Ga0209281_1000228 3300027111 Bacteria 118988
215 Ga0209281_1005506 3300027111 Bacteria 3502
216 Ga0209281_1005575 3300027111 Bacteria 3467
217 Ga0207428_10028922 3300027907 Bacteria 4599
218 Ga0207428_10074756 3300027907 Bacteria 2657
219 Ga0207428_10092454 3300027907 Bacteria 2347
220 Ga0207428_10154422 3300027907 Bacteria 1746
221 Ga0207428_10158327 3300027907 Bacteria 1721
222 Ga0207428_10209496 3300027907 Bacteria 1465
223 Ga0268266_10478097 3300028379 Bacteria 1187
224 Ga0307517_10089399 3300028786 Bacteria 2537
225 Ga0307511_10010399 3300030521 Bacteria 9248
226 Ga0316178_1164502 3300030735 Bacteria 19764
227 Ga0307509_10037638 3300031507 Bacteria 5288
228 Ga0307408_100000020 3300031548 Bacteria 340408
229 Ga0307408_100001505 3300031548 Bacteria 17302
230 Ga0307516_10094582 3300031730 Bacteria 2812
231 Ga0307405_10000239 3300031731 Bacteria 19944
232 Ga0307407_10228908 3300031903 Bacteria 1261
233 Ga0307412_10027680 3300031911 Bacteria 3537
234 Ga0307412_10214426 3300031911 Bacteria 1471
235 Ga0307409_100009952 3300031995 Bacteria 5873
236 Ga0307414_10017815 3300032004 Bacteria 4355
237 Ga0307411_10044816 3300032005 Bacteria 2840
238 Ga0307510_10003501 3300033180 Bacteria 18292
239 Ga0237819_01398 3300038705 Bacteria 6300
240 Ga0436363_0415726 3300039450 Bacteria 2749
241 Ga0439438_001132 3300041405 Bacteria 11869
242 Ga0439438_001176 3300041405 Bacteria 11622
243 Ga0439438_002514 3300041405 Bacteria 7780
244 Ga0439438_003231 3300041405 Bacteria 6666
245 Ga0439438_007531 3300041405 Bacteria 3712
246 Ga0439438_007957 3300041405 Bacteria 3571
247 Ga0439438_024885 3300041405 Bacteria 1636
248 Ga0439438_054589 3300041405 Bacteria 1009
249 Ga0439447_000778 3300041407 Bacteria 11699
250 Ga0439447_001654 3300041407 Bacteria 8179
251 Ga0439447_002372 3300041407 Bacteria 6883
252 Ga0439447_003180 3300041407 Bacteria 5847
253 Ga0439447_004880 3300041407 Bacteria 4544
254 Ga0439447_013273 3300041407 Bacteria 2342
255 Ga0439466_0012006 3300041411 Bacteria 3198
256 Ga0439466_0020449 3300041411 Bacteria 2359
257 Ga0439466_0034757 3300041411 Bacteria 1707
258 Ga0439466_0036466 3300041411 Bacteria 1660
259 Ga0439432_000220 3300042006 Bacteria 20561
260 Ga0439432_005607 3300042006 Bacteria 4511
261 Ga0439432_028183 3300042006 Bacteria 1830
262 Ga0439451_007377 3300042009 Bacteria 2243
263 Ga0439452_000610 3300042010 Bacteria 18093
264 Ga0439452_000620 3300042010 Bacteria 17943
265 Ga0439452_000710 3300042010 Bacteria 16255
266 Ga0439452_001067 3300042010 Bacteria 12115
267 Ga0439452_032128 3300042010 Bacteria 1284
268 Ga0439456_010963 3300042013 Bacteria 1874
269 Ga0439463_000367 3300042016 Bacteria 12484
270 Ga0439463_038737 3300042016 Bacteria 1210
271 Ga0450911_000325 3300042115 Bacteria 17090
272 Ga0450911_000350 3300042115 Bacteria 15711
273 Ga0450911_006933 3300042115 Bacteria 1665
274 Ga0450919_005429 3300042121 Bacteria 1531
275 Ga0450920_000077 3300042122 Bacteria 12684
276 Ga0450922_000111 3300042124 Bacteria 7954
277 Ga0450923_011103 3300042125 Bacteria 1613
278 Ga0450892_013218 3300042130 Bacteria 751
279 Ga0450902_003854 3300042137 Bacteria 2213
280 Ga0450902_014979 3300042137 Bacteria 1255
281 Ga0450902_025998 3300042137 Bacteria 978
282 Ga0450903_001128 3300042138 Bacteria 5046
283 Ga0450903_001557 3300042138 Bacteria 4272
284 Ga0450903_001702 3300042138 Bacteria 4054
285 Ga0450903_006541 3300042138 Bacteria 1930
286 Ga0450904_000312 3300042139 Bacteria 10265
287 Ga0450905_005133 3300042142 Bacteria 1755
288 Ga0450906_000403 3300042145 Bacteria 8904
289 Ga0450906_008043 3300042145 Bacteria 2056
290 Ga0450907_000534 3300042146 Bacteria 10311
291 Ga0450908_015428 3300042184 Bacteria 1368
292 Ga0439464_0000206 3300042439 Bacteria 10478
293 Ga0439460_0000711 3300042461 Bacteria 7414
294 Ga0450918_008235 3300042531 Bacteria 1833
295 Ga0450901_000142 3300042533 Bacteria 8004
296 Ga0495617_000667 3300046452 Bacteria 17138
297 Ga0495617_001882 3300046452 Bacteria 8848
298 Ga0495617_003367 3300046452 Bacteria 6026
299 Ga0495617_005415 3300046452 Bacteria 4525
300 Ga0495617_005526 3300046452 Bacteria 4475
301 Ga0495617_005795 3300046452 Bacteria 4361
302 Ga0495617_009584 3300046452 Bacteria 3323
303 Ga0495617_015400 3300046452 Bacteria 2591
304 Ga0495617_015605 3300046452 Bacteria 2572
305 Ga0495617_015626 3300046452 Bacteria 2570
306 Ga0495617_021642 3300046452 Bacteria 2172
307 Ga0495617_025225 3300046452 Bacteria 2004
308 Ga0495617_064930 3300046452 Bacteria 1204
309 Ga0495627_000246 3300046453 Bacteria 57085
310 Ga0495627_000953 3300046453 Bacteria 19856
311 Ga0495627_001633 3300046453 Bacteria 12509
312 Ga0495627_001765 3300046453 Bacteria 11626
313 Ga0495627_002228 3300046453 Bacteria 9623
314 Ga0495627_025502 3300046453 Bacteria 1916
315 Ga0495627_044529 3300046453 Bacteria 1354
316 Ga0495603_0031023 3300046455 Bacteria 3218
317 Ga0495603_0098430 3300046455 Bacteria 1708
318 Ga0495590_0000955 3300046457 Bacteria 12758
319 Ga0495590_0002233 3300046457 Bacteria 8096
320 Ga0495590_0019725 3300046457 Bacteria 2399
321 Ga0495590_0024064 3300046457 Bacteria 2147
322 Ga0495590_0027149 3300046457 Bacteria 2009
323 Ga0495590_0033997 3300046457 Bacteria 1781
324 Ga0495590_0050680 3300046457 Bacteria 1449
325 Ga0495591_000019 3300046458 Bacteria 223010
326 Ga0495591_001429 3300046458 Bacteria 14853
327 Ga0495591_001566 3300046458 Bacteria 13931
328 Ga0495591_001624 3300046458 Bacteria 13596
329 Ga0495591_001930 3300046458 Bacteria 12142
330 Ga0495591_003011 3300046458 Bacteria 8968
331 Ga0495591_003045 3300046458 Bacteria 8905
332 Ga0495591_004667 3300046458 Bacteria 6586
333 Ga0495591_005165 3300046458 Bacteria 6118
334 Ga0495591_005380 3300046458 Bacteria 5942
335 Ga0495591_005801 3300046458 Bacteria 5615
336 Ga0495591_009091 3300046458 Bacteria 3985
337 Ga0495629_0015042 3300046459 Bacteria 5561
338 Ga0495638_0002867 3300046460 Bacteria 13805
339 Ga0495638_0004852 3300046460 Bacteria 10124
340 Ga0495638_0005069 3300046460 Bacteria 9873
341 Ga0495638_0008148 3300046460 Bacteria 7448
342 Ga0495638_0008213 3300046460 Bacteria 7419
343 Ga0495638_0009283 3300046460 Bacteria 6912
344 Ga0495638_0025048 3300046460 Bacteria 3882
345 Ga0495638_0040582 3300046460 Bacteria 2949
346 Ga0495638_0134043 3300046460 Bacteria 1452
347 Ga0495638_0183613 3300046460 Bacteria 1191
348 Ga0495653_0002354 3300046463 Bacteria 15012
349 Ga0495653_0017215 3300046463 Bacteria 5877
350 Ga0495653_0017248 3300046463 Bacteria 5872
351 Ga0495653_0048799 3300046463 Bacteria 3265
352 Ga0495653_0048908 3300046463 Bacteria 3260
353 Ga0495650_0000392 3300046471 Bacteria 74545
354 Ga0495650_0001565 3300046471 Bacteria 21555
355 Ga0495650_0002459 3300046471 Bacteria 14936
356 Ga0495650_0002495 3300046471 Bacteria 14777
357 Ga0495650_0014382 3300046471 Bacteria 4121
358 Ga0495650_0035608 3300046471 Bacteria 2189
359 Ga0495582_0004029 3300046473 Bacteria 8245
360 Ga0495605_0000014 3300046474 Bacteria 305393
361 Ga0495605_0000763 3300046474 Bacteria 23515
362 Ga0495605_0001780 3300046474 Bacteria 13818
363 Ga0495605_0002004 3300046474 Bacteria 12877
364 Ga0495605_0003819 3300046474 Bacteria 8935
365 Ga0495605_0008550 3300046474 Bacteria 5786
366 Ga0495605_0008629 3300046474 Bacteria 5758
367 Ga0495605_0008757 3300046474 Bacteria 5711
368 Ga0495605_0060188 3300046474 Bacteria 1820
369 Ga0495605_0087940 3300046474 Bacteria 1444
370 Ga0495639_0001953 3300046475 Bacteria 9140
371 Ga0495584_0001741 3300046491 Bacteria 12726
372 Ga0495584_0002524 3300046491 Bacteria 10348
373 Ga0495584_0003815 3300046491 Bacteria 8190
374 Ga0495584_0004805 3300046491 Bacteria 7224
375 Ga0495584_0007706 3300046491 Bacteria 5606
376 Ga0495584_0012828 3300046491 Bacteria 4277
377 Ga0495584_0013835 3300046491 Bacteria 4113
378 Ga0495584_0017822 3300046491 Bacteria 3612
379 Ga0495584_0039515 3300046491 Bacteria 2383
380 Ga0495585_0001101 3300046492 Bacteria 22238
381 Ga0495585_0001554 3300046492 Bacteria 17806
382 Ga0495585_0002369 3300046492 Bacteria 13524
383 Ga0495585_0002609 3300046492 Bacteria 12727
384 Ga0495585_0003939 3300046492 Bacteria 9818
385 Ga0495585_0004096 3300046492 Bacteria 9564
386 Ga0495585_0008451 3300046492 Bacteria 6239
387 Ga0495585_0017309 3300046492 Bacteria 4165
388 Ga0495585_0019075 3300046492 Bacteria 3957
389 Ga0495594_0001414 3300046499 Bacteria 12453
390 Ga0495594_0086638 3300046499 Bacteria 1752
391 Ga0495596_0000586 3300046500 Bacteria 22741
392 Ga0495596_0060271 3300046500 Bacteria 1478
393 Ga0495596_0113229 3300046500 Bacteria 1053
394 Ga0495607_0000786 3300046501 Bacteria 30106
395 Ga0495607_0001843 3300046501 Bacteria 18048
396 Ga0495607_0002422 3300046501 Bacteria 15227
397 Ga0495607_0003715 3300046501 Bacteria 11572
398 Ga0495607_0003902 3300046501 Bacteria 11232
399 Ga0495607_0005045 3300046501 Bacteria 9577
400 Ga0495607_0005495 3300046501 Bacteria 9056
401 Ga0495607_0005660 3300046501 Bacteria 8900
402 Ga0495607_0005888 3300046501 Bacteria 8705
403 Ga0495607_0011711 3300046501 Bacteria 5821
404 Ga0495607_0016905 3300046501 Bacteria 4696
405 Ga0495607_0022877 3300046501 Bacteria 3920
406 Ga0495607_0063745 3300046501 Bacteria 2084
407 Ga0495607_0083819 3300046501 Bacteria 1745
408 Ga0495583_0000238 3300046506 Bacteria 91142
409 Ga0495583_0001503 3300046506 Bacteria 23204
410 Ga0495583_0002423 3300046506 Bacteria 15994
411 Ga0495583_0003204 3300046506 Bacteria 12808
412 Ga0495583_0004004 3300046506 Bacteria 10856
413 Ga0495583_0006547 3300046506 Bacteria 7588
414 Ga0495583_0007217 3300046506 Bacteria 7046
415 Ga0495583_0012358 3300046506 Bacteria 4839
416 Ga0495583_0017067 3300046506 Bacteria 3869
417 Ga0495606_0003000 3300046507 Bacteria 18536
418 Ga0495606_0003494 3300046507 Bacteria 16641
419 Ga0495606_0003509 3300046507 Bacteria 16588
420 Ga0495606_0004719 3300046507 Bacteria 13433
421 Ga0495606_0016662 3300046507 Bacteria 5592
422 Ga0495606_0022937 3300046507 Bacteria 4534
423 Ga0495606_0024044 3300046507 Bacteria 4402
424 Ga0495606_0030789 3300046507 Bacteria 3741
425 Ga0495606_0035727 3300046507 Bacteria 3394
426 Ga0495606_0038493 3300046507 Bacteria 3234
427 Ga0495606_0041651 3300046507 Bacteria 3078
428 Ga0495606_0046100 3300046507 Bacteria 2883
429 Ga0495606_0052514 3300046507 Bacteria 2650
430 Ga0495610_0002277 3300046512 Bacteria 16214
431 Ga0495610_0002473 3300046512 Bacteria 15494
432 Ga0495610_0003164 3300046512 Bacteria 13054
433 Ga0495610_0004307 3300046512 Bacteria 10568
434 Ga0495610_0005854 3300046512 Bacteria 8632
435 Ga0495610_0007604 3300046512 Bacteria 7175
436 Ga0495610_0012014 3300046512 Bacteria 5245
437 Ga0495610_0072322 3300046512 Bacteria 1605
438 Ga0495610_0079431 3300046512 Bacteria 1510
439 Ga0495616_0001700 3300046513 Bacteria 15013
440 Ga0495616_0001714 3300046513 Bacteria 14956
441 Ga0495616_0002067 3300046513 Bacteria 13489
442 Ga0495616_0016901 3300046513 Bacteria 4029
443 Ga0495616_0017724 3300046513 Bacteria 3923
444 Ga0495616_0018767 3300046513 Bacteria 3788
445 Ga0495616_0063553 3300046513 Bacteria 1804
446 Ga0495616_0067724 3300046513 Bacteria 1734
447 Ga0495620_0000094 3300046515 Bacteria 70534
448 Ga0495620_0000851 3300046515 Bacteria 18847
449 Ga0495620_0001961 3300046515 Bacteria 12055
450 Ga0495620_0003510 3300046515 Bacteria 8964
451 Ga0495620_0004762 3300046515 Bacteria 7632
452 Ga0495620_0009416 3300046515 Bacteria 5197
453 Ga0495620_0012824 3300046515 Bacteria 4310
454 Ga0495620_0014365 3300046515 Bacteria 4026
455 Ga0495620_0018411 3300046515 Bacteria 3459
456 Ga0495620_0059565 3300046515 Bacteria 1595
457 Ga0495620_0114305 3300046515 Bacteria 1067
458 Ga0495628_0112089 3300046516 Bacteria 2097
459 Ga0495630_0002286 3300046517 Bacteria 13336
460 Ga0495630_0006836 3300046517 Bacteria 8131
461 Ga0495630_0271947 3300046517 Bacteria 1294
462 Ga0495631_0000488 3300046518 Bacteria 26555
463 Ga0495631_0001163 3300046518 Bacteria 16265
464 Ga0495631_0001609 3300046518 Bacteria 13496
465 Ga0495631_0007414 3300046518 Bacteria 5575
466 Ga0495631_0029690 3300046518 Bacteria 2484
467 Ga0495631_0111459 3300046518 Bacteria 1176
468 Ga0495632_0001292 3300046519 Bacteria 21166
469 Ga0495632_0001914 3300046519 Bacteria 16652
470 Ga0495632_0002117 3300046519 Bacteria 15493
471 Ga0495632_0003612 3300046519 Bacteria 10879
472 Ga0495632_0004418 3300046519 Bacteria 9558
473 Ga0495632_0005155 3300046519 Bacteria 8717
474 Ga0495632_0009076 3300046519 Bacteria 6020
475 Ga0495632_0012529 3300046519 Bacteria 4887
476 Ga0495632_0019488 3300046519 Bacteria 3693
477 Ga0495632_0020796 3300046519 Bacteria 3546
478 Ga0495632_0055953 3300046519 Bacteria 1929
479 Ga0495632_0065717 3300046519 Bacteria 1751
480 Ga0495632_0067295 3300046519 Bacteria 1728
481 Ga0495632_0204618 3300046519 Bacteria 897
482 Ga0495637_0000032 3300046520 Bacteria 128687
483 Ga0495637_0000090 3300046520 Bacteria 70678
484 Ga0495637_0001989 3300046520 Bacteria 11563
485 Ga0495637_0002101 3300046520 Bacteria 11202
486 Ga0495637_0002393 3300046520 Bacteria 10384
487 Ga0495637_0004336 3300046520 Bacteria 7362
488 Ga0495637_0005094 3300046520 Bacteria 6741
489 Ga0495637_0005108 3300046520 Bacteria 6730
490 Ga0495637_0006798 3300046520 Bacteria 5726
491 Ga0495637_0007678 3300046520 Bacteria 5334
492 Ga0495637_0018274 3300046520 Bacteria 3253
493 Ga0495637_0033672 3300046520 Bacteria 2248
494 Ga0495637_0048433 3300046520 Bacteria 1789
495 Ga0495637_0058756 3300046520 Bacteria 1584
496 Ga0495637_0067001 3300046520 Bacteria 1458
497 Ga0495637_0103968 3300046520 Bacteria 1107
498 Ga0495643_0005003 3300046522 Bacteria 9086
499 Ga0495643_0019867 3300046522 Bacteria 3882
500 Ga0495643_0032561 3300046522 Bacteria 2893
501 Ga0495643_0058745 3300046522 Bacteria 2046
502 Ga0495643_0059987 3300046522 Bacteria 2020
503 Ga0495643_0111861 3300046522 Bacteria 1388
504 Ga0495643_0127996 3300046522 Bacteria 1277
505 Ga0495644_0001092 3300046523 Bacteria 11207
506 Ga0495644_0001366 3300046523 Bacteria 9970
507 Ga0495644_0001826 3300046523 Bacteria 8579
508 Ga0495644_0007472 3300046523 Bacteria 4210
509 Ga0495644_0069183 3300046523 Bacteria 1326
510 Ga0495648_0001390 3300046524 Bacteria 23808
511 Ga0495648_0003731 3300046524 Bacteria 13287
512 Ga0495648_0003891 3300046524 Bacteria 12947
513 Ga0495648_0006276 3300046524 Bacteria 9725
514 Ga0495648_0006685 3300046524 Bacteria 9337
515 Ga0495648_0006947 3300046524 Bacteria 9128
516 Ga0495648_0009988 3300046524 Bacteria 7280
517 Ga0495648_0011393 3300046524 Bacteria 6699
518 Ga0495648_0012078 3300046524 Bacteria 6465
519 Ga0495648_0020771 3300046524 Bacteria 4567
520 Ga0495648_0025249 3300046524 Bacteria 4026
521 Ga0495648_0056637 3300046524 Bacteria 2356
522 Ga0495648_0112399 3300046524 Bacteria 1479
523 Ga0495666_0001124 3300046526 Bacteria 12812
524 Ga0495666_0025192 3300046526 Bacteria 2938
525 Ga0495642_0000700 3300046528 Bacteria 16658
526 Ga0495654_0001918 3300046530 Bacteria 13798
527 Ga0495654_0002652 3300046530 Bacteria 11375
528 Ga0495654_0003715 3300046530 Bacteria 9262
529 Ga0495654_0005089 3300046530 Bacteria 7689
530 Ga0495654_0005593 3300046530 Bacteria 7273
531 Ga0495654_0006439 3300046530 Bacteria 6672
532 Ga0495654_0006741 3300046530 Bacteria 6494
533 Ga0495654_0010466 3300046530 Bacteria 5044
534 Ga0495654_0011769 3300046530 Bacteria 4723
535 Ga0495654_0014441 3300046530 Bacteria 4203
536 Ga0495654_0014657 3300046530 Bacteria 4168
537 Ga0495654_0022336 3300046530 Bacteria 3286
538 Ga0495654_0035654 3300046530 Bacteria 2503
539 Ga0495654_0042198 3300046530 Bacteria 2265
540 Ga0495665_0164050 3300046531 Bacteria 1158
541 Ga0495587_0002952 3300046536 Bacteria 11367
542 Ga0495609_0000006 3300046538 Bacteria 431833
543 Ga0495609_0000024 3300046538 Bacteria 264100
544 Ga0495609_0000040 3300046538 Bacteria 177058
545 Ga0495609_0001176 3300046538 Bacteria 18064
546 Ga0495609_0002123 3300046538 Bacteria 12461
547 Ga0495609_0005019 3300046538 Bacteria 7080
548 Ga0495609_0010441 3300046538 Bacteria 4450
549 Ga0495609_0055834 3300046538 Bacteria 1751
550 Ga0495597_0000010 3300046542 Bacteria 222418
551 Ga0495597_0002368 3300046542 Bacteria 12098
552 Ga0495597_0003333 3300046542 Bacteria 9467
553 Ga0495597_0003939 3300046542 Bacteria 8365
554 Ga0495597_0007406 3300046542 Bacteria 5574
555 Ga0495597_0009040 3300046542 Bacteria 4950
556 Ga0495597_0009761 3300046542 Bacteria 4726
557 Ga0495597_0013074 3300046542 Bacteria 3985
558 Ga0495597_0051472 3300046542 Bacteria 1815
559 Ga0495597_0053369 3300046542 Bacteria 1777
560 Ga0495645_0052289 3300046543 Bacteria 2972
561 Ga0495645_0058749 3300046543 Bacteria 2790
562 Ga0495645_0123796 3300046543 Bacteria 1818
563 Ga0495622_0001169 3300046557 Bacteria 13597
564 Ga0495622_0001974 3300046557 Bacteria 10053
565 Ga0495622_0064167 3300046557 Bacteria 1698
566 Ga0495633_0000118 3300046558 Bacteria 107914
567 Ga0495633_0004331 3300046558 Bacteria 9060
568 Ga0495633_0006665 3300046558 Bacteria 6803
569 Ga0495633_0019663 3300046558 Bacteria 3412
570 Ga0495656_0084414 3300046615 Bacteria 1440
571 Ga0495656_0139941 3300046615 Bacteria 1160
572 Ga0495668_0003335 3300046616 Bacteria 12107
573 Ga0495668_0005345 3300046616 Bacteria 8758
574 Ga0495668_0016347 3300046616 Bacteria 4312
575 Ga0495668_0023422 3300046616 Bacteria 3522
576 Ga0495668_0023581 3300046616 Bacteria 3506
577 Ga0495634_0002180 3300046642 Bacteria 16448
578 Ga0495611_0000580 3300046648 Bacteria 21129
579 Ga0495611_0000824 3300046648 Bacteria 17105
580 Ga0495611_0003161 3300046648 Bacteria 7303
581 Ga0495611_0008174 3300046648 Bacteria 4438
582 Ga0495625_0001279 3300046660 Bacteria 31563
583 Ga0495625_0005248 3300046660 Bacteria 11916
584 Ga0495625_0006726 3300046660 Bacteria 10184
585 Ga0495625_0009944 3300046660 Bacteria 7911
586 Ga0495625_0013736 3300046660 Bacteria 6492
587 Ga0495625_0038622 3300046660 Bacteria 3493
588 Ga0495625_0041360 3300046660 Bacteria 3355
589 Ga0495625_0043105 3300046660 Bacteria 3274
590 Ga0495625_0043396 3300046660 Bacteria 3261
591 Ga0495625_0096076 3300046660 Bacteria 2042
592 Ga0495635_0000990 3300046663 Bacteria 18718
593 Ga0495635_0007979 3300046663 Bacteria 7400
594 Ga0495661_0000019 3300046665 Bacteria 200606
595 Ga0495661_0001172 3300046665 Bacteria 22850
596 Ga0495661_0001599 3300046665 Bacteria 18637
597 Ga0495661_0002456 3300046665 Bacteria 14273
598 Ga0495661_0005146 3300046665 Bacteria 9316
599 Ga0495661_0005533 3300046665 Bacteria 8965
600 Ga0495661_0008134 3300046665 Bacteria 7268
601 Ga0495661_0016126 3300046665 Bacteria 4963
602 Ga0495661_0018734 3300046665 Bacteria 4545
603 Ga0495661_0116150 3300046665 Bacteria 1485
604 Ga0495661_0215785 3300046665 Bacteria 996
605 Ga0495588_0014652 3300046674 Bacteria 3758
606 Ga0495588_0180640 3300046674 Bacteria 1115
607 Ga0495599_0152622 3300046678 Bacteria 1430
608 Ga0495623_0001930 3300046679 Bacteria 13925
609 Ga0495623_0005963 3300046679 Bacteria 7939
610 Ga0495646_0004496 3300046680 Bacteria 8784
611 Ga0495646_0033141 3300046680 Bacteria 3212
612 Ga0495669_0113697 3300046684 Bacteria 1265
613 Ga0495613_0007975 3300046689 Bacteria 7881
614 Ga0495613_0009155 3300046689 Bacteria 7342
615 Ga0495613_0017806 3300046689 Bacteria 5294
616 Ga0495613_0352488 3300046689 Bacteria 1011
617 Ga0495624_0001662 3300046690 Bacteria 17053
618 Ga0495670_0000636 3300046691 Bacteria 16756
619 Ga0495670_0003410 3300046691 Bacteria 7807
620 Ga0495670_0003864 3300046691 Bacteria 7359
621 Ga0495670_0019874 3300046691 Bacteria 3309
622 Ga0495671_0002745 3300046692 Bacteria 11024
623 Ga0495671_0003114 3300046692 Bacteria 10306
624 Ga0495671_0003357 3300046692 Bacteria 9875
625 Ga0495671_0005851 3300046692 Bacteria 7158
626 Ga0495671_0006265 3300046692 Bacteria 6892
627 Ga0495671_0007722 3300046692 Bacteria 6101
628 Ga0495671_0008603 3300046692 Bacteria 5732
629 Ga0495671_0011531 3300046692 Bacteria 4857
630 Ga0495671_0012152 3300046692 Bacteria 4706
631 Ga0495671_0013449 3300046692 Bacteria 4433
632 Ga0495671_0018033 3300046692 Bacteria 3753
633 Ga0495671_0038321 3300046692 Bacteria 2422
634 Ga0495671_0052092 3300046692 Bacteria 2034
635 Ga0495671_0060818 3300046692 Bacteria 1864
636 Ga0495671_0108947 3300046692 Bacteria 1352
637 Ga0495671_0114558 3300046692 Bacteria 1316
638 Ga0495671_0150892 3300046692 Bacteria 1131
639 Ga0495649_0003038 3300046694 Bacteria 11507
640 Ga0495649_0003156 3300046694 Bacteria 11262
641 Ga0495649_0004810 3300046694 Bacteria 8744
642 Ga0495649_0009238 3300046694 Bacteria 5873
643 Ga0495649_0011169 3300046694 Bacteria 5280
644 Ga0495649_0014774 3300046694 Bacteria 4462
645 Ga0495649_0019982 3300046694 Bacteria 3758
646 Ga0495649_0020439 3300046694 Bacteria 3714
647 Ga0495649_0025150 3300046694 Bacteria 3316
648 Ga0495649_0039547 3300046694 Bacteria 2585
649 Ga0495649_0055194 3300046694 Bacteria 2147
650 Ga0495649_0116891 3300046694 Bacteria 1411
651 Ga0495589_0001025 3300046794 Bacteria 16878
652 Ga0495589_0001592 3300046794 Bacteria 13016
653 Ga0495589_0004214 3300046794 Bacteria 7687
654 Ga0495589_0005475 3300046794 Bacteria 6699
655 Ga0495589_0007705 3300046794 Bacteria 5635
656 Ga0495589_0007970 3300046794 Bacteria 5543
657 Ga0495589_0014691 3300046794 Bacteria 4029
658 Ga0495589_0021469 3300046794 Bacteria 3299
659 Ga0495589_0021921 3300046794 Bacteria 3263
660 Ga0495589_0133637 3300046794 Bacteria 1190
661 Ga0495600_0036841 3300046809 Bacteria 3179
662 Ga0495600_0071493 3300046809 Bacteria 2266
663 Ga0495660_0001004 3300046810 Bacteria 20529
664 Ga0495660_0002003 3300046810 Bacteria 13242
665 Ga0495660_0002035 3300046810 Bacteria 13141
666 Ga0495660_0002728 3300046810 Bacteria 11144
667 Ga0495660_0003528 3300046810 Bacteria 9642
668 Ga0495660_0003972 3300046810 Bacteria 9028
669 Ga0495660_0004059 3300046810 Bacteria 8941
670 Ga0495660_0004293 3300046810 Bacteria 8639
671 Ga0495660_0005931 3300046810 Bacteria 7276
672 Ga0495660_0009934 3300046810 Bacteria 5539
673 Ga0495660_0010156 3300046810 Bacteria 5474
674 Ga0495660_0013222 3300046810 Bacteria 4781
675 Ga0495660_0015884 3300046810 Bacteria 4344
676 Ga0495660_0019786 3300046810 Bacteria 3864
677 Ga0495660_0020997 3300046810 Bacteria 3742
678 Ga0495660_0028619 3300046810 Bacteria 3146
679 Ga0495660_0103372 3300046810 Bacteria 1463
680 Ga0495660_0132072 3300046810 Bacteria 1251
681 Ga0495604_0003494 3300047317 Bacteria 12523
682 Ga0495604_0014914 3300047317 Bacteria 6199
683 Ga0495604_0046113 3300047317 Bacteria 3398
684 Ga0495604_0073070 3300047317 Bacteria 2589
685 Ga0495674_0003856 3300047319 Bacteria 14564
686 Ga0495672_0002363 3300047320 Bacteria 17431
687 Ga0495672_0003692 3300047320 Bacteria 12929
688 Ga0495672_0003693 3300047320 Bacteria 12929
689 Ga0495672_0004600 3300047320 Bacteria 11210
690 Ga0495672_0005300 3300047320 Bacteria 10263
691 Ga0495672_0006516 3300047320 Bacteria 9011
692 Ga0495672_0009098 3300047320 Bacteria 7241
693 Ga0495672_0010215 3300047320 Bacteria 6709
694 Ga0495672_0018050 3300047320 Bacteria 4698
695 Ga0495672_0024066 3300047320 Bacteria 3931
696 Ga0495672_0024909 3300047320 Bacteria 3843
697 Ga0495672_0033804 3300047320 Bacteria 3166
698 Ga0495672_0038090 3300047320 Bacteria 2935
699 Ga0495672_0042480 3300047320 Bacteria 2741
700 Ga0495672_0075494 3300047320 Bacteria 1895
701 Ga0495676_0000010 3300047321 Bacteria 242637
702 Ga0495676_0003312 3300047321 Bacteria 14561
703 Ga0495676_0016858 3300047321 Bacteria 6468
704 Ga0495680_0009992 3300047322 Bacteria 8493
705 Ga0495680_0010958 3300047322 Bacteria 8054
706 Ga0495680_0110734 3300047322 Bacteria 2034
707 Ga0495683_0000066 3300047323 Bacteria 112097
708 Ga0495683_0000806 3300047323 Bacteria 22310
709 Ga0495683_0003688 3300047323 Bacteria 8874
710 Ga0495683_0003986 3300047323 Bacteria 8490
711 Ga0495683_0004355 3300047323 Bacteria 8063
712 Ga0495683_0007398 3300047323 Bacteria 5945
713 Ga0495683_0007487 3300047323 Bacteria 5899
714 Ga0495683_0054330 3300047323 Bacteria 1996
715 Ga0495687_003724 3300047443 Bacteria 10816
716 Ga0495687_006376 3300047443 Bacteria 7247
717 Ga0495675_0005514 3300047444 Bacteria 7719
718 Ga0495679_000141 3300047446 Bacteria 64974
719 Ga0495679_001103 3300047446 Bacteria 16292
720 Ga0495679_001931 3300047446 Bacteria 11076
721 Ga0495679_002188 3300047446 Bacteria 10231
722 Ga0495679_002199 3300047446 Bacteria 10185
723 Ga0495679_003492 3300047446 Bacteria 7525
724 Ga0495679_061909 3300047446 Bacteria 1096
725 Ga0495673_0001653 3300047469 Bacteria 17215
726 Ga0495673_0001688 3300047469 Bacteria 16955
727 Ga0495673_0002534 3300047469 Bacteria 12753
728 Ga0495673_0003140 3300047469 Bacteria 11062
729 Ga0495673_0004551 3300047469 Bacteria 8653
730 Ga0495673_0004808 3300047469 Bacteria 8360
731 Ga0495673_0005867 3300047469 Bacteria 7340
732 Ga0495673_0011535 3300047469 Bacteria 4747
733 Ga0495673_0022330 3300047469 Bacteria 3104
734 Ga0495673_0022891 3300047469 Bacteria 3053
735 Ga0495673_0025672 3300047469 Bacteria 2825
736 Ga0495673_0031237 3300047469 Bacteria 2495
737 Ga0495673_0036375 3300047469 Bacteria 2259
738 Ga0495673_0078692 3300047469 Bacteria 1369
739 Ga0495673_0151389 3300047469 Bacteria 896
740 Ga0495681_0001596 3300047470 Bacteria 16863
741 Ga0495681_0001617 3300047470 Bacteria 16762
742 Ga0495681_0001778 3300047470 Bacteria 15885
743 Ga0495681_0002778 3300047470 Bacteria 12385
744 Ga0495681_0002935 3300047470 Bacteria 12046
745 Ga0495681_0003984 3300047470 Bacteria 10164
746 Ga0495681_0003991 3300047470 Bacteria 10155
747 Ga0495681_0004835 3300047470 Bacteria 9116
748 Ga0495681_0005183 3300047470 Bacteria 8766
749 Ga0495681_0007335 3300047470 Bacteria 7060
750 Ga0495681_0011407 3300047470 Bacteria 5292
751 Ga0495681_0015490 3300047470 Bacteria 4310
752 Ga0495681_0032557 3300047470 Bacteria 2623
753 Ga0495681_0055393 3300047470 Bacteria 1849
754 Ga0495681_0145631 3300047470 Bacteria 997
755 Ga0495684_0035270 3300047471 Bacteria 3836
756 Ga0495684_0065625 3300047471 Bacteria 2759
757 Ga0495686_0004004 3300047472 Bacteria 12328
758 Ga0495686_0005123 3300047472 Bacteria 10471
759 Ga0495686_0005736 3300047472 Bacteria 9706
760 Ga0495686_0013748 3300047472 Bacteria 5607
761 Ga0495686_0025137 3300047472 Bacteria 3904
762 Ga0495686_0030278 3300047472 Bacteria 3515
763 Ga0495686_0032794 3300047472 Bacteria 3359
764 Ga0495593_0003875 3300047673 Bacteria 8939
765 Ga0495593_0011227 3300047673 Bacteria 5148
766 Ga0495593_0068325 3300047673 Bacteria 1849
767 Ga0495593_0105718 3300047673 Bacteria 1440
768 Ga0495602_0007090 3300048088 Bacteria 11764
769 Ga0495626_0000013 3300048091 Bacteria 248164
770 Ga0495626_0001910 3300048091 Bacteria 15526
771 Ga0495626_0002065 3300048091 Bacteria 14656
772 Ga0495626_0002705 3300048091 Bacteria 11975
773 Ga0495626_0002917 3300048091 Bacteria 11393
774 Ga0495626_0005843 3300048091 Bacteria 7099
775 Ga0495626_0008729 3300048091 Bacteria 5518
776 Ga0495626_0015223 3300048091 Bacteria 3942
777 Ga0495626_0081194 3300048091 Bacteria 1440
778 Ga0495626_0085991 3300048091 Bacteria 1390
779 Ga0496102_0000897 3300048905 Bacteria 28235
780 Ga0496103_0001672 3300048906 Bacteria 14511
781 Ga0496106_0489982 3300048909 Bacteria 987
782 Ga0496110_0035322 3300048913 Bacteria 4336
783 Ga0496114_0038599 3300048917 Bacteria 3952
784 Ga0496115_0038882 3300048918 Bacteria 3778
785 Ga0496116_0003051 3300048919 Bacteria 16928
786 Ga0496116_0004738 3300048919 Bacteria 12845
787 Ga0496116_0006230 3300048919 Bacteria 10884
788 Ga0496116_0008850 3300048919 Bacteria 8666
789 Ga0496116_0219361 3300048919 Bacteria 976
790 Ga0496117_0002846 3300048920 Bacteria 21057
791 Ga0496117_0004144 3300048920 Bacteria 16212
792 Ga0496117_0005741 3300048920 Bacteria 12893
793 Ga0496117_0022230 3300048920 Bacteria 5091
794 Ga0496117_0051122 3300048920 Bacteria 2924
795 Ga0496117_0084502 3300048920 Bacteria 2070
796 Ga0496117_0107815 3300048920 Bacteria 1743
797 Ga0496117_0155467 3300048920 Bacteria 1347
798 Ga0496117_0174727 3300048920 Bacteria 1242
799 Ga0496117_0185557 3300048920 Bacteria 1190
800 Ga0496118_0009822 3300048921 Bacteria 9579
801 Ga0496118_0010381 3300048921 Bacteria 9231
802 Ga0496118_0011218 3300048921 Bacteria 8773
803 Ga0496118_0021136 3300048921 Bacteria 5740
804 Ga0496118_0073717 3300048921 Bacteria 2444
805 Ga0496118_0126380 3300048921 Bacteria 1653
806 Ga0496118_0190815 3300048921 Bacteria 1225
807 Ga0496119_0024690 3300048922 Bacteria 4220
808 Ga0496119_0040109 3300048922 Bacteria 2999
809 Ga0496119_0043317 3300048922 Bacteria 2845
810 Ga0496120_0005635 3300048923 Bacteria 9919
811 Ga0496120_0023450 3300048923 Bacteria 3863
812 Ga0496120_0090352 3300048923 Bacteria 1637
813 Ga0496121_0008345 3300048924 Bacteria 12230
814 Ga0496121_0019561 3300048924 Bacteria 6762
815 Ga0496121_0052222 3300048924 Bacteria 3435
816 Ga0496121_0066811 3300048924 Bacteria 2917
817 Ga0496121_0414310 3300048924 Bacteria 878
818 Ga0496122_0016776 3300048925 Bacteria 6899
819 Ga0496122_0017459 3300048925 Bacteria 6708
820 Ga0496122_0055913 3300048925 Bacteria 2947
821 Ga0496122_0096990 3300048925 Bacteria 1985
822 Ga0496122_0184880 3300048925 Bacteria 1237
823 Ga0496123_0007295 3300048926 Bacteria 10487
824 Ga0496123_0035818 3300048926 Bacteria 3530
825 Ga0496123_0037568 3300048926 Bacteria 3417
826 Ga0496123_0072248 3300048926 Bacteria 2147
827 Ga0496123_0104683 3300048926 Bacteria 1635
828 Ga0496123_0124716 3300048926 Bacteria 1440
829 Ga0496123_0165274 3300048926 Bacteria 1174
830 Ga0496124_0002584 3300048927 Bacteria 23434
831 Ga0496124_0032660 3300048927 Bacteria 4591
832 Ga0496124_0032691 3300048927 Bacteria 4588
833 Ga0496124_0212498 3300048927 Bacteria 1462
834 Ga0496124_0281667 3300048927 Bacteria 1211
835 Ga0496124_0285441 3300048927 Bacteria 1201
836 Ga0496125_0002457 3300048928 Bacteria 24077
837 Ga0496125_0003608 3300048928 Bacteria 18580
838 Ga0496125_0009805 3300048928 Bacteria 9761
839 Ga0496125_0019386 3300048928 Bacteria 6417
840 Ga0496125_0020517 3300048928 Bacteria 6201
841 Ga0496125_0071528 3300048928 Bacteria 2708
842 Ga0496125_0095031 3300048928 Bacteria 2218
843 Ga0496126_0078610 3300048929 Bacteria 2922
844 Ga0496126_0079378 3300048929 Bacteria 2905
845 Ga0496126_0171134 3300048929 Bacteria 1850
846 Ga0496126_0248958 3300048929 Bacteria 1481
847 Ga0495678_000199 3300049459 Bacteria 70570
848 Ga0495678_000691 3300049459 Bacteria 30808
849 Ga0495678_001621 3300049459 Bacteria 17159
850 Ga0495678_002275 3300049459 Bacteria 13325
851 Ga0495678_002793 3300049459 Bacteria 11371
852 Ga0495678_003112 3300049459 Bacteria 10516
853 Ga0495678_003457 3300049459 Bacteria 9785
854 Ga0495678_005983 3300049459 Bacteria 6565
855 Ga0495678_008592 3300049459 Bacteria 5134
856 Ga0495678_015746 3300049459 Bacteria 3472
857 Ga0495678_022204 3300049459 Bacteria 2778
858 Ga0495678_053335 3300049459 Bacteria 1553
859 Ga0495678_097274 3300049459 Bacteria 1025
860 Ga0495682_0001846 3300049460 Bacteria 10628
861 Ga0495682_0002884 3300049460 Bacteria 7903
862 Ga0495682_0003067 3300049460 Bacteria 7592
863 Ga0495682_0006826 3300049460 Bacteria 4596
864 Ga0495682_0011210 3300049460 Bacteria 3454
865 Ga0495682_0058598 3300049460 Bacteria 1393
866 Ga0501235_026085 3300049669 Bacteria 1308
867 Ga0501241_000147 3300049758 Bacteria 15696
868 Ga0501269_004845 3300049766 Bacteria 1619
869 nmdc:mga03683_145944_c1 3300050489 Bacteria 1066
870 nmdc:mga00v17_24714_c1 3300050491 Bacteria 3487
871 nmdc:mga00v17_40102_c1 3300050491 Bacteria 2808
872 nmdc:mga08x19_101695_c1 3300050514 Bacteria 1908
873 Ga0500572_000925 3300053111 Bacteria 9055
874 Ga0500621_022345 3300053126 Bacteria 2438
875 Ga0500573_0067229 3300053140 Bacteria 2048
876 Ga0500634_0009095 3300053161 Bacteria 5003

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025206 Ga0209435_105928 Ga0209435_1059281 228
2 3300048927 Ga0496124_0212498 Ga0496124_0212498_18_704 228
3 iso_pu_bacteria 2916178963 2916179280 231
4 3300003771 Ga0055526_1003003 Ga0055526_100300311 236
5 3300003775 Ga0055524_1017203 Ga0055524_10172032 236
6 3300006058 Ga0075432_10090150 Ga0075432_100901502 236
7 3300013100 Ga0157373_10009410 Ga0157373_100094107 236
8 3300013102 Ga0157371_10130965 Ga0157371_101309651 236
9 3300025273 Ga0209673_1001639 Ga0209673_10016394 236
10 3300025295 Ga0209564_1000416 Ga0209564_100041610 236
11 3300025299 Ga0209256_1001705 Ga0209256_100170518 236
12 3300025935 Ga0207709_10005416 Ga0207709_100054161 236
13 3300027907 Ga0207428_10092454 Ga0207428_100924543 236
14 3300046538 Ga0495609_0055834 Ga0495609_0055834_330_1112 236
15 3300046530 Ga0495654_0005089 Ga0495654_0005089_5055_5837 237
16 3300005288 Ga0065714_10064824 Ga0065714_100648248 238
17 3300042130 Ga0450892_013218 Ga0450892_013218_22_741 239
18 3300048929 Ga0496126_0079378 Ga0496126_0079378_1994_2776 239
19 3300041405 Ga0439438_024885 Ga0439438_024885_251_985 244
20 3300041411 Ga0439466_0036466 Ga0439466_0036466_560_1294 244
21 3300042006 Ga0439432_028183 Ga0439432_028183_709_1443 244
22 3300046458 Ga0495591_005165 Ga0495591_005165_5027_5761 244
23 3300046519 Ga0495632_0055953 Ga0495632_0055953_1136_1870 244
24 3300046694 Ga0495649_0020439 Ga0495649_0020439_2443_3177 244
25 3300047320 Ga0495672_0010215 Ga0495672_0010215_2170_2904 244
26 3300049459 Ga0495678_003457 Ga0495678_003457_4746_5480 244
27 iso_pu_bacteria 2600254954 2600443363 247
28 iso_pu_bacteria 2600255389 2602009173 247
29 iso_pu_bacteria 2823421272 2823424969 247
30 iso_pu_bacteria 2919501602 2919501708 247
31 iso_pu_bacteria 2926063275 2926063381 247
32 iso_pu_bacteria 8034962539 8034962955 247
33 3300009036 Ga0105244_10001896 Ga0105244_100018964 248
34 3300011119 Ga0105246_10013025 Ga0105246_100130255 248
35 3300025728 Ga0207655_1005880 Ga0207655_10058803 248
36 iso_pu_bacteria 2808606373 2808905068 248
37 iso_pu_bacteria 2811994881 2812370651 248
38 iso_pu_bacteria 2923519811 2923524751 248
39 3300009011 Ga0105251_10000012 Ga0105251_10000012127 249
40 3300009092 Ga0105250_10000637 Ga0105250_100006379 249
41 3300025711 Ga0207696_1000138 Ga0207696_100013893 249
42 3300025735 Ga0207713_1000080 Ga0207713_1000080128 249
43 3300009011 Ga0105251_10005731 Ga0105251_100057319 250
44 3300009092 Ga0105250_10001848 Ga0105250_100018485 250
45 3300012498 Ga0157345_1000093 Ga0157345_100009312 250
46 3300013102 Ga0157371_10004812 Ga0157371_1000481211 250
47 3300013105 Ga0157369_10207009 Ga0157369_102070092 250
48 3300013306 Ga0163162_10001483 Ga0163162_1000148316 250
49 3300015261 Ga0182006_1002578 Ga0182006_10025785 250
50 3300041405 Ga0439438_003231 Ga0439438_003231_2668_3420 250
51 3300041407 Ga0439447_000778 Ga0439447_000778_3013_3765 250
52 3300041407 Ga0439447_002372 Ga0439447_002372_3675_4427 250
53 3300042006 Ga0439432_005607 Ga0439432_005607_1615_2367 250
54 3300042010 Ga0439452_000620 Ga0439452_000620_9564_10316 250
55 3300042010 Ga0439452_000710 Ga0439452_000710_11826_12578 250
56 3300042115 Ga0450911_000325 Ga0450911_000325_8631_9383 250
57 3300042531 Ga0450918_008235 Ga0450918_008235_991_1743 250
58 3300042533 Ga0450901_000142 Ga0450901_000142_2584_3336 250
59 3300046452 Ga0495617_003367 Ga0495617_003367_4892_5644 250
60 3300046452 Ga0495617_005415 Ga0495617_005415_2882_3634 250
61 3300046452 Ga0495617_015400 Ga0495617_015400_712_1464 250
62 3300046452 Ga0495617_015605 Ga0495617_015605_913_1665 250
63 3300046452 Ga0495617_025225 Ga0495617_025225_443_1195 250
64 3300046453 Ga0495627_000953 Ga0495627_000953_7595_8347 250
65 3300046453 Ga0495627_001633 Ga0495627_001633_6478_7230 250
66 3300046453 Ga0495627_001765 Ga0495627_001765_5765_6517 250
67 3300046453 Ga0495627_044529 Ga0495627_044529_196_948 250
68 3300046457 Ga0495590_0002233 Ga0495590_0002233_3105_3857 250
69 3300046457 Ga0495590_0033997 Ga0495590_0033997_612_1364 250
70 3300046458 Ga0495591_001429 Ga0495591_001429_9189_9941 250
71 3300046458 Ga0495591_001566 Ga0495591_001566_5308_6060 250
72 3300046458 Ga0495591_001624 Ga0495591_001624_5280_6032 250
73 3300046458 Ga0495591_001930 Ga0495591_001930_5276_6028 250
74 3300046458 Ga0495591_003011 Ga0495591_003011_3024_3776 250
75 3300046458 Ga0495591_003045 Ga0495591_003045_3084_3836 250
76 3300046459 Ga0495629_0015042 Ga0495629_0015042_262_1014 250
77 3300046460 Ga0495638_0002867 Ga0495638_0002867_4468_5220 250
78 3300046460 Ga0495638_0025048 Ga0495638_0025048_846_1598 250
79 3300046460 Ga0495638_0134043 Ga0495638_0134043_642_1394 250
80 3300046463 Ga0495653_0017215 Ga0495653_0017215_557_1309 250
81 3300046463 Ga0495653_0017248 Ga0495653_0017248_38_790 250
82 3300046463 Ga0495653_0048908 Ga0495653_0048908_1074_1826 250
83 3300046471 Ga0495650_0035608 Ga0495650_0035608_1352_2104 250
84 3300046473 Ga0495582_0004029 Ga0495582_0004029_557_1309 250
85 3300046474 Ga0495605_0003819 Ga0495605_0003819_4216_4968 250
86 3300046475 Ga0495639_0001953 Ga0495639_0001953_4431_5183 250
87 3300046491 Ga0495584_0013835 Ga0495584_0013835_2880_3632 250
88 3300046491 Ga0495584_0017822 Ga0495584_0017822_17_769 250
89 3300046491 Ga0495584_0039515 Ga0495584_0039515_508_1260 250
90 3300046492 Ga0495585_0001101 Ga0495585_0001101_11897_12649 250
91 3300046492 Ga0495585_0002369 Ga0495585_0002369_6455_7207 250
92 3300046492 Ga0495585_0002609 Ga0495585_0002609_5250_6002 250
93 3300046492 Ga0495585_0017309 Ga0495585_0017309_475_1227 250
94 3300046492 Ga0495585_0019075 Ga0495585_0019075_785_1537 250
95 3300046499 Ga0495594_0086638 Ga0495594_0086638_452_1204 250
96 3300046500 Ga0495596_0000586 Ga0495596_0000586_12420_13172 250
97 3300046500 Ga0495596_0113229 Ga0495596_0113229_203_955 250
98 3300046501 Ga0495607_0005888 Ga0495607_0005888_3595_4347 250
99 3300046501 Ga0495607_0016905 Ga0495607_0016905_3049_3801 250
100 3300046501 Ga0495607_0022877 Ga0495607_0022877_46_798 250
101 3300046501 Ga0495607_0083819 Ga0495607_0083819_30_782 250
102 3300046506 Ga0495583_0002423 Ga0495583_0002423_7513_8265 250
103 3300046507 Ga0495606_0003494 Ga0495606_0003494_8536_9288 250
104 3300046507 Ga0495606_0003509 Ga0495606_0003509_7571_8323 250
105 3300046507 Ga0495606_0022937 Ga0495606_0022937_1301_2053 250
106 3300046507 Ga0495606_0030789 Ga0495606_0030789_2949_3701 250
107 3300046507 Ga0495606_0038493 Ga0495606_0038493_887_1639 250
108 3300046507 Ga0495606_0041651 Ga0495606_0041651_45_797 250
109 3300046507 Ga0495606_0052514 Ga0495606_0052514_1693_2445 250
110 3300046512 Ga0495610_0002277 Ga0495610_0002277_7784_8536 250
111 3300046512 Ga0495610_0002473 Ga0495610_0002473_7262_8014 250
112 3300046512 Ga0495610_0007604 Ga0495610_0007604_4364_5116 250
113 3300046512 Ga0495610_0072322 Ga0495610_0072322_617_1369 250
114 3300046513 Ga0495616_0001700 Ga0495616_0001700_7974_8726 250
115 3300046513 Ga0495616_0002067 Ga0495616_0002067_7524_8276 250
116 3300046513 Ga0495616_0017724 Ga0495616_0017724_316_1068 250
117 3300046513 Ga0495616_0018767 Ga0495616_0018767_70_822 250
118 3300046515 Ga0495620_0000851 Ga0495620_0000851_9357_10109 250
119 3300046515 Ga0495620_0004762 Ga0495620_0004762_3990_4742 250
120 3300046515 Ga0495620_0014365 Ga0495620_0014365_197_949 250
121 3300046515 Ga0495620_0018411 Ga0495620_0018411_1959_2711 250
122 3300046515 Ga0495620_0059565 Ga0495620_0059565_155_907 250
123 3300046515 Ga0495620_0114305 Ga0495620_0114305_117_869 250
124 3300046516 Ga0495628_0112089 Ga0495628_0112089_875_1627 250
125 3300046517 Ga0495630_0271947 Ga0495630_0271947_516_1268 250
126 3300046518 Ga0495631_0001163 Ga0495631_0001163_7946_8698 250
127 3300046518 Ga0495631_0007414 Ga0495631_0007414_1123_1875 250
128 3300046519 Ga0495632_0002117 Ga0495632_0002117_5931_6683 250
129 3300046519 Ga0495632_0005155 Ga0495632_0005155_5102_5854 250
130 3300046519 Ga0495632_0019488 Ga0495632_0019488_386_1138 250
131 3300046519 Ga0495632_0020796 Ga0495632_0020796_2674_3426 250
132 3300046520 Ga0495637_0005094 Ga0495637_0005094_1712_2464 250
133 3300046520 Ga0495637_0006798 Ga0495637_0006798_229_981 250
134 3300046520 Ga0495637_0007678 Ga0495637_0007678_464_1216 250
135 3300046520 Ga0495637_0018274 Ga0495637_0018274_464_1216 250
136 3300046520 Ga0495637_0048433 Ga0495637_0048433_1000_1752 250
137 3300046520 Ga0495637_0058756 Ga0495637_0058756_219_971 250
138 3300046520 Ga0495637_0103968 Ga0495637_0103968_80_832 250
139 3300046522 Ga0495643_0005003 Ga0495643_0005003_3124_3876 250
140 3300046522 Ga0495643_0019867 Ga0495643_0019867_846_1598 250
141 3300046522 Ga0495643_0059987 Ga0495643_0059987_448_1200 250
142 3300046522 Ga0495643_0111861 Ga0495643_0111861_233_985 250
143 3300046523 Ga0495644_0001826 Ga0495644_0001826_4422_5174 250
144 3300046523 Ga0495644_0007472 Ga0495644_0007472_3110_3862 250
145 3300046524 Ga0495648_0003731 Ga0495648_0003731_5297_6049 250
146 3300046524 Ga0495648_0003891 Ga0495648_0003891_7222_7974 250
147 3300046524 Ga0495648_0006276 Ga0495648_0006276_5266_6018 250
148 3300046524 Ga0495648_0011393 Ga0495648_0011393_3920_4672 250
149 3300046524 Ga0495648_0112399 Ga0495648_0112399_379_1131 250
150 3300046530 Ga0495654_0001918 Ga0495654_0001918_5279_6031 250
151 3300046530 Ga0495654_0002652 Ga0495654_0002652_5343_6095 250
152 3300046530 Ga0495654_0010466 Ga0495654_0010466_541_1293 250
153 3300046530 Ga0495654_0011769 Ga0495654_0011769_713_1465 250
154 3300046530 Ga0495654_0035654 Ga0495654_0035654_1199_1951 250
155 3300046538 Ga0495609_0001176 Ga0495609_0001176_8347_9099 250
156 3300046538 Ga0495609_0002123 Ga0495609_0002123_5253_6005 250
157 3300046538 Ga0495609_0005019 Ga0495609_0005019_4245_4997 250
158 3300046538 Ga0495609_0010441 Ga0495609_0010441_810_1562 250
159 3300046542 Ga0495597_0003333 Ga0495597_0003333_3417_4169 250
160 3300046542 Ga0495597_0051472 Ga0495597_0051472_583_1335 250
161 3300046543 Ga0495645_0058749 Ga0495645_0058749_962_1714 250
162 3300046557 Ga0495622_0001169 Ga0495622_0001169_5296_6048 250
163 3300046558 Ga0495633_0004331 Ga0495633_0004331_5308_6060 250
164 3300046615 Ga0495656_0139941 Ga0495656_0139941_356_1108 250
165 3300046616 Ga0495668_0003335 Ga0495668_0003335_9071_9823 250
166 3300046616 Ga0495668_0005345 Ga0495668_0005345_5233_5985 250
167 3300046616 Ga0495668_0016347 Ga0495668_0016347_3278_4030 250
168 3300046648 Ga0495611_0000824 Ga0495611_0000824_8755_9507 250
169 3300046648 Ga0495611_0008174 Ga0495611_0008174_1608_2360 250
170 3300046660 Ga0495625_0005248 Ga0495625_0005248_5888_6640 250
171 3300046660 Ga0495625_0009944 Ga0495625_0009944_2415_3167 250
172 3300046660 Ga0495625_0013736 Ga0495625_0013736_3923_4675 250
173 3300046660 Ga0495625_0043105 Ga0495625_0043105_1686_2438 250
174 3300046663 Ga0495635_0007979 Ga0495635_0007979_2354_3106 250
175 3300046665 Ga0495661_0005533 Ga0495661_0005533_5068_5820 250
176 3300046665 Ga0495661_0215785 Ga0495661_0215785_219_971 250
177 3300046674 Ga0495588_0180640 Ga0495588_0180640_142_894 250
178 3300046679 Ga0495623_0005963 Ga0495623_0005963_4538_5290 250
179 3300046680 Ga0495646_0004496 Ga0495646_0004496_3572_4324 250
180 3300046689 Ga0495613_0009155 Ga0495613_0009155_4544_5296 250
181 3300046689 Ga0495613_0352488 Ga0495613_0352488_139_891 250
182 3300046691 Ga0495670_0000636 Ga0495670_0000636_7511_8263 250
183 3300046692 Ga0495671_0002745 Ga0495671_0002745_8404_9156 250
184 3300046692 Ga0495671_0003114 Ga0495671_0003114_4675_5427 250
185 3300046692 Ga0495671_0006265 Ga0495671_0006265_1833_2585 250
186 3300046692 Ga0495671_0018033 Ga0495671_0018033_1240_1992 250
187 3300046692 Ga0495671_0038321 Ga0495671_0038321_121_873 250
188 3300046692 Ga0495671_0052092 Ga0495671_0052092_637_1389 250
189 3300046694 Ga0495649_0003038 Ga0495649_0003038_5758_6510 250
190 3300046694 Ga0495649_0004810 Ga0495649_0004810_2864_3616 250
191 3300046694 Ga0495649_0009238 Ga0495649_0009238_3285_4037 250
192 3300046694 Ga0495649_0019982 Ga0495649_0019982_916_1668 250
193 3300046694 Ga0495649_0039547 Ga0495649_0039547_1664_2416 250
194 3300046694 Ga0495649_0116891 Ga0495649_0116891_499_1251 250
195 3300046794 Ga0495589_0001025 Ga0495589_0001025_7793_8545 250
196 3300046794 Ga0495589_0005475 Ga0495589_0005475_2310_3062 250
197 3300046794 Ga0495589_0014691 Ga0495589_0014691_663_1415 250
198 3300046794 Ga0495589_0021921 Ga0495589_0021921_1785_2537 250
199 3300046794 Ga0495589_0133637 Ga0495589_0133637_49_801 250
200 3300046809 Ga0495600_0071493 Ga0495600_0071493_957_1709 250
201 3300046810 Ga0495660_0002035 Ga0495660_0002035_5001_5753 250
202 3300046810 Ga0495660_0002728 Ga0495660_0002728_5131_5883 250
203 3300046810 Ga0495660_0003528 Ga0495660_0003528_7606_8358 250
204 3300046810 Ga0495660_0003972 Ga0495660_0003972_3035_3787 250
205 3300046810 Ga0495660_0004059 Ga0495660_0004059_5106_5858 250
206 3300046810 Ga0495660_0005931 Ga0495660_0005931_1687_2439 250
207 3300046810 Ga0495660_0132072 Ga0495660_0132072_59_811 250
208 3300047317 Ga0495604_0003494 Ga0495604_0003494_4650_5402 250
209 3300047317 Ga0495604_0073070 Ga0495604_0073070_847_1599 250
210 3300047320 Ga0495672_0003692 Ga0495672_0003692_4686_5438 250
211 3300047320 Ga0495672_0018050 Ga0495672_0018050_954_1706 250
212 3300047320 Ga0495672_0024909 Ga0495672_0024909_419_1171 250
213 3300047321 Ga0495676_0003312 Ga0495676_0003312_6181_6933 250
214 3300047322 Ga0495680_0010958 Ga0495680_0010958_426_1178 250
215 3300047323 Ga0495683_0003986 Ga0495683_0003986_5060_5812 250
216 3300047323 Ga0495683_0007398 Ga0495683_0007398_958_1710 250
217 3300047323 Ga0495683_0054330 Ga0495683_0054330_567_1319 250
218 3300047444 Ga0495675_0005514 Ga0495675_0005514_5883_6635 250
219 3300047446 Ga0495679_002188 Ga0495679_002188_4347_5099 250
220 3300047446 Ga0495679_061909 Ga0495679_061909_271_1023 250
221 3300047469 Ga0495673_0004551 Ga0495673_0004551_5064_5816 250
222 3300047469 Ga0495673_0004808 Ga0495673_0004808_5285_6037 250
223 3300047469 Ga0495673_0011535 Ga0495673_0011535_1830_2582 250
224 3300047469 Ga0495673_0022891 Ga0495673_0022891_199_951 250
225 3300047469 Ga0495673_0151389 Ga0495673_0151389_32_784 250
226 3300047470 Ga0495681_0001596 Ga0495681_0001596_7506_8258 250
227 3300047470 Ga0495681_0003991 Ga0495681_0003991_1826_2578 250
228 3300047470 Ga0495681_0004835 Ga0495681_0004835_8244_8996 250
229 3300047470 Ga0495681_0005183 Ga0495681_0005183_2750_3502 250
230 3300047470 Ga0495681_0055393 Ga0495681_0055393_800_1552 250
231 3300047470 Ga0495681_0145631 Ga0495681_0145631_22_774 250
232 3300047472 Ga0495686_0004004 Ga0495686_0004004_3055_3807 250
233 3300047472 Ga0495686_0013748 Ga0495686_0013748_1937_2689 250
234 3300047472 Ga0495686_0025137 Ga0495686_0025137_3054_3806 250
235 3300047673 Ga0495593_0068325 Ga0495593_0068325_400_1152 250
236 3300048091 Ga0495626_0002705 Ga0495626_0002705_5989_6741 250
237 3300048091 Ga0495626_0002917 Ga0495626_0002917_5751_6503 250
238 3300048091 Ga0495626_0005843 Ga0495626_0005843_3958_4710 250
239 3300048091 Ga0495626_0008729 Ga0495626_0008729_2692_3444 250
240 3300048091 Ga0495626_0015223 Ga0495626_0015223_2801_3553 250
241 3300048909 Ga0496106_0489982 Ga0496106_0489982_111_863 250
242 3300048917 Ga0496114_0038599 Ga0496114_0038599_796_1548 250
243 3300048918 Ga0496115_0038882 Ga0496115_0038882_2261_3013 250
244 3300048919 Ga0496116_0003051 Ga0496116_0003051_8574_9326 250
245 3300048919 Ga0496116_0008850 Ga0496116_0008850_2690_3442 250
246 3300048920 Ga0496117_0005741 Ga0496117_0005741_4751_5503 250
247 3300048921 Ga0496118_0011218 Ga0496118_0011218_2820_3572 250
248 3300048924 Ga0496121_0052222 Ga0496121_0052222_965_1717 250
249 3300048925 Ga0496122_0017459 Ga0496122_0017459_2693_3445 250
250 3300048926 Ga0496123_0007295 Ga0496123_0007295_5148_5900 250
251 3300048929 Ga0496126_0248958 Ga0496126_0248958_603_1355 250
252 3300049459 Ga0495678_001621 Ga0495678_001621_8617_9369 250
253 3300049459 Ga0495678_002275 Ga0495678_002275_5295_6047 250
254 3300049459 Ga0495678_003112 Ga0495678_003112_3975_4727 250
255 3300049459 Ga0495678_005983 Ga0495678_005983_2231_2983 250
256 3300049459 Ga0495678_015746 Ga0495678_015746_2382_3134 250
257 3300049460 Ga0495682_0001846 Ga0495682_0001846_5279_6031 250
258 3300049460 Ga0495682_0011210 Ga0495682_0011210_36_788 250
259 3300049460 Ga0495682_0058598 Ga0495682_0058598_276_1028 250
260 3300049669 Ga0501235_026085 Ga0501235_026085_485_1237 250
261 3300053111 Ga0500572_000925 Ga0500572_000925_3064_3816 250
262 3300053126 Ga0500621_022345 Ga0500621_022345_1663_2415 250
263 iso_pu_bacteria 2599185307 2599971828 250
264 3300031548 Ga0307408_100000020 Ga0307408_10000002019 251
265 3300039450 Ga0436363_0415726 Ga0436363_0415726_1556_2311 251
266 3300042439 Ga0439464_0000206 Ga0439464_0000206_9177_9932 251
267 3300042016 Ga0439463_000367 Ga0439463_000367_7942_8718 254
268 3300042137 Ga0450902_003854 Ga0450902_003854_428_1231 254
269 3300042138 Ga0450903_001557 Ga0450903_001557_2828_3631 254
270 3300046457 Ga0495590_0024064 Ga0495590_0024064_742_1518 254
271 3300046460 Ga0495638_0008213 Ga0495638_0008213_4541_5344 254
272 3300046471 Ga0495650_0000392 Ga0495650_0000392_62536_63312 254
273 3300046474 Ga0495605_0060188 Ga0495605_0060188_248_1024 254
274 3300046491 Ga0495584_0004805 Ga0495584_0004805_2627_3403 254
275 3300046492 Ga0495585_0008451 Ga0495585_0008451_4695_5471 254
276 3300046500 Ga0495596_0060271 Ga0495596_0060271_110_886 254
277 3300046501 Ga0495607_0003715 Ga0495607_0003715_816_1592 254
278 3300046501 Ga0495607_0005660 Ga0495607_0005660_4400_5203 254
279 3300046506 Ga0495583_0004004 Ga0495583_0004004_5096_5872 254
280 3300046506 Ga0495583_0007217 Ga0495583_0007217_2369_3145 254
281 3300046513 Ga0495616_0067724 Ga0495616_0067724_82_858 254
282 3300046515 Ga0495620_0009416 Ga0495620_0009416_3982_4758 254
283 3300046518 Ga0495631_0029690 Ga0495631_0029690_805_1581 254
284 3300046518 Ga0495631_0111459 Ga0495631_0111459_271_1047 254
285 3300046519 Ga0495632_0001914 Ga0495632_0001914_6521_7297 254
286 3300046519 Ga0495632_0003612 Ga0495632_0003612_7141_7917 254
287 3300046520 Ga0495637_0000032 Ga0495637_0000032_115014_115790 254
288 3300046520 Ga0495637_0000090 Ga0495637_0000090_13299_14075 254
289 3300046520 Ga0495637_0002101 Ga0495637_0002101_8810_9586 254
290 3300046522 Ga0495643_0032561 Ga0495643_0032561_1227_2003 254
291 3300046524 Ga0495648_0001390 Ga0495648_0001390_10134_10910 254
292 3300046524 Ga0495648_0056637 Ga0495648_0056637_475_1251 254
293 3300046530 Ga0495654_0005593 Ga0495654_0005593_3053_3829 254
294 3300046530 Ga0495654_0006741 Ga0495654_0006741_1932_2708 254
295 3300046538 Ga0495609_0000040 Ga0495609_0000040_13266_14042 254
296 3300046542 Ga0495597_0009040 Ga0495597_0009040_2630_3433 254
297 3300046542 Ga0495597_0013074 Ga0495597_0013074_2638_3414 254
298 3300046543 Ga0495645_0052289 Ga0495645_0052289_1862_2638 254
299 3300046557 Ga0495622_0001974 Ga0495622_0001974_1581_2357 254
300 3300046616 Ga0495668_0023422 Ga0495668_0023422_1071_1847 254
301 3300046648 Ga0495611_0000580 Ga0495611_0000580_7442_8218 254
302 3300046648 Ga0495611_0003161 Ga0495611_0003161_3973_4749 254
303 3300046660 Ga0495625_0001279 Ga0495625_0001279_12918_13694 254
304 3300046665 Ga0495661_0000019 Ga0495661_0000019_12925_13701 254
305 3300046665 Ga0495661_0008134 Ga0495661_0008134_1233_2009 254
306 3300046665 Ga0495661_0016126 Ga0495661_0016126_2674_3477 254
307 3300046692 Ga0495671_0003357 Ga0495671_0003357_8237_9013 254
308 3300046692 Ga0495671_0108947 Ga0495671_0108947_102_878 254
309 3300046694 Ga0495649_0014774 Ga0495649_0014774_475_1251 254
310 3300046810 Ga0495660_0002003 Ga0495660_0002003_8485_9261 254
311 3300046810 Ga0495660_0004293 Ga0495660_0004293_5793_6569 254
312 3300046810 Ga0495660_0020997 Ga0495660_0020997_1120_1923 254
313 3300047320 Ga0495672_0006516 Ga0495672_0006516_5356_6132 254
314 3300047320 Ga0495672_0042480 Ga0495672_0042480_663_1439 254
315 3300047321 Ga0495676_0000010 Ga0495676_0000010_228942_229718 254
316 3300047446 Ga0495679_000141 Ga0495679_000141_24663_25439 254
317 3300047469 Ga0495673_0002534 Ga0495673_0002534_2987_3763 254
318 3300047469 Ga0495673_0078692 Ga0495673_0078692_271_1047 254
319 3300047470 Ga0495681_0011407 Ga0495681_0011407_3831_4607 254
320 3300047470 Ga0495681_0032557 Ga0495681_0032557_668_1471 254
321 3300047472 Ga0495686_0030278 Ga0495686_0030278_678_1454 254
322 3300047472 Ga0495686_0032794 Ga0495686_0032794_2251_3054 254
323 3300048091 Ga0495626_0000013 Ga0495626_0000013_234466_235242 254
324 3300049459 Ga0495678_000691 Ga0495678_000691_16723_17499 254
325 3300049459 Ga0495678_002793 Ga0495678_002793_4138_4914 254
326 3300049459 Ga0495678_008592 Ga0495678_008592_2472_3248 254
327 iso_pu_bacteria 2738543015 2739257418 254
328 iso_pu_bacteria 2904550169 2904552932 254
329 iso_pu_bacteria 2599185155 2599328066 255
330 iso_pu_bacteria 2643221571 2643869213 255
331 iso_pu_bacteria 2945928738 2945929864 255
332 iso_pu_bacteria 2947233263 2947235509 255
333 3300046471 Ga0495650_0001565 Ga0495650_0001565_7398_8174 256
334 3300046474 Ga0495605_0008550 Ga0495605_0008550_740_1528 256
335 3300046501 Ga0495607_0003902 Ga0495607_0003902_7430_8218 256
336 3300046501 Ga0495607_0063745 Ga0495607_0063745_1262_2050 256
337 3300046506 Ga0495583_0001503 Ga0495583_0001503_13164_13940 256
338 3300046506 Ga0495583_0003204 Ga0495583_0003204_9754_10542 256
339 3300046507 Ga0495606_0024044 Ga0495606_0024044_3408_4196 256
340 3300046519 Ga0495632_0001292 Ga0495632_0001292_6818_7594 256
341 3300046520 Ga0495637_0001989 Ga0495637_0001989_2512_3288 256
342 3300046538 Ga0495609_0000006 Ga0495609_0000006_39608_40396 256
343 3300046665 Ga0495661_0001172 Ga0495661_0001172_7866_8642 256
344 3300047469 Ga0495673_0025672 Ga0495673_0025672_768_1556 256
345 iso_pu_bacteria 2511231010 2511288417 256
346 iso_pu_bacteria 2511231011 2511297582 256
347 iso_pu_bacteria 2511231012 2511301299 256
348 iso_pu_bacteria 2511231014 2511311502 256
349 iso_pu_bacteria 2511231015 2511319733 256
350 iso_pu_bacteria 2511231017 2511330677 256
351 iso_pu_bacteria 2511231018 2511336753 256
352 iso_pu_bacteria 2511231019 2511342531 256
353 iso_pu_bacteria 2511231020 2511348157 256
354 iso_pu_bacteria 2511231021 2511357001 256
355 iso_pu_bacteria 2511231023 2511371412 256
356 iso_pu_bacteria 2511231031 2511412956 256
357 iso_pu_bacteria 2597489888 2597861995 256
358 iso_pu_bacteria 2597489889 2597867722 256
359 iso_pu_bacteria 2599185167 2599397395 256
360 iso_pu_bacteria 2599185179 2599449391 256
361 iso_pu_bacteria 2599185189 2599507918 256
362 iso_pu_bacteria 2599185190 2599510869 256
363 iso_pu_bacteria 2599185191 2599519640 256
364 iso_pu_bacteria 2599185288 2599882778 256
365 iso_pu_bacteria 2599185290 2599890243 256
366 iso_pu_bacteria 2599185303 2599950258 256
367 iso_pu_bacteria 2600255296 2601690601 256
368 iso_pu_bacteria 2600255318 2601799655 256
369 iso_pu_bacteria 2603880185 2606074160 256
370 iso_pu_bacteria 2603880199 2606126195 256
371 iso_pu_bacteria 2619619299 2621301849 256
372 iso_pu_bacteria 2623620443 2624482707 256
373 iso_pu_bacteria 2643221565 2643842072 256
374 iso_pu_bacteria 2643221589 2643955467 256
375 iso_pu_bacteria 2643221602 2644023819 256
376 iso_pu_bacteria 2643221713 2644621417 256
377 iso_pu_bacteria 2675903420 2677898559 256
378 iso_pu_bacteria 2713897148 2715751966 256
379 iso_pu_bacteria 2713897149 2715755403 256
380 iso_pu_bacteria 2718217725 2718635920 256
381 iso_pu_bacteria 2721755607 2723246886 256
382 iso_pu_bacteria 2738541265 2738672502 256
383 iso_pu_bacteria 2738541282 2738750895 256
384 iso_pu_bacteria 2738541294 2738808797 256
385 iso_pu_bacteria 2738541303 2738859936 256
386 iso_pu_bacteria 2738541309 2738896157 256
387 iso_pu_bacteria 2738543004 2739196446 256
388 iso_pu_bacteria 2738543025 2739314424 256
389 iso_pu_bacteria 2773857673 2774133589 256
390 iso_pu_bacteria 2784132063 2784262521 256
391 iso_pu_bacteria 2808606377 2808932461 256
392 iso_pu_bacteria 2808606381 2808954584 256
393 iso_pu_bacteria 2808606382 2808959625 256
394 iso_pu_bacteria 2808606385 2808974930 256
395 iso_pu_bacteria 2808606388 2808991431 256
396 iso_pu_bacteria 2808606445 2809218616 256
397 iso_pu_bacteria 2816332298 2817488776 256
398 iso_pu_bacteria 2818991456 2819654190 256
399 iso_pu_bacteria 2826581358 2826586705 256
400 iso_pu_bacteria 2834028612 2834028693 256
401 iso_pu_bacteria 2842815866 2842820362 256
402 iso_pu_bacteria 2842826826 2842830766 256
403 iso_pu_bacteria 2842832357 2842837682 256
404 iso_pu_bacteria 2842837860 2842838803 256
405 iso_pu_bacteria 2842843487 2842845346 256
406 iso_pu_bacteria 2842849001 2842854330 256
407 iso_pu_bacteria 2852612431 2852615928 256
408 iso_pu_bacteria 2852657418 2852662959 256
409 iso_pu_bacteria 2852667396 2852670896 256
410 iso_pu_bacteria 2860339153 2860344576 256
411 iso_pu_bacteria 2860867994 2860868729 256
412 iso_pu_bacteria 2878029506 2878034636 256
413 iso_pu_bacteria 2880230671 2880235286 256
414 iso_pu_bacteria 2904518522 2904521659 256
415 iso_pu_bacteria 2908446538 2908447370 256
416 iso_pu_bacteria 2919063839 2919069445 256
417 iso_pu_bacteria 2919385768 2919388709 256
418 iso_pu_bacteria 2919456309 2919459690 256
419 iso_pu_bacteria 2919487758 2919489974 256
420 iso_pu_bacteria 2929189879 2929190605 256
421 iso_pu_bacteria 2931390751 2931391706 256
422 iso_pu_bacteria 2931396565 2931397346 256
423 iso_pu_bacteria 2939636861 2939636909 256
424 iso_pu_bacteria 2945961074 2945961172 256
425 iso_pu_bacteria 2946006987 2946012158 256
426 iso_pu_bacteria 2946027586 2946028955 256
427 iso_pu_bacteria 2969304461 2969309436 256
428 iso_pu_bacteria 2974289157 2974289208 256
429 iso_pu_bacteria 2998139840 2998144702 256
430 iso_pu_bacteria 3007419365 3007425104 256
431 iso_pu_bacteria 3007511990 3007516458 256
432 iso_pu_bacteria 3007614139 3007617955 256
433 iso_pu_bacteria 3007619802 3007621923 256
434 iso_pu_bacteria 3007718800 3007723490 256
435 iso_pu_bacteria 3007855910 3007858323 256
436 iso_pu_bacteria 3007861166 3007866161 256
437 iso_pu_bacteria 8029995093 8029996185 256
438 iso_pu_bacteria 8054285046 8054289195 256
439 iso_pu_bacteria 8054347763 8054348855 256
440 iso_pu_bacteria 8054503363 8054504302 256
441 iso_pu_bacteria 8055817908 8055818732 256
442 iso_pu_bacteria 8056125926 8056130934 256
443 iso_pu_bacteria 8056131705 8056132629 256
444 iso_pu_bacteria 8056148874 8056150892 256
445 iso_pu_bacteria 8056161164 8056161518 256
446 iso_pu_bacteria 8056166840 8056171858 256
447 iso_pu_bacteria 8056177738 8056179841 256
448 iso_pu_bacteria 8056569372 8056574682 256
449 iso_pu_bacteria 8056172158 8056172542 257
450 3300005288 Ga0065714_10069158 Ga0065714_100691584 258
451 3300005288 Ga0065714_10187061 Ga0065714_101870611 258
452 3300006058 Ga0075432_10078449 Ga0075432_100784492 258
453 3300027907 Ga0207428_10158327 Ga0207428_101583271 258
454 3300041405 Ga0439438_054589 Ga0439438_054589_52_870 258
455 3300046452 Ga0495617_000667 Ga0495617_000667_9257_10033 258
456 3300046453 Ga0495627_000246 Ga0495627_000246_12840_13631 258
457 3300046458 Ga0495591_000019 Ga0495591_000019_12933_13721 258
458 3300046474 Ga0495605_0000763 Ga0495605_0000763_9785_10573 258
459 3300046474 Ga0495605_0008629 Ga0495605_0008629_1003_1785 258
460 3300046474 Ga0495605_0008757 Ga0495605_0008757_2958_3740 258
461 3300046501 Ga0495607_0000786 Ga0495607_0000786_9797_10585 258
462 3300046501 Ga0495607_0002422 Ga0495607_0002422_185_967 258
463 3300046512 Ga0495610_0079431 Ga0495610_0079431_242_1018 258
464 3300046515 Ga0495620_0012824 Ga0495620_0012824_327_1103 258
465 3300046520 Ga0495637_0033672 Ga0495637_0033672_693_1481 258
466 3300046542 Ga0495597_0000010 Ga0495597_0000010_12940_13728 258
467 3300046660 Ga0495625_0043396 Ga0495625_0043396_1000_1788 258
468 3300046692 Ga0495671_0060818 Ga0495671_0060818_741_1529 258
469 3300046810 Ga0495660_0001004 Ga0495660_0001004_11801_12583 258
470 3300046810 Ga0495660_0013222 Ga0495660_0013222_3070_3858 258
471 3300047320 Ga0495672_0024066 Ga0495672_0024066_2362_3150 258
472 3300047470 Ga0495681_0003984 Ga0495681_0003984_6885_7661 258
473 3300048091 Ga0495626_0081194 Ga0495626_0081194_267_1043 258
474 3300053140 Ga0500573_0067229 Ga0500573_0067229_773_1564 258
475 3300042010 Ga0439452_000610 Ga0439452_000610_5767_6546 259
476 3300003323 rootH1_10231886 rootH1_102318862 260
477 3300003752 Ga0055539_1000122 Ga0055539_10001229 260
478 3300003756 Ga0055533_1000130 Ga0055533_100013079 260
479 3300003758 Ga0055532_1000118 Ga0055532_10001189 260
480 3300003759 Ga0055525_1000295 Ga0055525_10002959 260
481 3300003781 Ga0055536_1000822 Ga0055536_100082212 260
482 3300003781 Ga0055536_1000831 Ga0055536_100083112 260
483 3300003791 Ga0055530_10001294 Ga0055530_1000129410 260
484 3300003791 Ga0055530_10030209 Ga0055530_100302092 260
485 3300003792 Ga0055540_1000277 Ga0055540_100027712 260
486 3300003794 Ga0055531_10000123 Ga0055531_1000012338 260
487 3300003841 Ga0055541_1000082 Ga0055541_10000829 260
488 3300005288 Ga0065714_10006536 Ga0065714_100065363 260
489 3300005288 Ga0065714_10067473 Ga0065714_100674735 260
490 3300005288 Ga0065714_10077980 Ga0065714_100779802 260
491 3300005289 Ga0065704_10085475 Ga0065704_100854753 260
492 3300005290 Ga0065712_10000180 Ga0065712_1000018019 260
493 3300005290 Ga0065712_10083210 Ga0065712_100832103 260
494 3300005331 Ga0070670_100001337 Ga0070670_10000133711 260
495 3300005331 Ga0070670_100002685 Ga0070670_1000026857 260
496 3300005344 Ga0070661_100000550 Ga0070661_10000055011 260
497 3300005353 Ga0070669_100000354 Ga0070669_10000035421 260
498 3300005353 Ga0070669_100005412 Ga0070669_1000054128 260
499 3300005435 Ga0070714_100149542 Ga0070714_1001495422 260
500 3300005457 Ga0070662_100000402 Ga0070662_1000004024 260
501 3300005457 Ga0070662_100006388 Ga0070662_1000063883 260
502 3300005539 Ga0068853_100000188 Ga0068853_1000001883 260
503 3300005548 Ga0070665_100064792 Ga0070665_1000647924 260
504 3300005548 Ga0070665_100287362 Ga0070665_1002873622 260
505 3300005548 Ga0070665_100354167 Ga0070665_1003541672 260
506 3300005564 Ga0070664_100001098 Ga0070664_10000109811 260
507 3300005564 Ga0070664_100138987 Ga0070664_1001389873 260
508 3300005578 Ga0068854_100013770 Ga0068854_1000137703 260
509 3300005834 Ga0068851_10000021 Ga0068851_1000002176 260
510 3300006051 Ga0075364_10153213 Ga0075364_101532132 260
511 3300006051 Ga0075364_10172227 Ga0075364_101722272 260
512 3300006051 Ga0075364_10173924 Ga0075364_101739243 260
513 3300006058 Ga0075432_10019662 Ga0075432_100196623 260
514 3300006058 Ga0075432_10020489 Ga0075432_100204893 260
515 3300006058 Ga0075432_10046285 Ga0075432_100462852 260
516 3300006058 Ga0075432_10081665 Ga0075432_100816652 260
517 3300006177 Ga0075362_10003476 Ga0075362_100034765 260
518 3300006177 Ga0075362_10055628 Ga0075362_100556283 260
519 3300006177 Ga0075362_10149450 Ga0075362_101494502 260
520 3300006914 Ga0075436_100098389 Ga0075436_1000983892 260
521 3300006946 Ga0079104_1000331 Ga0079104_100033149 260
522 3300006946 Ga0079104_1007406 Ga0079104_10074063 260
523 3300009011 Ga0105251_10001226 Ga0105251_1000122612 260
524 3300009011 Ga0105251_10002141 Ga0105251_1000214114 260
525 3300009011 Ga0105251_10002793 Ga0105251_100027937 260
526 3300009011 Ga0105251_10005928 Ga0105251_100059288 260
527 3300009011 Ga0105251_10032944 Ga0105251_100329443 260
528 3300009011 Ga0105251_10045588 Ga0105251_100455883 260
529 3300009011 Ga0105251_10060867 Ga0105251_100608673 260
530 3300009011 Ga0105251_10061882 Ga0105251_100618823 260
531 3300009011 Ga0105251_10075030 Ga0105251_100750302 260
532 3300009036 Ga0105244_10001648 Ga0105244_1000164810 260
533 3300009036 Ga0105244_10002038 Ga0105244_100020387 260
534 3300009036 Ga0105244_10003111 Ga0105244_100031119 260
535 3300009036 Ga0105244_10003864 Ga0105244_100038647 260
536 3300009036 Ga0105244_10008293 Ga0105244_100082932 260
537 3300009036 Ga0105244_10008504 Ga0105244_100085042 260
538 3300009036 Ga0105244_10021455 Ga0105244_100214551 260
539 3300009036 Ga0105244_10038592 Ga0105244_100385923 260
540 3300009036 Ga0105244_10122762 Ga0105244_101227622 260
541 3300009092 Ga0105250_10001376 Ga0105250_1000137611 260
542 3300009092 Ga0105250_10002425 Ga0105250_100024252 260
543 3300009092 Ga0105250_10004161 Ga0105250_100041612 260
544 3300009092 Ga0105250_10011125 Ga0105250_100111253 260
545 3300009092 Ga0105250_10053048 Ga0105250_100530482 260
546 3300009092 Ga0105250_10060107 Ga0105250_100601073 260
547 3300009092 Ga0105250_10073235 Ga0105250_100732352 260
548 3300009148 Ga0105243_10000335 Ga0105243_1000033537 260
549 3300009148 Ga0105243_10003629 Ga0105243_100036297 260
550 3300009176 Ga0105242_10001961 Ga0105242_1000196116 260
551 3300009545 Ga0105237_10000547 Ga0105237_1000054750 260
552 3300009545 Ga0105237_10223757 Ga0105237_102237572 260
553 3300011119 Ga0105246_10000484 Ga0105246_1000048416 260
554 3300011119 Ga0105246_10000502 Ga0105246_1000050211 260
555 3300011119 Ga0105246_10037540 Ga0105246_100375402 260
556 3300013100 Ga0157373_10001705 Ga0157373_1000170511 260
557 3300013100 Ga0157373_10002281 Ga0157373_100022817 260
558 3300013100 Ga0157373_10009411 Ga0157373_100094117 260
559 3300013100 Ga0157373_10010433 Ga0157373_100104333 260
560 3300013100 Ga0157373_10224821 Ga0157373_102248212 260
561 3300013102 Ga0157371_10001483 Ga0157371_1000148317 260
562 3300013102 Ga0157371_10155754 Ga0157371_101557542 260
563 3300013102 Ga0157371_10352138 Ga0157371_103521382 260
564 3300013102 Ga0157371_10467986 Ga0157371_104679861 260
565 3300013104 Ga0157370_10066856 Ga0157370_100668563 260
566 3300013104 Ga0157370_10131699 Ga0157370_101316993 260
567 3300013104 Ga0157370_10176346 Ga0157370_101763462 260
568 3300013105 Ga0157369_10003087 Ga0157369_1000308711 260
569 3300013105 Ga0157369_10006204 Ga0157369_100062047 260
570 3300013105 Ga0157369_10010041 Ga0157369_1001004112 260
571 3300013105 Ga0157369_10033590 Ga0157369_100335907 260
572 3300013105 Ga0157369_10037528 Ga0157369_100375283 260
573 3300013306 Ga0163162_10231494 Ga0163162_102314943 260
574 3300013307 Ga0157372_10005543 Ga0157372_100055437 260
575 3300013308 Ga0157375_10002693 Ga0157375_100026937 260
576 3300013308 Ga0157375_10003190 Ga0157375_100031907 260
577 3300013308 Ga0157375_10113335 Ga0157375_101133353 260
578 3300013308 Ga0157375_10143600 Ga0157375_101436003 260
579 3300014497 Ga0182008_10001390 Ga0182008_1000139010 260
580 3300014497 Ga0182008_10002107 Ga0182008_100021077 260
581 3300014497 Ga0182008_10002532 Ga0182008_100025327 260
582 3300014497 Ga0182008_10007670 Ga0182008_100076707 260
583 3300014497 Ga0182008_10012213 Ga0182008_100122134 260
584 3300014497 Ga0182008_10013738 Ga0182008_100137384 260
585 3300014497 Ga0182008_10023214 Ga0182008_100232143 260
586 3300015261 Ga0182006_1001263 Ga0182006_100126312 260
587 3300015261 Ga0182006_1002219 Ga0182006_10022192 260
588 3300015261 Ga0182006_1015139 Ga0182006_10151393 260
589 3300015261 Ga0182006_1016511 Ga0182006_10165111 260
590 3300015261 Ga0182006_1083925 Ga0182006_10839252 260
591 3300015262 Ga0182007_10003613 Ga0182007_100036133 260
592 3300015262 Ga0182007_10050793 Ga0182007_100507932 260
593 3300015265 Ga0182005_1001270 Ga0182005_10012705 260
594 3300015265 Ga0182005_1010960 Ga0182005_10109603 260
595 3300017792 Ga0163161_10002271 Ga0163161_1000227111 260
596 3300017792 Ga0163161_10005421 Ga0163161_100054213 260
597 3300017792 Ga0163161_10007361 Ga0163161_100073617 260
598 3300017792 Ga0163161_10075584 Ga0163161_100755843 260
599 3300017792 Ga0163161_10102557 Ga0163161_101025572 260
600 3300017792 Ga0163161_10121576 Ga0163161_101215763 260
601 3300017792 Ga0163161_10535481 Ga0163161_105354812 260
602 3300025224 Ga0209784_100093 Ga0209784_10009380 260
603 3300025225 Ga0209566_100109 Ga0209566_10010980 260
604 3300025226 Ga0209674_100133 Ga0209674_10013380 260
605 3300025229 Ga0209147_100140 Ga0209147_10014080 260
606 3300025230 Ga0209563_100124 Ga0209563_10012480 260
607 3300025230 Ga0209563_100745 Ga0209563_1007459 260
608 3300025242 Ga0209258_100301 Ga0209258_1003019 260
609 3300025246 Ga0209646_1000320 Ga0209646_100032037 260
610 3300025253 Ga0209677_100084 Ga0209677_10008480 260
611 3300025256 Ga0209759_1002581 Ga0209759_10025813 260
612 3300025291 Ga0209675_1016529 Ga0209675_10165292 260
613 3300025292 Ga0209676_1000010 Ga0209676_1000010851 260
614 3300025292 Ga0209676_1000350 Ga0209676_100035052 260
615 3300025298 Ga0209050_1000019 Ga0209050_100001912 260
616 3300025298 Ga0209050_1002091 Ga0209050_10020918 260
617 3300025303 Ga0209051_1000383 Ga0209051_100038355 260
618 3300025303 Ga0209051_1008648 Ga0209051_10086483 260
619 3300025304 Ga0209257_1000357 Ga0209257_100035743 260
620 3300025321 Ga0207656_10000020 Ga0207656_1000002043 260
621 3300025711 Ga0207696_1000052 Ga0207696_100005288 260
622 3300025711 Ga0207696_1000213 Ga0207696_100021312 260
623 3300025711 Ga0207696_1001517 Ga0207696_10015177 260
624 3300025711 Ga0207696_1004910 Ga0207696_10049102 260
625 3300025711 Ga0207696_1005481 Ga0207696_10054812 260
626 3300025728 Ga0207655_1000021 Ga0207655_100002183 260
627 3300025728 Ga0207655_1000328 Ga0207655_100032845 260
628 3300025728 Ga0207655_1000954 Ga0207655_100095415 260
629 3300025728 Ga0207655_1003342 Ga0207655_10033429 260
630 3300025728 Ga0207655_1003350 Ga0207655_100335011 260
631 3300025728 Ga0207655_1004455 Ga0207655_10044558 260
632 3300025728 Ga0207655_1007456 Ga0207655_10074563 260
633 3300025728 Ga0207655_1034764 Ga0207655_10347642 260
634 3300025728 Ga0207655_1054512 Ga0207655_10545123 260
635 3300025728 Ga0207655_1088827 Ga0207655_10888271 260
636 3300025735 Ga0207713_1000446 Ga0207713_100044644 260
637 3300025735 Ga0207713_1001355 Ga0207713_100135515 260
638 3300025735 Ga0207713_1001622 Ga0207713_10016228 260
639 3300025735 Ga0207713_1002469 Ga0207713_100246912 260
640 3300025735 Ga0207713_1003366 Ga0207713_100336611 260
641 3300025735 Ga0207713_1004556 Ga0207713_10045564 260
642 3300025735 Ga0207713_1007719 Ga0207713_10077194 260
643 3300025735 Ga0207713_1016382 Ga0207713_10163823 260
644 3300025735 Ga0207713_1027678 Ga0207713_10276783 260
645 3300025914 Ga0207671_10000091 Ga0207671_1000009194 260
646 3300025920 Ga0207649_10000020 Ga0207649_10000020108 260
647 3300025923 Ga0207681_10000312 Ga0207681_1000031215 260
648 3300025923 Ga0207681_10002703 Ga0207681_1000270310 260
649 3300025925 Ga0207650_10000520 Ga0207650_1000052015 260
650 3300025925 Ga0207650_10000522 Ga0207650_1000052218 260
651 3300025929 Ga0207664_10428477 Ga0207664_104284772 260
652 3300025933 Ga0207706_10001502 Ga0207706_1000150213 260
653 3300025933 Ga0207706_10006616 Ga0207706_100066161 260
654 3300025934 Ga0207686_10003053 Ga0207686_100030539 260
655 3300025935 Ga0207709_10000189 Ga0207709_1000018943 260
656 3300025935 Ga0207709_10004233 Ga0207709_100042337 260
657 3300025941 Ga0207711_10043279 Ga0207711_100432793 260
658 3300025945 Ga0207679_10000023 Ga0207679_10000023108 260
659 3300025945 Ga0207679_10212469 Ga0207679_102124692 260
660 3300026041 Ga0207639_10002127 Ga0207639_100021273 260
661 3300027111 Ga0209281_1000228 Ga0209281_100022857 260
662 3300027111 Ga0209281_1005506 Ga0209281_10055064 260
663 3300027111 Ga0209281_1005575 Ga0209281_10055753 260
664 3300027907 Ga0207428_10028922 Ga0207428_100289225 260
665 3300027907 Ga0207428_10074756 Ga0207428_100747564 260
666 3300027907 Ga0207428_10154422 Ga0207428_101544222 260
667 3300027907 Ga0207428_10209496 Ga0207428_102094962 260
668 3300028379 Ga0268266_10478097 Ga0268266_104780971 260
669 3300028786 Ga0307517_10089399 Ga0307517_100893993 260
670 3300030521 Ga0307511_10010399 Ga0307511_100103998 260
671 3300030735 Ga0316178_1164502 Ga0316178_116450218 260
672 3300031507 Ga0307509_10037638 Ga0307509_100376383 260
673 3300031548 Ga0307408_100001505 Ga0307408_10000150511 260
674 3300031730 Ga0307516_10094582 Ga0307516_100945823 260
675 3300031731 Ga0307405_10000239 Ga0307405_1000023911 260
676 3300031903 Ga0307407_10228908 Ga0307407_102289081 260
677 3300031911 Ga0307412_10027680 Ga0307412_100276802 260
678 3300031911 Ga0307412_10214426 Ga0307412_102144262 260
679 3300031995 Ga0307409_100009952 Ga0307409_1000099524 260
680 3300032004 Ga0307414_10017815 Ga0307414_100178155 260
681 3300032005 Ga0307411_10044816 Ga0307411_100448162 260
682 3300033180 Ga0307510_10003501 Ga0307510_1000350112 260
683 3300038705 Ga0237819_01398 Ga0237819_01398_5163_5945 260
684 3300041405 Ga0439438_001132 Ga0439438_001132_3774_4556 260
685 3300041405 Ga0439438_001176 Ga0439438_001176_4376_5158 260
686 3300041405 Ga0439438_002514 Ga0439438_002514_3225_4007 260
687 3300041405 Ga0439438_007531 Ga0439438_007531_164_946 260
688 3300041405 Ga0439438_007957 Ga0439438_007957_1272_2054 260
689 3300041407 Ga0439447_001654 Ga0439447_001654_4762_5544 260
690 3300041407 Ga0439447_003180 Ga0439447_003180_4150_4932 260
691 3300041407 Ga0439447_004880 Ga0439447_004880_3529_4311 260
692 3300041407 Ga0439447_013273 Ga0439447_013273_403_1185 260
693 3300041411 Ga0439466_0012006 Ga0439466_0012006_1946_2728 260
694 3300041411 Ga0439466_0020449 Ga0439466_0020449_669_1451 260
695 3300041411 Ga0439466_0034757 Ga0439466_0034757_643_1476 260
696 3300042006 Ga0439432_000220 Ga0439432_000220_11632_12414 260
697 3300042009 Ga0439451_007377 Ga0439451_007377_430_1212 260
698 3300042010 Ga0439452_001067 Ga0439452_001067_8620_9402 260
699 3300042010 Ga0439452_032128 Ga0439452_032128_308_1141 260
700 3300042013 Ga0439456_010963 Ga0439456_010963_472_1254 260
701 3300042016 Ga0439463_038737 Ga0439463_038737_52_834 260
702 3300042115 Ga0450911_000350 Ga0450911_000350_7411_8193 260
703 3300042115 Ga0450911_006933 Ga0450911_006933_302_1084 260
704 3300042121 Ga0450919_005429 Ga0450919_005429_549_1331 260
705 3300042122 Ga0450920_000077 Ga0450920_000077_2234_3016 260
706 3300042124 Ga0450922_000111 Ga0450922_000111_4353_5135 260
707 3300042125 Ga0450923_011103 Ga0450923_011103_441_1223 260
708 3300042137 Ga0450902_014979 Ga0450902_014979_77_859 260
709 3300042137 Ga0450902_025998 Ga0450902_025998_90_872 260
710 3300042138 Ga0450903_001128 Ga0450903_001128_389_1222 260
711 3300042138 Ga0450903_001702 Ga0450903_001702_1570_2352 260
712 3300042138 Ga0450903_006541 Ga0450903_006541_954_1736 260
713 3300042139 Ga0450904_000312 Ga0450904_000312_3741_4523 260
714 3300042142 Ga0450905_005133 Ga0450905_005133_378_1160 260
715 3300042145 Ga0450906_000403 Ga0450906_000403_2856_3638 260
716 3300042145 Ga0450906_008043 Ga0450906_008043_650_1432 260
717 3300042146 Ga0450907_000534 Ga0450907_000534_6549_7331 260
718 3300042184 Ga0450908_015428 Ga0450908_015428_183_965 260
719 3300042461 Ga0439460_0000711 Ga0439460_0000711_940_1773 260
720 3300046452 Ga0495617_001882 Ga0495617_001882_3371_4180 260
721 3300046452 Ga0495617_005526 Ga0495617_005526_688_1470 260
722 3300046452 Ga0495617_005795 Ga0495617_005795_517_1299 260
723 3300046452 Ga0495617_009584 Ga0495617_009584_1808_2590 260
724 3300046452 Ga0495617_015626 Ga0495617_015626_83_865 260
725 3300046452 Ga0495617_021642 Ga0495617_021642_404_1186 260
726 3300046452 Ga0495617_064930 Ga0495617_064930_157_939 260
727 3300046453 Ga0495627_002228 Ga0495627_002228_3464_4273 260
728 3300046453 Ga0495627_025502 Ga0495627_025502_751_1533 260
729 3300046455 Ga0495603_0031023 Ga0495603_0031023_43_825 260
730 3300046455 Ga0495603_0098430 Ga0495603_0098430_457_1239 260
731 3300046457 Ga0495590_0000955 Ga0495590_0000955_6874_7656 260
732 3300046457 Ga0495590_0019725 Ga0495590_0019725_1074_1856 260
733 3300046457 Ga0495590_0027149 Ga0495590_0027149_829_1611 260
734 3300046457 Ga0495590_0050680 Ga0495590_0050680_392_1174 260
735 3300046458 Ga0495591_004667 Ga0495591_004667_5676_6458 260
736 3300046458 Ga0495591_005380 Ga0495591_005380_907_1689 260
737 3300046458 Ga0495591_005801 Ga0495591_005801_1938_2720 260
738 3300046458 Ga0495591_009091 Ga0495591_009091_2707_3489 260
739 3300046460 Ga0495638_0004852 Ga0495638_0004852_7232_8014 260
740 3300046460 Ga0495638_0005069 Ga0495638_0005069_4648_5430 260
741 3300046460 Ga0495638_0008148 Ga0495638_0008148_3611_4393 260
742 3300046460 Ga0495638_0009283 Ga0495638_0009283_4038_4820 260
743 3300046460 Ga0495638_0040582 Ga0495638_0040582_288_1070 260
744 3300046460 Ga0495638_0183613 Ga0495638_0183613_339_1148 260
745 3300046463 Ga0495653_0002354 Ga0495653_0002354_7785_8567 260
746 3300046463 Ga0495653_0048799 Ga0495653_0048799_1221_2003 260
747 3300046471 Ga0495650_0002459 Ga0495650_0002459_4215_4997 260
748 3300046471 Ga0495650_0002495 Ga0495650_0002495_7867_8649 260
749 3300046471 Ga0495650_0014382 Ga0495650_0014382_832_1620 260
750 3300046474 Ga0495605_0000014 Ga0495605_0000014_291693_292481 260
751 3300046474 Ga0495605_0001780 Ga0495605_0001780_5825_6607 260
752 3300046474 Ga0495605_0002004 Ga0495605_0002004_4966_5748 260
753 3300046474 Ga0495605_0087940 Ga0495605_0087940_160_942 260
754 3300046491 Ga0495584_0001741 Ga0495584_0001741_7159_7941 260
755 3300046491 Ga0495584_0002524 Ga0495584_0002524_5129_5911 260
756 3300046491 Ga0495584_0003815 Ga0495584_0003815_6768_7550 260
757 3300046491 Ga0495584_0007706 Ga0495584_0007706_2591_3373 260
758 3300046491 Ga0495584_0012828 Ga0495584_0012828_3384_4166 260
759 3300046492 Ga0495585_0001554 Ga0495585_0001554_9260_10042 260
760 3300046492 Ga0495585_0003939 Ga0495585_0003939_7650_8432 260
761 3300046492 Ga0495585_0004096 Ga0495585_0004096_4603_5412 260
762 3300046499 Ga0495594_0001414 Ga0495594_0001414_4507_5295 260
763 3300046501 Ga0495607_0001843 Ga0495607_0001843_9562_10344 260
764 3300046501 Ga0495607_0005045 Ga0495607_0005045_4579_5361 260
765 3300046501 Ga0495607_0005495 Ga0495607_0005495_5015_5797 260
766 3300046501 Ga0495607_0011711 Ga0495607_0011711_4563_5345 260
767 3300046506 Ga0495583_0000238 Ga0495583_0000238_77437_78225 260
768 3300046506 Ga0495583_0006547 Ga0495583_0006547_1759_2541 260
769 3300046506 Ga0495583_0012358 Ga0495583_0012358_624_1406 260
770 3300046506 Ga0495583_0017067 Ga0495583_0017067_2552_3334 260
771 3300046507 Ga0495606_0003000 Ga0495606_0003000_4893_5675 260
772 3300046507 Ga0495606_0004719 Ga0495606_0004719_11614_12396 260
773 3300046507 Ga0495606_0016662 Ga0495606_0016662_785_1567 260
774 3300046507 Ga0495606_0035727 Ga0495606_0035727_934_1716 260
775 3300046507 Ga0495606_0046100 Ga0495606_0046100_1779_2561 260
776 3300046512 Ga0495610_0003164 Ga0495610_0003164_2747_3529 260
777 3300046512 Ga0495610_0004307 Ga0495610_0004307_2306_3094 260
778 3300046512 Ga0495610_0005854 Ga0495610_0005854_4213_4995 260
779 3300046512 Ga0495610_0012014 Ga0495610_0012014_1313_2095 260
780 3300046513 Ga0495616_0001714 Ga0495616_0001714_7885_8667 260
781 3300046513 Ga0495616_0016901 Ga0495616_0016901_2586_3368 260
782 3300046513 Ga0495616_0063553 Ga0495616_0063553_911_1693 260
783 3300046515 Ga0495620_0000094 Ga0495620_0000094_56845_57633 260
784 3300046515 Ga0495620_0001961 Ga0495620_0001961_6178_6960 260
785 3300046515 Ga0495620_0003510 Ga0495620_0003510_3874_4656 260
786 3300046517 Ga0495630_0002286 Ga0495630_0002286_7561_8343 260
787 3300046517 Ga0495630_0006836 Ga0495630_0006836_5837_6619 260
788 3300046518 Ga0495631_0000488 Ga0495631_0000488_9577_10359 260
789 3300046518 Ga0495631_0001609 Ga0495631_0001609_4156_4944 260
790 3300046519 Ga0495632_0004418 Ga0495632_0004418_949_1731 260
791 3300046519 Ga0495632_0009076 Ga0495632_0009076_543_1352 260
792 3300046519 Ga0495632_0012529 Ga0495632_0012529_2113_2952 260
793 3300046519 Ga0495632_0065717 Ga0495632_0065717_690_1472 260
794 3300046519 Ga0495632_0067295 Ga0495632_0067295_748_1530 260
795 3300046519 Ga0495632_0204618 Ga0495632_0204618_29_811 260
796 3300046520 Ga0495637_0002393 Ga0495637_0002393_7936_8718 260
797 3300046520 Ga0495637_0004336 Ga0495637_0004336_2697_3479 260
798 3300046520 Ga0495637_0005108 Ga0495637_0005108_3336_4118 260
799 3300046520 Ga0495637_0067001 Ga0495637_0067001_132_914 260
800 3300046522 Ga0495643_0058745 Ga0495643_0058745_879_1661 260
801 3300046522 Ga0495643_0127996 Ga0495643_0127996_183_965 260
802 3300046523 Ga0495644_0001092 Ga0495644_0001092_5706_6515 260
803 3300046523 Ga0495644_0001366 Ga0495644_0001366_4648_5430 260
804 3300046523 Ga0495644_0069183 Ga0495644_0069183_227_1009 260
805 3300046524 Ga0495648_0006685 Ga0495648_0006685_3687_4544 260
806 3300046524 Ga0495648_0006947 Ga0495648_0006947_4479_5261 260
807 3300046524 Ga0495648_0009988 Ga0495648_0009988_369_1151 260
808 3300046524 Ga0495648_0012078 Ga0495648_0012078_992_1801 260
809 3300046524 Ga0495648_0020771 Ga0495648_0020771_3369_4157 260
810 3300046524 Ga0495648_0025249 Ga0495648_0025249_2930_3712 260
811 3300046526 Ga0495666_0001124 Ga0495666_0001124_4685_5467 260
812 3300046526 Ga0495666_0025192 Ga0495666_0025192_295_1077 260
813 3300046528 Ga0495642_0000700 Ga0495642_0000700_6763_7545 260
814 3300046530 Ga0495654_0003715 Ga0495654_0003715_4415_5197 260
815 3300046530 Ga0495654_0006439 Ga0495654_0006439_1800_2582 260
816 3300046530 Ga0495654_0014441 Ga0495654_0014441_1087_1869 260
817 3300046530 Ga0495654_0014657 Ga0495654_0014657_2351_3160 260
818 3300046530 Ga0495654_0022336 Ga0495654_0022336_1254_2036 260
819 3300046530 Ga0495654_0042198 Ga0495654_0042198_840_1622 260
820 3300046531 Ga0495665_0164050 Ga0495665_0164050_41_823 260
821 3300046536 Ga0495587_0002952 Ga0495587_0002952_6737_7519 260
822 3300046538 Ga0495609_0000024 Ga0495609_0000024_12904_13692 260
823 3300046542 Ga0495597_0002368 Ga0495597_0002368_6287_7075 260
824 3300046542 Ga0495597_0003939 Ga0495597_0003939_2399_3181 260
825 3300046542 Ga0495597_0007406 Ga0495597_0007406_2586_3368 260
826 3300046542 Ga0495597_0009761 Ga0495597_0009761_324_1106 260
827 3300046542 Ga0495597_0053369 Ga0495597_0053369_816_1598 260
828 3300046543 Ga0495645_0123796 Ga0495645_0123796_757_1539 260
829 3300046557 Ga0495622_0064167 Ga0495622_0064167_174_956 260
830 3300046558 Ga0495633_0000118 Ga0495633_0000118_94175_94963 260
831 3300046558 Ga0495633_0006665 Ga0495633_0006665_2461_3243 260
832 3300046558 Ga0495633_0019663 Ga0495633_0019663_836_1618 260
833 3300046615 Ga0495656_0084414 Ga0495656_0084414_335_1144 260
834 3300046616 Ga0495668_0023581 Ga0495668_0023581_2378_3160 260
835 3300046642 Ga0495634_0002180 Ga0495634_0002180_9578_10360 260
836 3300046660 Ga0495625_0006726 Ga0495625_0006726_4249_5031 260
837 3300046660 Ga0495625_0038622 Ga0495625_0038622_2349_3158 260
838 3300046660 Ga0495625_0041360 Ga0495625_0041360_1468_2250 260
839 3300046660 Ga0495625_0096076 Ga0495625_0096076_799_1581 260
840 3300046663 Ga0495635_0000990 Ga0495635_0000990_9294_10076 260
841 3300046665 Ga0495661_0001599 Ga0495661_0001599_12805_13587 260
842 3300046665 Ga0495661_0002456 Ga0495661_0002456_8503_9285 260
843 3300046665 Ga0495661_0005146 Ga0495661_0005146_5271_6053 260
844 3300046665 Ga0495661_0018734 Ga0495661_0018734_1638_2447 260
845 3300046665 Ga0495661_0116150 Ga0495661_0116150_302_1084 260
846 3300046674 Ga0495588_0014652 Ga0495588_0014652_2821_3603 260
847 3300046678 Ga0495599_0152622 Ga0495599_0152622_277_1059 260
848 3300046679 Ga0495623_0001930 Ga0495623_0001930_6981_7763 260
849 3300046680 Ga0495646_0033141 Ga0495646_0033141_1949_2731 260
850 3300046684 Ga0495669_0113697 Ga0495669_0113697_412_1194 260
851 3300046689 Ga0495613_0007975 Ga0495613_0007975_2856_3638 260
852 3300046689 Ga0495613_0017806 Ga0495613_0017806_2773_3555 260
853 3300046690 Ga0495624_0001662 Ga0495624_0001662_7825_8607 260
854 3300046691 Ga0495670_0003410 Ga0495670_0003410_4263_5045 260
855 3300046691 Ga0495670_0003864 Ga0495670_0003864_2721_3503 260
856 3300046691 Ga0495670_0019874 Ga0495670_0019874_2039_2848 260
857 3300046692 Ga0495671_0005851 Ga0495671_0005851_3060_3869 260
858 3300046692 Ga0495671_0007722 Ga0495671_0007722_2689_3471 260
859 3300046692 Ga0495671_0008603 Ga0495671_0008603_3466_4254 260
860 3300046692 Ga0495671_0011531 Ga0495671_0011531_356_1138 260
861 3300046692 Ga0495671_0012152 Ga0495671_0012152_3591_4373 260
862 3300046692 Ga0495671_0013449 Ga0495671_0013449_1002_1784 260
863 3300046692 Ga0495671_0114558 Ga0495671_0114558_499_1281 260
864 3300046692 Ga0495671_0150892 Ga0495671_0150892_20_853 260
865 3300046694 Ga0495649_0003156 Ga0495649_0003156_3691_4473 260
866 3300046694 Ga0495649_0011169 Ga0495649_0011169_2351_3133 260
867 3300046694 Ga0495649_0025150 Ga0495649_0025150_157_939 260
868 3300046694 Ga0495649_0055194 Ga0495649_0055194_143_925 260
869 3300046794 Ga0495589_0001592 Ga0495589_0001592_7680_8468 260
870 3300046794 Ga0495589_0004214 Ga0495589_0004214_2830_3612 260
871 3300046794 Ga0495589_0007705 Ga0495589_0007705_855_1637 260
872 3300046794 Ga0495589_0007970 Ga0495589_0007970_3708_4490 260
873 3300046794 Ga0495589_0021469 Ga0495589_0021469_714_1496 260
874 3300046809 Ga0495600_0036841 Ga0495600_0036841_725_1507 260
875 3300046810 Ga0495660_0009934 Ga0495660_0009934_429_1211 260
876 3300046810 Ga0495660_0010156 Ga0495660_0010156_2758_3540 260
877 3300046810 Ga0495660_0015884 Ga0495660_0015884_2828_3610 260
878 3300046810 Ga0495660_0019786 Ga0495660_0019786_2287_3069 260
879 3300046810 Ga0495660_0028619 Ga0495660_0028619_1751_2533 260
880 3300046810 Ga0495660_0103372 Ga0495660_0103372_143_931 260
881 3300047317 Ga0495604_0014914 Ga0495604_0014914_351_1133 260
882 3300047317 Ga0495604_0046113 Ga0495604_0046113_1368_2150 260
883 3300047319 Ga0495674_0003856 Ga0495674_0003856_7682_8464 260
884 3300047320 Ga0495672_0002363 Ga0495672_0002363_8737_9519 260
885 3300047320 Ga0495672_0003693 Ga0495672_0003693_4685_5467 260
886 3300047320 Ga0495672_0004600 Ga0495672_0004600_4919_5701 260
887 3300047320 Ga0495672_0005300 Ga0495672_0005300_2841_3623 260
888 3300047320 Ga0495672_0009098 Ga0495672_0009098_3550_4407 260
889 3300047320 Ga0495672_0033804 Ga0495672_0033804_1929_2711 260
890 3300047320 Ga0495672_0038090 Ga0495672_0038090_2105_2914 260
891 3300047320 Ga0495672_0075494 Ga0495672_0075494_703_1485 260
892 3300047321 Ga0495676_0016858 Ga0495676_0016858_853_1635 260
893 3300047322 Ga0495680_0009992 Ga0495680_0009992_504_1286 260
894 3300047322 Ga0495680_0110734 Ga0495680_0110734_687_1469 260
895 3300047323 Ga0495683_0000066 Ga0495683_0000066_98398_99186 260
896 3300047323 Ga0495683_0000806 Ga0495683_0000806_12130_12912 260
897 3300047323 Ga0495683_0003688 Ga0495683_0003688_4142_4924 260
898 3300047323 Ga0495683_0004355 Ga0495683_0004355_7258_8040 260
899 3300047323 Ga0495683_0007487 Ga0495683_0007487_2853_3635 260
900 3300047443 Ga0495687_003724 Ga0495687_003724_4521_5303 260
901 3300047443 Ga0495687_006376 Ga0495687_006376_2718_3575 260
902 3300047446 Ga0495679_001103 Ga0495679_001103_6168_6950 260
903 3300047446 Ga0495679_001931 Ga0495679_001931_9532_10314 260
904 3300047446 Ga0495679_002199 Ga0495679_002199_9132_9920 260
905 3300047446 Ga0495679_003492 Ga0495679_003492_2504_3286 260
906 3300047469 Ga0495673_0001653 Ga0495673_0001653_5635_6417 260
907 3300047469 Ga0495673_0001688 Ga0495673_0001688_12241_13023 260
908 3300047469 Ga0495673_0003140 Ga0495673_0003140_4663_5445 260
909 3300047469 Ga0495673_0005867 Ga0495673_0005867_2650_3432 260
910 3300047469 Ga0495673_0022330 Ga0495673_0022330_1962_2744 260
911 3300047469 Ga0495673_0031237 Ga0495673_0031237_1478_2260 260
912 3300047469 Ga0495673_0036375 Ga0495673_0036375_631_1419 260
913 3300047470 Ga0495681_0001617 Ga0495681_0001617_9547_10329 260
914 3300047470 Ga0495681_0001778 Ga0495681_0001778_8859_9641 260
915 3300047470 Ga0495681_0002778 Ga0495681_0002778_5757_6539 260
916 3300047470 Ga0495681_0002935 Ga0495681_0002935_4464_5246 260
917 3300047470 Ga0495681_0007335 Ga0495681_0007335_2907_3689 260
918 3300047470 Ga0495681_0015490 Ga0495681_0015490_2762_3544 260
919 3300047471 Ga0495684_0035270 Ga0495684_0035270_253_1035 260
920 3300047471 Ga0495684_0065625 Ga0495684_0065625_60_842 260
921 3300047472 Ga0495686_0005123 Ga0495686_0005123_4275_5057 260
922 3300047472 Ga0495686_0005736 Ga0495686_0005736_6096_6878 260
923 3300047673 Ga0495593_0003875 Ga0495593_0003875_5038_5820 260
924 3300047673 Ga0495593_0011227 Ga0495593_0011227_1383_2165 260
925 3300047673 Ga0495593_0105718 Ga0495593_0105718_435_1217 260
926 3300048088 Ga0495602_0007090 Ga0495602_0007090_3167_3949 260
927 3300048091 Ga0495626_0001910 Ga0495626_0001910_5839_6672 260
928 3300048091 Ga0495626_0002065 Ga0495626_0002065_4649_5431 260
929 3300048091 Ga0495626_0085991 Ga0495626_0085991_545_1327 260
930 3300048905 Ga0496102_0000897 Ga0496102_0000897_17965_18747 260
931 3300048906 Ga0496103_0001672 Ga0496103_0001672_7816_8598 260
932 3300048913 Ga0496110_0035322 Ga0496110_0035322_1119_1901 260
933 3300048919 Ga0496116_0004738 Ga0496116_0004738_7022_7804 260
934 3300048919 Ga0496116_0006230 Ga0496116_0006230_5234_6016 260
935 3300048919 Ga0496116_0219361 Ga0496116_0219361_142_924 260
936 3300048920 Ga0496117_0002846 Ga0496117_0002846_12898_13680 260
937 3300048920 Ga0496117_0004144 Ga0496117_0004144_6002_6784 260
938 3300048920 Ga0496117_0022230 Ga0496117_0022230_1632_2414 260
939 3300048920 Ga0496117_0051122 Ga0496117_0051122_1632_2414 260
940 3300048920 Ga0496117_0084502 Ga0496117_0084502_240_1022 260
941 3300048920 Ga0496117_0107815 Ga0496117_0107815_397_1230 260
942 3300048920 Ga0496117_0155467 Ga0496117_0155467_136_924 260
943 3300048920 Ga0496117_0174727 Ga0496117_0174727_267_1049 260
944 3300048920 Ga0496117_0185557 Ga0496117_0185557_58_840 260
945 3300048921 Ga0496118_0009822 Ga0496118_0009822_4395_5177 260
946 3300048921 Ga0496118_0010381 Ga0496118_0010381_6122_6904 260
947 3300048921 Ga0496118_0021136 Ga0496118_0021136_2571_3353 260
948 3300048921 Ga0496118_0073717 Ga0496118_0073717_1134_1967 260
949 3300048921 Ga0496118_0126380 Ga0496118_0126380_802_1584 260
950 3300048921 Ga0496118_0190815 Ga0496118_0190815_380_1162 260
951 3300048922 Ga0496119_0024690 Ga0496119_0024690_1481_2263 260
952 3300048922 Ga0496119_0040109 Ga0496119_0040109_1585_2367 260
953 3300048922 Ga0496119_0043317 Ga0496119_0043317_780_1562 260
954 3300048923 Ga0496120_0005635 Ga0496120_0005635_8379_9161 260
955 3300048923 Ga0496120_0023450 Ga0496120_0023450_1424_2206 260
956 3300048923 Ga0496120_0090352 Ga0496120_0090352_710_1492 260
957 3300048924 Ga0496121_0008345 Ga0496121_0008345_6461_7243 260
958 3300048924 Ga0496121_0019561 Ga0496121_0019561_1865_2647 260
959 3300048924 Ga0496121_0066811 Ga0496121_0066811_680_1462 260
960 3300048924 Ga0496121_0414310 Ga0496121_0414310_58_840 260
961 3300048925 Ga0496122_0016776 Ga0496122_0016776_1215_1997 260
962 3300048925 Ga0496122_0055913 Ga0496122_0055913_1893_2675 260
963 3300048925 Ga0496122_0096990 Ga0496122_0096990_759_1547 260
964 3300048925 Ga0496122_0184880 Ga0496122_0184880_392_1174 260
965 3300048926 Ga0496123_0035818 Ga0496123_0035818_1785_2567 260
966 3300048926 Ga0496123_0037568 Ga0496123_0037568_1894_2676 260
967 3300048926 Ga0496123_0072248 Ga0496123_0072248_729_1517 260
968 3300048926 Ga0496123_0104683 Ga0496123_0104683_367_1149 260
969 3300048926 Ga0496123_0124716 Ga0496123_0124716_447_1229 260
970 3300048926 Ga0496123_0165274 Ga0496123_0165274_28_810 260
971 3300048927 Ga0496124_0002584 Ga0496124_0002584_10020_10802 260
972 3300048927 Ga0496124_0032660 Ga0496124_0032660_2617_3399 260
973 3300048927 Ga0496124_0032691 Ga0496124_0032691_2823_3656 260
974 3300048927 Ga0496124_0281667 Ga0496124_0281667_59_841 260
975 3300048927 Ga0496124_0285441 Ga0496124_0285441_103_885 260
976 3300048928 Ga0496125_0002457 Ga0496125_0002457_10176_10958 260
977 3300048928 Ga0496125_0003608 Ga0496125_0003608_4994_5776 260
978 3300048928 Ga0496125_0009805 Ga0496125_0009805_4353_5135 260
979 3300048928 Ga0496125_0019386 Ga0496125_0019386_1723_2505 260
980 3300048928 Ga0496125_0020517 Ga0496125_0020517_1049_1831 260
981 3300048928 Ga0496125_0071528 Ga0496125_0071528_511_1293 260
982 3300048928 Ga0496125_0095031 Ga0496125_0095031_829_1611 260
983 3300048929 Ga0496126_0078610 Ga0496126_0078610_809_1591 260
984 3300048929 Ga0496126_0171134 Ga0496126_0171134_765_1547 260
985 3300049459 Ga0495678_000199 Ga0495678_000199_12912_13700 260
986 3300049459 Ga0495678_022204 Ga0495678_022204_243_1025 260
987 3300049459 Ga0495678_053335 Ga0495678_053335_271_1053 260
988 3300049459 Ga0495678_097274 Ga0495678_097274_160_942 260
989 3300049460 Ga0495682_0002884 Ga0495682_0002884_4444_5226 260
990 3300049460 Ga0495682_0003067 Ga0495682_0003067_664_1446 260
991 3300049460 Ga0495682_0006826 Ga0495682_0006826_933_1790 260
992 3300049758 Ga0501241_000147 Ga0501241_000147_6599_7381 260
993 3300049766 Ga0501269_004845 Ga0501269_004845_619_1401 260
994 3300050489 nmdc:mga03683_145944_c1 nmdc:mga03683_145944_c1_79_861 260
995 3300050491 nmdc:mga00v17_24714_c1 nmdc:mga00v17_24714_c1_2463_3245 260
996 3300050491 nmdc:mga00v17_40102_c1 nmdc:mga00v17_40102_c1_18_800 260
997 3300050514 nmdc:mga08x19_101695_c1 nmdc:mga08x19_101695_c1_1064_1897 260
998 3300053161 Ga0500634_0009095 Ga0500634_0009095_1608_2390 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

33

221

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

38

253

0.93

PF23441

28

220

0.85

PF08659

KR

KR domain

33

203

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pk0-assembly1.cif.gz_C crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis 0.888 7 183
3rih-assembly1.cif.gz_C crystal structure of a putative short chain dehydrogenase or reductase from mycobacterium abscessus 0.8863 7 183
1yde-assembly4.cif.gz_N crystal structure of human retinal short-chain dehydrogenase/reductase 3 0.8846 7 183
5ff9-assembly1.cif.gz_C noroxomaritidine/norcraugsodine reductase in complex with nadp+ and tyramine 0.88 7 183
7wbc-assembly1.cif.gz_B hydroxysteroid dehydrogenase wild-type complexed with nad+ and (4s)-2-2-methyl-2,4-pentanediol 0.8787 7 182
ID Description Score Start End Superfamily
2ntnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8882 5 184 3.40.50.720
3rihC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8863 7 183 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8835 7 91 3.40.50.720
af_Q20840_35_300_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8782 7 184 3.40.50.720
4lvuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8769 7 184 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Z0LVN5-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.9007 7 183 GO:0047936
AF-A0A086PBX9-F1-model_v4 3-alpha-(Or 20-beta)-hydroxysteroid dehydrogenase (EC 1.1.1.53) 0.8886 7 183 GO:0047044
AF-A0A202DKQ9-F1-model_v4 Short-chain dehydrogenase 0.8872 1 175 GO:0016020
GO:0016491
AF-A0A836NU12-F1-model_v4 deleted 0.8871 1 162
AF-A0A0B5DW46-F1-model_v4 Oxidoreductase 0.8866 5 183 GO:0016491

Feature Viewer

pLDDT pTM Quality
77.03 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map