F487792
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 997 | 428 | 821 | 77 |
Family's Representative Sequence
| Representative Sequence | 3300005288|Ga0065714_10065086|Ga0065714_100650867 |
| Length | 81 |
| Sequence | MLTCKEQVARSSDYLDGQLTFRERLLVRHHLMFCPNCRRFIRQMRLMQATLKIMPDEPVEGVDALAQRLAAERLKDHKDGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 7 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 8 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 9 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 10 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 11 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 12 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 13 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 14 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 15 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 16 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 17 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 18 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 19 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 20 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 21 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 22 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 23 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 24 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 25 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 26 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 27 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 28 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 29 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 30 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 31 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 32 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 33 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 34 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 35 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 36 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 37 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 38 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 39 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 40 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 41 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 42 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 43 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 44 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 45 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 46 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 47 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 48 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 49 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 50 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 51 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 52 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 53 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 54 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 55 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 56 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 57 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 58 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 59 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 60 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 61 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 62 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 63 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 64 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 65 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 66 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 67 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 68 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 69 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 70 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 71 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 72 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 73 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 74 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 75 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 76 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 77 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 78 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 79 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 80 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 81 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 82 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 83 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 84 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 85 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 86 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 87 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 88 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 89 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 90 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 91 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 92 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 93 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 94 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 95 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 96 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 97 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 98 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 99 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 100 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 101 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 102 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 103 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 104 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 105 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 106 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 107 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 108 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 109 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 110 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 111 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 112 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 113 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 114 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 115 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 116 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 117 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 118 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 119 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 120 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 121 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 122 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 123 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 124 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 125 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 126 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 127 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 128 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 129 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 130 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 131 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 132 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 133 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 134 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 135 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 136 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 137 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 138 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 139 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 140 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 141 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 142 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 143 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 144 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 145 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 146 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 147 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 148 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 149 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 150 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 151 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 152 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 153 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 154 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 155 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 156 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 157 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 158 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 159 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 160 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 161 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 162 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 163 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 164 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 165 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 166 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 167 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 168 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 169 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 170 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 171 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 172 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 173 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 174 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 175 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 176 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 177 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 178 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 179 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 180 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 181 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 190 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 191 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 192 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 194 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 195 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 196 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 197 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 198 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 208 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 209 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 217 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 218 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 219 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 220 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 222 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 232 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 234 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 236 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 258 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 259 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 261 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 262 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 263 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 264 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 265 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 266 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 267 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 268 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 269 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 270 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 271 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 272 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 273 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 274 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 275 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 276 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 277 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 278 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 279 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 280 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 281 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 282 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 283 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 284 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 285 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 286 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 287 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 288 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 289 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 290 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 291 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 292 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 293 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 294 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 295 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 296 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 297 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 298 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 299 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 300 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 301 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 302 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 303 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 304 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 305 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 306 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 307 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 308 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 309 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 310 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 385 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 386 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 387 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 388 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 389 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 390 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 391 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 392 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 393 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 394 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 395 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 396 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 397 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 398 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 399 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 400 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 401 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 402 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 403 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 404 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 407 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 408 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 409 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 410 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 411 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 412 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 413 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 414 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 415 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 416 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 417 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 418 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 419 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 420 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 421 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 422 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 423 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 424 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 425 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 426 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 427 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 428 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.35 |
| Metatranscriptomes | 0 |
| Isolates | 17.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.72 |
| Nodule | 2.01 |
| Rhizoplane | 7.12 |
| Rhizosphere | 71.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_449 | 2124908027 | Bacteria | 2542 |
| 2 | MRS2a_Contig_8358 | 2124908027 | Bacteria | 1981 |
| 3 | SwRhRL2b_contig_9416 | 2162886007 | Bacteria | 1988 |
| 4 | JGI25162J39368_1000085 | 3300002737 | Bacteria | 107722 |
| 5 | JGI25162J39368_1000100 | 3300002737 | Bacteria | 94568 |
| 6 | JGI25154J39366_1010304 | 3300002738 | Bacteria | 1112 |
| 7 | JGI25163J39215_1000366 | 3300002771 | Bacteria | 14567 |
| 8 | JGI25163J39215_1000401 | 3300002771 | Bacteria | 13748 |
| 9 | JGI25164J39214_1000063 | 3300002772 | Bacteria | 107722 |
| 10 | JGI25164J39214_1000079 | 3300002772 | Bacteria | 94568 |
| 11 | JGI25165J46597_1000160 | 3300003214 | Bacteria | 107722 |
| 12 | JGI25165J46597_1000183 | 3300003214 | Bacteria | 94568 |
| 13 | rootH1_10159091 | 3300003323 | Bacteria | 2188 |
| 14 | Ga0055538_1000027 | 3300003751 | Bacteria | 216576 |
| 15 | Ga0055539_1000036 | 3300003752 | Bacteria | 216576 |
| 16 | Ga0055533_1000046 | 3300003756 | Bacteria | 216576 |
| 17 | Ga0055532_1000032 | 3300003758 | Bacteria | 216568 |
| 18 | Ga0055525_1000217 | 3300003759 | Bacteria | 62978 |
| 19 | Ga0055525_1009439 | 3300003759 | Bacteria | 824 |
| 20 | Ga0055535_1029868 | 3300003761 | Bacteria | 573 |
| 21 | Ga0055536_1000041 | 3300003781 | Bacteria | 127266 |
| 22 | Ga0055536_1000362 | 3300003781 | Bacteria | 33679 |
| 23 | Ga0055536_1000391 | 3300003781 | Bacteria | 31787 |
| 24 | Ga0055536_1041221 | 3300003781 | Bacteria | 1092 |
| 25 | Ga0055530_10000113 | 3300003791 | Bacteria | 70767 |
| 26 | Ga0055530_10000290 | 3300003791 | Bacteria | 45698 |
| 27 | Ga0055530_10002005 | 3300003791 | Bacteria | 13797 |
| 28 | Ga0055530_10003530 | 3300003791 | Bacteria | 8821 |
| 29 | Ga0055540_1000154 | 3300003792 | Bacteria | 67934 |
| 30 | Ga0055540_1000170 | 3300003792 | Bacteria | 64696 |
| 31 | Ga0055540_1000584 | 3300003792 | Bacteria | 26615 |
| 32 | Ga0055531_10000842 | 3300003794 | Bacteria | 25309 |
| 33 | Ga0055531_10106302 | 3300003794 | Bacteria | 567 |
| 34 | Ga0055541_1000024 | 3300003841 | Bacteria | 216576 |
| 35 | Ga0065714_10003448 | 3300005288 | Bacteria | 9250 |
| 36 | Ga0065714_10065086 | 3300005288 | Bacteria | 13133 |
| 37 | Ga0065714_10065134 | 3300005288 | Bacteria | 12629 |
| 38 | Ga0065714_10065524 | 3300005288 | Bacteria | 9615 |
| 39 | Ga0065714_10065645 | 3300005288 | Bacteria | 9025 |
| 40 | Ga0065714_10071128 | 3300005288 | Bacteria | 3646 |
| 41 | Ga0065714_10151886 | 3300005288 | Bacteria | 1087 |
| 42 | Ga0065714_10192218 | 3300005288 | Bacteria | 922 |
| 43 | Ga0065714_10248730 | 3300005288 | Bacteria | 771 |
| 44 | Ga0065704_10008790 | 3300005289 | Bacteria | 3930 |
| 45 | Ga0065704_10070997 | 3300005289 | Bacteria | 13885 |
| 46 | Ga0065704_10157503 | 3300005289 | Bacteria | 1380 |
| 47 | Ga0065704_10724502 | 3300005289 | Bacteria | 527 |
| 48 | Ga0065712_10077776 | 3300005290 | Bacteria | 3443 |
| 49 | Ga0065715_10463401 | 3300005293 | Bacteria | 813 |
| 50 | Ga0070676_10709116 | 3300005328 | Bacteria | 735 |
| 51 | Ga0070670_100001455 | 3300005331 | Bacteria | 19037 |
| 52 | Ga0070670_100022866 | 3300005331 | Bacteria | 5379 |
| 53 | Ga0070661_100000008 | 3300005344 | Bacteria | 183494 |
| 54 | Ga0070669_100000579 | 3300005353 | Bacteria | 27197 |
| 55 | Ga0070669_100301821 | 3300005353 | Bacteria | 1288 |
| 56 | Ga0070669_100418801 | 3300005353 | Bacteria | 1099 |
| 57 | Ga0070669_100594378 | 3300005353 | Bacteria | 927 |
| 58 | Ga0070659_100630535 | 3300005366 | Bacteria | 923 |
| 59 | Ga0070662_100000388 | 3300005457 | Bacteria | 26210 |
| 60 | Ga0070665_100189991 | 3300005548 | Bacteria | 2055 |
| 61 | Ga0070665_101315365 | 3300005548 | Bacteria | 732 |
| 62 | Ga0070664_100000028 | 3300005564 | Bacteria | 90414 |
| 63 | Ga0068857_101147489 | 3300005577 | Bacteria | 751 |
| 64 | Ga0068854_100025361 | 3300005578 | Bacteria | 4067 |
| 65 | Ga0068851_10000068 | 3300005834 | Bacteria | 58513 |
| 66 | Ga0070717_11548613 | 3300006028 | Bacteria | 601 |
| 67 | Ga0075364_10066979 | 3300006051 | Bacteria | 2360 |
| 68 | Ga0075364_10084878 | 3300006051 | Bacteria | 2097 |
| 69 | Ga0075364_10516479 | 3300006051 | Bacteria | 816 |
| 70 | Ga0075432_10006592 | 3300006058 | Bacteria | 3953 |
| 71 | Ga0075432_10146805 | 3300006058 | Bacteria | 903 |
| 72 | Ga0075432_10403646 | 3300006058 | Bacteria | 590 |
| 73 | Ga0075362_10644463 | 3300006177 | Bacteria | 550 |
| 74 | Ga0075436_100903128 | 3300006914 | Bacteria | 661 |
| 75 | Ga0079104_1000676 | 3300006946 | Bacteria | 31801 |
| 76 | Ga0079104_1003227 | 3300006946 | Bacteria | 7842 |
| 77 | Ga0079104_1086989 | 3300006946 | Bacteria | 637 |
| 78 | Ga0079104_1106266 | 3300006946 | Bacteria | 558 |
| 79 | Ga0105251_10002641 | 3300009011 | Bacteria | 13820 |
| 80 | Ga0105251_10005407 | 3300009011 | Bacteria | 8356 |
| 81 | Ga0105251_10010986 | 3300009011 | Bacteria | 5204 |
| 82 | Ga0105251_10037148 | 3300009011 | Bacteria | 2392 |
| 83 | Ga0105251_10184456 | 3300009011 | Bacteria | 940 |
| 84 | Ga0105251_10203855 | 3300009011 | Bacteria | 891 |
| 85 | Ga0105251_10315213 | 3300009011 | Bacteria | 710 |
| 86 | Ga0105251_10496421 | 3300009011 | Bacteria | 570 |
| 87 | Ga0105244_10002540 | 3300009036 | Bacteria | 13709 |
| 88 | Ga0105244_10004871 | 3300009036 | Bacteria | 9102 |
| 89 | Ga0105244_10005389 | 3300009036 | Bacteria | 8516 |
| 90 | Ga0105244_10026118 | 3300009036 | Bacteria | 3164 |
| 91 | Ga0105244_10056004 | 3300009036 | Bacteria | 1997 |
| 92 | Ga0105244_10065022 | 3300009036 | Bacteria | 1828 |
| 93 | Ga0105244_10108077 | 3300009036 | Bacteria | 1356 |
| 94 | Ga0105244_10210113 | 3300009036 | Bacteria | 916 |
| 95 | Ga0105244_10223117 | 3300009036 | Bacteria | 883 |
| 96 | Ga0105244_10436551 | 3300009036 | Bacteria | 602 |
| 97 | Ga0105250_10000180 | 3300009092 | Bacteria | 54634 |
| 98 | Ga0105250_10003055 | 3300009092 | Bacteria | 8079 |
| 99 | Ga0105250_10013656 | 3300009092 | Bacteria | 3346 |
| 100 | Ga0105250_10078404 | 3300009092 | Bacteria | 1338 |
| 101 | Ga0105250_10179206 | 3300009092 | Bacteria | 889 |
| 102 | Ga0105250_10188621 | 3300009092 | Bacteria | 867 |
| 103 | Ga0105250_10249086 | 3300009092 | Bacteria | 759 |
| 104 | Ga0105243_10000451 | 3300009148 | Bacteria | 42796 |
| 105 | Ga0105243_10001489 | 3300009148 | Bacteria | 20503 |
| 106 | Ga0105243_10605625 | 3300009148 | Bacteria | 1055 |
| 107 | Ga0105243_12854837 | 3300009148 | Bacteria | 524 |
| 108 | Ga0105242_10000024 | 3300009176 | Bacteria | 111115 |
| 109 | Ga0105242_11199979 | 3300009176 | Bacteria | 778 |
| 110 | Ga0105248_10306112 | 3300009177 | Bacteria | 1790 |
| 111 | Ga0105237_10144455 | 3300009545 | Bacteria | 2374 |
| 112 | Ga0105237_10245206 | 3300009545 | Bacteria | 1793 |
| 113 | Ga0105239_11945189 | 3300010375 | Bacteria | 682 |
| 114 | Ga0105246_10001574 | 3300011119 | Bacteria | 13577 |
| 115 | Ga0105246_10003399 | 3300011119 | Bacteria | 9643 |
| 116 | Ga0105246_10344830 | 3300011119 | Bacteria | 1218 |
| 117 | Ga0157345_1000081 | 3300012498 | Bacteria | 20216 |
| 118 | Ga0157347_1011309 | 3300012502 | Bacteria | 947 |
| 119 | Ga0157373_10000593 | 3300013100 | Bacteria | 28147 |
| 120 | Ga0157373_10005230 | 3300013100 | Bacteria | 9742 |
| 121 | Ga0157373_10034426 | 3300013100 | Bacteria | 3638 |
| 122 | Ga0157373_10057732 | 3300013100 | Bacteria | 2752 |
| 123 | Ga0157373_10075043 | 3300013100 | Bacteria | 2386 |
| 124 | Ga0157373_10211115 | 3300013100 | Bacteria | 1369 |
| 125 | Ga0157373_11019802 | 3300013100 | Bacteria | 618 |
| 126 | Ga0157373_11193533 | 3300013100 | Bacteria | 573 |
| 127 | Ga0157373_11435105 | 3300013100 | Bacteria | 525 |
| 128 | Ga0157371_10000583 | 3300013102 | Bacteria | 43268 |
| 129 | Ga0157371_10002025 | 3300013102 | Bacteria | 20017 |
| 130 | Ga0157371_10026343 | 3300013102 | Bacteria | 4229 |
| 131 | Ga0157371_10029477 | 3300013102 | Bacteria | 3968 |
| 132 | Ga0157371_10528442 | 3300013102 | Bacteria | 873 |
| 133 | Ga0157371_11220898 | 3300013102 | Bacteria | 580 |
| 134 | Ga0157370_10025749 | 3300013104 | Bacteria | 5820 |
| 135 | Ga0157370_10034132 | 3300013104 | Bacteria | 4957 |
| 136 | Ga0157370_10116449 | 3300013104 | Bacteria | 2496 |
| 137 | Ga0157370_10122454 | 3300013104 | Bacteria | 2428 |
| 138 | Ga0157370_10139652 | 3300013104 | Bacteria | 2257 |
| 139 | Ga0157370_10233128 | 3300013104 | Bacteria | 1703 |
| 140 | Ga0157370_10640182 | 3300013104 | Bacteria | 972 |
| 141 | Ga0157370_11699099 | 3300013104 | Bacteria | 567 |
| 142 | Ga0157370_11763240 | 3300013104 | Bacteria | 556 |
| 143 | Ga0157370_11998981 | 3300013104 | Bacteria | 520 |
| 144 | Ga0157369_10007489 | 3300013105 | Bacteria | 12564 |
| 145 | Ga0157369_10026040 | 3300013105 | Bacteria | 6491 |
| 146 | Ga0157369_10124067 | 3300013105 | Bacteria | 2739 |
| 147 | Ga0157369_10162310 | 3300013105 | Bacteria | 2358 |
| 148 | Ga0157369_10237276 | 3300013105 | Bacteria | 1905 |
| 149 | Ga0157369_10306275 | 3300013105 | Bacteria | 1652 |
| 150 | Ga0157369_10546892 | 3300013105 | Bacteria | 1197 |
| 151 | Ga0163162_10000649 | 3300013306 | Bacteria | 32160 |
| 152 | Ga0163162_10033464 | 3300013306 | Bacteria | 5109 |
| 153 | Ga0163162_10083369 | 3300013306 | Bacteria | 3271 |
| 154 | Ga0157372_10003301 | 3300013307 | Bacteria | 17426 |
| 155 | Ga0157375_10002948 | 3300013308 | Bacteria | 14762 |
| 156 | Ga0157375_10011410 | 3300013308 | Bacteria | 7843 |
| 157 | Ga0157375_10401634 | 3300013308 | Bacteria | 1537 |
| 158 | Ga0157375_10496052 | 3300013308 | Bacteria | 1385 |
| 159 | Ga0157375_10894683 | 3300013308 | Bacteria | 1032 |
| 160 | Ga0182008_10002558 | 3300014497 | Bacteria | 11328 |
| 161 | Ga0182008_10003740 | 3300014497 | Bacteria | 9065 |
| 162 | Ga0182008_10009051 | 3300014497 | Bacteria | 5392 |
| 163 | Ga0182008_10032174 | 3300014497 | Bacteria | 2636 |
| 164 | Ga0182006_1000750 | 3300015261 | Bacteria | 22221 |
| 165 | Ga0182006_1000997 | 3300015261 | Bacteria | 18524 |
| 166 | Ga0182006_1010943 | 3300015261 | Bacteria | 4012 |
| 167 | Ga0182006_1015982 | 3300015261 | Bacteria | 3207 |
| 168 | Ga0182006_1121783 | 3300015261 | Bacteria | 905 |
| 169 | Ga0182006_1142881 | 3300015261 | Bacteria | 816 |
| 170 | Ga0182007_10000143 | 3300015262 | Bacteria | 47807 |
| 171 | Ga0182007_10028714 | 3300015262 | Bacteria | 1909 |
| 172 | Ga0182007_10180095 | 3300015262 | Bacteria | 730 |
| 173 | Ga0182007_10182958 | 3300015262 | Bacteria | 725 |
| 174 | Ga0182007_10281916 | 3300015262 | Bacteria | 605 |
| 175 | Ga0182005_1000800 | 3300015265 | Bacteria | 14334 |
| 176 | Ga0182005_1034772 | 3300015265 | Bacteria | 1370 |
| 177 | Ga0182005_1056902 | 3300015265 | Bacteria | 1066 |
| 178 | Ga0182005_1109253 | 3300015265 | Bacteria | 780 |
| 179 | Ga0163161_10003088 | 3300017792 | Bacteria | 11754 |
| 180 | Ga0163161_10004501 | 3300017792 | Bacteria | 9698 |
| 181 | Ga0163161_10012220 | 3300017792 | Bacteria | 5955 |
| 182 | Ga0163161_10054830 | 3300017792 | Bacteria | 2894 |
| 183 | Ga0163161_11107236 | 3300017792 | Bacteria | 681 |
| 184 | Ga0163161_11654599 | 3300017792 | Bacteria | 566 |
| 185 | Ga0209435_110293 | 3300025206 | Bacteria | 1012 |
| 186 | Ga0209760_100039 | 3300025207 | Bacteria | 118977 |
| 187 | Ga0209760_100052 | 3300025207 | Bacteria | 103453 |
| 188 | Ga0209784_100017 | 3300025224 | Bacteria | 472003 |
| 189 | Ga0209566_100014 | 3300025225 | Bacteria | 472003 |
| 190 | Ga0209674_100028 | 3300025226 | Bacteria | 472003 |
| 191 | Ga0209147_100038 | 3300025229 | Bacteria | 314497 |
| 192 | Ga0209563_100032 | 3300025230 | Bacteria | 472003 |
| 193 | Ga0209563_100193 | 3300025230 | Bacteria | 33884 |
| 194 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 195 | Ga0207427_100029 | 3300025231 | Bacteria | 376678 |
| 196 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 197 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 198 | Ga0209258_100197 | 3300025242 | Bacteria | 124028 |
| 199 | Ga0209646_1000711 | 3300025246 | Bacteria | 11903 |
| 200 | Ga0209677_100018 | 3300025253 | Bacteria | 472003 |
| 201 | Ga0209759_1005073 | 3300025256 | Bacteria | 4715 |
| 202 | Ga0209759_1022298 | 3300025256 | Bacteria | 1419 |
| 203 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 204 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 205 | Ga0209675_1005911 | 3300025291 | Bacteria | 5020 |
| 206 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 207 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 208 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 209 | Ga0209676_1002055 | 3300025292 | Bacteria | 15733 |
| 210 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 211 | Ga0209050_1000036 | 3300025298 | Bacteria | 423070 |
| 212 | Ga0209050_1000107 | 3300025298 | Bacteria | 223303 |
| 213 | Ga0209051_1000043 | 3300025303 | Bacteria | 305473 |
| 214 | Ga0209051_1000053 | 3300025303 | Bacteria | 281564 |
| 215 | Ga0209051_1000090 | 3300025303 | Bacteria | 173748 |
| 216 | Ga0209257_1000098 | 3300025304 | Bacteria | 256390 |
| 217 | Ga0209257_1010396 | 3300025304 | Bacteria | 4718 |
| 218 | Ga0209257_1044277 | 3300025304 | Bacteria | 1300 |
| 219 | Ga0207656_10000089 | 3300025321 | Bacteria | 33748 |
| 220 | Ga0207696_1000043 | 3300025711 | Bacteria | 307112 |
| 221 | Ga0207696_1000158 | 3300025711 | Bacteria | 112178 |
| 222 | Ga0207696_1001093 | 3300025711 | Bacteria | 15931 |
| 223 | Ga0207696_1015471 | 3300025711 | Bacteria | 2586 |
| 224 | Ga0207696_1031373 | 3300025711 | Bacteria | 1608 |
| 225 | Ga0207696_1099842 | 3300025711 | Bacteria | 791 |
| 226 | Ga0207655_1000095 | 3300025728 | Bacteria | 195899 |
| 227 | Ga0207655_1001318 | 3300025728 | Bacteria | 23425 |
| 228 | Ga0207655_1002702 | 3300025728 | Bacteria | 13908 |
| 229 | Ga0207655_1002953 | 3300025728 | Bacteria | 13065 |
| 230 | Ga0207655_1008609 | 3300025728 | Bacteria | 6451 |
| 231 | Ga0207655_1010781 | 3300025728 | Bacteria | 5512 |
| 232 | Ga0207655_1018148 | 3300025728 | Bacteria | 3751 |
| 233 | Ga0207655_1049631 | 3300025728 | Bacteria | 1712 |
| 234 | Ga0207655_1076360 | 3300025728 | Bacteria | 1225 |
| 235 | Ga0207713_1001420 | 3300025735 | Bacteria | 19190 |
| 236 | Ga0207713_1003434 | 3300025735 | Bacteria | 10808 |
| 237 | Ga0207713_1003857 | 3300025735 | Bacteria | 10007 |
| 238 | Ga0207713_1005710 | 3300025735 | Bacteria | 7722 |
| 239 | Ga0207713_1009834 | 3300025735 | Bacteria | 5353 |
| 240 | Ga0207713_1013374 | 3300025735 | Bacteria | 4329 |
| 241 | Ga0207713_1053355 | 3300025735 | Bacteria | 1593 |
| 242 | Ga0207713_1218481 | 3300025735 | Bacteria | 576 |
| 243 | Ga0207645_11081834 | 3300025907 | Bacteria | 541 |
| 244 | Ga0207671_10000035 | 3300025914 | Bacteria | 237603 |
| 245 | Ga0207649_10000017 | 3300025920 | Bacteria | 225193 |
| 246 | Ga0207681_10000835 | 3300025923 | Bacteria | 20332 |
| 247 | Ga0207681_10027375 | 3300025923 | Bacteria | 3685 |
| 248 | Ga0207681_10226781 | 3300025923 | Bacteria | 1448 |
| 249 | Ga0207650_10000212 | 3300025925 | Bacteria | 66326 |
| 250 | Ga0207650_10001330 | 3300025925 | Bacteria | 17884 |
| 251 | Ga0207690_11098812 | 3300025932 | Bacteria | 663 |
| 252 | Ga0207706_10000170 | 3300025933 | Bacteria | 72208 |
| 253 | Ga0207706_10104110 | 3300025933 | Bacteria | 2497 |
| 254 | Ga0207686_10037438 | 3300025934 | Bacteria | 2927 |
| 255 | Ga0207709_10000036 | 3300025935 | Bacteria | 292568 |
| 256 | Ga0207709_10000350 | 3300025935 | Bacteria | 47371 |
| 257 | Ga0207711_10219890 | 3300025941 | Bacteria | 1737 |
| 258 | Ga0207679_10000005 | 3300025945 | Bacteria | 525011 |
| 259 | Ga0207679_10112075 | 3300025945 | Bacteria | 2155 |
| 260 | Ga0207640_10032869 | 3300025981 | Bacteria | 3221 |
| 261 | Ga0207674_11685104 | 3300026116 | Bacteria | 602 |
| 262 | Ga0209281_1000172 | 3300027111 | Bacteria | 151766 |
| 263 | Ga0209281_1002499 | 3300027111 | Bacteria | 7265 |
| 264 | Ga0209281_1008985 | 3300027111 | Bacteria | 2377 |
| 265 | Ga0209281_1009557 | 3300027111 | Bacteria | 2270 |
| 266 | Ga0209281_1059341 | 3300027111 | Bacteria | 588 |
| 267 | Ga0207428_10052129 | 3300027907 | Bacteria | 3269 |
| 268 | Ga0207428_10379095 | 3300027907 | Bacteria | 1038 |
| 269 | Ga0268266_10041099 | 3300028379 | Bacteria | 3944 |
| 270 | Ga0268266_12041360 | 3300028379 | Bacteria | 546 |
| 271 | Ga0307517_10152648 | 3300028786 | Bacteria | 1579 |
| 272 | Ga0307517_10380240 | 3300028786 | Bacteria | 755 |
| 273 | Ga0307511_10338628 | 3300030521 | Bacteria | 654 |
| 274 | Ga0307511_10355633 | 3300030521 | Bacteria | 627 |
| 275 | Ga0316178_1161793 | 3300030735 | Bacteria | 38251 |
| 276 | Ga0316181_1076629 | 3300030744 | Bacteria | 1379 |
| 277 | Ga0265316_10130885 | 3300031344 | Bacteria | 1890 |
| 278 | Ga0307509_10058296 | 3300031507 | Bacteria | 4090 |
| 279 | Ga0307408_100003851 | 3300031548 | Bacteria | 10205 |
| 280 | Ga0307408_100052108 | 3300031548 | Bacteria | 2950 |
| 281 | Ga0307408_100168745 | 3300031548 | Bacteria | 1745 |
| 282 | Ga0307516_10194640 | 3300031730 | Bacteria | 1751 |
| 283 | Ga0307516_10207335 | 3300031730 | Bacteria | 1676 |
| 284 | Ga0307405_10000148 | 3300031731 | Bacteria | 26698 |
| 285 | Ga0307406_10590351 | 3300031901 | Bacteria | 914 |
| 286 | Ga0307407_10110702 | 3300031903 | Bacteria | 1723 |
| 287 | Ga0307407_10248612 | 3300031903 | Bacteria | 1217 |
| 288 | Ga0307412_10092885 | 3300031911 | Bacteria | 2115 |
| 289 | Ga0307412_10530125 | 3300031911 | Bacteria | 985 |
| 290 | Ga0307412_10555070 | 3300031911 | Bacteria | 965 |
| 291 | Ga0307412_10799667 | 3300031911 | Bacteria | 818 |
| 292 | Ga0307416_100724355 | 3300032002 | Bacteria | 1085 |
| 293 | Ga0307416_101574603 | 3300032002 | Bacteria | 762 |
| 294 | Ga0307414_10152903 | 3300032004 | Bacteria | 1823 |
| 295 | Ga0307414_10477821 | 3300032004 | Bacteria | 1098 |
| 296 | Ga0307414_10696333 | 3300032004 | Bacteria | 919 |
| 297 | Ga0307411_10073133 | 3300032005 | Bacteria | 2330 |
| 298 | Ga0307411_11568955 | 3300032005 | Bacteria | 607 |
| 299 | Ga0237819_04361 | 3300038705 | Bacteria | 2337 |
| 300 | Ga0439438_001947 | 3300041405 | Bacteria | 9014 |
| 301 | Ga0439438_013399 | 3300041405 | Bacteria | 2475 |
| 302 | Ga0439438_108813 | 3300041405 | Bacteria | 669 |
| 303 | Ga0439438_133340 | 3300041405 | Bacteria | 595 |
| 304 | Ga0439438_176169 | 3300041405 | Bacteria | 508 |
| 305 | Ga0439447_001682 | 3300041407 | Bacteria | 8121 |
| 306 | Ga0439447_018880 | 3300041407 | Bacteria | 1849 |
| 307 | Ga0439447_026416 | 3300041407 | Bacteria | 1489 |
| 308 | Ga0439447_029934 | 3300041407 | Bacteria | 1375 |
| 309 | Ga0439447_059499 | 3300041407 | Bacteria | 900 |
| 310 | Ga0439466_0000210 | 3300041411 | Bacteria | 23037 |
| 311 | Ga0439466_0004698 | 3300041411 | Bacteria | 5248 |
| 312 | Ga0439466_0033490 | 3300041411 | Bacteria | 1745 |
| 313 | Ga0439466_0038598 | 3300041411 | Bacteria | 1603 |
| 314 | Ga0439466_0044783 | 3300041411 | Bacteria | 1465 |
| 315 | Ga0439465_0006255 | 3300041413 | Bacteria | 3783 |
| 316 | Ga0451841_0215041 | 3300041498 | Bacteria | 757 |
| 317 | Ga0451841_0896663 | 3300041498 | Bacteria | 996 |
| 318 | Ga0451843_0380463 | 3300041509 | Bacteria | 512 |
| 319 | Ga0439431_0000893 | 3300041997 | Bacteria | 6451 |
| 320 | Ga0439445_0067994 | 3300042004 | Bacteria | 982 |
| 321 | Ga0439445_0143953 | 3300042004 | Bacteria | 692 |
| 322 | Ga0439445_0220782 | 3300042004 | Bacteria | 562 |
| 323 | Ga0439432_003985 | 3300042006 | Bacteria | 5424 |
| 324 | Ga0439432_004679 | 3300042006 | Bacteria | 4986 |
| 325 | Ga0439432_009861 | 3300042006 | Bacteria | 3322 |
| 326 | Ga0439451_000899 | 3300042009 | Bacteria | 5708 |
| 327 | Ga0439451_002691 | 3300042009 | Bacteria | 3605 |
| 328 | Ga0439451_005962 | 3300042009 | Bacteria | 2488 |
| 329 | Ga0439451_015645 | 3300042009 | Bacteria | 1530 |
| 330 | Ga0439451_041973 | 3300042009 | Bacteria | 917 |
| 331 | Ga0439451_046382 | 3300042009 | Bacteria | 870 |
| 332 | Ga0439451_051511 | 3300042009 | Bacteria | 824 |
| 333 | Ga0439451_058159 | 3300042009 | Bacteria | 773 |
| 334 | Ga0439452_019397 | 3300042010 | Bacteria | 1798 |
| 335 | Ga0439452_025198 | 3300042010 | Bacteria | 1512 |
| 336 | Ga0439452_025626 | 3300042010 | Bacteria | 1495 |
| 337 | Ga0439452_126262 | 3300042010 | Bacteria | 543 |
| 338 | Ga0439456_001820 | 3300042013 | Bacteria | 4303 |
| 339 | Ga0439456_012542 | 3300042013 | Bacteria | 1757 |
| 340 | Ga0439456_069164 | 3300042013 | Bacteria | 781 |
| 341 | Ga0439456_099842 | 3300042013 | Bacteria | 656 |
| 342 | Ga0439456_124594 | 3300042013 | Bacteria | 592 |
| 343 | Ga0439463_021112 | 3300042016 | Bacteria | 1625 |
| 344 | Ga0439463_055798 | 3300042016 | Bacteria | 1008 |
| 345 | Ga0450911_005477 | 3300042115 | Bacteria | 1967 |
| 346 | Ga0450912_007723 | 3300042116 | Bacteria | 879 |
| 347 | Ga0450919_002405 | 3300042121 | Bacteria | 2424 |
| 348 | Ga0450922_007365 | 3300042124 | Bacteria | 1032 |
| 349 | Ga0450890_000610 | 3300042127 | Bacteria | 5227 |
| 350 | Ga0450892_011333 | 3300042130 | Bacteria | 790 |
| 351 | Ga0450900_068521 | 3300042136 | Bacteria | 561 |
| 352 | Ga0450902_015108 | 3300042137 | Bacteria | 1251 |
| 353 | Ga0450903_001584 | 3300042138 | Bacteria | 4228 |
| 354 | Ga0450904_008178 | 3300042139 | Bacteria | 1033 |
| 355 | Ga0450904_016455 | 3300042139 | Bacteria | 740 |
| 356 | Ga0450905_003100 | 3300042142 | Bacteria | 2171 |
| 357 | Ga0450906_007238 | 3300042145 | Bacteria | 2199 |
| 358 | Ga0450907_001013 | 3300042146 | Bacteria | 6586 |
| 359 | Ga0450907_010936 | 3300042146 | Bacteria | 1508 |
| 360 | Ga0450910_000904 | 3300042147 | Bacteria | 3581 |
| 361 | Ga0450910_015437 | 3300042147 | Bacteria | 1124 |
| 362 | Ga0439446_0018280 | 3300042156 | Bacteria | 1962 |
| 363 | Ga0450908_006686 | 3300042184 | Bacteria | 2182 |
| 364 | Ga0450909_003084 | 3300042185 | Bacteria | 2367 |
| 365 | Ga0439434_0085923 | 3300042435 | Bacteria | 1002 |
| 366 | Ga0439460_0015510 | 3300042461 | Bacteria | 2018 |
| 367 | Ga0439460_0145693 | 3300042461 | Bacteria | 788 |
| 368 | Ga0450893_0006743 | 3300042532 | Bacteria | 1860 |
| 369 | Ga0450893_0009120 | 3300042532 | Bacteria | 1620 |
| 370 | Ga0450893_0013634 | 3300042532 | Bacteria | 1357 |
| 371 | Ga0439440_0008787 | 3300042993 | Bacteria | 2079 |
| 372 | Ga0439440_0021555 | 3300042993 | Bacteria | 1453 |
| 373 | Ga0495617_000327 | 3300046452 | Bacteria | 26705 |
| 374 | Ga0495617_010431 | 3300046452 | Bacteria | 3182 |
| 375 | Ga0495617_019467 | 3300046452 | Bacteria | 2295 |
| 376 | Ga0495617_020302 | 3300046452 | Bacteria | 2245 |
| 377 | Ga0495617_020933 | 3300046452 | Bacteria | 2210 |
| 378 | Ga0495617_058620 | 3300046452 | Bacteria | 1276 |
| 379 | Ga0495617_063705 | 3300046452 | Bacteria | 1217 |
| 380 | Ga0495617_079901 | 3300046452 | Bacteria | 1071 |
| 381 | Ga0495617_122471 | 3300046452 | Bacteria | 837 |
| 382 | Ga0495627_001088 | 3300046453 | Bacteria | 17809 |
| 383 | Ga0495627_004254 | 3300046453 | Bacteria | 6043 |
| 384 | Ga0495627_020332 | 3300046453 | Bacteria | 2213 |
| 385 | Ga0495627_026027 | 3300046453 | Bacteria | 1891 |
| 386 | Ga0495592_0104335 | 3300046454 | Bacteria | 2015 |
| 387 | Ga0495603_0321448 | 3300046455 | Bacteria | 888 |
| 388 | Ga0495603_0717352 | 3300046455 | Bacteria | 571 |
| 389 | Ga0495590_0032831 | 3300046457 | Bacteria | 1815 |
| 390 | Ga0495590_0034403 | 3300046457 | Bacteria | 1769 |
| 391 | Ga0495590_0044000 | 3300046457 | Bacteria | 1557 |
| 392 | Ga0495590_0044874 | 3300046457 | Bacteria | 1541 |
| 393 | Ga0495591_005439 | 3300046458 | Bacteria | 5902 |
| 394 | Ga0495591_012253 | 3300046458 | Bacteria | 3203 |
| 395 | Ga0495591_014139 | 3300046458 | Bacteria | 2883 |
| 396 | Ga0495591_014821 | 3300046458 | Bacteria | 2781 |
| 397 | Ga0495591_021071 | 3300046458 | Bacteria | 2137 |
| 398 | Ga0495591_021448 | 3300046458 | Bacteria | 2107 |
| 399 | Ga0495591_029685 | 3300046458 | Bacteria | 1658 |
| 400 | Ga0495591_033078 | 3300046458 | Bacteria | 1533 |
| 401 | Ga0495591_068473 | 3300046458 | Bacteria | 927 |
| 402 | Ga0495638_0014931 | 3300046460 | Bacteria | 5230 |
| 403 | Ga0495638_0063478 | 3300046460 | Bacteria | 2277 |
| 404 | Ga0495638_0186002 | 3300046460 | Bacteria | 1181 |
| 405 | Ga0495638_0254095 | 3300046460 | Bacteria | 967 |
| 406 | Ga0495653_0006548 | 3300046463 | Bacteria | 9555 |
| 407 | Ga0495653_0019975 | 3300046463 | Bacteria | 5429 |
| 408 | Ga0495653_0143755 | 3300046463 | Bacteria | 1674 |
| 409 | Ga0495650_0038016 | 3300046471 | Bacteria | 2088 |
| 410 | Ga0495650_0043624 | 3300046471 | Bacteria | 1901 |
| 411 | Ga0495650_0043909 | 3300046471 | Bacteria | 1892 |
| 412 | Ga0495650_0141147 | 3300046471 | Bacteria | 871 |
| 413 | Ga0495650_0287459 | 3300046471 | Bacteria | 552 |
| 414 | Ga0495580_0249009 | 3300046472 | Bacteria | 1217 |
| 415 | Ga0495605_0001320 | 3300046474 | Bacteria | 16426 |
| 416 | Ga0495605_0016458 | 3300046474 | Bacteria | 4002 |
| 417 | Ga0495605_0039196 | 3300046474 | Bacteria | 2374 |
| 418 | Ga0495605_0050225 | 3300046474 | Bacteria | 2035 |
| 419 | Ga0495605_0050933 | 3300046474 | Bacteria | 2018 |
| 420 | Ga0495605_0059732 | 3300046474 | Bacteria | 1830 |
| 421 | Ga0495605_0069676 | 3300046474 | Bacteria | 1665 |
| 422 | Ga0495605_0094212 | 3300046474 | Bacteria | 1383 |
| 423 | Ga0495639_0000714 | 3300046475 | Bacteria | 15193 |
| 424 | Ga0495639_0328600 | 3300046475 | Bacteria | 765 |
| 425 | Ga0495584_0001356 | 3300046491 | Bacteria | 14814 |
| 426 | Ga0495584_0003392 | 3300046491 | Bacteria | 8787 |
| 427 | Ga0495584_0036104 | 3300046491 | Bacteria | 2496 |
| 428 | Ga0495584_0041130 | 3300046491 | Bacteria | 2334 |
| 429 | Ga0495584_0087031 | 3300046491 | Bacteria | 1574 |
| 430 | Ga0495584_0091666 | 3300046491 | Bacteria | 1532 |
| 431 | Ga0495584_0173416 | 3300046491 | Bacteria | 1096 |
| 432 | Ga0495584_0643750 | 3300046491 | Bacteria | 540 |
| 433 | Ga0495585_0010554 | 3300046492 | Bacteria | 5495 |
| 434 | Ga0495585_0052421 | 3300046492 | Bacteria | 2258 |
| 435 | Ga0495585_0053613 | 3300046492 | Bacteria | 2231 |
| 436 | Ga0495585_0064713 | 3300046492 | Bacteria | 2004 |
| 437 | Ga0495585_0287265 | 3300046492 | Bacteria | 811 |
| 438 | Ga0495585_0479708 | 3300046492 | Bacteria | 592 |
| 439 | Ga0495585_0504896 | 3300046492 | Bacteria | 574 |
| 440 | Ga0495594_0085319 | 3300046499 | Bacteria | 1766 |
| 441 | Ga0495594_0517572 | 3300046499 | Bacteria | 677 |
| 442 | Ga0495596_0024462 | 3300046500 | Bacteria | 2443 |
| 443 | Ga0495596_0408276 | 3300046500 | Bacteria | 529 |
| 444 | Ga0495596_0446655 | 3300046500 | Bacteria | 504 |
| 445 | Ga0495607_0000655 | 3300046501 | Bacteria | 33607 |
| 446 | Ga0495607_0001755 | 3300046501 | Bacteria | 18554 |
| 447 | Ga0495607_0004203 | 3300046501 | Bacteria | 10684 |
| 448 | Ga0495607_0009299 | 3300046501 | Bacteria | 6661 |
| 449 | Ga0495607_0014936 | 3300046501 | Bacteria | 5048 |
| 450 | Ga0495607_0020561 | 3300046501 | Bacteria | 4170 |
| 451 | Ga0495607_0044527 | 3300046501 | Bacteria | 2616 |
| 452 | Ga0495607_0075018 | 3300046501 | Bacteria | 1875 |
| 453 | Ga0495607_0106195 | 3300046501 | Bacteria | 1495 |
| 454 | Ga0495607_0151363 | 3300046501 | Bacteria | 1187 |
| 455 | Ga0495607_0199120 | 3300046501 | Bacteria | 992 |
| 456 | Ga0495607_0312059 | 3300046501 | Bacteria | 736 |
| 457 | Ga0495607_0317932 | 3300046501 | Bacteria | 727 |
| 458 | Ga0495583_0001561 | 3300046506 | Bacteria | 22653 |
| 459 | Ga0495583_0054763 | 3300046506 | Bacteria | 1804 |
| 460 | Ga0495583_0108766 | 3300046506 | Bacteria | 1176 |
| 461 | Ga0495606_0003868 | 3300046507 | Bacteria | 15455 |
| 462 | Ga0495606_0067682 | 3300046507 | Bacteria | 2260 |
| 463 | Ga0495606_0075214 | 3300046507 | Bacteria | 2113 |
| 464 | Ga0495606_0078217 | 3300046507 | Bacteria | 2063 |
| 465 | Ga0495606_0081816 | 3300046507 | Bacteria | 2006 |
| 466 | Ga0495606_0083878 | 3300046507 | Bacteria | 1974 |
| 467 | Ga0495606_0190858 | 3300046507 | Bacteria | 1174 |
| 468 | Ga0495606_0296678 | 3300046507 | Bacteria | 877 |
| 469 | Ga0495606_0511393 | 3300046507 | Bacteria | 604 |
| 470 | Ga0495610_0001544 | 3300046512 | Bacteria | 20283 |
| 471 | Ga0495610_0004742 | 3300046512 | Bacteria | 9921 |
| 472 | Ga0495610_0009200 | 3300046512 | Bacteria | 6270 |
| 473 | Ga0495610_0022244 | 3300046512 | Bacteria | 3472 |
| 474 | Ga0495610_0026446 | 3300046512 | Bacteria | 3097 |
| 475 | Ga0495610_0032277 | 3300046512 | Bacteria | 2722 |
| 476 | Ga0495610_0047577 | 3300046512 | Bacteria | 2109 |
| 477 | Ga0495610_0083075 | 3300046512 | Bacteria | 1466 |
| 478 | Ga0495610_0117289 | 3300046512 | Bacteria | 1171 |
| 479 | Ga0495610_0148770 | 3300046512 | Bacteria | 1001 |
| 480 | Ga0495610_0213867 | 3300046512 | Bacteria | 782 |
| 481 | Ga0495610_0277251 | 3300046512 | Bacteria | 654 |
| 482 | Ga0495616_0029743 | 3300046513 | Bacteria | 2880 |
| 483 | Ga0495616_0042041 | 3300046513 | Bacteria | 2328 |
| 484 | Ga0495616_0043788 | 3300046513 | Bacteria | 2272 |
| 485 | Ga0495616_0051681 | 3300046513 | Bacteria | 2048 |
| 486 | Ga0495616_0057902 | 3300046513 | Bacteria | 1909 |
| 487 | Ga0495616_0156734 | 3300046513 | Bacteria | 1026 |
| 488 | Ga0495620_0004800 | 3300046515 | Bacteria | 7595 |
| 489 | Ga0495620_0004858 | 3300046515 | Bacteria | 7538 |
| 490 | Ga0495620_0013240 | 3300046515 | Bacteria | 4229 |
| 491 | Ga0495620_0037976 | 3300046515 | Bacteria | 2140 |
| 492 | Ga0495620_0041416 | 3300046515 | Bacteria | 2020 |
| 493 | Ga0495620_0059262 | 3300046515 | Bacteria | 1600 |
| 494 | Ga0495620_0134352 | 3300046515 | Bacteria | 969 |
| 495 | Ga0495628_0102425 | 3300046516 | Bacteria | 2209 |
| 496 | Ga0495630_0265401 | 3300046517 | Bacteria | 1311 |
| 497 | Ga0495631_0001232 | 3300046518 | Bacteria | 15789 |
| 498 | Ga0495631_0039064 | 3300046518 | Bacteria | 2107 |
| 499 | Ga0495631_0084338 | 3300046518 | Bacteria | 1369 |
| 500 | Ga0495631_0239117 | 3300046518 | Bacteria | 774 |
| 501 | Ga0495631_0239911 | 3300046518 | Bacteria | 773 |
| 502 | Ga0495631_0348172 | 3300046518 | Bacteria | 630 |
| 503 | Ga0495632_0002507 | 3300046519 | Bacteria | 13918 |
| 504 | Ga0495632_0002719 | 3300046519 | Bacteria | 13140 |
| 505 | Ga0495632_0011305 | 3300046519 | Bacteria | 5215 |
| 506 | Ga0495632_0051933 | 3300046519 | Bacteria | 2016 |
| 507 | Ga0495632_0064247 | 3300046519 | Bacteria | 1775 |
| 508 | Ga0495632_0237552 | 3300046519 | Bacteria | 820 |
| 509 | Ga0495632_0400428 | 3300046519 | Bacteria | 599 |
| 510 | Ga0495637_0000187 | 3300046520 | Bacteria | 48520 |
| 511 | Ga0495637_0010404 | 3300046520 | Bacteria | 4501 |
| 512 | Ga0495637_0020327 | 3300046520 | Bacteria | 3056 |
| 513 | Ga0495637_0047575 | 3300046520 | Bacteria | 1809 |
| 514 | Ga0495637_0048558 | 3300046520 | Bacteria | 1786 |
| 515 | Ga0495637_0049009 | 3300046520 | Bacteria | 1776 |
| 516 | Ga0495637_0177451 | 3300046520 | Bacteria | 791 |
| 517 | Ga0495637_0280555 | 3300046520 | Bacteria | 594 |
| 518 | Ga0495643_0048404 | 3300046522 | Bacteria | 2298 |
| 519 | Ga0495643_0064810 | 3300046522 | Bacteria | 1929 |
| 520 | Ga0495643_0073847 | 3300046522 | Bacteria | 1786 |
| 521 | Ga0495643_0078686 | 3300046522 | Bacteria | 1720 |
| 522 | Ga0495643_0131300 | 3300046522 | Bacteria | 1257 |
| 523 | Ga0495644_0038575 | 3300046523 | Bacteria | 1801 |
| 524 | Ga0495644_0064015 | 3300046523 | Bacteria | 1382 |
| 525 | Ga0495644_0079041 | 3300046523 | Bacteria | 1239 |
| 526 | Ga0495648_0046293 | 3300046524 | Bacteria | 2697 |
| 527 | Ga0495648_0050430 | 3300046524 | Bacteria | 2542 |
| 528 | Ga0495648_0054086 | 3300046524 | Bacteria | 2427 |
| 529 | Ga0495648_0058470 | 3300046524 | Bacteria | 2305 |
| 530 | Ga0495648_0074960 | 3300046524 | Bacteria | 1947 |
| 531 | Ga0495648_0079298 | 3300046524 | Bacteria | 1874 |
| 532 | Ga0495648_0136790 | 3300046524 | Bacteria | 1294 |
| 533 | Ga0495648_0149432 | 3300046524 | Bacteria | 1220 |
| 534 | Ga0495648_0203652 | 3300046524 | Bacteria | 988 |
| 535 | Ga0495666_0019502 | 3300046526 | Bacteria | 3364 |
| 536 | Ga0495666_0079701 | 3300046526 | Bacteria | 1550 |
| 537 | Ga0495642_0031860 | 3300046528 | Bacteria | 2114 |
| 538 | Ga0495654_0000870 | 3300046530 | Bacteria | 22703 |
| 539 | Ga0495654_0009384 | 3300046530 | Bacteria | 5363 |
| 540 | Ga0495654_0010391 | 3300046530 | Bacteria | 5066 |
| 541 | Ga0495654_0018271 | 3300046530 | Bacteria | 3677 |
| 542 | Ga0495654_0027452 | 3300046530 | Bacteria | 2919 |
| 543 | Ga0495654_0027896 | 3300046530 | Bacteria | 2889 |
| 544 | Ga0495654_0031821 | 3300046530 | Bacteria | 2676 |
| 545 | Ga0495654_0036713 | 3300046530 | Bacteria | 2461 |
| 546 | Ga0495654_0079991 | 3300046530 | Bacteria | 1534 |
| 547 | Ga0495654_0106309 | 3300046530 | Bacteria | 1285 |
| 548 | Ga0495654_0141567 | 3300046530 | Bacteria | 1071 |
| 549 | Ga0495654_0175149 | 3300046530 | Bacteria | 932 |
| 550 | Ga0495654_0180117 | 3300046530 | Bacteria | 915 |
| 551 | Ga0495654_0297653 | 3300046530 | Bacteria | 659 |
| 552 | Ga0495587_0018188 | 3300046536 | Bacteria | 4358 |
| 553 | Ga0495587_0324178 | 3300046536 | Bacteria | 860 |
| 554 | Ga0495609_0005792 | 3300046538 | Bacteria | 6417 |
| 555 | Ga0495609_0007937 | 3300046538 | Bacteria | 5245 |
| 556 | Ga0495609_0015538 | 3300046538 | Bacteria | 3562 |
| 557 | Ga0495609_0043026 | 3300046538 | Bacteria | 2028 |
| 558 | Ga0495609_0056997 | 3300046538 | Bacteria | 1730 |
| 559 | Ga0495609_0063818 | 3300046538 | Bacteria | 1625 |
| 560 | Ga0495609_0219607 | 3300046538 | Bacteria | 789 |
| 561 | Ga0495597_0043614 | 3300046542 | Bacteria | 1996 |
| 562 | Ga0495597_0082283 | 3300046542 | Bacteria | 1375 |
| 563 | Ga0495597_0206888 | 3300046542 | Bacteria | 784 |
| 564 | Ga0495597_0229701 | 3300046542 | Bacteria | 734 |
| 565 | Ga0495622_0002066 | 3300046557 | Bacteria | 9810 |
| 566 | Ga0495622_0014065 | 3300046557 | Bacteria | 3713 |
| 567 | Ga0495622_0046259 | 3300046557 | Bacteria | 2021 |
| 568 | Ga0495622_0445457 | 3300046557 | Bacteria | 555 |
| 569 | Ga0495633_0015447 | 3300046558 | Bacteria | 3960 |
| 570 | Ga0495633_0049604 | 3300046558 | Bacteria | 1980 |
| 571 | Ga0495633_0159357 | 3300046558 | Bacteria | 1041 |
| 572 | Ga0495633_0389707 | 3300046558 | Bacteria | 630 |
| 573 | Ga0495656_0152179 | 3300046615 | Bacteria | 1118 |
| 574 | Ga0495656_0715316 | 3300046615 | Bacteria | 539 |
| 575 | Ga0495668_0039708 | 3300046616 | Bacteria | 2627 |
| 576 | Ga0495668_0094609 | 3300046616 | Bacteria | 1635 |
| 577 | Ga0495668_0127672 | 3300046616 | Bacteria | 1392 |
| 578 | Ga0495634_0012245 | 3300046642 | Bacteria | 6217 |
| 579 | Ga0495634_0065442 | 3300046642 | Bacteria | 2409 |
| 580 | Ga0495611_0000770 | 3300046648 | Bacteria | 17962 |
| 581 | Ga0495611_0025189 | 3300046648 | Bacteria | 2591 |
| 582 | Ga0495611_0060264 | 3300046648 | Bacteria | 1724 |
| 583 | Ga0495611_0078271 | 3300046648 | Bacteria | 1517 |
| 584 | Ga0495625_0031997 | 3300046660 | Bacteria | 3907 |
| 585 | Ga0495625_0045921 | 3300046660 | Bacteria | 3154 |
| 586 | Ga0495625_0063823 | 3300046660 | Bacteria | 2600 |
| 587 | Ga0495625_0154226 | 3300046660 | Bacteria | 1542 |
| 588 | Ga0495625_0155893 | 3300046660 | Bacteria | 1532 |
| 589 | Ga0495625_0195570 | 3300046660 | Bacteria | 1337 |
| 590 | Ga0495625_0368138 | 3300046660 | Bacteria | 904 |
| 591 | Ga0495635_0014016 | 3300046663 | Bacteria | 5609 |
| 592 | Ga0495659_0026538 | 3300046664 | Bacteria | 1991 |
| 593 | Ga0495659_0035214 | 3300046664 | Bacteria | 1763 |
| 594 | Ga0495659_0349806 | 3300046664 | Bacteria | 631 |
| 595 | Ga0495661_0000773 | 3300046665 | Bacteria | 30663 |
| 596 | Ga0495661_0008915 | 3300046665 | Bacteria | 6907 |
| 597 | Ga0495661_0027284 | 3300046665 | Bacteria | 3667 |
| 598 | Ga0495661_0092559 | 3300046665 | Bacteria | 1717 |
| 599 | Ga0495661_0118140 | 3300046665 | Bacteria | 1468 |
| 600 | Ga0495661_0301024 | 3300046665 | Bacteria | 802 |
| 601 | Ga0495661_0311730 | 3300046665 | Bacteria | 784 |
| 602 | Ga0495661_0577250 | 3300046665 | Bacteria | 530 |
| 603 | Ga0495588_0173183 | 3300046674 | Bacteria | 1141 |
| 604 | Ga0495623_0009827 | 3300046679 | Bacteria | 6198 |
| 605 | Ga0495646_0012643 | 3300046680 | Bacteria | 5362 |
| 606 | Ga0495646_0045300 | 3300046680 | Bacteria | 2688 |
| 607 | Ga0495613_0065131 | 3300046689 | Bacteria | 2664 |
| 608 | Ga0495613_0092377 | 3300046689 | Bacteria | 2191 |
| 609 | Ga0495613_0161253 | 3300046689 | Bacteria | 1595 |
| 610 | Ga0495613_0747323 | 3300046689 | Bacteria | 641 |
| 611 | Ga0495624_0001003 | 3300046690 | Bacteria | 22331 |
| 612 | Ga0495670_0000389 | 3300046691 | Bacteria | 20982 |
| 613 | Ga0495670_0000899 | 3300046691 | Bacteria | 14381 |
| 614 | Ga0495670_0013878 | 3300046691 | Bacteria | 3962 |
| 615 | Ga0495670_0084657 | 3300046691 | Bacteria | 1618 |
| 616 | Ga0495670_0147650 | 3300046691 | Bacteria | 1232 |
| 617 | Ga0495670_0152544 | 3300046691 | Bacteria | 1212 |
| 618 | Ga0495670_0682514 | 3300046691 | Bacteria | 560 |
| 619 | Ga0495671_0000307 | 3300046692 | Bacteria | 41409 |
| 620 | Ga0495671_0000377 | 3300046692 | Bacteria | 36641 |
| 621 | Ga0495671_0032755 | 3300046692 | Bacteria | 2651 |
| 622 | Ga0495671_0041495 | 3300046692 | Bacteria | 2316 |
| 623 | Ga0495671_0055115 | 3300046692 | Bacteria | 1969 |
| 624 | Ga0495671_0112986 | 3300046692 | Bacteria | 1326 |
| 625 | Ga0495671_0140344 | 3300046692 | Bacteria | 1177 |
| 626 | Ga0495671_0195145 | 3300046692 | Bacteria | 982 |
| 627 | Ga0495671_0229663 | 3300046692 | Bacteria | 897 |
| 628 | Ga0495671_0339607 | 3300046692 | Bacteria | 721 |
| 629 | Ga0495649_0001633 | 3300046694 | Bacteria | 16680 |
| 630 | Ga0495649_0019441 | 3300046694 | Bacteria | 3816 |
| 631 | Ga0495649_0024279 | 3300046694 | Bacteria | 3381 |
| 632 | Ga0495649_0036297 | 3300046694 | Bacteria | 2707 |
| 633 | Ga0495649_0036768 | 3300046694 | Bacteria | 2689 |
| 634 | Ga0495649_0043082 | 3300046694 | Bacteria | 2464 |
| 635 | Ga0495649_0067292 | 3300046694 | Bacteria | 1921 |
| 636 | Ga0495649_0086894 | 3300046694 | Bacteria | 1668 |
| 637 | Ga0495649_0092334 | 3300046694 | Bacteria | 1612 |
| 638 | Ga0495589_0000194 | 3300046794 | Bacteria | 53082 |
| 639 | Ga0495589_0002053 | 3300046794 | Bacteria | 11393 |
| 640 | Ga0495589_0003682 | 3300046794 | Bacteria | 8278 |
| 641 | Ga0495589_0071159 | 3300046794 | Bacteria | 1700 |
| 642 | Ga0495589_0099786 | 3300046794 | Bacteria | 1405 |
| 643 | Ga0495589_0257392 | 3300046794 | Bacteria | 814 |
| 644 | Ga0495589_0266236 | 3300046794 | Bacteria | 798 |
| 645 | Ga0495600_0089290 | 3300046809 | Bacteria | 2010 |
| 646 | Ga0495660_0003352 | 3300046810 | Bacteria | 9927 |
| 647 | Ga0495660_0035438 | 3300046810 | Bacteria | 2787 |
| 648 | Ga0495660_0042076 | 3300046810 | Bacteria | 2525 |
| 649 | Ga0495660_0044608 | 3300046810 | Bacteria | 2438 |
| 650 | Ga0495660_0046396 | 3300046810 | Bacteria | 2382 |
| 651 | Ga0495660_0054628 | 3300046810 | Bacteria | 2163 |
| 652 | Ga0495660_0065101 | 3300046810 | Bacteria | 1946 |
| 653 | Ga0495660_0067034 | 3300046810 | Bacteria | 1912 |
| 654 | Ga0495660_0070707 | 3300046810 | Bacteria | 1851 |
| 655 | Ga0495660_0329094 | 3300046810 | Bacteria | 684 |
| 656 | Ga0495581_0095470 | 3300047315 | Bacteria | 1726 |
| 657 | Ga0495604_0053907 | 3300047317 | Bacteria | 3105 |
| 658 | Ga0495604_0065469 | 3300047317 | Bacteria | 2766 |
| 659 | Ga0495636_0044292 | 3300047318 | Bacteria | 1853 |
| 660 | Ga0495674_0027872 | 3300047319 | Bacteria | 5158 |
| 661 | Ga0495672_0004930 | 3300047320 | Bacteria | 10716 |
| 662 | Ga0495672_0015161 | 3300047320 | Bacteria | 5245 |
| 663 | Ga0495672_0021422 | 3300047320 | Bacteria | 4216 |
| 664 | Ga0495672_0064656 | 3300047320 | Bacteria | 2093 |
| 665 | Ga0495672_0083839 | 3300047320 | Bacteria | 1769 |
| 666 | Ga0495672_0105399 | 3300047320 | Bacteria | 1521 |
| 667 | Ga0495676_0110851 | 3300047321 | Bacteria | 2013 |
| 668 | Ga0495680_0026473 | 3300047322 | Bacteria | 4779 |
| 669 | Ga0495680_0090594 | 3300047322 | Bacteria | 2294 |
| 670 | Ga0495683_0002776 | 3300047323 | Bacteria | 10426 |
| 671 | Ga0495683_0006216 | 3300047323 | Bacteria | 6537 |
| 672 | Ga0495683_0072254 | 3300047323 | Bacteria | 1692 |
| 673 | Ga0495683_0080317 | 3300047323 | Bacteria | 1591 |
| 674 | Ga0495683_0100217 | 3300047323 | Bacteria | 1393 |
| 675 | Ga0495683_0110107 | 3300047323 | Bacteria | 1315 |
| 676 | Ga0495683_0271858 | 3300047323 | Bacteria | 736 |
| 677 | Ga0495687_044216 | 3300047443 | Bacteria | 1937 |
| 678 | Ga0495687_115414 | 3300047443 | Bacteria | 978 |
| 679 | Ga0495679_001372 | 3300047446 | Bacteria | 13978 |
| 680 | Ga0495679_001589 | 3300047446 | Bacteria | 12774 |
| 681 | Ga0495679_005387 | 3300047446 | Bacteria | 5674 |
| 682 | Ga0495679_015499 | 3300047446 | Bacteria | 2785 |
| 683 | Ga0495679_022757 | 3300047446 | Bacteria | 2139 |
| 684 | Ga0495679_030605 | 3300047446 | Bacteria | 1744 |
| 685 | Ga0495679_035238 | 3300047446 | Bacteria | 1587 |
| 686 | Ga0495673_0003020 | 3300047469 | Bacteria | 11334 |
| 687 | Ga0495673_0026774 | 3300047469 | Bacteria | 2751 |
| 688 | Ga0495673_0046008 | 3300047469 | Bacteria | 1936 |
| 689 | Ga0495673_0055171 | 3300047469 | Bacteria | 1725 |
| 690 | Ga0495673_0065731 | 3300047469 | Bacteria | 1539 |
| 691 | Ga0495673_0068698 | 3300047469 | Bacteria | 1496 |
| 692 | Ga0495673_0070234 | 3300047469 | Bacteria | 1475 |
| 693 | Ga0495673_0138546 | 3300047469 | Bacteria | 950 |
| 694 | Ga0495681_0005323 | 3300047470 | Bacteria | 8637 |
| 695 | Ga0495681_0015768 | 3300047470 | Bacteria | 4266 |
| 696 | Ga0495681_0018369 | 3300047470 | Bacteria | 3855 |
| 697 | Ga0495681_0021062 | 3300047470 | Bacteria | 3521 |
| 698 | Ga0495681_0026688 | 3300047470 | Bacteria | 3000 |
| 699 | Ga0495681_0033575 | 3300047470 | Bacteria | 2568 |
| 700 | Ga0495681_0037051 | 3300047470 | Bacteria | 2406 |
| 701 | Ga0495681_0038988 | 3300047470 | Bacteria | 2323 |
| 702 | Ga0495681_0058247 | 3300047470 | Bacteria | 1790 |
| 703 | Ga0495681_0077921 | 3300047470 | Bacteria | 1486 |
| 704 | Ga0495681_0106388 | 3300047470 | Bacteria | 1220 |
| 705 | Ga0495681_0201669 | 3300047470 | Bacteria | 806 |
| 706 | Ga0495681_0274392 | 3300047470 | Bacteria | 659 |
| 707 | Ga0495684_0069061 | 3300047471 | Bacteria | 2687 |
| 708 | Ga0495686_0080633 | 3300047472 | Bacteria | 1989 |
| 709 | Ga0495686_0083666 | 3300047472 | Bacteria | 1945 |
| 710 | Ga0495686_0088430 | 3300047472 | Bacteria | 1883 |
| 711 | Ga0495686_0088821 | 3300047472 | Bacteria | 1878 |
| 712 | Ga0495593_0070990 | 3300047673 | Bacteria | 1808 |
| 713 | Ga0495593_0071140 | 3300047673 | Bacteria | 1806 |
| 714 | Ga0495593_0200653 | 3300047673 | Bacteria | 1002 |
| 715 | Ga0495602_0031550 | 3300048088 | Bacteria | 5008 |
| 716 | Ga0495626_0003523 | 3300048091 | Bacteria | 10021 |
| 717 | Ga0495626_0009007 | 3300048091 | Bacteria | 5411 |
| 718 | Ga0495626_0037662 | 3300048091 | Bacteria | 2296 |
| 719 | Ga0495626_0060331 | 3300048091 | Bacteria | 1728 |
| 720 | Ga0495626_0065354 | 3300048091 | Bacteria | 1646 |
| 721 | Ga0495626_0068377 | 3300048091 | Bacteria | 1601 |
| 722 | Ga0495626_0073819 | 3300048091 | Bacteria | 1527 |
| 723 | Ga0495626_0241831 | 3300048091 | Bacteria | 726 |
| 724 | Ga0495626_0356101 | 3300048091 | Bacteria | 570 |
| 725 | Ga0496102_0004455 | 3300048905 | Bacteria | 11829 |
| 726 | Ga0496103_0021772 | 3300048906 | Bacteria | 3858 |
| 727 | Ga0496105_0704587 | 3300048908 | Bacteria | 775 |
| 728 | Ga0496106_0198099 | 3300048909 | Bacteria | 1598 |
| 729 | Ga0496107_1099274 | 3300048910 | Bacteria | 574 |
| 730 | Ga0496110_0494573 | 3300048913 | Bacteria | 1114 |
| 731 | Ga0496112_0221243 | 3300048915 | Bacteria | 1849 |
| 732 | Ga0496114_0353194 | 3300048917 | Bacteria | 1300 |
| 733 | Ga0496115_0172523 | 3300048918 | Bacteria | 1788 |
| 734 | Ga0496116_0000085 | 3300048919 | Bacteria | 219553 |
| 735 | Ga0496116_0001088 | 3300048919 | Bacteria | 32732 |
| 736 | Ga0496116_0002312 | 3300048919 | Bacteria | 20203 |
| 737 | Ga0496116_0032645 | 3300048919 | Bacteria | 3707 |
| 738 | Ga0496116_0061978 | 3300048919 | Bacteria | 2417 |
| 739 | Ga0496116_0074368 | 3300048919 | Bacteria | 2137 |
| 740 | Ga0496117_0001620 | 3300048920 | Bacteria | 31800 |
| 741 | Ga0496117_0011807 | 3300048920 | Bacteria | 7777 |
| 742 | Ga0496117_0032234 | 3300048920 | Bacteria | 3984 |
| 743 | Ga0496117_0055410 | 3300048920 | Bacteria | 2770 |
| 744 | Ga0496117_0088609 | 3300048920 | Bacteria | 2001 |
| 745 | Ga0496117_0092318 | 3300048920 | Bacteria | 1945 |
| 746 | Ga0496117_0095409 | 3300048920 | Bacteria | 1900 |
| 747 | Ga0496117_0161415 | 3300048920 | Bacteria | 1312 |
| 748 | Ga0496117_0276673 | 3300048920 | Bacteria | 901 |
| 749 | Ga0496118_0018066 | 3300048921 | Bacteria | 6382 |
| 750 | Ga0496118_0034843 | 3300048921 | Bacteria | 4099 |
| 751 | Ga0496118_0051681 | 3300048921 | Bacteria | 3141 |
| 752 | Ga0496118_0097736 | 3300048921 | Bacteria | 1996 |
| 753 | Ga0496118_0112796 | 3300048921 | Bacteria | 1798 |
| 754 | Ga0496118_0114349 | 3300048921 | Bacteria | 1779 |
| 755 | Ga0496118_0230431 | 3300048921 | Bacteria | 1069 |
| 756 | Ga0496118_0578922 | 3300048921 | Bacteria | 541 |
| 757 | Ga0496119_0025519 | 3300048922 | Bacteria | 4124 |
| 758 | Ga0496119_0081228 | 3300048922 | Bacteria | 1867 |
| 759 | Ga0496119_0137789 | 3300048922 | Bacteria | 1321 |
| 760 | Ga0496119_0226100 | 3300048922 | Bacteria | 955 |
| 761 | Ga0496120_0009532 | 3300048923 | Bacteria | 6875 |
| 762 | Ga0496120_0106524 | 3300048923 | Bacteria | 1471 |
| 763 | Ga0496120_0149119 | 3300048923 | Bacteria | 1177 |
| 764 | Ga0496121_0000179 | 3300048924 | Bacteria | 141214 |
| 765 | Ga0496121_0022604 | 3300048924 | Bacteria | 6091 |
| 766 | Ga0496121_0039080 | 3300048924 | Bacteria | 4189 |
| 767 | Ga0496121_0042923 | 3300048924 | Bacteria | 3924 |
| 768 | Ga0496121_0116747 | 3300048924 | Bacteria | 2023 |
| 769 | Ga0496121_0670547 | 3300048924 | Bacteria | 628 |
| 770 | Ga0496122_0019724 | 3300048925 | Bacteria | 6144 |
| 771 | Ga0496122_0025135 | 3300048925 | Bacteria | 5186 |
| 772 | Ga0496122_0048380 | 3300048925 | Bacteria | 3270 |
| 773 | Ga0496122_0104123 | 3300048925 | Bacteria | 1886 |
| 774 | Ga0496122_0143541 | 3300048925 | Bacteria | 1488 |
| 775 | Ga0496122_0265133 | 3300048925 | Bacteria | 950 |
| 776 | Ga0496122_0420285 | 3300048925 | Bacteria | 672 |
| 777 | Ga0496122_0436645 | 3300048925 | Bacteria | 653 |
| 778 | Ga0496123_0006947 | 3300048926 | Bacteria | 10811 |
| 779 | Ga0496123_0082998 | 3300048926 | Bacteria | 1939 |
| 780 | Ga0496123_0099233 | 3300048926 | Bacteria | 1700 |
| 781 | Ga0496123_0107324 | 3300048926 | Bacteria | 1606 |
| 782 | Ga0496123_0171370 | 3300048926 | Bacteria | 1144 |
| 783 | Ga0496123_0374622 | 3300048926 | Bacteria | 655 |
| 784 | Ga0496123_0468191 | 3300048926 | Bacteria | 557 |
| 785 | Ga0496124_0001693 | 3300048927 | Bacteria | 31219 |
| 786 | Ga0496124_0025284 | 3300048927 | Bacteria | 5380 |
| 787 | Ga0496124_0072809 | 3300048927 | Bacteria | 2844 |
| 788 | Ga0496124_0076738 | 3300048927 | Bacteria | 2757 |
| 789 | Ga0496124_0119923 | 3300048927 | Bacteria | 2103 |
| 790 | Ga0496124_0198005 | 3300048927 | Bacteria | 1530 |
| 791 | Ga0496124_0280459 | 3300048927 | Bacteria | 1215 |
| 792 | Ga0496124_0288474 | 3300048927 | Bacteria | 1192 |
| 793 | Ga0496124_0515781 | 3300048927 | Bacteria | 797 |
| 794 | Ga0496125_0001691 | 3300048928 | Bacteria | 30828 |
| 795 | Ga0496125_0005335 | 3300048928 | Bacteria | 14361 |
| 796 | Ga0496125_0036633 | 3300048928 | Bacteria | 4278 |
| 797 | Ga0496125_0037228 | 3300048928 | Bacteria | 4232 |
| 798 | Ga0496125_0073871 | 3300048928 | Bacteria | 2647 |
| 799 | Ga0496125_0128524 | 3300048928 | Bacteria | 1789 |
| 800 | Ga0496125_0200182 | 3300048928 | Bacteria | 1308 |
| 801 | Ga0496126_0009164 | 3300048929 | Bacteria | 10562 |
| 802 | Ga0496126_0037114 | 3300048929 | Bacteria | 4550 |
| 803 | Ga0496126_0133460 | 3300048929 | Bacteria | 2143 |
| 804 | Ga0495678_001578 | 3300049459 | Bacteria | 17516 |
| 805 | Ga0495678_019547 | 3300049459 | Bacteria | 3018 |
| 806 | Ga0495678_023839 | 3300049459 | Bacteria | 2652 |
| 807 | Ga0495678_030472 | 3300049459 | Bacteria | 2256 |
| 808 | Ga0495678_039602 | 3300049459 | Bacteria | 1900 |
| 809 | Ga0495678_041527 | 3300049459 | Bacteria | 1839 |
| 810 | Ga0495678_047779 | 3300049459 | Bacteria | 1673 |
| 811 | Ga0495678_150381 | 3300049459 | Bacteria | 752 |
| 812 | Ga0495678_152370 | 3300049459 | Bacteria | 745 |
| 813 | Ga0495682_0024472 | 3300049460 | Bacteria | 2250 |
| 814 | Ga0495682_0033100 | 3300049460 | Bacteria | 1908 |
| 815 | Ga0495682_0194055 | 3300049460 | Bacteria | 720 |
| 816 | Ga0495682_0223264 | 3300049460 | Bacteria | 667 |
| 817 | Ga0501241_008359 | 3300049758 | Bacteria | 1890 |
| 818 | Ga0500572_018857 | 3300053111 | Bacteria | 1793 |
| 819 | Ga0500621_181547 | 3300053126 | Bacteria | 762 |
| 820 | Ga0500586_199134 | 3300053145 | Bacteria | 658 |
| 821 | Ga0500634_0003648 | 3300053161 | Bacteria | 6919 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013308 | Ga0157375_10894683 | Ga0157375_108946832 | 65 |
| 2 | 3300009036 | Ga0105244_10056004 | Ga0105244_100560042 | 66 |
| 3 | 3300012502 | Ga0157347_1011309 | Ga0157347_10113092 | 66 |
| 4 | 3300013306 | Ga0163162_10000649 | Ga0163162_1000064933 | 66 |
| 5 | 3300017792 | Ga0163161_10004501 | Ga0163161_100045013 | 66 |
| 6 | 3300025728 | Ga0207655_1010781 | Ga0207655_10107812 | 66 |
| 7 | 3300025728 | Ga0207655_1049631 | Ga0207655_10496312 | 66 |
| 8 | 3300046452 | Ga0495617_020933 | Ga0495617_020933_968_1207 | 66 |
| 9 | 3300046453 | Ga0495627_001088 | Ga0495627_001088_972_1211 | 66 |
| 10 | 3300046458 | Ga0495591_029685 | Ga0495591_029685_642_881 | 66 |
| 11 | 3300046460 | Ga0495638_0186002 | Ga0495638_0186002_84_323 | 66 |
| 12 | 3300046491 | Ga0495584_0036104 | Ga0495584_0036104_1828_2067 | 66 |
| 13 | 3300046492 | Ga0495585_0052421 | Ga0495585_0052421_852_1091 | 66 |
| 14 | 3300046500 | Ga0495596_0024462 | Ga0495596_0024462_1971_2210 | 66 |
| 15 | 3300046501 | Ga0495607_0009299 | Ga0495607_0009299_443_682 | 66 |
| 16 | 3300046506 | Ga0495583_0054763 | Ga0495583_0054763_574_813 | 66 |
| 17 | 3300046512 | Ga0495610_0026446 | Ga0495610_0026446_2208_2447 | 66 |
| 18 | 3300046513 | Ga0495616_0051681 | Ga0495616_0051681_659_898 | 66 |
| 19 | 3300046515 | Ga0495620_0134352 | Ga0495620_0134352_347_586 | 66 |
| 20 | 3300046518 | Ga0495631_0084338 | Ga0495631_0084338_1028_1267 | 66 |
| 21 | 3300046519 | Ga0495632_0002719 | Ga0495632_0002719_12210_12449 | 66 |
| 22 | 3300046520 | Ga0495637_0020327 | Ga0495637_0020327_923_1162 | 66 |
| 23 | 3300046522 | Ga0495643_0064810 | Ga0495643_0064810_511_750 | 66 |
| 24 | 3300046523 | Ga0495644_0038575 | Ga0495644_0038575_520_759 | 66 |
| 25 | 3300046524 | Ga0495648_0050430 | Ga0495648_0050430_1053_1292 | 66 |
| 26 | 3300046530 | Ga0495654_0031821 | Ga0495654_0031821_1832_2071 | 66 |
| 27 | 3300046538 | Ga0495609_0056997 | Ga0495609_0056997_383_622 | 66 |
| 28 | 3300046538 | Ga0495609_0219607 | Ga0495609_0219607_432_671 | 66 |
| 29 | 3300046558 | Ga0495633_0389707 | Ga0495633_0389707_335_574 | 66 |
| 30 | 3300046616 | Ga0495668_0094609 | Ga0495668_0094609_382_621 | 66 |
| 31 | 3300046648 | Ga0495611_0000770 | Ga0495611_0000770_16904_17143 | 66 |
| 32 | 3300046660 | Ga0495625_0045921 | Ga0495625_0045921_966_1205 | 66 |
| 33 | 3300046665 | Ga0495661_0092559 | Ga0495661_0092559_357_596 | 66 |
| 34 | 3300046691 | Ga0495670_0000899 | Ga0495670_0000899_13529_13768 | 66 |
| 35 | 3300046692 | Ga0495671_0112986 | Ga0495671_0112986_653_892 | 66 |
| 36 | 3300046794 | Ga0495589_0099786 | Ga0495589_0099786_1108_1347 | 66 |
| 37 | 3300046810 | Ga0495660_0046396 | Ga0495660_0046396_225_464 | 66 |
| 38 | 3300047320 | Ga0495672_0083839 | Ga0495672_0083839_388_627 | 66 |
| 39 | 3300047323 | Ga0495683_0072254 | Ga0495683_0072254_1068_1307 | 66 |
| 40 | 3300047470 | Ga0495681_0026688 | Ga0495681_0026688_858_1097 | 66 |
| 41 | 3300047472 | Ga0495686_0088821 | Ga0495686_0088821_337_576 | 66 |
| 42 | 2124908027 | MRS2a_Contig_8358 | MRS2a_00253900 | 70 |
| 43 | 3300046500 | Ga0495596_0408276 | Ga0495596_0408276_21_236 | 71 |
| 44 | 3300046520 | Ga0495637_0280555 | Ga0495637_0280555_19_234 | 71 |
| 45 | 3300047446 | Ga0495679_035238 | Ga0495679_035238_14_238 | 71 |
| 46 | 3300047470 | Ga0495681_0274392 | Ga0495681_0274392_12_236 | 71 |
| 47 | 3300032004 | Ga0307414_10696333 | Ga0307414_106963332 | 73 |
| 48 | iso_pu_bacteria | 2511231006 | 2511266110 | 73 |
| 49 | iso_pu_bacteria | 2511231023 | 2511371752 | 73 |
| 50 | iso_pu_bacteria | 2512047018 | 2512329548 | 73 |
| 51 | iso_pu_bacteria | 2554235341 | 2555668515 | 73 |
| 52 | iso_pu_bacteria | 2582580891 | 2583790909 | 73 |
| 53 | iso_pu_bacteria | 2597489887 | 2597856678 | 73 |
| 54 | iso_pu_bacteria | 2597489889 | 2597871090 | 73 |
| 55 | iso_pu_bacteria | 2599185160 | 2599355512 | 73 |
| 56 | iso_pu_bacteria | 2599185161 | 2599360654 | 73 |
| 57 | iso_pu_bacteria | 2599185162 | 2599366976 | 73 |
| 58 | iso_pu_bacteria | 2599185163 | 2599373766 | 73 |
| 59 | iso_pu_bacteria | 2599185164 | 2599380618 | 73 |
| 60 | iso_pu_bacteria | 2599185165 | 2599387065 | 73 |
| 61 | iso_pu_bacteria | 2599185166 | 2599392624 | 73 |
| 62 | iso_pu_bacteria | 2599185168 | 2599404391 | 73 |
| 63 | iso_pu_bacteria | 2599185181 | 2599462346 | 73 |
| 64 | iso_pu_bacteria | 2599185182 | 2599466600 | 73 |
| 65 | iso_pu_bacteria | 2599185185 | 2599483071 | 73 |
| 66 | iso_pu_bacteria | 2599185186 | 2599490562 | 73 |
| 67 | iso_pu_bacteria | 2599185257 | 2599801346 | 73 |
| 68 | iso_pu_bacteria | 2599185356 | 2600214968 | 73 |
| 69 | iso_pu_bacteria | 2600254931 | 2600363688 | 73 |
| 70 | iso_pu_bacteria | 2600255313 | 2601774327 | 73 |
| 71 | iso_pu_bacteria | 2619619299 | 2621298212 | 73 |
| 72 | iso_pu_bacteria | 2643221571 | 2643869346 | 73 |
| 73 | iso_pu_bacteria | 2643221713 | 2644622069 | 73 |
| 74 | iso_pu_bacteria | 2667528171 | 2671098127 | 73 |
| 75 | iso_pu_bacteria | 2671180172 | 2671768294 | 73 |
| 76 | iso_pu_bacteria | 2738541265 | 2738671405 | 73 |
| 77 | iso_pu_bacteria | 2738541282 | 2738749799 | 73 |
| 78 | iso_pu_bacteria | 2738541303 | 2738858839 | 73 |
| 79 | iso_pu_bacteria | 2740892503 | 2743736102 | 73 |
| 80 | iso_pu_bacteria | 2773857673 | 2774135972 | 73 |
| 81 | iso_pu_bacteria | 2773857673 | 2774138316 | 73 |
| 82 | iso_pu_bacteria | 2784132063 | 2784259981 | 73 |
| 83 | iso_pu_bacteria | 2816332298 | 2817492645 | 73 |
| 84 | iso_pu_bacteria | 2818991464 | 2819703194 | 73 |
| 85 | iso_pu_bacteria | 2852657418 | 2852658728 | 73 |
| 86 | iso_pu_bacteria | 2860867994 | 2860871738 | 73 |
| 87 | iso_pu_bacteria | 2880230671 | 2880232119 | 73 |
| 88 | iso_pu_bacteria | 2904518522 | 2904522352 | 73 |
| 89 | iso_pu_bacteria | 2908446538 | 2908451141 | 73 |
| 90 | iso_pu_bacteria | 2917070673 | 2917072283 | 73 |
| 91 | iso_pu_bacteria | 2923153595 | 2923155114 | 73 |
| 92 | iso_pu_bacteria | 2929189879 | 2929193809 | 73 |
| 93 | iso_pu_bacteria | 2935353572 | 2935354448 | 73 |
| 94 | iso_pu_bacteria | 2945961074 | 2945961826 | 73 |
| 95 | iso_pu_bacteria | 2946006987 | 2946008400 | 73 |
| 96 | iso_pu_bacteria | 2946027586 | 2946032249 | 73 |
| 97 | iso_pu_bacteria | 2947233263 | 2947239068 | 73 |
| 98 | iso_pu_bacteria | 2984286254 | 2984290928 | 73 |
| 99 | iso_pu_bacteria | 3007395558 | 3007400651 | 73 |
| 100 | iso_pu_bacteria | 3007855910 | 3007856050 | 73 |
| 101 | iso_pu_bacteria | 3007861166 | 3007863317 | 73 |
| 102 | iso_pu_bacteria | 637000220 | 637318874 | 73 |
| 103 | iso_pu_bacteria | 8015687852 | 8015689335 | 73 |
| 104 | iso_pu_bacteria | 8019769354 | 8019771056 | 73 |
| 105 | iso_pu_bacteria | 8054503363 | 8054507610 | 73 |
| 106 | iso_pu_bacteria | 8055770955 | 8055772462 | 73 |
| 107 | iso_pu_bacteria | 8056131705 | 8056136000 | 73 |
| 108 | iso_pu_bacteria | 8056569372 | 8056570113 | 73 |
| 109 | iso_pu_bacteria | 8057798959 | 8057803803 | 73 |
| 110 | iso_pu_bacteria | 2511231004 | 2511254492 | 74 |
| 111 | iso_pu_bacteria | 2511231007 | 2511269692 | 74 |
| 112 | iso_pu_bacteria | 2511231008 | 2511281035 | 74 |
| 113 | iso_pu_bacteria | 2511231010 | 2511291046 | 74 |
| 114 | iso_pu_bacteria | 2511231011 | 2511298779 | 74 |
| 115 | iso_pu_bacteria | 2511231016 | 2511326456 | 74 |
| 116 | iso_pu_bacteria | 2511231022 | 2511363088 | 74 |
| 117 | iso_pu_bacteria | 2511231031 | 2511413717 | 74 |
| 118 | iso_pu_bacteria | 2511231156 | 2511823462 | 74 |
| 119 | iso_pu_bacteria | 2597489888 | 2597865236 | 74 |
| 120 | iso_pu_bacteria | 2599185167 | 2599400368 | 74 |
| 121 | iso_pu_bacteria | 2599185179 | 2599451302 | 74 |
| 122 | iso_pu_bacteria | 2599185188 | 2599503939 | 74 |
| 123 | iso_pu_bacteria | 2599185189 | 2599508620 | 74 |
| 124 | iso_pu_bacteria | 2599185190 | 2599512476 | 74 |
| 125 | iso_pu_bacteria | 2599185191 | 2599519824 | 74 |
| 126 | iso_pu_bacteria | 2599185212 | 2599615803 | 74 |
| 127 | iso_pu_bacteria | 2599185248 | 2599772721 | 74 |
| 128 | iso_pu_bacteria | 2599185288 | 2599878579 | 74 |
| 129 | iso_pu_bacteria | 2599185289 | 2599889218 | 74 |
| 130 | iso_pu_bacteria | 2599185290 | 2599891152 | 74 |
| 131 | iso_pu_bacteria | 2599185291 | 2599896539 | 74 |
| 132 | iso_pu_bacteria | 2599185300 | 2599931908 | 74 |
| 133 | iso_pu_bacteria | 2599185302 | 2599945559 | 74 |
| 134 | iso_pu_bacteria | 2599185303 | 2599947782 | 74 |
| 135 | iso_pu_bacteria | 2599185304 | 2599956677 | 74 |
| 136 | iso_pu_bacteria | 2599185305 | 2599962630 | 74 |
| 137 | iso_pu_bacteria | 2599185306 | 2599965250 | 74 |
| 138 | iso_pu_bacteria | 2599185308 | 2599978796 | 74 |
| 139 | iso_pu_bacteria | 2599185309 | 2599985401 | 74 |
| 140 | iso_pu_bacteria | 2599185310 | 2599991848 | 74 |
| 141 | iso_pu_bacteria | 2599185311 | 2599996553 | 74 |
| 142 | iso_pu_bacteria | 2599185312 | 2600002355 | 74 |
| 143 | iso_pu_bacteria | 2599185313 | 2600006892 | 74 |
| 144 | iso_pu_bacteria | 2599185314 | 2600010482 | 74 |
| 145 | iso_pu_bacteria | 2599185315 | 2600021405 | 74 |
| 146 | iso_pu_bacteria | 2599185316 | 2600026373 | 74 |
| 147 | iso_pu_bacteria | 2599185317 | 2600032471 | 74 |
| 148 | iso_pu_bacteria | 2599185318 | 2600036310 | 74 |
| 149 | iso_pu_bacteria | 2599185319 | 2600043607 | 74 |
| 150 | iso_pu_bacteria | 2599185320 | 2600049888 | 74 |
| 151 | iso_pu_bacteria | 2599185321 | 2600053531 | 74 |
| 152 | iso_pu_bacteria | 2599185322 | 2600061453 | 74 |
| 153 | iso_pu_bacteria | 2599185323 | 2600067377 | 74 |
| 154 | iso_pu_bacteria | 2599185324 | 2600070384 | 74 |
| 155 | iso_pu_bacteria | 2599185325 | 2600080211 | 74 |
| 156 | iso_pu_bacteria | 2600254930 | 2600362033 | 74 |
| 157 | iso_pu_bacteria | 2600255296 | 2601689511 | 74 |
| 158 | iso_pu_bacteria | 2600255318 | 2601799973 | 74 |
| 159 | iso_pu_bacteria | 2603880185 | 2606074228 | 74 |
| 160 | iso_pu_bacteria | 2603880199 | 2606127090 | 74 |
| 161 | iso_pu_bacteria | 2623620443 | 2624479263 | 74 |
| 162 | iso_pu_bacteria | 2623620446 | 2624493745 | 74 |
| 163 | iso_pu_bacteria | 2643221650 | 2644283642 | 74 |
| 164 | iso_pu_bacteria | 2651869719 | 2652546598 | 74 |
| 165 | iso_pu_bacteria | 2667528170 | 2671090415 | 74 |
| 166 | iso_pu_bacteria | 2667528176 | 2671130387 | 74 |
| 167 | iso_pu_bacteria | 2675903420 | 2677900018 | 74 |
| 168 | iso_pu_bacteria | 2675903515 | 2678262389 | 74 |
| 169 | iso_pu_bacteria | 2713897148 | 2715751799 | 74 |
| 170 | iso_pu_bacteria | 2713897149 | 2715759654 | 74 |
| 171 | iso_pu_bacteria | 2718217725 | 2718633119 | 74 |
| 172 | iso_pu_bacteria | 2721755607 | 2723249989 | 74 |
| 173 | iso_pu_bacteria | 2738541294 | 2738808335 | 74 |
| 174 | iso_pu_bacteria | 2738541309 | 2738895695 | 74 |
| 175 | iso_pu_bacteria | 2738543025 | 2739314277 | 74 |
| 176 | iso_pu_bacteria | 2744054620 | 2745008735 | 74 |
| 177 | iso_pu_bacteria | 2791355520 | 2794596185 | 74 |
| 178 | iso_pu_bacteria | 2808606361 | 2808858219 | 74 |
| 179 | iso_pu_bacteria | 2808606376 | 2808924158 | 74 |
| 180 | iso_pu_bacteria | 2808606377 | 2808929969 | 74 |
| 181 | iso_pu_bacteria | 2808606378 | 2808938392 | 74 |
| 182 | iso_pu_bacteria | 2808606380 | 2808946099 | 74 |
| 183 | iso_pu_bacteria | 2808606381 | 2808951955 | 74 |
| 184 | iso_pu_bacteria | 2808606383 | 2808966704 | 74 |
| 185 | iso_pu_bacteria | 2808606385 | 2808977942 | 74 |
| 186 | iso_pu_bacteria | 2808606388 | 2808993422 | 74 |
| 187 | iso_pu_bacteria | 2808606389 | 2809001534 | 74 |
| 188 | iso_pu_bacteria | 2818991456 | 2819654494 | 74 |
| 189 | iso_pu_bacteria | 2842832357 | 2842832916 | 74 |
| 190 | iso_pu_bacteria | 2842843487 | 2842848467 | 74 |
| 191 | iso_pu_bacteria | 2852612431 | 2852612985 | 74 |
| 192 | iso_pu_bacteria | 2852667396 | 2852669280 | 74 |
| 193 | iso_pu_bacteria | 2860339153 | 2860340203 | 74 |
| 194 | iso_pu_bacteria | 2878029506 | 2878031272 | 74 |
| 195 | iso_pu_bacteria | 2913036834 | 2913038361 | 74 |
| 196 | iso_pu_bacteria | 2919063839 | 2919064258 | 74 |
| 197 | iso_pu_bacteria | 2919385768 | 2919386242 | 74 |
| 198 | iso_pu_bacteria | 2919456309 | 2919461935 | 74 |
| 199 | iso_pu_bacteria | 2919481497 | 2919481628 | 74 |
| 200 | iso_pu_bacteria | 2919487758 | 2919491670 | 74 |
| 201 | iso_pu_bacteria | 2919697872 | 2919700346 | 74 |
| 202 | iso_pu_bacteria | 2923586266 | 2923587515 | 74 |
| 203 | iso_pu_bacteria | 2929144301 | 2929145805 | 74 |
| 204 | iso_pu_bacteria | 2931369376 | 2931370854 | 74 |
| 205 | iso_pu_bacteria | 2931390751 | 2931395106 | 74 |
| 206 | iso_pu_bacteria | 2931396565 | 2931399899 | 74 |
| 207 | iso_pu_bacteria | 2945928738 | 2945932209 | 74 |
| 208 | iso_pu_bacteria | 2969304461 | 2969306043 | 74 |
| 209 | iso_pu_bacteria | 2974289157 | 2974292292 | 74 |
| 210 | iso_pu_bacteria | 2988728565 | 2988733340 | 74 |
| 211 | iso_pu_bacteria | 2998139840 | 2998141454 | 74 |
| 212 | iso_pu_bacteria | 3007614139 | 3007616293 | 74 |
| 213 | iso_pu_bacteria | 3007718800 | 3007719658 | 74 |
| 214 | iso_pu_bacteria | 8019775933 | 8019777001 | 74 |
| 215 | iso_pu_bacteria | 8029995093 | 8029999296 | 74 |
| 216 | iso_pu_bacteria | 8054285046 | 8054288530 | 74 |
| 217 | iso_pu_bacteria | 8054347763 | 8054350643 | 74 |
| 218 | iso_pu_bacteria | 8055817908 | 8055822544 | 74 |
| 219 | iso_pu_bacteria | 8056148874 | 8056150322 | 74 |
| 220 | iso_pu_bacteria | 8056155041 | 8056159304 | 74 |
| 221 | iso_pu_bacteria | 8056161164 | 8056162215 | 74 |
| 222 | iso_pu_bacteria | 8056166840 | 8056169607 | 74 |
| 223 | iso_pu_bacteria | 8056172158 | 8056175724 | 74 |
| 224 | 3300002737 | JGI25162J39368_1000085 | JGI25162J39368_100008582 | 77 |
| 225 | 3300002771 | JGI25163J39215_1000401 | JGI25163J39215_10004019 | 77 |
| 226 | 3300002772 | JGI25164J39214_1000063 | JGI25164J39214_100006382 | 77 |
| 227 | 3300003214 | JGI25165J46597_1000160 | JGI25165J46597_100016082 | 77 |
| 228 | 3300003781 | Ga0055536_1000041 | Ga0055536_1000041115 | 77 |
| 229 | 3300003791 | Ga0055530_10000290 | Ga0055530_1000029034 | 77 |
| 230 | 3300003792 | Ga0055540_1000584 | Ga0055540_100058415 | 77 |
| 231 | 3300005289 | Ga0065704_10157503 | Ga0065704_101575033 | 77 |
| 232 | 3300005289 | Ga0065704_10724502 | Ga0065704_107245021 | 77 |
| 233 | 3300005331 | Ga0070670_100001455 | Ga0070670_1000014552 | 77 |
| 234 | 3300009011 | Ga0105251_10005407 | Ga0105251_100054074 | 77 |
| 235 | 3300009036 | Ga0105244_10002540 | Ga0105244_1000254010 | 77 |
| 236 | 3300009036 | Ga0105244_10223117 | Ga0105244_102231172 | 77 |
| 237 | 3300009036 | Ga0105244_10436551 | Ga0105244_104365511 | 77 |
| 238 | 3300009092 | Ga0105250_10013656 | Ga0105250_100136565 | 77 |
| 239 | 3300009092 | Ga0105250_10188621 | Ga0105250_101886212 | 77 |
| 240 | 3300009148 | Ga0105243_10001489 | Ga0105243_1000148920 | 77 |
| 241 | 3300009176 | Ga0105242_11199979 | Ga0105242_111999792 | 77 |
| 242 | 3300010375 | Ga0105239_11945189 | Ga0105239_119451892 | 77 |
| 243 | 3300011119 | Ga0105246_10003399 | Ga0105246_100033993 | 77 |
| 244 | 3300013100 | Ga0157373_10057732 | Ga0157373_100577322 | 77 |
| 245 | 3300013100 | Ga0157373_10211115 | Ga0157373_102111152 | 77 |
| 246 | 3300013100 | Ga0157373_11193533 | Ga0157373_111935331 | 77 |
| 247 | 3300013102 | Ga0157371_10002025 | Ga0157371_1000202515 | 77 |
| 248 | 3300013102 | Ga0157371_11220898 | Ga0157371_112208981 | 77 |
| 249 | 3300013104 | Ga0157370_10233128 | Ga0157370_102331282 | 77 |
| 250 | 3300013104 | Ga0157370_11763240 | Ga0157370_117632401 | 77 |
| 251 | 3300013306 | Ga0163162_10083369 | Ga0163162_100833695 | 77 |
| 252 | 3300013307 | Ga0157372_10003301 | Ga0157372_100033015 | 77 |
| 253 | 3300013308 | Ga0157375_10002948 | Ga0157375_1000294815 | 77 |
| 254 | 3300013308 | Ga0157375_10401634 | Ga0157375_104016342 | 77 |
| 255 | 3300014497 | Ga0182008_10009051 | Ga0182008_100090514 | 77 |
| 256 | 3300015265 | Ga0182005_1109253 | Ga0182005_11092531 | 77 |
| 257 | 3300017792 | Ga0163161_10012220 | Ga0163161_100122202 | 77 |
| 258 | 3300017792 | Ga0163161_10054830 | Ga0163161_100548303 | 77 |
| 259 | 3300025207 | Ga0209760_100039 | Ga0209760_10003994 | 77 |
| 260 | 3300025231 | Ga0207427_100001 | Ga0207427_100001768 | 77 |
| 261 | 3300025233 | Ga0209437_100003 | Ga0209437_100003604 | 77 |
| 262 | 3300025261 | Ga0209233_1000007 | Ga0209233_1000007768 | 77 |
| 263 | 3300025292 | Ga0209676_1000021 | Ga0209676_100002158 | 77 |
| 264 | 3300025298 | Ga0209050_1000107 | Ga0209050_100010757 | 77 |
| 265 | 3300025303 | Ga0209051_1000090 | Ga0209051_100009099 | 77 |
| 266 | 3300025304 | Ga0209257_1044277 | Ga0209257_10442772 | 77 |
| 267 | 3300025711 | Ga0207696_1000158 | Ga0207696_100015846 | 77 |
| 268 | 3300025711 | Ga0207696_1031373 | Ga0207696_10313733 | 77 |
| 269 | 3300025728 | Ga0207655_1002953 | Ga0207655_10029533 | 77 |
| 270 | 3300025728 | Ga0207655_1076360 | Ga0207655_10763602 | 77 |
| 271 | 3300025735 | Ga0207713_1003857 | Ga0207713_10038578 | 77 |
| 272 | 3300025735 | Ga0207713_1009834 | Ga0207713_10098345 | 77 |
| 273 | 3300025925 | Ga0207650_10000212 | Ga0207650_1000021214 | 77 |
| 274 | 3300025933 | Ga0207706_10104110 | Ga0207706_101041103 | 77 |
| 275 | 3300025935 | Ga0207709_10000350 | Ga0207709_1000035023 | 77 |
| 276 | 3300031344 | Ga0265316_10130885 | Ga0265316_101308853 | 77 |
| 277 | 3300041411 | Ga0439466_0000210 | Ga0439466_0000210_3504_3746 | 77 |
| 278 | 3300041498 | Ga0451841_0896663 | Ga0451841_0896663_466_699 | 77 |
| 279 | 3300042009 | Ga0439451_051511 | Ga0439451_051511_264_497 | 77 |
| 280 | 3300042013 | Ga0439456_012542 | Ga0439456_012542_783_1016 | 77 |
| 281 | 3300042016 | Ga0439463_055798 | Ga0439463_055798_750_983 | 77 |
| 282 | 3300042139 | Ga0450904_016455 | Ga0450904_016455_395_628 | 77 |
| 283 | 3300042461 | Ga0439460_0145693 | Ga0439460_0145693_314_547 | 77 |
| 284 | 3300042532 | Ga0450893_0009120 | Ga0450893_0009120_448_681 | 77 |
| 285 | 3300042993 | Ga0439440_0021555 | Ga0439440_0021555_500_733 | 77 |
| 286 | 3300046453 | Ga0495627_004254 | Ga0495627_004254_2788_3021 | 77 |
| 287 | 3300046458 | Ga0495591_005439 | Ga0495591_005439_4488_4721 | 77 |
| 288 | 3300046458 | Ga0495591_021071 | Ga0495591_021071_789_1022 | 77 |
| 289 | 3300046458 | Ga0495591_033078 | Ga0495591_033078_211_444 | 77 |
| 290 | 3300046460 | Ga0495638_0014931 | Ga0495638_0014931_4176_4409 | 77 |
| 291 | 3300046474 | Ga0495605_0050225 | Ga0495605_0050225_1324_1557 | 77 |
| 292 | 3300046492 | Ga0495585_0053613 | Ga0495585_0053613_637_870 | 77 |
| 293 | 3300046492 | Ga0495585_0064713 | Ga0495585_0064713_1138_1371 | 77 |
| 294 | 3300046501 | Ga0495607_0044527 | Ga0495607_0044527_2117_2350 | 77 |
| 295 | 3300046501 | Ga0495607_0075018 | Ga0495607_0075018_1470_1703 | 77 |
| 296 | 3300046507 | Ga0495606_0003868 | Ga0495606_0003868_8150_8383 | 77 |
| 297 | 3300046507 | Ga0495606_0067682 | Ga0495606_0067682_636_869 | 77 |
| 298 | 3300046507 | Ga0495606_0081816 | Ga0495606_0081816_446_679 | 77 |
| 299 | 3300046507 | Ga0495606_0296678 | Ga0495606_0296678_82_315 | 77 |
| 300 | 3300046507 | Ga0495606_0511393 | Ga0495606_0511393_310_543 | 77 |
| 301 | 3300046512 | Ga0495610_0001544 | Ga0495610_0001544_19117_19350 | 77 |
| 302 | 3300046512 | Ga0495610_0004742 | Ga0495610_0004742_1366_1599 | 77 |
| 303 | 3300046512 | Ga0495610_0009200 | Ga0495610_0009200_3285_3518 | 77 |
| 304 | 3300046512 | Ga0495610_0117289 | Ga0495610_0117289_156_389 | 77 |
| 305 | 3300046515 | Ga0495620_0004800 | Ga0495620_0004800_2784_3017 | 77 |
| 306 | 3300046519 | Ga0495632_0011305 | Ga0495632_0011305_3873_4106 | 77 |
| 307 | 3300046520 | Ga0495637_0047575 | Ga0495637_0047575_584_817 | 77 |
| 308 | 3300046522 | Ga0495643_0048404 | Ga0495643_0048404_2053_2286 | 77 |
| 309 | 3300046524 | Ga0495648_0136790 | Ga0495648_0136790_1011_1244 | 77 |
| 310 | 3300046530 | Ga0495654_0141567 | Ga0495654_0141567_349_582 | 77 |
| 311 | 3300046530 | Ga0495654_0175149 | Ga0495654_0175149_130_363 | 77 |
| 312 | 3300046616 | Ga0495668_0039708 | Ga0495668_0039708_923_1156 | 77 |
| 313 | 3300046648 | Ga0495611_0025189 | Ga0495611_0025189_335_568 | 77 |
| 314 | 3300046665 | Ga0495661_0000773 | Ga0495661_0000773_16895_17128 | 77 |
| 315 | 3300046692 | Ga0495671_0000377 | Ga0495671_0000377_29935_30168 | 77 |
| 316 | 3300046692 | Ga0495671_0032755 | Ga0495671_0032755_1398_1631 | 77 |
| 317 | 3300046692 | Ga0495671_0229663 | Ga0495671_0229663_186_419 | 77 |
| 318 | 3300046694 | Ga0495649_0019441 | Ga0495649_0019441_699_932 | 77 |
| 319 | 3300046694 | Ga0495649_0043082 | Ga0495649_0043082_584_817 | 77 |
| 320 | 3300046694 | Ga0495649_0092334 | Ga0495649_0092334_1130_1363 | 77 |
| 321 | 3300046794 | Ga0495589_0003682 | Ga0495589_0003682_3589_3822 | 77 |
| 322 | 3300046794 | Ga0495589_0071159 | Ga0495589_0071159_1041_1274 | 77 |
| 323 | 3300046810 | Ga0495660_0070707 | Ga0495660_0070707_514_747 | 77 |
| 324 | 3300047446 | Ga0495679_005387 | Ga0495679_005387_4183_4416 | 77 |
| 325 | 3300047446 | Ga0495679_022757 | Ga0495679_022757_532_765 | 77 |
| 326 | 3300047469 | Ga0495673_0055171 | Ga0495673_0055171_749_982 | 77 |
| 327 | 3300047469 | Ga0495673_0070234 | Ga0495673_0070234_67_300 | 77 |
| 328 | 3300047469 | Ga0495673_0138546 | Ga0495673_0138546_130_363 | 77 |
| 329 | 3300047470 | Ga0495681_0015768 | Ga0495681_0015768_3258_3491 | 77 |
| 330 | 3300047470 | Ga0495681_0018369 | Ga0495681_0018369_52_285 | 77 |
| 331 | 3300047470 | Ga0495681_0033575 | Ga0495681_0033575_1665_1898 | 77 |
| 332 | 3300047470 | Ga0495681_0106388 | Ga0495681_0106388_688_921 | 77 |
| 333 | 3300047472 | Ga0495686_0080633 | Ga0495686_0080633_1482_1715 | 77 |
| 334 | 3300048091 | Ga0495626_0060331 | Ga0495626_0060331_488_721 | 77 |
| 335 | 3300048919 | Ga0496116_0000085 | Ga0496116_0000085_18786_19019 | 77 |
| 336 | 3300048920 | Ga0496117_0001620 | Ga0496117_0001620_14932_15165 | 77 |
| 337 | 3300048920 | Ga0496117_0011807 | Ga0496117_0011807_4652_4885 | 77 |
| 338 | 3300048920 | Ga0496117_0095409 | Ga0496117_0095409_648_881 | 77 |
| 339 | 3300048921 | Ga0496118_0112796 | Ga0496118_0112796_425_658 | 77 |
| 340 | 3300048921 | Ga0496118_0114349 | Ga0496118_0114349_304_537 | 77 |
| 341 | 3300048922 | Ga0496119_0025519 | Ga0496119_0025519_759_992 | 77 |
| 342 | 3300048922 | Ga0496119_0081228 | Ga0496119_0081228_707_940 | 77 |
| 343 | 3300048923 | Ga0496120_0009532 | Ga0496120_0009532_3506_3739 | 77 |
| 344 | 3300048923 | Ga0496120_0106524 | Ga0496120_0106524_216_449 | 77 |
| 345 | 3300048924 | Ga0496121_0000179 | Ga0496121_0000179_22405_22638 | 77 |
| 346 | 3300048925 | Ga0496122_0019724 | Ga0496122_0019724_2929_3162 | 77 |
| 347 | 3300048925 | Ga0496122_0265133 | Ga0496122_0265133_424_657 | 77 |
| 348 | 3300048925 | Ga0496122_0436645 | Ga0496122_0436645_282_515 | 77 |
| 349 | 3300048926 | Ga0496123_0006947 | Ga0496123_0006947_1090_1323 | 77 |
| 350 | 3300048926 | Ga0496123_0468191 | Ga0496123_0468191_133_366 | 77 |
| 351 | 3300048927 | Ga0496124_0001693 | Ga0496124_0001693_16818_17051 | 77 |
| 352 | 3300048927 | Ga0496124_0198005 | Ga0496124_0198005_1199_1432 | 77 |
| 353 | 3300048927 | Ga0496124_0515781 | Ga0496124_0515781_75_308 | 77 |
| 354 | 3300048928 | Ga0496125_0001691 | Ga0496125_0001691_16218_16451 | 77 |
| 355 | 3300048928 | Ga0496125_0036633 | Ga0496125_0036633_3481_3714 | 77 |
| 356 | 3300048928 | Ga0496125_0200182 | Ga0496125_0200182_178_411 | 77 |
| 357 | 3300048929 | Ga0496126_0037114 | Ga0496126_0037114_1288_1521 | 77 |
| 358 | 3300049459 | Ga0495678_023839 | Ga0495678_023839_1436_1669 | 77 |
| 359 | 3300049459 | Ga0495678_150381 | Ga0495678_150381_124_357 | 77 |
| 360 | 3300053145 | Ga0500586_199134 | Ga0500586_199134_40_273 | 77 |
| 361 | 2124908027 | MRS2a_Contig_449 | MRS2a_00336440 | 78 |
| 362 | 2162886007 | SwRhRL2b_contig_9416 | SwRhRL2b_0433.00005010 | 78 |
| 363 | 3300002737 | JGI25162J39368_1000100 | JGI25162J39368_100010074 | 78 |
| 364 | 3300002738 | JGI25154J39366_1010304 | JGI25154J39366_10103042 | 78 |
| 365 | 3300002771 | JGI25163J39215_1000366 | JGI25163J39215_10003665 | 78 |
| 366 | 3300002772 | JGI25164J39214_1000079 | JGI25164J39214_100007974 | 78 |
| 367 | 3300003214 | JGI25165J46597_1000183 | JGI25165J46597_100018374 | 78 |
| 368 | 3300003323 | rootH1_10159091 | rootH1_101590913 | 78 |
| 369 | 3300003751 | Ga0055538_1000027 | Ga0055538_1000027147 | 78 |
| 370 | 3300003752 | Ga0055539_1000036 | Ga0055539_1000036147 | 78 |
| 371 | 3300003756 | Ga0055533_1000046 | Ga0055533_1000046147 | 78 |
| 372 | 3300003758 | Ga0055532_1000032 | Ga0055532_1000032147 | 78 |
| 373 | 3300003759 | Ga0055525_1000217 | Ga0055525_100021714 | 78 |
| 374 | 3300003759 | Ga0055525_1009439 | Ga0055525_10094391 | 78 |
| 375 | 3300003761 | Ga0055535_1029868 | Ga0055535_10298682 | 78 |
| 376 | 3300003781 | Ga0055536_1000362 | Ga0055536_100036222 | 78 |
| 377 | 3300003781 | Ga0055536_1000391 | Ga0055536_100039123 | 78 |
| 378 | 3300003781 | Ga0055536_1041221 | Ga0055536_10412211 | 78 |
| 379 | 3300003791 | Ga0055530_10000113 | Ga0055530_1000011356 | 78 |
| 380 | 3300003791 | Ga0055530_10002005 | Ga0055530_100020053 | 78 |
| 381 | 3300003791 | Ga0055530_10003530 | Ga0055530_100035304 | 78 |
| 382 | 3300003792 | Ga0055540_1000154 | Ga0055540_100015414 | 78 |
| 383 | 3300003792 | Ga0055540_1000170 | Ga0055540_100017014 | 78 |
| 384 | 3300003794 | Ga0055531_10000842 | Ga0055531_1000084216 | 78 |
| 385 | 3300003794 | Ga0055531_10106302 | Ga0055531_101063022 | 78 |
| 386 | 3300003841 | Ga0055541_1000024 | Ga0055541_1000024147 | 78 |
| 387 | 3300005288 | Ga0065714_10003448 | Ga0065714_100034484 | 78 |
| 388 | 3300005288 | Ga0065714_10065086 | Ga0065714_100650867 | 78 |
| 389 | 3300005288 | Ga0065714_10065134 | Ga0065714_100651343 | 78 |
| 390 | 3300005288 | Ga0065714_10065524 | Ga0065714_100655242 | 78 |
| 391 | 3300005288 | Ga0065714_10065645 | Ga0065714_100656455 | 78 |
| 392 | 3300005288 | Ga0065714_10071128 | Ga0065714_100711283 | 78 |
| 393 | 3300005288 | Ga0065714_10151886 | Ga0065714_101518861 | 78 |
| 394 | 3300005288 | Ga0065714_10192218 | Ga0065714_101922182 | 78 |
| 395 | 3300005288 | Ga0065714_10248730 | Ga0065714_102487302 | 78 |
| 396 | 3300005289 | Ga0065704_10008790 | Ga0065704_100087903 | 78 |
| 397 | 3300005289 | Ga0065704_10070997 | Ga0065704_100709973 | 78 |
| 398 | 3300005290 | Ga0065712_10077776 | Ga0065712_100777763 | 78 |
| 399 | 3300005293 | Ga0065715_10463401 | Ga0065715_104634011 | 78 |
| 400 | 3300005328 | Ga0070676_10709116 | Ga0070676_107091162 | 78 |
| 401 | 3300005331 | Ga0070670_100022866 | Ga0070670_1000228662 | 78 |
| 402 | 3300005344 | Ga0070661_100000008 | Ga0070661_100000008143 | 78 |
| 403 | 3300005353 | Ga0070669_100000579 | Ga0070669_10000057914 | 78 |
| 404 | 3300005353 | Ga0070669_100301821 | Ga0070669_1003018211 | 78 |
| 405 | 3300005353 | Ga0070669_100418801 | Ga0070669_1004188012 | 78 |
| 406 | 3300005353 | Ga0070669_100594378 | Ga0070669_1005943782 | 78 |
| 407 | 3300005366 | Ga0070659_100630535 | Ga0070659_1006305352 | 78 |
| 408 | 3300005457 | Ga0070662_100000388 | Ga0070662_10000038814 | 78 |
| 409 | 3300005548 | Ga0070665_100189991 | Ga0070665_1001899913 | 78 |
| 410 | 3300005548 | Ga0070665_101315365 | Ga0070665_1013153651 | 78 |
| 411 | 3300005564 | Ga0070664_100000028 | Ga0070664_10000002851 | 78 |
| 412 | 3300005577 | Ga0068857_101147489 | Ga0068857_1011474892 | 78 |
| 413 | 3300005578 | Ga0068854_100025361 | Ga0068854_1000253613 | 78 |
| 414 | 3300005834 | Ga0068851_10000068 | Ga0068851_1000006824 | 78 |
| 415 | 3300006028 | Ga0070717_11548613 | Ga0070717_115486132 | 78 |
| 416 | 3300006051 | Ga0075364_10066979 | Ga0075364_100669792 | 78 |
| 417 | 3300006051 | Ga0075364_10084878 | Ga0075364_100848782 | 78 |
| 418 | 3300006051 | Ga0075364_10516479 | Ga0075364_105164792 | 78 |
| 419 | 3300006058 | Ga0075432_10006592 | Ga0075432_100065924 | 78 |
| 420 | 3300006058 | Ga0075432_10146805 | Ga0075432_101468052 | 78 |
| 421 | 3300006058 | Ga0075432_10403646 | Ga0075432_104036461 | 78 |
| 422 | 3300006177 | Ga0075362_10644463 | Ga0075362_106444632 | 78 |
| 423 | 3300006914 | Ga0075436_100903128 | Ga0075436_1009031282 | 78 |
| 424 | 3300006946 | Ga0079104_1000676 | Ga0079104_100067616 | 78 |
| 425 | 3300006946 | Ga0079104_1003227 | Ga0079104_10032274 | 78 |
| 426 | 3300006946 | Ga0079104_1086989 | Ga0079104_10869892 | 78 |
| 427 | 3300006946 | Ga0079104_1106266 | Ga0079104_11062661 | 78 |
| 428 | 3300009011 | Ga0105251_10002641 | Ga0105251_100026413 | 78 |
| 429 | 3300009011 | Ga0105251_10010986 | Ga0105251_100109864 | 78 |
| 430 | 3300009011 | Ga0105251_10037148 | Ga0105251_100371482 | 78 |
| 431 | 3300009011 | Ga0105251_10184456 | Ga0105251_101844561 | 78 |
| 432 | 3300009011 | Ga0105251_10203855 | Ga0105251_102038552 | 78 |
| 433 | 3300009011 | Ga0105251_10315213 | Ga0105251_103152132 | 78 |
| 434 | 3300009011 | Ga0105251_10496421 | Ga0105251_104964211 | 78 |
| 435 | 3300009036 | Ga0105244_10004871 | Ga0105244_100048718 | 78 |
| 436 | 3300009036 | Ga0105244_10005389 | Ga0105244_100053893 | 78 |
| 437 | 3300009036 | Ga0105244_10026118 | Ga0105244_100261182 | 78 |
| 438 | 3300009036 | Ga0105244_10065022 | Ga0105244_100650223 | 78 |
| 439 | 3300009036 | Ga0105244_10108077 | Ga0105244_101080772 | 78 |
| 440 | 3300009036 | Ga0105244_10210113 | Ga0105244_102101132 | 78 |
| 441 | 3300009092 | Ga0105250_10000180 | Ga0105250_100001807 | 78 |
| 442 | 3300009092 | Ga0105250_10003055 | Ga0105250_100030555 | 78 |
| 443 | 3300009092 | Ga0105250_10078404 | Ga0105250_100784041 | 78 |
| 444 | 3300009092 | Ga0105250_10179206 | Ga0105250_101792062 | 78 |
| 445 | 3300009092 | Ga0105250_10249086 | Ga0105250_102490861 | 78 |
| 446 | 3300009148 | Ga0105243_10000451 | Ga0105243_1000045119 | 78 |
| 447 | 3300009148 | Ga0105243_10605625 | Ga0105243_106056252 | 78 |
| 448 | 3300009148 | Ga0105243_12854837 | Ga0105243_128548371 | 78 |
| 449 | 3300009176 | Ga0105242_10000024 | Ga0105242_1000002440 | 78 |
| 450 | 3300009177 | Ga0105248_10306112 | Ga0105248_103061122 | 78 |
| 451 | 3300009545 | Ga0105237_10144455 | Ga0105237_101444553 | 78 |
| 452 | 3300009545 | Ga0105237_10245206 | Ga0105237_102452062 | 78 |
| 453 | 3300011119 | Ga0105246_10001574 | Ga0105246_100015743 | 78 |
| 454 | 3300011119 | Ga0105246_10344830 | Ga0105246_103448302 | 78 |
| 455 | 3300012498 | Ga0157345_1000081 | Ga0157345_10000813 | 78 |
| 456 | 3300013100 | Ga0157373_10000593 | Ga0157373_1000059316 | 78 |
| 457 | 3300013100 | Ga0157373_10005230 | Ga0157373_100052303 | 78 |
| 458 | 3300013100 | Ga0157373_10034426 | Ga0157373_100344262 | 78 |
| 459 | 3300013100 | Ga0157373_10075043 | Ga0157373_100750432 | 78 |
| 460 | 3300013100 | Ga0157373_11019802 | Ga0157373_110198022 | 78 |
| 461 | 3300013100 | Ga0157373_11435105 | Ga0157373_114351051 | 78 |
| 462 | 3300013102 | Ga0157371_10000583 | Ga0157371_1000058315 | 78 |
| 463 | 3300013102 | Ga0157371_10026343 | Ga0157371_100263434 | 78 |
| 464 | 3300013102 | Ga0157371_10029477 | Ga0157371_100294773 | 78 |
| 465 | 3300013102 | Ga0157371_10528442 | Ga0157371_105284422 | 78 |
| 466 | 3300013104 | Ga0157370_10025749 | Ga0157370_100257494 | 78 |
| 467 | 3300013104 | Ga0157370_10034132 | Ga0157370_100341324 | 78 |
| 468 | 3300013104 | Ga0157370_10116449 | Ga0157370_101164492 | 78 |
| 469 | 3300013104 | Ga0157370_10122454 | Ga0157370_101224542 | 78 |
| 470 | 3300013104 | Ga0157370_10139652 | Ga0157370_101396523 | 78 |
| 471 | 3300013104 | Ga0157370_10640182 | Ga0157370_106401822 | 78 |
| 472 | 3300013104 | Ga0157370_11699099 | Ga0157370_116990991 | 78 |
| 473 | 3300013104 | Ga0157370_11998981 | Ga0157370_119989811 | 78 |
| 474 | 3300013105 | Ga0157369_10007489 | Ga0157369_100074895 | 78 |
| 475 | 3300013105 | Ga0157369_10026040 | Ga0157369_100260402 | 78 |
| 476 | 3300013105 | Ga0157369_10124067 | Ga0157369_101240672 | 78 |
| 477 | 3300013105 | Ga0157369_10162310 | Ga0157369_101623103 | 78 |
| 478 | 3300013105 | Ga0157369_10237276 | Ga0157369_102372763 | 78 |
| 479 | 3300013105 | Ga0157369_10306275 | Ga0157369_103062752 | 78 |
| 480 | 3300013105 | Ga0157369_10546892 | Ga0157369_105468922 | 78 |
| 481 | 3300013306 | Ga0163162_10033464 | Ga0163162_100334643 | 78 |
| 482 | 3300013308 | Ga0157375_10011410 | Ga0157375_100114103 | 78 |
| 483 | 3300013308 | Ga0157375_10496052 | Ga0157375_104960522 | 78 |
| 484 | 3300014497 | Ga0182008_10002558 | Ga0182008_1000255811 | 78 |
| 485 | 3300014497 | Ga0182008_10003740 | Ga0182008_100037408 | 78 |
| 486 | 3300014497 | Ga0182008_10032174 | Ga0182008_100321743 | 78 |
| 487 | 3300015261 | Ga0182006_1000750 | Ga0182006_100075010 | 78 |
| 488 | 3300015261 | Ga0182006_1000997 | Ga0182006_10009974 | 78 |
| 489 | 3300015261 | Ga0182006_1010943 | Ga0182006_10109433 | 78 |
| 490 | 3300015261 | Ga0182006_1015982 | Ga0182006_10159822 | 78 |
| 491 | 3300015261 | Ga0182006_1121783 | Ga0182006_11217831 | 78 |
| 492 | 3300015261 | Ga0182006_1142881 | Ga0182006_11428811 | 78 |
| 493 | 3300015262 | Ga0182007_10000143 | Ga0182007_1000014315 | 78 |
| 494 | 3300015262 | Ga0182007_10028714 | Ga0182007_100287142 | 78 |
| 495 | 3300015262 | Ga0182007_10180095 | Ga0182007_101800952 | 78 |
| 496 | 3300015262 | Ga0182007_10182958 | Ga0182007_101829582 | 78 |
| 497 | 3300015262 | Ga0182007_10281916 | Ga0182007_102819162 | 78 |
| 498 | 3300015265 | Ga0182005_1000800 | Ga0182005_10008002 | 78 |
| 499 | 3300015265 | Ga0182005_1034772 | Ga0182005_10347722 | 78 |
| 500 | 3300015265 | Ga0182005_1056902 | Ga0182005_10569022 | 78 |
| 501 | 3300017792 | Ga0163161_10003088 | Ga0163161_100030884 | 78 |
| 502 | 3300017792 | Ga0163161_11107236 | Ga0163161_111072361 | 78 |
| 503 | 3300017792 | Ga0163161_11654599 | Ga0163161_116545992 | 78 |
| 504 | 3300025206 | Ga0209435_110293 | Ga0209435_1102932 | 78 |
| 505 | 3300025207 | Ga0209760_100052 | Ga0209760_10005273 | 78 |
| 506 | 3300025224 | Ga0209784_100017 | Ga0209784_100017302 | 78 |
| 507 | 3300025225 | Ga0209566_100014 | Ga0209566_100014302 | 78 |
| 508 | 3300025226 | Ga0209674_100028 | Ga0209674_100028302 | 78 |
| 509 | 3300025229 | Ga0209147_100038 | Ga0209147_100038157 | 78 |
| 510 | 3300025230 | Ga0209563_100032 | Ga0209563_100032302 | 78 |
| 511 | 3300025230 | Ga0209563_100193 | Ga0209563_10019335 | 78 |
| 512 | 3300025231 | Ga0207427_100029 | Ga0207427_10002921 | 78 |
| 513 | 3300025233 | Ga0209437_100009 | Ga0209437_100009276 | 78 |
| 514 | 3300025242 | Ga0209258_100197 | Ga0209258_10019782 | 78 |
| 515 | 3300025246 | Ga0209646_1000711 | Ga0209646_10007116 | 78 |
| 516 | 3300025253 | Ga0209677_100018 | Ga0209677_100018302 | 78 |
| 517 | 3300025256 | Ga0209759_1005073 | Ga0209759_10050734 | 78 |
| 518 | 3300025256 | Ga0209759_1022298 | Ga0209759_10222982 | 78 |
| 519 | 3300025261 | Ga0209233_1000032 | Ga0209233_1000032276 | 78 |
| 520 | 3300025291 | Ga0209675_1005911 | Ga0209675_10059114 | 78 |
| 521 | 3300025292 | Ga0209676_1000016 | Ga0209676_1000016370 | 78 |
| 522 | 3300025292 | Ga0209676_1000033 | Ga0209676_1000033198 | 78 |
| 523 | 3300025292 | Ga0209676_1002055 | Ga0209676_10020559 | 78 |
| 524 | 3300025298 | Ga0209050_1000009 | Ga0209050_1000009137 | 78 |
| 525 | 3300025298 | Ga0209050_1000036 | Ga0209050_1000036188 | 78 |
| 526 | 3300025303 | Ga0209051_1000043 | Ga0209051_1000043260 | 78 |
| 527 | 3300025303 | Ga0209051_1000053 | Ga0209051_1000053137 | 78 |
| 528 | 3300025304 | Ga0209257_1000098 | Ga0209257_100009853 | 78 |
| 529 | 3300025304 | Ga0209257_1010396 | Ga0209257_10103962 | 78 |
| 530 | 3300025321 | Ga0207656_10000089 | Ga0207656_1000008918 | 78 |
| 531 | 3300025711 | Ga0207696_1000043 | Ga0207696_1000043243 | 78 |
| 532 | 3300025711 | Ga0207696_1001093 | Ga0207696_100109311 | 78 |
| 533 | 3300025711 | Ga0207696_1015471 | Ga0207696_10154713 | 78 |
| 534 | 3300025711 | Ga0207696_1099842 | Ga0207696_10998421 | 78 |
| 535 | 3300025728 | Ga0207655_1000095 | Ga0207655_1000095159 | 78 |
| 536 | 3300025728 | Ga0207655_1001318 | Ga0207655_10013189 | 78 |
| 537 | 3300025728 | Ga0207655_1002702 | Ga0207655_100270210 | 78 |
| 538 | 3300025728 | Ga0207655_1008609 | Ga0207655_10086096 | 78 |
| 539 | 3300025728 | Ga0207655_1018148 | Ga0207655_10181482 | 78 |
| 540 | 3300025735 | Ga0207713_1001420 | Ga0207713_10014205 | 78 |
| 541 | 3300025735 | Ga0207713_1003434 | Ga0207713_10034345 | 78 |
| 542 | 3300025735 | Ga0207713_1005710 | Ga0207713_10057105 | 78 |
| 543 | 3300025735 | Ga0207713_1013374 | Ga0207713_10133742 | 78 |
| 544 | 3300025735 | Ga0207713_1053355 | Ga0207713_10533552 | 78 |
| 545 | 3300025735 | Ga0207713_1218481 | Ga0207713_12184812 | 78 |
| 546 | 3300025907 | Ga0207645_11081834 | Ga0207645_110818341 | 78 |
| 547 | 3300025914 | Ga0207671_10000035 | Ga0207671_10000035147 | 78 |
| 548 | 3300025920 | Ga0207649_10000017 | Ga0207649_1000001718 | 78 |
| 549 | 3300025923 | Ga0207681_10000835 | Ga0207681_100008356 | 78 |
| 550 | 3300025923 | Ga0207681_10027375 | Ga0207681_100273752 | 78 |
| 551 | 3300025923 | Ga0207681_10226781 | Ga0207681_102267812 | 78 |
| 552 | 3300025925 | Ga0207650_10001330 | Ga0207650_100013302 | 78 |
| 553 | 3300025932 | Ga0207690_11098812 | Ga0207690_110988121 | 78 |
| 554 | 3300025933 | Ga0207706_10000170 | Ga0207706_1000017050 | 78 |
| 555 | 3300025934 | Ga0207686_10037438 | Ga0207686_100374383 | 78 |
| 556 | 3300025935 | Ga0207709_10000036 | Ga0207709_10000036233 | 78 |
| 557 | 3300025941 | Ga0207711_10219890 | Ga0207711_102198902 | 78 |
| 558 | 3300025945 | Ga0207679_10000005 | Ga0207679_10000005237 | 78 |
| 559 | 3300025945 | Ga0207679_10112075 | Ga0207679_101120752 | 78 |
| 560 | 3300025981 | Ga0207640_10032869 | Ga0207640_100328692 | 78 |
| 561 | 3300026116 | Ga0207674_11685104 | Ga0207674_116851041 | 78 |
| 562 | 3300027111 | Ga0209281_1000172 | Ga0209281_1000172120 | 78 |
| 563 | 3300027111 | Ga0209281_1002499 | Ga0209281_10024994 | 78 |
| 564 | 3300027111 | Ga0209281_1008985 | Ga0209281_10089853 | 78 |
| 565 | 3300027111 | Ga0209281_1009557 | Ga0209281_10095572 | 78 |
| 566 | 3300027111 | Ga0209281_1059341 | Ga0209281_10593411 | 78 |
| 567 | 3300027907 | Ga0207428_10052129 | Ga0207428_100521293 | 78 |
| 568 | 3300027907 | Ga0207428_10379095 | Ga0207428_103790952 | 78 |
| 569 | 3300028379 | Ga0268266_10041099 | Ga0268266_100410992 | 78 |
| 570 | 3300028379 | Ga0268266_12041360 | Ga0268266_120413601 | 78 |
| 571 | 3300028786 | Ga0307517_10152648 | Ga0307517_101526482 | 78 |
| 572 | 3300028786 | Ga0307517_10380240 | Ga0307517_103802401 | 78 |
| 573 | 3300030521 | Ga0307511_10338628 | Ga0307511_103386282 | 78 |
| 574 | 3300030521 | Ga0307511_10355633 | Ga0307511_103556331 | 78 |
| 575 | 3300030735 | Ga0316178_1161793 | Ga0316178_11617933 | 78 |
| 576 | 3300030744 | Ga0316181_1076629 | Ga0316181_10766293 | 78 |
| 577 | 3300031507 | Ga0307509_10058296 | Ga0307509_100582961 | 78 |
| 578 | 3300031548 | Ga0307408_100003851 | Ga0307408_1000038513 | 78 |
| 579 | 3300031548 | Ga0307408_100052108 | Ga0307408_1000521082 | 78 |
| 580 | 3300031548 | Ga0307408_100168745 | Ga0307408_1001687452 | 78 |
| 581 | 3300031730 | Ga0307516_10194640 | Ga0307516_101946401 | 78 |
| 582 | 3300031730 | Ga0307516_10207335 | Ga0307516_102073352 | 78 |
| 583 | 3300031731 | Ga0307405_10000148 | Ga0307405_1000014818 | 78 |
| 584 | 3300031901 | Ga0307406_10590351 | Ga0307406_105903511 | 78 |
| 585 | 3300031903 | Ga0307407_10110702 | Ga0307407_101107022 | 78 |
| 586 | 3300031903 | Ga0307407_10248612 | Ga0307407_102486122 | 78 |
| 587 | 3300031911 | Ga0307412_10092885 | Ga0307412_100928853 | 78 |
| 588 | 3300031911 | Ga0307412_10530125 | Ga0307412_105301252 | 78 |
| 589 | 3300031911 | Ga0307412_10555070 | Ga0307412_105550702 | 78 |
| 590 | 3300031911 | Ga0307412_10799667 | Ga0307412_107996672 | 78 |
| 591 | 3300032002 | Ga0307416_100724355 | Ga0307416_1007243552 | 78 |
| 592 | 3300032002 | Ga0307416_101574603 | Ga0307416_1015746032 | 78 |
| 593 | 3300032004 | Ga0307414_10152903 | Ga0307414_101529033 | 78 |
| 594 | 3300032004 | Ga0307414_10477821 | Ga0307414_104778211 | 78 |
| 595 | 3300032005 | Ga0307411_10073133 | Ga0307411_100731331 | 78 |
| 596 | 3300032005 | Ga0307411_11568955 | Ga0307411_115689552 | 78 |
| 597 | 3300038705 | Ga0237819_04361 | Ga0237819_04361_1275_1511 | 78 |
| 598 | 3300041405 | Ga0439438_001947 | Ga0439438_001947_7911_8147 | 78 |
| 599 | 3300041405 | Ga0439438_013399 | Ga0439438_013399_663_899 | 78 |
| 600 | 3300041405 | Ga0439438_108813 | Ga0439438_108813_419_658 | 78 |
| 601 | 3300041405 | Ga0439438_133340 | Ga0439438_133340_12_251 | 78 |
| 602 | 3300041405 | Ga0439438_176169 | Ga0439438_176169_262_498 | 78 |
| 603 | 3300041407 | Ga0439447_001682 | Ga0439447_001682_6671_6907 | 78 |
| 604 | 3300041407 | Ga0439447_018880 | Ga0439447_018880_423_659 | 78 |
| 605 | 3300041407 | Ga0439447_026416 | Ga0439447_026416_139_375 | 78 |
| 606 | 3300041407 | Ga0439447_029934 | Ga0439447_029934_137_382 | 78 |
| 607 | 3300041407 | Ga0439447_059499 | Ga0439447_059499_392_631 | 78 |
| 608 | 3300041411 | Ga0439466_0004698 | Ga0439466_0004698_1730_1966 | 78 |
| 609 | 3300041411 | Ga0439466_0033490 | Ga0439466_0033490_1081_1317 | 78 |
| 610 | 3300041411 | Ga0439466_0038598 | Ga0439466_0038598_1160_1396 | 78 |
| 611 | 3300041411 | Ga0439466_0044783 | Ga0439466_0044783_794_1030 | 78 |
| 612 | 3300041413 | Ga0439465_0006255 | Ga0439465_0006255_2122_2358 | 78 |
| 613 | 3300041498 | Ga0451841_0215041 | Ga0451841_0215041_374_610 | 78 |
| 614 | 3300041509 | Ga0451843_0380463 | Ga0451843_0380463_170_409 | 78 |
| 615 | 3300041997 | Ga0439431_0000893 | Ga0439431_0000893_3333_3569 | 78 |
| 616 | 3300042004 | Ga0439445_0067994 | Ga0439445_0067994_315_554 | 78 |
| 617 | 3300042004 | Ga0439445_0143953 | Ga0439445_0143953_405_644 | 78 |
| 618 | 3300042004 | Ga0439445_0220782 | Ga0439445_0220782_284_520 | 78 |
| 619 | 3300042006 | Ga0439432_003985 | Ga0439432_003985_4757_4993 | 78 |
| 620 | 3300042006 | Ga0439432_004679 | Ga0439432_004679_2584_2820 | 78 |
| 621 | 3300042006 | Ga0439432_009861 | Ga0439432_009861_1356_1601 | 78 |
| 622 | 3300042009 | Ga0439451_000899 | Ga0439451_000899_2115_2351 | 78 |
| 623 | 3300042009 | Ga0439451_002691 | Ga0439451_002691_2207_2443 | 78 |
| 624 | 3300042009 | Ga0439451_005962 | Ga0439451_005962_1624_1860 | 78 |
| 625 | 3300042009 | Ga0439451_015645 | Ga0439451_015645_720_956 | 78 |
| 626 | 3300042009 | Ga0439451_041973 | Ga0439451_041973_264_500 | 78 |
| 627 | 3300042009 | Ga0439451_046382 | Ga0439451_046382_97_333 | 78 |
| 628 | 3300042009 | Ga0439451_058159 | Ga0439451_058159_29_265 | 78 |
| 629 | 3300042010 | Ga0439452_019397 | Ga0439452_019397_370_606 | 78 |
| 630 | 3300042010 | Ga0439452_025198 | Ga0439452_025198_1077_1313 | 78 |
| 631 | 3300042010 | Ga0439452_025626 | Ga0439452_025626_418_657 | 78 |
| 632 | 3300042010 | Ga0439452_126262 | Ga0439452_126262_37_273 | 78 |
| 633 | 3300042013 | Ga0439456_001820 | Ga0439456_001820_1658_1894 | 78 |
| 634 | 3300042013 | Ga0439456_069164 | Ga0439456_069164_209_445 | 78 |
| 635 | 3300042013 | Ga0439456_099842 | Ga0439456_099842_73_309 | 78 |
| 636 | 3300042013 | Ga0439456_124594 | Ga0439456_124594_102_338 | 78 |
| 637 | 3300042016 | Ga0439463_021112 | Ga0439463_021112_596_832 | 78 |
| 638 | 3300042115 | Ga0450911_005477 | Ga0450911_005477_861_1097 | 78 |
| 639 | 3300042116 | Ga0450912_007723 | Ga0450912_007723_502_738 | 78 |
| 640 | 3300042121 | Ga0450919_002405 | Ga0450919_002405_1076_1312 | 78 |
| 641 | 3300042124 | Ga0450922_007365 | Ga0450922_007365_337_573 | 78 |
| 642 | 3300042127 | Ga0450890_000610 | Ga0450890_000610_1184_1420 | 78 |
| 643 | 3300042130 | Ga0450892_011333 | Ga0450892_011333_272_508 | 78 |
| 644 | 3300042136 | Ga0450900_068521 | Ga0450900_068521_114_353 | 78 |
| 645 | 3300042137 | Ga0450902_015108 | Ga0450902_015108_938_1174 | 78 |
| 646 | 3300042138 | Ga0450903_001584 | Ga0450903_001584_3045_3281 | 78 |
| 647 | 3300042139 | Ga0450904_008178 | Ga0450904_008178_542_781 | 78 |
| 648 | 3300042142 | Ga0450905_003100 | Ga0450905_003100_391_627 | 78 |
| 649 | 3300042145 | Ga0450906_007238 | Ga0450906_007238_916_1152 | 78 |
| 650 | 3300042146 | Ga0450907_001013 | Ga0450907_001013_5580_5816 | 78 |
| 651 | 3300042146 | Ga0450907_010936 | Ga0450907_010936_786_1025 | 78 |
| 652 | 3300042147 | Ga0450910_000904 | Ga0450910_000904_3118_3354 | 78 |
| 653 | 3300042147 | Ga0450910_015437 | Ga0450910_015437_580_816 | 78 |
| 654 | 3300042156 | Ga0439446_0018280 | Ga0439446_0018280_1076_1312 | 78 |
| 655 | 3300042184 | Ga0450908_006686 | Ga0450908_006686_723_959 | 78 |
| 656 | 3300042185 | Ga0450909_003084 | Ga0450909_003084_697_933 | 78 |
| 657 | 3300042435 | Ga0439434_0085923 | Ga0439434_0085923_562_798 | 78 |
| 658 | 3300042461 | Ga0439460_0015510 | Ga0439460_0015510_727_963 | 78 |
| 659 | 3300042532 | Ga0450893_0006743 | Ga0450893_0006743_1020_1256 | 78 |
| 660 | 3300042532 | Ga0450893_0013634 | Ga0450893_0013634_1051_1287 | 78 |
| 661 | 3300042993 | Ga0439440_0008787 | Ga0439440_0008787_692_928 | 78 |
| 662 | 3300046452 | Ga0495617_000327 | Ga0495617_000327_25893_26129 | 78 |
| 663 | 3300046452 | Ga0495617_010431 | Ga0495617_010431_551_787 | 78 |
| 664 | 3300046452 | Ga0495617_019467 | Ga0495617_019467_1778_2017 | 78 |
| 665 | 3300046452 | Ga0495617_020302 | Ga0495617_020302_514_750 | 78 |
| 666 | 3300046452 | Ga0495617_058620 | Ga0495617_058620_664_900 | 78 |
| 667 | 3300046452 | Ga0495617_063705 | Ga0495617_063705_62_298 | 78 |
| 668 | 3300046452 | Ga0495617_079901 | Ga0495617_079901_428_664 | 78 |
| 669 | 3300046452 | Ga0495617_122471 | Ga0495617_122471_435_671 | 78 |
| 670 | 3300046453 | Ga0495627_020332 | Ga0495627_020332_1443_1682 | 78 |
| 671 | 3300046453 | Ga0495627_026027 | Ga0495627_026027_592_828 | 78 |
| 672 | 3300046454 | Ga0495592_0104335 | Ga0495592_0104335_836_1072 | 78 |
| 673 | 3300046455 | Ga0495603_0321448 | Ga0495603_0321448_118_354 | 78 |
| 674 | 3300046455 | Ga0495603_0717352 | Ga0495603_0717352_162_398 | 78 |
| 675 | 3300046457 | Ga0495590_0032831 | Ga0495590_0032831_1019_1255 | 78 |
| 676 | 3300046457 | Ga0495590_0034403 | Ga0495590_0034403_464_700 | 78 |
| 677 | 3300046457 | Ga0495590_0044000 | Ga0495590_0044000_259_495 | 78 |
| 678 | 3300046457 | Ga0495590_0044874 | Ga0495590_0044874_77_313 | 78 |
| 679 | 3300046458 | Ga0495591_012253 | Ga0495591_012253_889_1125 | 78 |
| 680 | 3300046458 | Ga0495591_014139 | Ga0495591_014139_1831_2067 | 78 |
| 681 | 3300046458 | Ga0495591_014821 | Ga0495591_014821_786_1025 | 78 |
| 682 | 3300046458 | Ga0495591_021448 | Ga0495591_021448_691_930 | 78 |
| 683 | 3300046458 | Ga0495591_068473 | Ga0495591_068473_589_825 | 78 |
| 684 | 3300046460 | Ga0495638_0063478 | Ga0495638_0063478_1433_1669 | 78 |
| 685 | 3300046460 | Ga0495638_0254095 | Ga0495638_0254095_21_257 | 78 |
| 686 | 3300046463 | Ga0495653_0006548 | Ga0495653_0006548_2944_3180 | 78 |
| 687 | 3300046463 | Ga0495653_0019975 | Ga0495653_0019975_3774_4010 | 78 |
| 688 | 3300046463 | Ga0495653_0143755 | Ga0495653_0143755_701_937 | 78 |
| 689 | 3300046471 | Ga0495650_0038016 | Ga0495650_0038016_792_1028 | 78 |
| 690 | 3300046471 | Ga0495650_0043624 | Ga0495650_0043624_1238_1474 | 78 |
| 691 | 3300046471 | Ga0495650_0043909 | Ga0495650_0043909_867_1103 | 78 |
| 692 | 3300046471 | Ga0495650_0141147 | Ga0495650_0141147_313_549 | 78 |
| 693 | 3300046471 | Ga0495650_0287459 | Ga0495650_0287459_23_262 | 78 |
| 694 | 3300046472 | Ga0495580_0249009 | Ga0495580_0249009_106_342 | 78 |
| 695 | 3300046474 | Ga0495605_0001320 | Ga0495605_0001320_11506_11742 | 78 |
| 696 | 3300046474 | Ga0495605_0016458 | Ga0495605_0016458_632_871 | 78 |
| 697 | 3300046474 | Ga0495605_0039196 | Ga0495605_0039196_1297_1533 | 78 |
| 698 | 3300046474 | Ga0495605_0050933 | Ga0495605_0050933_801_1037 | 78 |
| 699 | 3300046474 | Ga0495605_0059732 | Ga0495605_0059732_921_1157 | 78 |
| 700 | 3300046474 | Ga0495605_0069676 | Ga0495605_0069676_181_417 | 78 |
| 701 | 3300046474 | Ga0495605_0094212 | Ga0495605_0094212_991_1227 | 78 |
| 702 | 3300046475 | Ga0495639_0000714 | Ga0495639_0000714_14453_14689 | 78 |
| 703 | 3300046475 | Ga0495639_0328600 | Ga0495639_0328600_59_295 | 78 |
| 704 | 3300046491 | Ga0495584_0001356 | Ga0495584_0001356_185_421 | 78 |
| 705 | 3300046491 | Ga0495584_0003392 | Ga0495584_0003392_5995_6231 | 78 |
| 706 | 3300046491 | Ga0495584_0041130 | Ga0495584_0041130_1488_1724 | 78 |
| 707 | 3300046491 | Ga0495584_0087031 | Ga0495584_0087031_549_785 | 78 |
| 708 | 3300046491 | Ga0495584_0091666 | Ga0495584_0091666_993_1229 | 78 |
| 709 | 3300046491 | Ga0495584_0173416 | Ga0495584_0173416_357_596 | 78 |
| 710 | 3300046491 | Ga0495584_0643750 | Ga0495584_0643750_224_460 | 78 |
| 711 | 3300046492 | Ga0495585_0010554 | Ga0495585_0010554_4153_4389 | 78 |
| 712 | 3300046492 | Ga0495585_0287265 | Ga0495585_0287265_458_694 | 78 |
| 713 | 3300046492 | Ga0495585_0479708 | Ga0495585_0479708_288_524 | 78 |
| 714 | 3300046492 | Ga0495585_0504896 | Ga0495585_0504896_154_390 | 78 |
| 715 | 3300046499 | Ga0495594_0085319 | Ga0495594_0085319_1062_1298 | 78 |
| 716 | 3300046499 | Ga0495594_0517572 | Ga0495594_0517572_101_337 | 78 |
| 717 | 3300046500 | Ga0495596_0446655 | Ga0495596_0446655_106_345 | 78 |
| 718 | 3300046501 | Ga0495607_0000655 | Ga0495607_0000655_32431_32667 | 78 |
| 719 | 3300046501 | Ga0495607_0001755 | Ga0495607_0001755_18162_18398 | 78 |
| 720 | 3300046501 | Ga0495607_0004203 | Ga0495607_0004203_1405_1641 | 78 |
| 721 | 3300046501 | Ga0495607_0014936 | Ga0495607_0014936_347_583 | 78 |
| 722 | 3300046501 | Ga0495607_0020561 | Ga0495607_0020561_1012_1248 | 78 |
| 723 | 3300046501 | Ga0495607_0106195 | Ga0495607_0106195_707_943 | 78 |
| 724 | 3300046501 | Ga0495607_0151363 | Ga0495607_0151363_120_359 | 78 |
| 725 | 3300046501 | Ga0495607_0199120 | Ga0495607_0199120_50_286 | 78 |
| 726 | 3300046501 | Ga0495607_0312059 | Ga0495607_0312059_444_680 | 78 |
| 727 | 3300046501 | Ga0495607_0317932 | Ga0495607_0317932_241_477 | 78 |
| 728 | 3300046506 | Ga0495583_0001561 | Ga0495583_0001561_6511_6756 | 78 |
| 729 | 3300046506 | Ga0495583_0108766 | Ga0495583_0108766_412_648 | 78 |
| 730 | 3300046507 | Ga0495606_0075214 | Ga0495606_0075214_598_834 | 78 |
| 731 | 3300046507 | Ga0495606_0078217 | Ga0495606_0078217_1089_1325 | 78 |
| 732 | 3300046507 | Ga0495606_0083878 | Ga0495606_0083878_517_753 | 78 |
| 733 | 3300046507 | Ga0495606_0190858 | Ga0495606_0190858_41_277 | 78 |
| 734 | 3300046512 | Ga0495610_0022244 | Ga0495610_0022244_883_1119 | 78 |
| 735 | 3300046512 | Ga0495610_0032277 | Ga0495610_0032277_985_1221 | 78 |
| 736 | 3300046512 | Ga0495610_0047577 | Ga0495610_0047577_1229_1465 | 78 |
| 737 | 3300046512 | Ga0495610_0083075 | Ga0495610_0083075_474_710 | 78 |
| 738 | 3300046512 | Ga0495610_0148770 | Ga0495610_0148770_55_300 | 78 |
| 739 | 3300046512 | Ga0495610_0213867 | Ga0495610_0213867_352_588 | 78 |
| 740 | 3300046512 | Ga0495610_0277251 | Ga0495610_0277251_378_623 | 78 |
| 741 | 3300046513 | Ga0495616_0029743 | Ga0495616_0029743_638_877 | 78 |
| 742 | 3300046513 | Ga0495616_0042041 | Ga0495616_0042041_1137_1373 | 78 |
| 743 | 3300046513 | Ga0495616_0043788 | Ga0495616_0043788_1139_1375 | 78 |
| 744 | 3300046513 | Ga0495616_0057902 | Ga0495616_0057902_1112_1348 | 78 |
| 745 | 3300046513 | Ga0495616_0156734 | Ga0495616_0156734_571_807 | 78 |
| 746 | 3300046515 | Ga0495620_0004858 | Ga0495620_0004858_989_1225 | 78 |
| 747 | 3300046515 | Ga0495620_0013240 | Ga0495620_0013240_914_1150 | 78 |
| 748 | 3300046515 | Ga0495620_0037976 | Ga0495620_0037976_1447_1686 | 78 |
| 749 | 3300046515 | Ga0495620_0041416 | Ga0495620_0041416_470_706 | 78 |
| 750 | 3300046515 | Ga0495620_0059262 | Ga0495620_0059262_988_1224 | 78 |
| 751 | 3300046516 | Ga0495628_0102425 | Ga0495628_0102425_189_425 | 78 |
| 752 | 3300046517 | Ga0495630_0265401 | Ga0495630_0265401_570_806 | 78 |
| 753 | 3300046518 | Ga0495631_0001232 | Ga0495631_0001232_1339_1575 | 78 |
| 754 | 3300046518 | Ga0495631_0039064 | Ga0495631_0039064_1287_1523 | 78 |
| 755 | 3300046518 | Ga0495631_0239117 | Ga0495631_0239117_438_683 | 78 |
| 756 | 3300046518 | Ga0495631_0239911 | Ga0495631_0239911_251_487 | 78 |
| 757 | 3300046518 | Ga0495631_0348172 | Ga0495631_0348172_320_556 | 78 |
| 758 | 3300046519 | Ga0495632_0002507 | Ga0495632_0002507_534_770 | 78 |
| 759 | 3300046519 | Ga0495632_0051933 | Ga0495632_0051933_1153_1389 | 78 |
| 760 | 3300046519 | Ga0495632_0064247 | Ga0495632_0064247_1012_1251 | 78 |
| 761 | 3300046519 | Ga0495632_0237552 | Ga0495632_0237552_571_807 | 78 |
| 762 | 3300046519 | Ga0495632_0400428 | Ga0495632_0400428_93_329 | 78 |
| 763 | 3300046520 | Ga0495637_0000187 | Ga0495637_0000187_45612_45848 | 78 |
| 764 | 3300046520 | Ga0495637_0010404 | Ga0495637_0010404_3132_3368 | 78 |
| 765 | 3300046520 | Ga0495637_0048558 | Ga0495637_0048558_474_710 | 78 |
| 766 | 3300046520 | Ga0495637_0049009 | Ga0495637_0049009_497_736 | 78 |
| 767 | 3300046520 | Ga0495637_0177451 | Ga0495637_0177451_154_390 | 78 |
| 768 | 3300046522 | Ga0495643_0073847 | Ga0495643_0073847_1374_1610 | 78 |
| 769 | 3300046522 | Ga0495643_0078686 | Ga0495643_0078686_582_818 | 78 |
| 770 | 3300046522 | Ga0495643_0131300 | Ga0495643_0131300_143_379 | 78 |
| 771 | 3300046523 | Ga0495644_0064015 | Ga0495644_0064015_980_1216 | 78 |
| 772 | 3300046523 | Ga0495644_0079041 | Ga0495644_0079041_691_927 | 78 |
| 773 | 3300046524 | Ga0495648_0046293 | Ga0495648_0046293_1830_2066 | 78 |
| 774 | 3300046524 | Ga0495648_0054086 | Ga0495648_0054086_1035_1271 | 78 |
| 775 | 3300046524 | Ga0495648_0058470 | Ga0495648_0058470_599_838 | 78 |
| 776 | 3300046524 | Ga0495648_0074960 | Ga0495648_0074960_600_836 | 78 |
| 777 | 3300046524 | Ga0495648_0079298 | Ga0495648_0079298_489_725 | 78 |
| 778 | 3300046524 | Ga0495648_0149432 | Ga0495648_0149432_302_538 | 78 |
| 779 | 3300046524 | Ga0495648_0203652 | Ga0495648_0203652_466_702 | 78 |
| 780 | 3300046526 | Ga0495666_0019502 | Ga0495666_0019502_1414_1650 | 78 |
| 781 | 3300046526 | Ga0495666_0079701 | Ga0495666_0079701_375_611 | 78 |
| 782 | 3300046528 | Ga0495642_0031860 | Ga0495642_0031860_535_771 | 78 |
| 783 | 3300046530 | Ga0495654_0000870 | Ga0495654_0000870_6497_6742 | 78 |
| 784 | 3300046530 | Ga0495654_0009384 | Ga0495654_0009384_475_711 | 78 |
| 785 | 3300046530 | Ga0495654_0010391 | Ga0495654_0010391_3818_4054 | 78 |
| 786 | 3300046530 | Ga0495654_0018271 | Ga0495654_0018271_2418_2654 | 78 |
| 787 | 3300046530 | Ga0495654_0027452 | Ga0495654_0027452_2582_2818 | 78 |
| 788 | 3300046530 | Ga0495654_0027896 | Ga0495654_0027896_800_1039 | 78 |
| 789 | 3300046530 | Ga0495654_0036713 | Ga0495654_0036713_488_724 | 78 |
| 790 | 3300046530 | Ga0495654_0079991 | Ga0495654_0079991_1094_1330 | 78 |
| 791 | 3300046530 | Ga0495654_0106309 | Ga0495654_0106309_878_1114 | 78 |
| 792 | 3300046530 | Ga0495654_0180117 | Ga0495654_0180117_180_416 | 78 |
| 793 | 3300046530 | Ga0495654_0297653 | Ga0495654_0297653_19_255 | 78 |
| 794 | 3300046536 | Ga0495587_0018188 | Ga0495587_0018188_2534_2770 | 78 |
| 795 | 3300046536 | Ga0495587_0324178 | Ga0495587_0324178_609_845 | 78 |
| 796 | 3300046538 | Ga0495609_0005792 | Ga0495609_0005792_5584_5820 | 78 |
| 797 | 3300046538 | Ga0495609_0007937 | Ga0495609_0007937_2097_2333 | 78 |
| 798 | 3300046538 | Ga0495609_0015538 | Ga0495609_0015538_2344_2580 | 78 |
| 799 | 3300046538 | Ga0495609_0043026 | Ga0495609_0043026_1408_1647 | 78 |
| 800 | 3300046538 | Ga0495609_0063818 | Ga0495609_0063818_443_679 | 78 |
| 801 | 3300046542 | Ga0495597_0043614 | Ga0495597_0043614_1158_1394 | 78 |
| 802 | 3300046542 | Ga0495597_0082283 | Ga0495597_0082283_554_790 | 78 |
| 803 | 3300046542 | Ga0495597_0206888 | Ga0495597_0206888_406_642 | 78 |
| 804 | 3300046542 | Ga0495597_0229701 | Ga0495597_0229701_36_275 | 78 |
| 805 | 3300046557 | Ga0495622_0002066 | Ga0495622_0002066_8800_9036 | 78 |
| 806 | 3300046557 | Ga0495622_0014065 | Ga0495622_0014065_1333_1569 | 78 |
| 807 | 3300046557 | Ga0495622_0046259 | Ga0495622_0046259_609_845 | 78 |
| 808 | 3300046557 | Ga0495622_0445457 | Ga0495622_0445457_280_516 | 78 |
| 809 | 3300046558 | Ga0495633_0015447 | Ga0495633_0015447_1164_1400 | 78 |
| 810 | 3300046558 | Ga0495633_0049604 | Ga0495633_0049604_598_834 | 78 |
| 811 | 3300046558 | Ga0495633_0159357 | Ga0495633_0159357_112_348 | 78 |
| 812 | 3300046615 | Ga0495656_0152179 | Ga0495656_0152179_184_420 | 78 |
| 813 | 3300046615 | Ga0495656_0715316 | Ga0495656_0715316_163_399 | 78 |
| 814 | 3300046616 | Ga0495668_0127672 | Ga0495668_0127672_321_557 | 78 |
| 815 | 3300046642 | Ga0495634_0012245 | Ga0495634_0012245_1173_1409 | 78 |
| 816 | 3300046642 | Ga0495634_0065442 | Ga0495634_0065442_766_1002 | 78 |
| 817 | 3300046648 | Ga0495611_0060264 | Ga0495611_0060264_1208_1444 | 78 |
| 818 | 3300046648 | Ga0495611_0078271 | Ga0495611_0078271_420_656 | 78 |
| 819 | 3300046660 | Ga0495625_0031997 | Ga0495625_0031997_1090_1326 | 78 |
| 820 | 3300046660 | Ga0495625_0063823 | Ga0495625_0063823_1791_2030 | 78 |
| 821 | 3300046660 | Ga0495625_0154226 | Ga0495625_0154226_484_720 | 78 |
| 822 | 3300046660 | Ga0495625_0155893 | Ga0495625_0155893_428_664 | 78 |
| 823 | 3300046660 | Ga0495625_0195570 | Ga0495625_0195570_240_476 | 78 |
| 824 | 3300046660 | Ga0495625_0368138 | Ga0495625_0368138_475_711 | 78 |
| 825 | 3300046663 | Ga0495635_0014016 | Ga0495635_0014016_1333_1569 | 78 |
| 826 | 3300046664 | Ga0495659_0026538 | Ga0495659_0026538_553_789 | 78 |
| 827 | 3300046664 | Ga0495659_0035214 | Ga0495659_0035214_400_636 | 78 |
| 828 | 3300046664 | Ga0495659_0349806 | Ga0495659_0349806_381_617 | 78 |
| 829 | 3300046665 | Ga0495661_0008915 | Ga0495661_0008915_6379_6624 | 78 |
| 830 | 3300046665 | Ga0495661_0027284 | Ga0495661_0027284_820_1056 | 78 |
| 831 | 3300046665 | Ga0495661_0118140 | Ga0495661_0118140_499_735 | 78 |
| 832 | 3300046665 | Ga0495661_0301024 | Ga0495661_0301024_145_381 | 78 |
| 833 | 3300046665 | Ga0495661_0311730 | Ga0495661_0311730_121_360 | 78 |
| 834 | 3300046665 | Ga0495661_0577250 | Ga0495661_0577250_122_358 | 78 |
| 835 | 3300046674 | Ga0495588_0173183 | Ga0495588_0173183_20_256 | 78 |
| 836 | 3300046679 | Ga0495623_0009827 | Ga0495623_0009827_4763_4999 | 78 |
| 837 | 3300046680 | Ga0495646_0012643 | Ga0495646_0012643_2489_2725 | 78 |
| 838 | 3300046680 | Ga0495646_0045300 | Ga0495646_0045300_1396_1632 | 78 |
| 839 | 3300046689 | Ga0495613_0065131 | Ga0495613_0065131_1013_1249 | 78 |
| 840 | 3300046689 | Ga0495613_0092377 | Ga0495613_0092377_1031_1267 | 78 |
| 841 | 3300046689 | Ga0495613_0161253 | Ga0495613_0161253_943_1179 | 78 |
| 842 | 3300046689 | Ga0495613_0747323 | Ga0495613_0747323_93_329 | 78 |
| 843 | 3300046690 | Ga0495624_0001003 | Ga0495624_0001003_17138_17374 | 78 |
| 844 | 3300046691 | Ga0495670_0000389 | Ga0495670_0000389_18171_18407 | 78 |
| 845 | 3300046691 | Ga0495670_0013878 | Ga0495670_0013878_1353_1589 | 78 |
| 846 | 3300046691 | Ga0495670_0084657 | Ga0495670_0084657_1120_1356 | 78 |
| 847 | 3300046691 | Ga0495670_0147650 | Ga0495670_0147650_124_360 | 78 |
| 848 | 3300046691 | Ga0495670_0152544 | Ga0495670_0152544_37_273 | 78 |
| 849 | 3300046691 | Ga0495670_0682514 | Ga0495670_0682514_214_450 | 78 |
| 850 | 3300046692 | Ga0495671_0000307 | Ga0495671_0000307_39624_39860 | 78 |
| 851 | 3300046692 | Ga0495671_0041495 | Ga0495671_0041495_611_850 | 78 |
| 852 | 3300046692 | Ga0495671_0055115 | Ga0495671_0055115_1159_1395 | 78 |
| 853 | 3300046692 | Ga0495671_0140344 | Ga0495671_0140344_668_904 | 78 |
| 854 | 3300046692 | Ga0495671_0195145 | Ga0495671_0195145_177_413 | 78 |
| 855 | 3300046692 | Ga0495671_0339607 | Ga0495671_0339607_58_294 | 78 |
| 856 | 3300046694 | Ga0495649_0001633 | Ga0495649_0001633_4877_5113 | 78 |
| 857 | 3300046694 | Ga0495649_0024279 | Ga0495649_0024279_2452_2688 | 78 |
| 858 | 3300046694 | Ga0495649_0036297 | Ga0495649_0036297_570_809 | 78 |
| 859 | 3300046694 | Ga0495649_0036768 | Ga0495649_0036768_1096_1341 | 78 |
| 860 | 3300046694 | Ga0495649_0067292 | Ga0495649_0067292_1369_1605 | 78 |
| 861 | 3300046694 | Ga0495649_0086894 | Ga0495649_0086894_302_538 | 78 |
| 862 | 3300046794 | Ga0495589_0000194 | Ga0495589_0000194_4607_4843 | 78 |
| 863 | 3300046794 | Ga0495589_0002053 | Ga0495589_0002053_880_1116 | 78 |
| 864 | 3300046794 | Ga0495589_0257392 | Ga0495589_0257392_102_338 | 78 |
| 865 | 3300046794 | Ga0495589_0266236 | Ga0495589_0266236_461_697 | 78 |
| 866 | 3300046809 | Ga0495600_0089290 | Ga0495600_0089290_668_904 | 78 |
| 867 | 3300046810 | Ga0495660_0003352 | Ga0495660_0003352_4579_4824 | 78 |
| 868 | 3300046810 | Ga0495660_0035438 | Ga0495660_0035438_687_923 | 78 |
| 869 | 3300046810 | Ga0495660_0042076 | Ga0495660_0042076_397_636 | 78 |
| 870 | 3300046810 | Ga0495660_0044608 | Ga0495660_0044608_1284_1520 | 78 |
| 871 | 3300046810 | Ga0495660_0054628 | Ga0495660_0054628_110_346 | 78 |
| 872 | 3300046810 | Ga0495660_0065101 | Ga0495660_0065101_1149_1385 | 78 |
| 873 | 3300046810 | Ga0495660_0067034 | Ga0495660_0067034_576_812 | 78 |
| 874 | 3300046810 | Ga0495660_0329094 | Ga0495660_0329094_414_650 | 78 |
| 875 | 3300047315 | Ga0495581_0095470 | Ga0495581_0095470_417_653 | 78 |
| 876 | 3300047317 | Ga0495604_0053907 | Ga0495604_0053907_698_934 | 78 |
| 877 | 3300047317 | Ga0495604_0065469 | Ga0495604_0065469_1112_1348 | 78 |
| 878 | 3300047318 | Ga0495636_0044292 | Ga0495636_0044292_606_842 | 78 |
| 879 | 3300047319 | Ga0495674_0027872 | Ga0495674_0027872_1078_1314 | 78 |
| 880 | 3300047320 | Ga0495672_0004930 | Ga0495672_0004930_1489_1725 | 78 |
| 881 | 3300047320 | Ga0495672_0015161 | Ga0495672_0015161_173_409 | 78 |
| 882 | 3300047320 | Ga0495672_0021422 | Ga0495672_0021422_1418_1654 | 78 |
| 883 | 3300047320 | Ga0495672_0064656 | Ga0495672_0064656_619_855 | 78 |
| 884 | 3300047320 | Ga0495672_0105399 | Ga0495672_0105399_173_409 | 78 |
| 885 | 3300047321 | Ga0495676_0110851 | Ga0495676_0110851_562_798 | 78 |
| 886 | 3300047322 | Ga0495680_0026473 | Ga0495680_0026473_1198_1434 | 78 |
| 887 | 3300047322 | Ga0495680_0090594 | Ga0495680_0090594_2035_2271 | 78 |
| 888 | 3300047323 | Ga0495683_0002776 | Ga0495683_0002776_8974_9210 | 78 |
| 889 | 3300047323 | Ga0495683_0006216 | Ga0495683_0006216_5885_6121 | 78 |
| 890 | 3300047323 | Ga0495683_0080317 | Ga0495683_0080317_915_1151 | 78 |
| 891 | 3300047323 | Ga0495683_0100217 | Ga0495683_0100217_718_957 | 78 |
| 892 | 3300047323 | Ga0495683_0110107 | Ga0495683_0110107_734_970 | 78 |
| 893 | 3300047323 | Ga0495683_0271858 | Ga0495683_0271858_126_362 | 78 |
| 894 | 3300047443 | Ga0495687_044216 | Ga0495687_044216_1315_1551 | 78 |
| 895 | 3300047443 | Ga0495687_115414 | Ga0495687_115414_602_838 | 78 |
| 896 | 3300047446 | Ga0495679_001372 | Ga0495679_001372_13211_13456 | 78 |
| 897 | 3300047446 | Ga0495679_001589 | Ga0495679_001589_5478_5723 | 78 |
| 898 | 3300047446 | Ga0495679_015499 | Ga0495679_015499_544_783 | 78 |
| 899 | 3300047446 | Ga0495679_030605 | Ga0495679_030605_1050_1289 | 78 |
| 900 | 3300047469 | Ga0495673_0003020 | Ga0495673_0003020_667_903 | 78 |
| 901 | 3300047469 | Ga0495673_0026774 | Ga0495673_0026774_577_816 | 78 |
| 902 | 3300047469 | Ga0495673_0046008 | Ga0495673_0046008_1047_1283 | 78 |
| 903 | 3300047469 | Ga0495673_0065731 | Ga0495673_0065731_1143_1379 | 78 |
| 904 | 3300047469 | Ga0495673_0068698 | Ga0495673_0068698_894_1133 | 78 |
| 905 | 3300047470 | Ga0495681_0005323 | Ga0495681_0005323_5705_5941 | 78 |
| 906 | 3300047470 | Ga0495681_0021062 | Ga0495681_0021062_1160_1396 | 78 |
| 907 | 3300047470 | Ga0495681_0037051 | Ga0495681_0037051_853_1089 | 78 |
| 908 | 3300047470 | Ga0495681_0038988 | Ga0495681_0038988_1194_1430 | 78 |
| 909 | 3300047470 | Ga0495681_0058247 | Ga0495681_0058247_947_1186 | 78 |
| 910 | 3300047470 | Ga0495681_0077921 | Ga0495681_0077921_770_1006 | 78 |
| 911 | 3300047470 | Ga0495681_0201669 | Ga0495681_0201669_194_433 | 78 |
| 912 | 3300047471 | Ga0495684_0069061 | Ga0495684_0069061_1417_1653 | 78 |
| 913 | 3300047472 | Ga0495686_0083666 | Ga0495686_0083666_546_782 | 78 |
| 914 | 3300047472 | Ga0495686_0088430 | Ga0495686_0088430_651_887 | 78 |
| 915 | 3300047673 | Ga0495593_0070990 | Ga0495593_0070990_694_930 | 78 |
| 916 | 3300047673 | Ga0495593_0071140 | Ga0495593_0071140_277_513 | 78 |
| 917 | 3300047673 | Ga0495593_0200653 | Ga0495593_0200653_753_989 | 78 |
| 918 | 3300048088 | Ga0495602_0031550 | Ga0495602_0031550_3359_3595 | 78 |
| 919 | 3300048091 | Ga0495626_0003523 | Ga0495626_0003523_8555_8791 | 78 |
| 920 | 3300048091 | Ga0495626_0009007 | Ga0495626_0009007_489_725 | 78 |
| 921 | 3300048091 | Ga0495626_0037662 | Ga0495626_0037662_544_783 | 78 |
| 922 | 3300048091 | Ga0495626_0065354 | Ga0495626_0065354_125_361 | 78 |
| 923 | 3300048091 | Ga0495626_0068377 | Ga0495626_0068377_605_841 | 78 |
| 924 | 3300048091 | Ga0495626_0073819 | Ga0495626_0073819_296_532 | 78 |
| 925 | 3300048091 | Ga0495626_0241831 | Ga0495626_0241831_375_611 | 78 |
| 926 | 3300048091 | Ga0495626_0356101 | Ga0495626_0356101_71_307 | 78 |
| 927 | 3300048905 | Ga0496102_0004455 | Ga0496102_0004455_1612_1848 | 78 |
| 928 | 3300048906 | Ga0496103_0021772 | Ga0496103_0021772_2558_2794 | 78 |
| 929 | 3300048908 | Ga0496105_0704587 | Ga0496105_0704587_527_763 | 78 |
| 930 | 3300048909 | Ga0496106_0198099 | Ga0496106_0198099_175_411 | 78 |
| 931 | 3300048910 | Ga0496107_1099274 | Ga0496107_1099274_93_329 | 78 |
| 932 | 3300048913 | Ga0496110_0494573 | Ga0496110_0494573_384_620 | 78 |
| 933 | 3300048915 | Ga0496112_0221243 | Ga0496112_0221243_895_1131 | 78 |
| 934 | 3300048917 | Ga0496114_0353194 | Ga0496114_0353194_155_391 | 78 |
| 935 | 3300048918 | Ga0496115_0172523 | Ga0496115_0172523_1338_1574 | 78 |
| 936 | 3300048919 | Ga0496116_0001088 | Ga0496116_0001088_30963_31199 | 78 |
| 937 | 3300048919 | Ga0496116_0002312 | Ga0496116_0002312_19151_19387 | 78 |
| 938 | 3300048919 | Ga0496116_0032645 | Ga0496116_0032645_1015_1251 | 78 |
| 939 | 3300048919 | Ga0496116_0061978 | Ga0496116_0061978_953_1192 | 78 |
| 940 | 3300048919 | Ga0496116_0074368 | Ga0496116_0074368_761_1000 | 78 |
| 941 | 3300048920 | Ga0496117_0032234 | Ga0496117_0032234_1196_1432 | 78 |
| 942 | 3300048920 | Ga0496117_0055410 | Ga0496117_0055410_1960_2205 | 78 |
| 943 | 3300048920 | Ga0496117_0088609 | Ga0496117_0088609_618_857 | 78 |
| 944 | 3300048920 | Ga0496117_0092318 | Ga0496117_0092318_917_1165 | 78 |
| 945 | 3300048920 | Ga0496117_0161415 | Ga0496117_0161415_969_1208 | 78 |
| 946 | 3300048920 | Ga0496117_0276673 | Ga0496117_0276673_305_541 | 78 |
| 947 | 3300048921 | Ga0496118_0018066 | Ga0496118_0018066_5018_5257 | 78 |
| 948 | 3300048921 | Ga0496118_0034843 | Ga0496118_0034843_2716_2952 | 78 |
| 949 | 3300048921 | Ga0496118_0051681 | Ga0496118_0051681_409_654 | 78 |
| 950 | 3300048921 | Ga0496118_0097736 | Ga0496118_0097736_1120_1359 | 78 |
| 951 | 3300048921 | Ga0496118_0230431 | Ga0496118_0230431_771_1007 | 78 |
| 952 | 3300048921 | Ga0496118_0578922 | Ga0496118_0578922_265_501 | 78 |
| 953 | 3300048922 | Ga0496119_0137789 | Ga0496119_0137789_186_425 | 78 |
| 954 | 3300048922 | Ga0496119_0226100 | Ga0496119_0226100_23_259 | 78 |
| 955 | 3300048923 | Ga0496120_0149119 | Ga0496120_0149119_737_976 | 78 |
| 956 | 3300048924 | Ga0496121_0022604 | Ga0496121_0022604_1214_1450 | 78 |
| 957 | 3300048924 | Ga0496121_0039080 | Ga0496121_0039080_334_579 | 78 |
| 958 | 3300048924 | Ga0496121_0042923 | Ga0496121_0042923_1009_1245 | 78 |
| 959 | 3300048924 | Ga0496121_0116747 | Ga0496121_0116747_1105_1344 | 78 |
| 960 | 3300048924 | Ga0496121_0670547 | Ga0496121_0670547_347_583 | 78 |
| 961 | 3300048925 | Ga0496122_0025135 | Ga0496122_0025135_400_636 | 78 |
| 962 | 3300048925 | Ga0496122_0048380 | Ga0496122_0048380_2946_3191 | 78 |
| 963 | 3300048925 | Ga0496122_0104123 | Ga0496122_0104123_1135_1374 | 78 |
| 964 | 3300048925 | Ga0496122_0143541 | Ga0496122_0143541_264_503 | 78 |
| 965 | 3300048925 | Ga0496122_0420285 | Ga0496122_0420285_284_523 | 78 |
| 966 | 3300048926 | Ga0496123_0082998 | Ga0496123_0082998_1292_1531 | 78 |
| 967 | 3300048926 | Ga0496123_0099233 | Ga0496123_0099233_1307_1552 | 78 |
| 968 | 3300048926 | Ga0496123_0107324 | Ga0496123_0107324_724_963 | 78 |
| 969 | 3300048926 | Ga0496123_0171370 | Ga0496123_0171370_86_331 | 78 |
| 970 | 3300048926 | Ga0496123_0374622 | Ga0496123_0374622_354_590 | 78 |
| 971 | 3300048927 | Ga0496124_0025284 | Ga0496124_0025284_1323_1568 | 78 |
| 972 | 3300048927 | Ga0496124_0072809 | Ga0496124_0072809_1972_2217 | 78 |
| 973 | 3300048927 | Ga0496124_0076738 | Ga0496124_0076738_1170_1415 | 78 |
| 974 | 3300048927 | Ga0496124_0119923 | Ga0496124_0119923_918_1157 | 78 |
| 975 | 3300048927 | Ga0496124_0280459 | Ga0496124_0280459_344_580 | 78 |
| 976 | 3300048927 | Ga0496124_0288474 | Ga0496124_0288474_43_288 | 78 |
| 977 | 3300048928 | Ga0496125_0005335 | Ga0496125_0005335_136_381 | 78 |
| 978 | 3300048928 | Ga0496125_0037228 | Ga0496125_0037228_180_416 | 78 |
| 979 | 3300048928 | Ga0496125_0073871 | Ga0496125_0073871_1960_2205 | 78 |
| 980 | 3300048928 | Ga0496125_0128524 | Ga0496125_0128524_110_346 | 78 |
| 981 | 3300048929 | Ga0496126_0009164 | Ga0496126_0009164_9693_9938 | 78 |
| 982 | 3300048929 | Ga0496126_0133460 | Ga0496126_0133460_1394_1630 | 78 |
| 983 | 3300049459 | Ga0495678_001578 | Ga0495678_001578_2188_2424 | 78 |
| 984 | 3300049459 | Ga0495678_019547 | Ga0495678_019547_2239_2475 | 78 |
| 985 | 3300049459 | Ga0495678_030472 | Ga0495678_030472_1268_1504 | 78 |
| 986 | 3300049459 | Ga0495678_039602 | Ga0495678_039602_567_806 | 78 |
| 987 | 3300049459 | Ga0495678_041527 | Ga0495678_041527_458_694 | 78 |
| 988 | 3300049459 | Ga0495678_047779 | Ga0495678_047779_581_817 | 78 |
| 989 | 3300049459 | Ga0495678_152370 | Ga0495678_152370_180_416 | 78 |
| 990 | 3300049460 | Ga0495682_0024472 | Ga0495682_0024472_918_1154 | 78 |
| 991 | 3300049460 | Ga0495682_0033100 | Ga0495682_0033100_1086_1322 | 78 |
| 992 | 3300049460 | Ga0495682_0194055 | Ga0495682_0194055_378_614 | 78 |
| 993 | 3300049460 | Ga0495682_0223264 | Ga0495682_0223264_117_353 | 78 |
| 994 | 3300049758 | Ga0501241_008359 | Ga0501241_008359_1138_1374 | 78 |
| 995 | 3300053111 | Ga0500572_018857 | Ga0500572_018857_1038_1277 | 78 |
| 996 | 3300053126 | Ga0500621_181547 | Ga0500621_181547_142_378 | 78 |
| 997 | 3300053161 | Ga0500634_0003648 | Ga0500634_0003648_265_510 | 78 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hug-assembly6.cif.gz_F | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.7164 | 8 | 59 |
| 5wuq-assembly2.cif.gz_D | crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form | 0.6942 | 8 | 68 |
| 5wur-assembly1.cif.gz_C | crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form | 0.6769 | 5 | 67 |
| 2z2s-assembly1.cif.gz_B | crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr | 0.6724 | 9 | 70 |
| 2z2s-assembly2.cif.gz_D | crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr | 0.6709 | 9 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hugF00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.7164 | 8 | 59 | 1.10.10.1320 |
| 2z2sB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.7033 | 9 | 66 | 1.10.10.1320 |
| 2z2sD01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.687 | 9 | 66 | 1.10.10.1320 |
| 3hugF00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6617 | 8 | 59 | 1.10.10.1320 |
| 3hugL00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.652 | 7 | 67 | 1.10.10.1320 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R6YKZ8-F1-model_v4 | Anti-sigma-K factor RskA | 0.9352 | 3 | 59 |
|
| AF-A0A2N2NJG7-F1-model_v4 | Zinc-finger domain-containing protein | 0.9042 | 1 | 59 |
GO:0016020
|
| AF-A0A7C3GNG7-F1-model_v4 | Zinc-finger domain-containing protein | 0.83 | 2 | 61 |
GO:0016020
|
| AF-A0A547P9W6-F1-model_v4 | Zinc-finger domain-containing protein | 0.8293 | 1 | 62 |
|
| AF-A0A7C2U771-F1-model_v4 | Putative zinc-finger domain-containing protein | 0.8127 | 2 | 59 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar