F487792

General Info

Members Datasets Scaffolds Average Seq Length
997 428 821 77

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10065086|Ga0065714_100650867
Length 81
Sequence MLTCKEQVARSSDYLDGQLTFRERLLVRHHLMFCPNCRRFIRQMRLMQATLKIMPDEPVEGVDALAQRLAAERLKDHKDGE

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231016 Pseudomonas sp. GM50 Isolate Nodule
10 2511231022 Pseudomonas sp. GM79 Isolate Nodule
11 2511231023 Pseudomonas sp. GM80 Isolate Nodule
12 2511231031 Pseudomonas sp. GM16 Isolate Nodule
13 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
14 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
15 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
16 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
17 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
18 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
19 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
20 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
21 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
22 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
23 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
24 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
25 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
26 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
27 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
28 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
29 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
30 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
31 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
32 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
33 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
34 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
35 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
36 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
37 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
38 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
39 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
40 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
41 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
42 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
43 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
44 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
45 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
46 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
47 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
48 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
49 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
50 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
51 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
52 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
53 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
54 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
55 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
56 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
57 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
58 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
59 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
60 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
61 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
62 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
63 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
64 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
65 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
66 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
67 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
68 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
69 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
70 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
71 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
72 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
73 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
74 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
75 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
76 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
77 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
78 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
79 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
80 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
81 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
82 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
83 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
84 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
85 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
86 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
87 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
88 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
89 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
90 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
91 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
92 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
93 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
94 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
95 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
96 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
97 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
98 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
99 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
100 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
101 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
102 2773857673 Pseudomonas sp. 443 Isolate Unclassified
103 2784132063 Pseudomonas sp. 424 Isolate Unclassified
104 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
105 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
106 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
107 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
108 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
109 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
110 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
111 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
112 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
113 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
114 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
115 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
116 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
117 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
118 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
119 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
120 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
121 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
122 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
123 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
124 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
125 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
126 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
127 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
128 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
129 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
130 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
131 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
132 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
133 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
134 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
135 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
136 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
137 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
138 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
139 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
140 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
141 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
142 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
143 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
144 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
145 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
146 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
147 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
148 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
149 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
150 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
151 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
152 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
153 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
154 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
155 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
156 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
157 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
158 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
159 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
160 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
161 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
162 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
163 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
164 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
165 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
166 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
167 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
168 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
169 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
170 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
171 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
172 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
173 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
174 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
175 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
176 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
177 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
178 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
179 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
180 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
181 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
182 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
183 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
184 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
185 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
186 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
187 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
188 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
189 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
190 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
191 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
192 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
193 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
194 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
195 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
196 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
197 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
198 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
199 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
200 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
201 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
202 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
203 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
204 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
205 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
206 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
207 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
208 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
209 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
210 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
211 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
212 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
213 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
214 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
215 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
216 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
217 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
218 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
219 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
220 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
221 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
222 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
223 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
229 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
230 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
232 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
234 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
235 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
236 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
258 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
259 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
261 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
262 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
263 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
264 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
265 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
266 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
267 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
268 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
269 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
270 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
271 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
272 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
273 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
274 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
275 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
276 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
277 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
278 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
279 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
280 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
281 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
282 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
283 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
284 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
285 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
286 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
287 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
288 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
289 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
290 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
291 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
292 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
293 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
294 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
295 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
296 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
297 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
298 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
299 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
300 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
301 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
302 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
303 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
304 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
305 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
306 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
307 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
308 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
309 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
310 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
311 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
312 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
313 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
314 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
315 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
316 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
317 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
318 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
319 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
320 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
321 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
322 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
323 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
324 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
325 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
326 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
327 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
328 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
329 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
330 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
331 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
332 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
333 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
334 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
335 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
336 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
337 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
338 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
339 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
340 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
341 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
342 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
343 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
344 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
345 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
346 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
347 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
348 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
349 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
350 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
351 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
352 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
353 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
354 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
355 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
356 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
357 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
358 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
359 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
360 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
361 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
362 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
363 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
364 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
365 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
366 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
367 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
368 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
369 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
370 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
371 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
372 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
373 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
374 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
375 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
376 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
377 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
378 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
379 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
380 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
381 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
382 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
383 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
384 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
385 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
386 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
387 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
388 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
389 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
390 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
391 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
392 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
393 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
394 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
395 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
396 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
397 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
398 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
399 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
400 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
401 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
402 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
403 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
404 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
405 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
406 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
407 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
408 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
409 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
410 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
411 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
412 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
413 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
414 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
415 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
416 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
417 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
418 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
419 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
420 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
421 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
422 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
423 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
424 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
425 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
426 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
427 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
428 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.35
Metatranscriptomes 0
Isolates 17.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.72
Nodule 2.01
Rhizoplane 7.12
Rhizosphere 71.82
Stem 0
Stem Tuber 0
Unclassified 12.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_449 2124908027 Bacteria 2542
2 MRS2a_Contig_8358 2124908027 Bacteria 1981
3 SwRhRL2b_contig_9416 2162886007 Bacteria 1988
4 JGI25162J39368_1000085 3300002737 Bacteria 107722
5 JGI25162J39368_1000100 3300002737 Bacteria 94568
6 JGI25154J39366_1010304 3300002738 Bacteria 1112
7 JGI25163J39215_1000366 3300002771 Bacteria 14567
8 JGI25163J39215_1000401 3300002771 Bacteria 13748
9 JGI25164J39214_1000063 3300002772 Bacteria 107722
10 JGI25164J39214_1000079 3300002772 Bacteria 94568
11 JGI25165J46597_1000160 3300003214 Bacteria 107722
12 JGI25165J46597_1000183 3300003214 Bacteria 94568
13 rootH1_10159091 3300003323 Bacteria 2188
14 Ga0055538_1000027 3300003751 Bacteria 216576
15 Ga0055539_1000036 3300003752 Bacteria 216576
16 Ga0055533_1000046 3300003756 Bacteria 216576
17 Ga0055532_1000032 3300003758 Bacteria 216568
18 Ga0055525_1000217 3300003759 Bacteria 62978
19 Ga0055525_1009439 3300003759 Bacteria 824
20 Ga0055535_1029868 3300003761 Bacteria 573
21 Ga0055536_1000041 3300003781 Bacteria 127266
22 Ga0055536_1000362 3300003781 Bacteria 33679
23 Ga0055536_1000391 3300003781 Bacteria 31787
24 Ga0055536_1041221 3300003781 Bacteria 1092
25 Ga0055530_10000113 3300003791 Bacteria 70767
26 Ga0055530_10000290 3300003791 Bacteria 45698
27 Ga0055530_10002005 3300003791 Bacteria 13797
28 Ga0055530_10003530 3300003791 Bacteria 8821
29 Ga0055540_1000154 3300003792 Bacteria 67934
30 Ga0055540_1000170 3300003792 Bacteria 64696
31 Ga0055540_1000584 3300003792 Bacteria 26615
32 Ga0055531_10000842 3300003794 Bacteria 25309
33 Ga0055531_10106302 3300003794 Bacteria 567
34 Ga0055541_1000024 3300003841 Bacteria 216576
35 Ga0065714_10003448 3300005288 Bacteria 9250
36 Ga0065714_10065086 3300005288 Bacteria 13133
37 Ga0065714_10065134 3300005288 Bacteria 12629
38 Ga0065714_10065524 3300005288 Bacteria 9615
39 Ga0065714_10065645 3300005288 Bacteria 9025
40 Ga0065714_10071128 3300005288 Bacteria 3646
41 Ga0065714_10151886 3300005288 Bacteria 1087
42 Ga0065714_10192218 3300005288 Bacteria 922
43 Ga0065714_10248730 3300005288 Bacteria 771
44 Ga0065704_10008790 3300005289 Bacteria 3930
45 Ga0065704_10070997 3300005289 Bacteria 13885
46 Ga0065704_10157503 3300005289 Bacteria 1380
47 Ga0065704_10724502 3300005289 Bacteria 527
48 Ga0065712_10077776 3300005290 Bacteria 3443
49 Ga0065715_10463401 3300005293 Bacteria 813
50 Ga0070676_10709116 3300005328 Bacteria 735
51 Ga0070670_100001455 3300005331 Bacteria 19037
52 Ga0070670_100022866 3300005331 Bacteria 5379
53 Ga0070661_100000008 3300005344 Bacteria 183494
54 Ga0070669_100000579 3300005353 Bacteria 27197
55 Ga0070669_100301821 3300005353 Bacteria 1288
56 Ga0070669_100418801 3300005353 Bacteria 1099
57 Ga0070669_100594378 3300005353 Bacteria 927
58 Ga0070659_100630535 3300005366 Bacteria 923
59 Ga0070662_100000388 3300005457 Bacteria 26210
60 Ga0070665_100189991 3300005548 Bacteria 2055
61 Ga0070665_101315365 3300005548 Bacteria 732
62 Ga0070664_100000028 3300005564 Bacteria 90414
63 Ga0068857_101147489 3300005577 Bacteria 751
64 Ga0068854_100025361 3300005578 Bacteria 4067
65 Ga0068851_10000068 3300005834 Bacteria 58513
66 Ga0070717_11548613 3300006028 Bacteria 601
67 Ga0075364_10066979 3300006051 Bacteria 2360
68 Ga0075364_10084878 3300006051 Bacteria 2097
69 Ga0075364_10516479 3300006051 Bacteria 816
70 Ga0075432_10006592 3300006058 Bacteria 3953
71 Ga0075432_10146805 3300006058 Bacteria 903
72 Ga0075432_10403646 3300006058 Bacteria 590
73 Ga0075362_10644463 3300006177 Bacteria 550
74 Ga0075436_100903128 3300006914 Bacteria 661
75 Ga0079104_1000676 3300006946 Bacteria 31801
76 Ga0079104_1003227 3300006946 Bacteria 7842
77 Ga0079104_1086989 3300006946 Bacteria 637
78 Ga0079104_1106266 3300006946 Bacteria 558
79 Ga0105251_10002641 3300009011 Bacteria 13820
80 Ga0105251_10005407 3300009011 Bacteria 8356
81 Ga0105251_10010986 3300009011 Bacteria 5204
82 Ga0105251_10037148 3300009011 Bacteria 2392
83 Ga0105251_10184456 3300009011 Bacteria 940
84 Ga0105251_10203855 3300009011 Bacteria 891
85 Ga0105251_10315213 3300009011 Bacteria 710
86 Ga0105251_10496421 3300009011 Bacteria 570
87 Ga0105244_10002540 3300009036 Bacteria 13709
88 Ga0105244_10004871 3300009036 Bacteria 9102
89 Ga0105244_10005389 3300009036 Bacteria 8516
90 Ga0105244_10026118 3300009036 Bacteria 3164
91 Ga0105244_10056004 3300009036 Bacteria 1997
92 Ga0105244_10065022 3300009036 Bacteria 1828
93 Ga0105244_10108077 3300009036 Bacteria 1356
94 Ga0105244_10210113 3300009036 Bacteria 916
95 Ga0105244_10223117 3300009036 Bacteria 883
96 Ga0105244_10436551 3300009036 Bacteria 602
97 Ga0105250_10000180 3300009092 Bacteria 54634
98 Ga0105250_10003055 3300009092 Bacteria 8079
99 Ga0105250_10013656 3300009092 Bacteria 3346
100 Ga0105250_10078404 3300009092 Bacteria 1338
101 Ga0105250_10179206 3300009092 Bacteria 889
102 Ga0105250_10188621 3300009092 Bacteria 867
103 Ga0105250_10249086 3300009092 Bacteria 759
104 Ga0105243_10000451 3300009148 Bacteria 42796
105 Ga0105243_10001489 3300009148 Bacteria 20503
106 Ga0105243_10605625 3300009148 Bacteria 1055
107 Ga0105243_12854837 3300009148 Bacteria 524
108 Ga0105242_10000024 3300009176 Bacteria 111115
109 Ga0105242_11199979 3300009176 Bacteria 778
110 Ga0105248_10306112 3300009177 Bacteria 1790
111 Ga0105237_10144455 3300009545 Bacteria 2374
112 Ga0105237_10245206 3300009545 Bacteria 1793
113 Ga0105239_11945189 3300010375 Bacteria 682
114 Ga0105246_10001574 3300011119 Bacteria 13577
115 Ga0105246_10003399 3300011119 Bacteria 9643
116 Ga0105246_10344830 3300011119 Bacteria 1218
117 Ga0157345_1000081 3300012498 Bacteria 20216
118 Ga0157347_1011309 3300012502 Bacteria 947
119 Ga0157373_10000593 3300013100 Bacteria 28147
120 Ga0157373_10005230 3300013100 Bacteria 9742
121 Ga0157373_10034426 3300013100 Bacteria 3638
122 Ga0157373_10057732 3300013100 Bacteria 2752
123 Ga0157373_10075043 3300013100 Bacteria 2386
124 Ga0157373_10211115 3300013100 Bacteria 1369
125 Ga0157373_11019802 3300013100 Bacteria 618
126 Ga0157373_11193533 3300013100 Bacteria 573
127 Ga0157373_11435105 3300013100 Bacteria 525
128 Ga0157371_10000583 3300013102 Bacteria 43268
129 Ga0157371_10002025 3300013102 Bacteria 20017
130 Ga0157371_10026343 3300013102 Bacteria 4229
131 Ga0157371_10029477 3300013102 Bacteria 3968
132 Ga0157371_10528442 3300013102 Bacteria 873
133 Ga0157371_11220898 3300013102 Bacteria 580
134 Ga0157370_10025749 3300013104 Bacteria 5820
135 Ga0157370_10034132 3300013104 Bacteria 4957
136 Ga0157370_10116449 3300013104 Bacteria 2496
137 Ga0157370_10122454 3300013104 Bacteria 2428
138 Ga0157370_10139652 3300013104 Bacteria 2257
139 Ga0157370_10233128 3300013104 Bacteria 1703
140 Ga0157370_10640182 3300013104 Bacteria 972
141 Ga0157370_11699099 3300013104 Bacteria 567
142 Ga0157370_11763240 3300013104 Bacteria 556
143 Ga0157370_11998981 3300013104 Bacteria 520
144 Ga0157369_10007489 3300013105 Bacteria 12564
145 Ga0157369_10026040 3300013105 Bacteria 6491
146 Ga0157369_10124067 3300013105 Bacteria 2739
147 Ga0157369_10162310 3300013105 Bacteria 2358
148 Ga0157369_10237276 3300013105 Bacteria 1905
149 Ga0157369_10306275 3300013105 Bacteria 1652
150 Ga0157369_10546892 3300013105 Bacteria 1197
151 Ga0163162_10000649 3300013306 Bacteria 32160
152 Ga0163162_10033464 3300013306 Bacteria 5109
153 Ga0163162_10083369 3300013306 Bacteria 3271
154 Ga0157372_10003301 3300013307 Bacteria 17426
155 Ga0157375_10002948 3300013308 Bacteria 14762
156 Ga0157375_10011410 3300013308 Bacteria 7843
157 Ga0157375_10401634 3300013308 Bacteria 1537
158 Ga0157375_10496052 3300013308 Bacteria 1385
159 Ga0157375_10894683 3300013308 Bacteria 1032
160 Ga0182008_10002558 3300014497 Bacteria 11328
161 Ga0182008_10003740 3300014497 Bacteria 9065
162 Ga0182008_10009051 3300014497 Bacteria 5392
163 Ga0182008_10032174 3300014497 Bacteria 2636
164 Ga0182006_1000750 3300015261 Bacteria 22221
165 Ga0182006_1000997 3300015261 Bacteria 18524
166 Ga0182006_1010943 3300015261 Bacteria 4012
167 Ga0182006_1015982 3300015261 Bacteria 3207
168 Ga0182006_1121783 3300015261 Bacteria 905
169 Ga0182006_1142881 3300015261 Bacteria 816
170 Ga0182007_10000143 3300015262 Bacteria 47807
171 Ga0182007_10028714 3300015262 Bacteria 1909
172 Ga0182007_10180095 3300015262 Bacteria 730
173 Ga0182007_10182958 3300015262 Bacteria 725
174 Ga0182007_10281916 3300015262 Bacteria 605
175 Ga0182005_1000800 3300015265 Bacteria 14334
176 Ga0182005_1034772 3300015265 Bacteria 1370
177 Ga0182005_1056902 3300015265 Bacteria 1066
178 Ga0182005_1109253 3300015265 Bacteria 780
179 Ga0163161_10003088 3300017792 Bacteria 11754
180 Ga0163161_10004501 3300017792 Bacteria 9698
181 Ga0163161_10012220 3300017792 Bacteria 5955
182 Ga0163161_10054830 3300017792 Bacteria 2894
183 Ga0163161_11107236 3300017792 Bacteria 681
184 Ga0163161_11654599 3300017792 Bacteria 566
185 Ga0209435_110293 3300025206 Bacteria 1012
186 Ga0209760_100039 3300025207 Bacteria 118977
187 Ga0209760_100052 3300025207 Bacteria 103453
188 Ga0209784_100017 3300025224 Bacteria 472003
189 Ga0209566_100014 3300025225 Bacteria 472003
190 Ga0209674_100028 3300025226 Bacteria 472003
191 Ga0209147_100038 3300025229 Bacteria 314497
192 Ga0209563_100032 3300025230 Bacteria 472003
193 Ga0209563_100193 3300025230 Bacteria 33884
194 Ga0207427_100001 3300025231 Bacteria 1410763
195 Ga0207427_100029 3300025231 Bacteria 376678
196 Ga0209437_100003 3300025233 Bacteria 1517827
197 Ga0209437_100009 3300025233 Bacteria 915954
198 Ga0209258_100197 3300025242 Bacteria 124028
199 Ga0209646_1000711 3300025246 Bacteria 11903
200 Ga0209677_100018 3300025253 Bacteria 472003
201 Ga0209759_1005073 3300025256 Bacteria 4715
202 Ga0209759_1022298 3300025256 Bacteria 1419
203 Ga0209233_1000007 3300025261 Bacteria 1411234
204 Ga0209233_1000032 3300025261 Bacteria 623596
205 Ga0209675_1005911 3300025291 Bacteria 5020
206 Ga0209676_1000016 3300025292 Bacteria 655561
207 Ga0209676_1000021 3300025292 Bacteria 609534
208 Ga0209676_1000033 3300025292 Bacteria 463236
209 Ga0209676_1002055 3300025292 Bacteria 15733
210 Ga0209050_1000009 3300025298 Bacteria 1047265
211 Ga0209050_1000036 3300025298 Bacteria 423070
212 Ga0209050_1000107 3300025298 Bacteria 223303
213 Ga0209051_1000043 3300025303 Bacteria 305473
214 Ga0209051_1000053 3300025303 Bacteria 281564
215 Ga0209051_1000090 3300025303 Bacteria 173748
216 Ga0209257_1000098 3300025304 Bacteria 256390
217 Ga0209257_1010396 3300025304 Bacteria 4718
218 Ga0209257_1044277 3300025304 Bacteria 1300
219 Ga0207656_10000089 3300025321 Bacteria 33748
220 Ga0207696_1000043 3300025711 Bacteria 307112
221 Ga0207696_1000158 3300025711 Bacteria 112178
222 Ga0207696_1001093 3300025711 Bacteria 15931
223 Ga0207696_1015471 3300025711 Bacteria 2586
224 Ga0207696_1031373 3300025711 Bacteria 1608
225 Ga0207696_1099842 3300025711 Bacteria 791
226 Ga0207655_1000095 3300025728 Bacteria 195899
227 Ga0207655_1001318 3300025728 Bacteria 23425
228 Ga0207655_1002702 3300025728 Bacteria 13908
229 Ga0207655_1002953 3300025728 Bacteria 13065
230 Ga0207655_1008609 3300025728 Bacteria 6451
231 Ga0207655_1010781 3300025728 Bacteria 5512
232 Ga0207655_1018148 3300025728 Bacteria 3751
233 Ga0207655_1049631 3300025728 Bacteria 1712
234 Ga0207655_1076360 3300025728 Bacteria 1225
235 Ga0207713_1001420 3300025735 Bacteria 19190
236 Ga0207713_1003434 3300025735 Bacteria 10808
237 Ga0207713_1003857 3300025735 Bacteria 10007
238 Ga0207713_1005710 3300025735 Bacteria 7722
239 Ga0207713_1009834 3300025735 Bacteria 5353
240 Ga0207713_1013374 3300025735 Bacteria 4329
241 Ga0207713_1053355 3300025735 Bacteria 1593
242 Ga0207713_1218481 3300025735 Bacteria 576
243 Ga0207645_11081834 3300025907 Bacteria 541
244 Ga0207671_10000035 3300025914 Bacteria 237603
245 Ga0207649_10000017 3300025920 Bacteria 225193
246 Ga0207681_10000835 3300025923 Bacteria 20332
247 Ga0207681_10027375 3300025923 Bacteria 3685
248 Ga0207681_10226781 3300025923 Bacteria 1448
249 Ga0207650_10000212 3300025925 Bacteria 66326
250 Ga0207650_10001330 3300025925 Bacteria 17884
251 Ga0207690_11098812 3300025932 Bacteria 663
252 Ga0207706_10000170 3300025933 Bacteria 72208
253 Ga0207706_10104110 3300025933 Bacteria 2497
254 Ga0207686_10037438 3300025934 Bacteria 2927
255 Ga0207709_10000036 3300025935 Bacteria 292568
256 Ga0207709_10000350 3300025935 Bacteria 47371
257 Ga0207711_10219890 3300025941 Bacteria 1737
258 Ga0207679_10000005 3300025945 Bacteria 525011
259 Ga0207679_10112075 3300025945 Bacteria 2155
260 Ga0207640_10032869 3300025981 Bacteria 3221
261 Ga0207674_11685104 3300026116 Bacteria 602
262 Ga0209281_1000172 3300027111 Bacteria 151766
263 Ga0209281_1002499 3300027111 Bacteria 7265
264 Ga0209281_1008985 3300027111 Bacteria 2377
265 Ga0209281_1009557 3300027111 Bacteria 2270
266 Ga0209281_1059341 3300027111 Bacteria 588
267 Ga0207428_10052129 3300027907 Bacteria 3269
268 Ga0207428_10379095 3300027907 Bacteria 1038
269 Ga0268266_10041099 3300028379 Bacteria 3944
270 Ga0268266_12041360 3300028379 Bacteria 546
271 Ga0307517_10152648 3300028786 Bacteria 1579
272 Ga0307517_10380240 3300028786 Bacteria 755
273 Ga0307511_10338628 3300030521 Bacteria 654
274 Ga0307511_10355633 3300030521 Bacteria 627
275 Ga0316178_1161793 3300030735 Bacteria 38251
276 Ga0316181_1076629 3300030744 Bacteria 1379
277 Ga0265316_10130885 3300031344 Bacteria 1890
278 Ga0307509_10058296 3300031507 Bacteria 4090
279 Ga0307408_100003851 3300031548 Bacteria 10205
280 Ga0307408_100052108 3300031548 Bacteria 2950
281 Ga0307408_100168745 3300031548 Bacteria 1745
282 Ga0307516_10194640 3300031730 Bacteria 1751
283 Ga0307516_10207335 3300031730 Bacteria 1676
284 Ga0307405_10000148 3300031731 Bacteria 26698
285 Ga0307406_10590351 3300031901 Bacteria 914
286 Ga0307407_10110702 3300031903 Bacteria 1723
287 Ga0307407_10248612 3300031903 Bacteria 1217
288 Ga0307412_10092885 3300031911 Bacteria 2115
289 Ga0307412_10530125 3300031911 Bacteria 985
290 Ga0307412_10555070 3300031911 Bacteria 965
291 Ga0307412_10799667 3300031911 Bacteria 818
292 Ga0307416_100724355 3300032002 Bacteria 1085
293 Ga0307416_101574603 3300032002 Bacteria 762
294 Ga0307414_10152903 3300032004 Bacteria 1823
295 Ga0307414_10477821 3300032004 Bacteria 1098
296 Ga0307414_10696333 3300032004 Bacteria 919
297 Ga0307411_10073133 3300032005 Bacteria 2330
298 Ga0307411_11568955 3300032005 Bacteria 607
299 Ga0237819_04361 3300038705 Bacteria 2337
300 Ga0439438_001947 3300041405 Bacteria 9014
301 Ga0439438_013399 3300041405 Bacteria 2475
302 Ga0439438_108813 3300041405 Bacteria 669
303 Ga0439438_133340 3300041405 Bacteria 595
304 Ga0439438_176169 3300041405 Bacteria 508
305 Ga0439447_001682 3300041407 Bacteria 8121
306 Ga0439447_018880 3300041407 Bacteria 1849
307 Ga0439447_026416 3300041407 Bacteria 1489
308 Ga0439447_029934 3300041407 Bacteria 1375
309 Ga0439447_059499 3300041407 Bacteria 900
310 Ga0439466_0000210 3300041411 Bacteria 23037
311 Ga0439466_0004698 3300041411 Bacteria 5248
312 Ga0439466_0033490 3300041411 Bacteria 1745
313 Ga0439466_0038598 3300041411 Bacteria 1603
314 Ga0439466_0044783 3300041411 Bacteria 1465
315 Ga0439465_0006255 3300041413 Bacteria 3783
316 Ga0451841_0215041 3300041498 Bacteria 757
317 Ga0451841_0896663 3300041498 Bacteria 996
318 Ga0451843_0380463 3300041509 Bacteria 512
319 Ga0439431_0000893 3300041997 Bacteria 6451
320 Ga0439445_0067994 3300042004 Bacteria 982
321 Ga0439445_0143953 3300042004 Bacteria 692
322 Ga0439445_0220782 3300042004 Bacteria 562
323 Ga0439432_003985 3300042006 Bacteria 5424
324 Ga0439432_004679 3300042006 Bacteria 4986
325 Ga0439432_009861 3300042006 Bacteria 3322
326 Ga0439451_000899 3300042009 Bacteria 5708
327 Ga0439451_002691 3300042009 Bacteria 3605
328 Ga0439451_005962 3300042009 Bacteria 2488
329 Ga0439451_015645 3300042009 Bacteria 1530
330 Ga0439451_041973 3300042009 Bacteria 917
331 Ga0439451_046382 3300042009 Bacteria 870
332 Ga0439451_051511 3300042009 Bacteria 824
333 Ga0439451_058159 3300042009 Bacteria 773
334 Ga0439452_019397 3300042010 Bacteria 1798
335 Ga0439452_025198 3300042010 Bacteria 1512
336 Ga0439452_025626 3300042010 Bacteria 1495
337 Ga0439452_126262 3300042010 Bacteria 543
338 Ga0439456_001820 3300042013 Bacteria 4303
339 Ga0439456_012542 3300042013 Bacteria 1757
340 Ga0439456_069164 3300042013 Bacteria 781
341 Ga0439456_099842 3300042013 Bacteria 656
342 Ga0439456_124594 3300042013 Bacteria 592
343 Ga0439463_021112 3300042016 Bacteria 1625
344 Ga0439463_055798 3300042016 Bacteria 1008
345 Ga0450911_005477 3300042115 Bacteria 1967
346 Ga0450912_007723 3300042116 Bacteria 879
347 Ga0450919_002405 3300042121 Bacteria 2424
348 Ga0450922_007365 3300042124 Bacteria 1032
349 Ga0450890_000610 3300042127 Bacteria 5227
350 Ga0450892_011333 3300042130 Bacteria 790
351 Ga0450900_068521 3300042136 Bacteria 561
352 Ga0450902_015108 3300042137 Bacteria 1251
353 Ga0450903_001584 3300042138 Bacteria 4228
354 Ga0450904_008178 3300042139 Bacteria 1033
355 Ga0450904_016455 3300042139 Bacteria 740
356 Ga0450905_003100 3300042142 Bacteria 2171
357 Ga0450906_007238 3300042145 Bacteria 2199
358 Ga0450907_001013 3300042146 Bacteria 6586
359 Ga0450907_010936 3300042146 Bacteria 1508
360 Ga0450910_000904 3300042147 Bacteria 3581
361 Ga0450910_015437 3300042147 Bacteria 1124
362 Ga0439446_0018280 3300042156 Bacteria 1962
363 Ga0450908_006686 3300042184 Bacteria 2182
364 Ga0450909_003084 3300042185 Bacteria 2367
365 Ga0439434_0085923 3300042435 Bacteria 1002
366 Ga0439460_0015510 3300042461 Bacteria 2018
367 Ga0439460_0145693 3300042461 Bacteria 788
368 Ga0450893_0006743 3300042532 Bacteria 1860
369 Ga0450893_0009120 3300042532 Bacteria 1620
370 Ga0450893_0013634 3300042532 Bacteria 1357
371 Ga0439440_0008787 3300042993 Bacteria 2079
372 Ga0439440_0021555 3300042993 Bacteria 1453
373 Ga0495617_000327 3300046452 Bacteria 26705
374 Ga0495617_010431 3300046452 Bacteria 3182
375 Ga0495617_019467 3300046452 Bacteria 2295
376 Ga0495617_020302 3300046452 Bacteria 2245
377 Ga0495617_020933 3300046452 Bacteria 2210
378 Ga0495617_058620 3300046452 Bacteria 1276
379 Ga0495617_063705 3300046452 Bacteria 1217
380 Ga0495617_079901 3300046452 Bacteria 1071
381 Ga0495617_122471 3300046452 Bacteria 837
382 Ga0495627_001088 3300046453 Bacteria 17809
383 Ga0495627_004254 3300046453 Bacteria 6043
384 Ga0495627_020332 3300046453 Bacteria 2213
385 Ga0495627_026027 3300046453 Bacteria 1891
386 Ga0495592_0104335 3300046454 Bacteria 2015
387 Ga0495603_0321448 3300046455 Bacteria 888
388 Ga0495603_0717352 3300046455 Bacteria 571
389 Ga0495590_0032831 3300046457 Bacteria 1815
390 Ga0495590_0034403 3300046457 Bacteria 1769
391 Ga0495590_0044000 3300046457 Bacteria 1557
392 Ga0495590_0044874 3300046457 Bacteria 1541
393 Ga0495591_005439 3300046458 Bacteria 5902
394 Ga0495591_012253 3300046458 Bacteria 3203
395 Ga0495591_014139 3300046458 Bacteria 2883
396 Ga0495591_014821 3300046458 Bacteria 2781
397 Ga0495591_021071 3300046458 Bacteria 2137
398 Ga0495591_021448 3300046458 Bacteria 2107
399 Ga0495591_029685 3300046458 Bacteria 1658
400 Ga0495591_033078 3300046458 Bacteria 1533
401 Ga0495591_068473 3300046458 Bacteria 927
402 Ga0495638_0014931 3300046460 Bacteria 5230
403 Ga0495638_0063478 3300046460 Bacteria 2277
404 Ga0495638_0186002 3300046460 Bacteria 1181
405 Ga0495638_0254095 3300046460 Bacteria 967
406 Ga0495653_0006548 3300046463 Bacteria 9555
407 Ga0495653_0019975 3300046463 Bacteria 5429
408 Ga0495653_0143755 3300046463 Bacteria 1674
409 Ga0495650_0038016 3300046471 Bacteria 2088
410 Ga0495650_0043624 3300046471 Bacteria 1901
411 Ga0495650_0043909 3300046471 Bacteria 1892
412 Ga0495650_0141147 3300046471 Bacteria 871
413 Ga0495650_0287459 3300046471 Bacteria 552
414 Ga0495580_0249009 3300046472 Bacteria 1217
415 Ga0495605_0001320 3300046474 Bacteria 16426
416 Ga0495605_0016458 3300046474 Bacteria 4002
417 Ga0495605_0039196 3300046474 Bacteria 2374
418 Ga0495605_0050225 3300046474 Bacteria 2035
419 Ga0495605_0050933 3300046474 Bacteria 2018
420 Ga0495605_0059732 3300046474 Bacteria 1830
421 Ga0495605_0069676 3300046474 Bacteria 1665
422 Ga0495605_0094212 3300046474 Bacteria 1383
423 Ga0495639_0000714 3300046475 Bacteria 15193
424 Ga0495639_0328600 3300046475 Bacteria 765
425 Ga0495584_0001356 3300046491 Bacteria 14814
426 Ga0495584_0003392 3300046491 Bacteria 8787
427 Ga0495584_0036104 3300046491 Bacteria 2496
428 Ga0495584_0041130 3300046491 Bacteria 2334
429 Ga0495584_0087031 3300046491 Bacteria 1574
430 Ga0495584_0091666 3300046491 Bacteria 1532
431 Ga0495584_0173416 3300046491 Bacteria 1096
432 Ga0495584_0643750 3300046491 Bacteria 540
433 Ga0495585_0010554 3300046492 Bacteria 5495
434 Ga0495585_0052421 3300046492 Bacteria 2258
435 Ga0495585_0053613 3300046492 Bacteria 2231
436 Ga0495585_0064713 3300046492 Bacteria 2004
437 Ga0495585_0287265 3300046492 Bacteria 811
438 Ga0495585_0479708 3300046492 Bacteria 592
439 Ga0495585_0504896 3300046492 Bacteria 574
440 Ga0495594_0085319 3300046499 Bacteria 1766
441 Ga0495594_0517572 3300046499 Bacteria 677
442 Ga0495596_0024462 3300046500 Bacteria 2443
443 Ga0495596_0408276 3300046500 Bacteria 529
444 Ga0495596_0446655 3300046500 Bacteria 504
445 Ga0495607_0000655 3300046501 Bacteria 33607
446 Ga0495607_0001755 3300046501 Bacteria 18554
447 Ga0495607_0004203 3300046501 Bacteria 10684
448 Ga0495607_0009299 3300046501 Bacteria 6661
449 Ga0495607_0014936 3300046501 Bacteria 5048
450 Ga0495607_0020561 3300046501 Bacteria 4170
451 Ga0495607_0044527 3300046501 Bacteria 2616
452 Ga0495607_0075018 3300046501 Bacteria 1875
453 Ga0495607_0106195 3300046501 Bacteria 1495
454 Ga0495607_0151363 3300046501 Bacteria 1187
455 Ga0495607_0199120 3300046501 Bacteria 992
456 Ga0495607_0312059 3300046501 Bacteria 736
457 Ga0495607_0317932 3300046501 Bacteria 727
458 Ga0495583_0001561 3300046506 Bacteria 22653
459 Ga0495583_0054763 3300046506 Bacteria 1804
460 Ga0495583_0108766 3300046506 Bacteria 1176
461 Ga0495606_0003868 3300046507 Bacteria 15455
462 Ga0495606_0067682 3300046507 Bacteria 2260
463 Ga0495606_0075214 3300046507 Bacteria 2113
464 Ga0495606_0078217 3300046507 Bacteria 2063
465 Ga0495606_0081816 3300046507 Bacteria 2006
466 Ga0495606_0083878 3300046507 Bacteria 1974
467 Ga0495606_0190858 3300046507 Bacteria 1174
468 Ga0495606_0296678 3300046507 Bacteria 877
469 Ga0495606_0511393 3300046507 Bacteria 604
470 Ga0495610_0001544 3300046512 Bacteria 20283
471 Ga0495610_0004742 3300046512 Bacteria 9921
472 Ga0495610_0009200 3300046512 Bacteria 6270
473 Ga0495610_0022244 3300046512 Bacteria 3472
474 Ga0495610_0026446 3300046512 Bacteria 3097
475 Ga0495610_0032277 3300046512 Bacteria 2722
476 Ga0495610_0047577 3300046512 Bacteria 2109
477 Ga0495610_0083075 3300046512 Bacteria 1466
478 Ga0495610_0117289 3300046512 Bacteria 1171
479 Ga0495610_0148770 3300046512 Bacteria 1001
480 Ga0495610_0213867 3300046512 Bacteria 782
481 Ga0495610_0277251 3300046512 Bacteria 654
482 Ga0495616_0029743 3300046513 Bacteria 2880
483 Ga0495616_0042041 3300046513 Bacteria 2328
484 Ga0495616_0043788 3300046513 Bacteria 2272
485 Ga0495616_0051681 3300046513 Bacteria 2048
486 Ga0495616_0057902 3300046513 Bacteria 1909
487 Ga0495616_0156734 3300046513 Bacteria 1026
488 Ga0495620_0004800 3300046515 Bacteria 7595
489 Ga0495620_0004858 3300046515 Bacteria 7538
490 Ga0495620_0013240 3300046515 Bacteria 4229
491 Ga0495620_0037976 3300046515 Bacteria 2140
492 Ga0495620_0041416 3300046515 Bacteria 2020
493 Ga0495620_0059262 3300046515 Bacteria 1600
494 Ga0495620_0134352 3300046515 Bacteria 969
495 Ga0495628_0102425 3300046516 Bacteria 2209
496 Ga0495630_0265401 3300046517 Bacteria 1311
497 Ga0495631_0001232 3300046518 Bacteria 15789
498 Ga0495631_0039064 3300046518 Bacteria 2107
499 Ga0495631_0084338 3300046518 Bacteria 1369
500 Ga0495631_0239117 3300046518 Bacteria 774
501 Ga0495631_0239911 3300046518 Bacteria 773
502 Ga0495631_0348172 3300046518 Bacteria 630
503 Ga0495632_0002507 3300046519 Bacteria 13918
504 Ga0495632_0002719 3300046519 Bacteria 13140
505 Ga0495632_0011305 3300046519 Bacteria 5215
506 Ga0495632_0051933 3300046519 Bacteria 2016
507 Ga0495632_0064247 3300046519 Bacteria 1775
508 Ga0495632_0237552 3300046519 Bacteria 820
509 Ga0495632_0400428 3300046519 Bacteria 599
510 Ga0495637_0000187 3300046520 Bacteria 48520
511 Ga0495637_0010404 3300046520 Bacteria 4501
512 Ga0495637_0020327 3300046520 Bacteria 3056
513 Ga0495637_0047575 3300046520 Bacteria 1809
514 Ga0495637_0048558 3300046520 Bacteria 1786
515 Ga0495637_0049009 3300046520 Bacteria 1776
516 Ga0495637_0177451 3300046520 Bacteria 791
517 Ga0495637_0280555 3300046520 Bacteria 594
518 Ga0495643_0048404 3300046522 Bacteria 2298
519 Ga0495643_0064810 3300046522 Bacteria 1929
520 Ga0495643_0073847 3300046522 Bacteria 1786
521 Ga0495643_0078686 3300046522 Bacteria 1720
522 Ga0495643_0131300 3300046522 Bacteria 1257
523 Ga0495644_0038575 3300046523 Bacteria 1801
524 Ga0495644_0064015 3300046523 Bacteria 1382
525 Ga0495644_0079041 3300046523 Bacteria 1239
526 Ga0495648_0046293 3300046524 Bacteria 2697
527 Ga0495648_0050430 3300046524 Bacteria 2542
528 Ga0495648_0054086 3300046524 Bacteria 2427
529 Ga0495648_0058470 3300046524 Bacteria 2305
530 Ga0495648_0074960 3300046524 Bacteria 1947
531 Ga0495648_0079298 3300046524 Bacteria 1874
532 Ga0495648_0136790 3300046524 Bacteria 1294
533 Ga0495648_0149432 3300046524 Bacteria 1220
534 Ga0495648_0203652 3300046524 Bacteria 988
535 Ga0495666_0019502 3300046526 Bacteria 3364
536 Ga0495666_0079701 3300046526 Bacteria 1550
537 Ga0495642_0031860 3300046528 Bacteria 2114
538 Ga0495654_0000870 3300046530 Bacteria 22703
539 Ga0495654_0009384 3300046530 Bacteria 5363
540 Ga0495654_0010391 3300046530 Bacteria 5066
541 Ga0495654_0018271 3300046530 Bacteria 3677
542 Ga0495654_0027452 3300046530 Bacteria 2919
543 Ga0495654_0027896 3300046530 Bacteria 2889
544 Ga0495654_0031821 3300046530 Bacteria 2676
545 Ga0495654_0036713 3300046530 Bacteria 2461
546 Ga0495654_0079991 3300046530 Bacteria 1534
547 Ga0495654_0106309 3300046530 Bacteria 1285
548 Ga0495654_0141567 3300046530 Bacteria 1071
549 Ga0495654_0175149 3300046530 Bacteria 932
550 Ga0495654_0180117 3300046530 Bacteria 915
551 Ga0495654_0297653 3300046530 Bacteria 659
552 Ga0495587_0018188 3300046536 Bacteria 4358
553 Ga0495587_0324178 3300046536 Bacteria 860
554 Ga0495609_0005792 3300046538 Bacteria 6417
555 Ga0495609_0007937 3300046538 Bacteria 5245
556 Ga0495609_0015538 3300046538 Bacteria 3562
557 Ga0495609_0043026 3300046538 Bacteria 2028
558 Ga0495609_0056997 3300046538 Bacteria 1730
559 Ga0495609_0063818 3300046538 Bacteria 1625
560 Ga0495609_0219607 3300046538 Bacteria 789
561 Ga0495597_0043614 3300046542 Bacteria 1996
562 Ga0495597_0082283 3300046542 Bacteria 1375
563 Ga0495597_0206888 3300046542 Bacteria 784
564 Ga0495597_0229701 3300046542 Bacteria 734
565 Ga0495622_0002066 3300046557 Bacteria 9810
566 Ga0495622_0014065 3300046557 Bacteria 3713
567 Ga0495622_0046259 3300046557 Bacteria 2021
568 Ga0495622_0445457 3300046557 Bacteria 555
569 Ga0495633_0015447 3300046558 Bacteria 3960
570 Ga0495633_0049604 3300046558 Bacteria 1980
571 Ga0495633_0159357 3300046558 Bacteria 1041
572 Ga0495633_0389707 3300046558 Bacteria 630
573 Ga0495656_0152179 3300046615 Bacteria 1118
574 Ga0495656_0715316 3300046615 Bacteria 539
575 Ga0495668_0039708 3300046616 Bacteria 2627
576 Ga0495668_0094609 3300046616 Bacteria 1635
577 Ga0495668_0127672 3300046616 Bacteria 1392
578 Ga0495634_0012245 3300046642 Bacteria 6217
579 Ga0495634_0065442 3300046642 Bacteria 2409
580 Ga0495611_0000770 3300046648 Bacteria 17962
581 Ga0495611_0025189 3300046648 Bacteria 2591
582 Ga0495611_0060264 3300046648 Bacteria 1724
583 Ga0495611_0078271 3300046648 Bacteria 1517
584 Ga0495625_0031997 3300046660 Bacteria 3907
585 Ga0495625_0045921 3300046660 Bacteria 3154
586 Ga0495625_0063823 3300046660 Bacteria 2600
587 Ga0495625_0154226 3300046660 Bacteria 1542
588 Ga0495625_0155893 3300046660 Bacteria 1532
589 Ga0495625_0195570 3300046660 Bacteria 1337
590 Ga0495625_0368138 3300046660 Bacteria 904
591 Ga0495635_0014016 3300046663 Bacteria 5609
592 Ga0495659_0026538 3300046664 Bacteria 1991
593 Ga0495659_0035214 3300046664 Bacteria 1763
594 Ga0495659_0349806 3300046664 Bacteria 631
595 Ga0495661_0000773 3300046665 Bacteria 30663
596 Ga0495661_0008915 3300046665 Bacteria 6907
597 Ga0495661_0027284 3300046665 Bacteria 3667
598 Ga0495661_0092559 3300046665 Bacteria 1717
599 Ga0495661_0118140 3300046665 Bacteria 1468
600 Ga0495661_0301024 3300046665 Bacteria 802
601 Ga0495661_0311730 3300046665 Bacteria 784
602 Ga0495661_0577250 3300046665 Bacteria 530
603 Ga0495588_0173183 3300046674 Bacteria 1141
604 Ga0495623_0009827 3300046679 Bacteria 6198
605 Ga0495646_0012643 3300046680 Bacteria 5362
606 Ga0495646_0045300 3300046680 Bacteria 2688
607 Ga0495613_0065131 3300046689 Bacteria 2664
608 Ga0495613_0092377 3300046689 Bacteria 2191
609 Ga0495613_0161253 3300046689 Bacteria 1595
610 Ga0495613_0747323 3300046689 Bacteria 641
611 Ga0495624_0001003 3300046690 Bacteria 22331
612 Ga0495670_0000389 3300046691 Bacteria 20982
613 Ga0495670_0000899 3300046691 Bacteria 14381
614 Ga0495670_0013878 3300046691 Bacteria 3962
615 Ga0495670_0084657 3300046691 Bacteria 1618
616 Ga0495670_0147650 3300046691 Bacteria 1232
617 Ga0495670_0152544 3300046691 Bacteria 1212
618 Ga0495670_0682514 3300046691 Bacteria 560
619 Ga0495671_0000307 3300046692 Bacteria 41409
620 Ga0495671_0000377 3300046692 Bacteria 36641
621 Ga0495671_0032755 3300046692 Bacteria 2651
622 Ga0495671_0041495 3300046692 Bacteria 2316
623 Ga0495671_0055115 3300046692 Bacteria 1969
624 Ga0495671_0112986 3300046692 Bacteria 1326
625 Ga0495671_0140344 3300046692 Bacteria 1177
626 Ga0495671_0195145 3300046692 Bacteria 982
627 Ga0495671_0229663 3300046692 Bacteria 897
628 Ga0495671_0339607 3300046692 Bacteria 721
629 Ga0495649_0001633 3300046694 Bacteria 16680
630 Ga0495649_0019441 3300046694 Bacteria 3816
631 Ga0495649_0024279 3300046694 Bacteria 3381
632 Ga0495649_0036297 3300046694 Bacteria 2707
633 Ga0495649_0036768 3300046694 Bacteria 2689
634 Ga0495649_0043082 3300046694 Bacteria 2464
635 Ga0495649_0067292 3300046694 Bacteria 1921
636 Ga0495649_0086894 3300046694 Bacteria 1668
637 Ga0495649_0092334 3300046694 Bacteria 1612
638 Ga0495589_0000194 3300046794 Bacteria 53082
639 Ga0495589_0002053 3300046794 Bacteria 11393
640 Ga0495589_0003682 3300046794 Bacteria 8278
641 Ga0495589_0071159 3300046794 Bacteria 1700
642 Ga0495589_0099786 3300046794 Bacteria 1405
643 Ga0495589_0257392 3300046794 Bacteria 814
644 Ga0495589_0266236 3300046794 Bacteria 798
645 Ga0495600_0089290 3300046809 Bacteria 2010
646 Ga0495660_0003352 3300046810 Bacteria 9927
647 Ga0495660_0035438 3300046810 Bacteria 2787
648 Ga0495660_0042076 3300046810 Bacteria 2525
649 Ga0495660_0044608 3300046810 Bacteria 2438
650 Ga0495660_0046396 3300046810 Bacteria 2382
651 Ga0495660_0054628 3300046810 Bacteria 2163
652 Ga0495660_0065101 3300046810 Bacteria 1946
653 Ga0495660_0067034 3300046810 Bacteria 1912
654 Ga0495660_0070707 3300046810 Bacteria 1851
655 Ga0495660_0329094 3300046810 Bacteria 684
656 Ga0495581_0095470 3300047315 Bacteria 1726
657 Ga0495604_0053907 3300047317 Bacteria 3105
658 Ga0495604_0065469 3300047317 Bacteria 2766
659 Ga0495636_0044292 3300047318 Bacteria 1853
660 Ga0495674_0027872 3300047319 Bacteria 5158
661 Ga0495672_0004930 3300047320 Bacteria 10716
662 Ga0495672_0015161 3300047320 Bacteria 5245
663 Ga0495672_0021422 3300047320 Bacteria 4216
664 Ga0495672_0064656 3300047320 Bacteria 2093
665 Ga0495672_0083839 3300047320 Bacteria 1769
666 Ga0495672_0105399 3300047320 Bacteria 1521
667 Ga0495676_0110851 3300047321 Bacteria 2013
668 Ga0495680_0026473 3300047322 Bacteria 4779
669 Ga0495680_0090594 3300047322 Bacteria 2294
670 Ga0495683_0002776 3300047323 Bacteria 10426
671 Ga0495683_0006216 3300047323 Bacteria 6537
672 Ga0495683_0072254 3300047323 Bacteria 1692
673 Ga0495683_0080317 3300047323 Bacteria 1591
674 Ga0495683_0100217 3300047323 Bacteria 1393
675 Ga0495683_0110107 3300047323 Bacteria 1315
676 Ga0495683_0271858 3300047323 Bacteria 736
677 Ga0495687_044216 3300047443 Bacteria 1937
678 Ga0495687_115414 3300047443 Bacteria 978
679 Ga0495679_001372 3300047446 Bacteria 13978
680 Ga0495679_001589 3300047446 Bacteria 12774
681 Ga0495679_005387 3300047446 Bacteria 5674
682 Ga0495679_015499 3300047446 Bacteria 2785
683 Ga0495679_022757 3300047446 Bacteria 2139
684 Ga0495679_030605 3300047446 Bacteria 1744
685 Ga0495679_035238 3300047446 Bacteria 1587
686 Ga0495673_0003020 3300047469 Bacteria 11334
687 Ga0495673_0026774 3300047469 Bacteria 2751
688 Ga0495673_0046008 3300047469 Bacteria 1936
689 Ga0495673_0055171 3300047469 Bacteria 1725
690 Ga0495673_0065731 3300047469 Bacteria 1539
691 Ga0495673_0068698 3300047469 Bacteria 1496
692 Ga0495673_0070234 3300047469 Bacteria 1475
693 Ga0495673_0138546 3300047469 Bacteria 950
694 Ga0495681_0005323 3300047470 Bacteria 8637
695 Ga0495681_0015768 3300047470 Bacteria 4266
696 Ga0495681_0018369 3300047470 Bacteria 3855
697 Ga0495681_0021062 3300047470 Bacteria 3521
698 Ga0495681_0026688 3300047470 Bacteria 3000
699 Ga0495681_0033575 3300047470 Bacteria 2568
700 Ga0495681_0037051 3300047470 Bacteria 2406
701 Ga0495681_0038988 3300047470 Bacteria 2323
702 Ga0495681_0058247 3300047470 Bacteria 1790
703 Ga0495681_0077921 3300047470 Bacteria 1486
704 Ga0495681_0106388 3300047470 Bacteria 1220
705 Ga0495681_0201669 3300047470 Bacteria 806
706 Ga0495681_0274392 3300047470 Bacteria 659
707 Ga0495684_0069061 3300047471 Bacteria 2687
708 Ga0495686_0080633 3300047472 Bacteria 1989
709 Ga0495686_0083666 3300047472 Bacteria 1945
710 Ga0495686_0088430 3300047472 Bacteria 1883
711 Ga0495686_0088821 3300047472 Bacteria 1878
712 Ga0495593_0070990 3300047673 Bacteria 1808
713 Ga0495593_0071140 3300047673 Bacteria 1806
714 Ga0495593_0200653 3300047673 Bacteria 1002
715 Ga0495602_0031550 3300048088 Bacteria 5008
716 Ga0495626_0003523 3300048091 Bacteria 10021
717 Ga0495626_0009007 3300048091 Bacteria 5411
718 Ga0495626_0037662 3300048091 Bacteria 2296
719 Ga0495626_0060331 3300048091 Bacteria 1728
720 Ga0495626_0065354 3300048091 Bacteria 1646
721 Ga0495626_0068377 3300048091 Bacteria 1601
722 Ga0495626_0073819 3300048091 Bacteria 1527
723 Ga0495626_0241831 3300048091 Bacteria 726
724 Ga0495626_0356101 3300048091 Bacteria 570
725 Ga0496102_0004455 3300048905 Bacteria 11829
726 Ga0496103_0021772 3300048906 Bacteria 3858
727 Ga0496105_0704587 3300048908 Bacteria 775
728 Ga0496106_0198099 3300048909 Bacteria 1598
729 Ga0496107_1099274 3300048910 Bacteria 574
730 Ga0496110_0494573 3300048913 Bacteria 1114
731 Ga0496112_0221243 3300048915 Bacteria 1849
732 Ga0496114_0353194 3300048917 Bacteria 1300
733 Ga0496115_0172523 3300048918 Bacteria 1788
734 Ga0496116_0000085 3300048919 Bacteria 219553
735 Ga0496116_0001088 3300048919 Bacteria 32732
736 Ga0496116_0002312 3300048919 Bacteria 20203
737 Ga0496116_0032645 3300048919 Bacteria 3707
738 Ga0496116_0061978 3300048919 Bacteria 2417
739 Ga0496116_0074368 3300048919 Bacteria 2137
740 Ga0496117_0001620 3300048920 Bacteria 31800
741 Ga0496117_0011807 3300048920 Bacteria 7777
742 Ga0496117_0032234 3300048920 Bacteria 3984
743 Ga0496117_0055410 3300048920 Bacteria 2770
744 Ga0496117_0088609 3300048920 Bacteria 2001
745 Ga0496117_0092318 3300048920 Bacteria 1945
746 Ga0496117_0095409 3300048920 Bacteria 1900
747 Ga0496117_0161415 3300048920 Bacteria 1312
748 Ga0496117_0276673 3300048920 Bacteria 901
749 Ga0496118_0018066 3300048921 Bacteria 6382
750 Ga0496118_0034843 3300048921 Bacteria 4099
751 Ga0496118_0051681 3300048921 Bacteria 3141
752 Ga0496118_0097736 3300048921 Bacteria 1996
753 Ga0496118_0112796 3300048921 Bacteria 1798
754 Ga0496118_0114349 3300048921 Bacteria 1779
755 Ga0496118_0230431 3300048921 Bacteria 1069
756 Ga0496118_0578922 3300048921 Bacteria 541
757 Ga0496119_0025519 3300048922 Bacteria 4124
758 Ga0496119_0081228 3300048922 Bacteria 1867
759 Ga0496119_0137789 3300048922 Bacteria 1321
760 Ga0496119_0226100 3300048922 Bacteria 955
761 Ga0496120_0009532 3300048923 Bacteria 6875
762 Ga0496120_0106524 3300048923 Bacteria 1471
763 Ga0496120_0149119 3300048923 Bacteria 1177
764 Ga0496121_0000179 3300048924 Bacteria 141214
765 Ga0496121_0022604 3300048924 Bacteria 6091
766 Ga0496121_0039080 3300048924 Bacteria 4189
767 Ga0496121_0042923 3300048924 Bacteria 3924
768 Ga0496121_0116747 3300048924 Bacteria 2023
769 Ga0496121_0670547 3300048924 Bacteria 628
770 Ga0496122_0019724 3300048925 Bacteria 6144
771 Ga0496122_0025135 3300048925 Bacteria 5186
772 Ga0496122_0048380 3300048925 Bacteria 3270
773 Ga0496122_0104123 3300048925 Bacteria 1886
774 Ga0496122_0143541 3300048925 Bacteria 1488
775 Ga0496122_0265133 3300048925 Bacteria 950
776 Ga0496122_0420285 3300048925 Bacteria 672
777 Ga0496122_0436645 3300048925 Bacteria 653
778 Ga0496123_0006947 3300048926 Bacteria 10811
779 Ga0496123_0082998 3300048926 Bacteria 1939
780 Ga0496123_0099233 3300048926 Bacteria 1700
781 Ga0496123_0107324 3300048926 Bacteria 1606
782 Ga0496123_0171370 3300048926 Bacteria 1144
783 Ga0496123_0374622 3300048926 Bacteria 655
784 Ga0496123_0468191 3300048926 Bacteria 557
785 Ga0496124_0001693 3300048927 Bacteria 31219
786 Ga0496124_0025284 3300048927 Bacteria 5380
787 Ga0496124_0072809 3300048927 Bacteria 2844
788 Ga0496124_0076738 3300048927 Bacteria 2757
789 Ga0496124_0119923 3300048927 Bacteria 2103
790 Ga0496124_0198005 3300048927 Bacteria 1530
791 Ga0496124_0280459 3300048927 Bacteria 1215
792 Ga0496124_0288474 3300048927 Bacteria 1192
793 Ga0496124_0515781 3300048927 Bacteria 797
794 Ga0496125_0001691 3300048928 Bacteria 30828
795 Ga0496125_0005335 3300048928 Bacteria 14361
796 Ga0496125_0036633 3300048928 Bacteria 4278
797 Ga0496125_0037228 3300048928 Bacteria 4232
798 Ga0496125_0073871 3300048928 Bacteria 2647
799 Ga0496125_0128524 3300048928 Bacteria 1789
800 Ga0496125_0200182 3300048928 Bacteria 1308
801 Ga0496126_0009164 3300048929 Bacteria 10562
802 Ga0496126_0037114 3300048929 Bacteria 4550
803 Ga0496126_0133460 3300048929 Bacteria 2143
804 Ga0495678_001578 3300049459 Bacteria 17516
805 Ga0495678_019547 3300049459 Bacteria 3018
806 Ga0495678_023839 3300049459 Bacteria 2652
807 Ga0495678_030472 3300049459 Bacteria 2256
808 Ga0495678_039602 3300049459 Bacteria 1900
809 Ga0495678_041527 3300049459 Bacteria 1839
810 Ga0495678_047779 3300049459 Bacteria 1673
811 Ga0495678_150381 3300049459 Bacteria 752
812 Ga0495678_152370 3300049459 Bacteria 745
813 Ga0495682_0024472 3300049460 Bacteria 2250
814 Ga0495682_0033100 3300049460 Bacteria 1908
815 Ga0495682_0194055 3300049460 Bacteria 720
816 Ga0495682_0223264 3300049460 Bacteria 667
817 Ga0501241_008359 3300049758 Bacteria 1890
818 Ga0500572_018857 3300053111 Bacteria 1793
819 Ga0500621_181547 3300053126 Bacteria 762
820 Ga0500586_199134 3300053145 Bacteria 658
821 Ga0500634_0003648 3300053161 Bacteria 6919

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10894683 Ga0157375_108946832 65
2 3300009036 Ga0105244_10056004 Ga0105244_100560042 66
3 3300012502 Ga0157347_1011309 Ga0157347_10113092 66
4 3300013306 Ga0163162_10000649 Ga0163162_1000064933 66
5 3300017792 Ga0163161_10004501 Ga0163161_100045013 66
6 3300025728 Ga0207655_1010781 Ga0207655_10107812 66
7 3300025728 Ga0207655_1049631 Ga0207655_10496312 66
8 3300046452 Ga0495617_020933 Ga0495617_020933_968_1207 66
9 3300046453 Ga0495627_001088 Ga0495627_001088_972_1211 66
10 3300046458 Ga0495591_029685 Ga0495591_029685_642_881 66
11 3300046460 Ga0495638_0186002 Ga0495638_0186002_84_323 66
12 3300046491 Ga0495584_0036104 Ga0495584_0036104_1828_2067 66
13 3300046492 Ga0495585_0052421 Ga0495585_0052421_852_1091 66
14 3300046500 Ga0495596_0024462 Ga0495596_0024462_1971_2210 66
15 3300046501 Ga0495607_0009299 Ga0495607_0009299_443_682 66
16 3300046506 Ga0495583_0054763 Ga0495583_0054763_574_813 66
17 3300046512 Ga0495610_0026446 Ga0495610_0026446_2208_2447 66
18 3300046513 Ga0495616_0051681 Ga0495616_0051681_659_898 66
19 3300046515 Ga0495620_0134352 Ga0495620_0134352_347_586 66
20 3300046518 Ga0495631_0084338 Ga0495631_0084338_1028_1267 66
21 3300046519 Ga0495632_0002719 Ga0495632_0002719_12210_12449 66
22 3300046520 Ga0495637_0020327 Ga0495637_0020327_923_1162 66
23 3300046522 Ga0495643_0064810 Ga0495643_0064810_511_750 66
24 3300046523 Ga0495644_0038575 Ga0495644_0038575_520_759 66
25 3300046524 Ga0495648_0050430 Ga0495648_0050430_1053_1292 66
26 3300046530 Ga0495654_0031821 Ga0495654_0031821_1832_2071 66
27 3300046538 Ga0495609_0056997 Ga0495609_0056997_383_622 66
28 3300046538 Ga0495609_0219607 Ga0495609_0219607_432_671 66
29 3300046558 Ga0495633_0389707 Ga0495633_0389707_335_574 66
30 3300046616 Ga0495668_0094609 Ga0495668_0094609_382_621 66
31 3300046648 Ga0495611_0000770 Ga0495611_0000770_16904_17143 66
32 3300046660 Ga0495625_0045921 Ga0495625_0045921_966_1205 66
33 3300046665 Ga0495661_0092559 Ga0495661_0092559_357_596 66
34 3300046691 Ga0495670_0000899 Ga0495670_0000899_13529_13768 66
35 3300046692 Ga0495671_0112986 Ga0495671_0112986_653_892 66
36 3300046794 Ga0495589_0099786 Ga0495589_0099786_1108_1347 66
37 3300046810 Ga0495660_0046396 Ga0495660_0046396_225_464 66
38 3300047320 Ga0495672_0083839 Ga0495672_0083839_388_627 66
39 3300047323 Ga0495683_0072254 Ga0495683_0072254_1068_1307 66
40 3300047470 Ga0495681_0026688 Ga0495681_0026688_858_1097 66
41 3300047472 Ga0495686_0088821 Ga0495686_0088821_337_576 66
42 2124908027 MRS2a_Contig_8358 MRS2a_00253900 70
43 3300046500 Ga0495596_0408276 Ga0495596_0408276_21_236 71
44 3300046520 Ga0495637_0280555 Ga0495637_0280555_19_234 71
45 3300047446 Ga0495679_035238 Ga0495679_035238_14_238 71
46 3300047470 Ga0495681_0274392 Ga0495681_0274392_12_236 71
47 3300032004 Ga0307414_10696333 Ga0307414_106963332 73
48 iso_pu_bacteria 2511231006 2511266110 73
49 iso_pu_bacteria 2511231023 2511371752 73
50 iso_pu_bacteria 2512047018 2512329548 73
51 iso_pu_bacteria 2554235341 2555668515 73
52 iso_pu_bacteria 2582580891 2583790909 73
53 iso_pu_bacteria 2597489887 2597856678 73
54 iso_pu_bacteria 2597489889 2597871090 73
55 iso_pu_bacteria 2599185160 2599355512 73
56 iso_pu_bacteria 2599185161 2599360654 73
57 iso_pu_bacteria 2599185162 2599366976 73
58 iso_pu_bacteria 2599185163 2599373766 73
59 iso_pu_bacteria 2599185164 2599380618 73
60 iso_pu_bacteria 2599185165 2599387065 73
61 iso_pu_bacteria 2599185166 2599392624 73
62 iso_pu_bacteria 2599185168 2599404391 73
63 iso_pu_bacteria 2599185181 2599462346 73
64 iso_pu_bacteria 2599185182 2599466600 73
65 iso_pu_bacteria 2599185185 2599483071 73
66 iso_pu_bacteria 2599185186 2599490562 73
67 iso_pu_bacteria 2599185257 2599801346 73
68 iso_pu_bacteria 2599185356 2600214968 73
69 iso_pu_bacteria 2600254931 2600363688 73
70 iso_pu_bacteria 2600255313 2601774327 73
71 iso_pu_bacteria 2619619299 2621298212 73
72 iso_pu_bacteria 2643221571 2643869346 73
73 iso_pu_bacteria 2643221713 2644622069 73
74 iso_pu_bacteria 2667528171 2671098127 73
75 iso_pu_bacteria 2671180172 2671768294 73
76 iso_pu_bacteria 2738541265 2738671405 73
77 iso_pu_bacteria 2738541282 2738749799 73
78 iso_pu_bacteria 2738541303 2738858839 73
79 iso_pu_bacteria 2740892503 2743736102 73
80 iso_pu_bacteria 2773857673 2774135972 73
81 iso_pu_bacteria 2773857673 2774138316 73
82 iso_pu_bacteria 2784132063 2784259981 73
83 iso_pu_bacteria 2816332298 2817492645 73
84 iso_pu_bacteria 2818991464 2819703194 73
85 iso_pu_bacteria 2852657418 2852658728 73
86 iso_pu_bacteria 2860867994 2860871738 73
87 iso_pu_bacteria 2880230671 2880232119 73
88 iso_pu_bacteria 2904518522 2904522352 73
89 iso_pu_bacteria 2908446538 2908451141 73
90 iso_pu_bacteria 2917070673 2917072283 73
91 iso_pu_bacteria 2923153595 2923155114 73
92 iso_pu_bacteria 2929189879 2929193809 73
93 iso_pu_bacteria 2935353572 2935354448 73
94 iso_pu_bacteria 2945961074 2945961826 73
95 iso_pu_bacteria 2946006987 2946008400 73
96 iso_pu_bacteria 2946027586 2946032249 73
97 iso_pu_bacteria 2947233263 2947239068 73
98 iso_pu_bacteria 2984286254 2984290928 73
99 iso_pu_bacteria 3007395558 3007400651 73
100 iso_pu_bacteria 3007855910 3007856050 73
101 iso_pu_bacteria 3007861166 3007863317 73
102 iso_pu_bacteria 637000220 637318874 73
103 iso_pu_bacteria 8015687852 8015689335 73
104 iso_pu_bacteria 8019769354 8019771056 73
105 iso_pu_bacteria 8054503363 8054507610 73
106 iso_pu_bacteria 8055770955 8055772462 73
107 iso_pu_bacteria 8056131705 8056136000 73
108 iso_pu_bacteria 8056569372 8056570113 73
109 iso_pu_bacteria 8057798959 8057803803 73
110 iso_pu_bacteria 2511231004 2511254492 74
111 iso_pu_bacteria 2511231007 2511269692 74
112 iso_pu_bacteria 2511231008 2511281035 74
113 iso_pu_bacteria 2511231010 2511291046 74
114 iso_pu_bacteria 2511231011 2511298779 74
115 iso_pu_bacteria 2511231016 2511326456 74
116 iso_pu_bacteria 2511231022 2511363088 74
117 iso_pu_bacteria 2511231031 2511413717 74
118 iso_pu_bacteria 2511231156 2511823462 74
119 iso_pu_bacteria 2597489888 2597865236 74
120 iso_pu_bacteria 2599185167 2599400368 74
121 iso_pu_bacteria 2599185179 2599451302 74
122 iso_pu_bacteria 2599185188 2599503939 74
123 iso_pu_bacteria 2599185189 2599508620 74
124 iso_pu_bacteria 2599185190 2599512476 74
125 iso_pu_bacteria 2599185191 2599519824 74
126 iso_pu_bacteria 2599185212 2599615803 74
127 iso_pu_bacteria 2599185248 2599772721 74
128 iso_pu_bacteria 2599185288 2599878579 74
129 iso_pu_bacteria 2599185289 2599889218 74
130 iso_pu_bacteria 2599185290 2599891152 74
131 iso_pu_bacteria 2599185291 2599896539 74
132 iso_pu_bacteria 2599185300 2599931908 74
133 iso_pu_bacteria 2599185302 2599945559 74
134 iso_pu_bacteria 2599185303 2599947782 74
135 iso_pu_bacteria 2599185304 2599956677 74
136 iso_pu_bacteria 2599185305 2599962630 74
137 iso_pu_bacteria 2599185306 2599965250 74
138 iso_pu_bacteria 2599185308 2599978796 74
139 iso_pu_bacteria 2599185309 2599985401 74
140 iso_pu_bacteria 2599185310 2599991848 74
141 iso_pu_bacteria 2599185311 2599996553 74
142 iso_pu_bacteria 2599185312 2600002355 74
143 iso_pu_bacteria 2599185313 2600006892 74
144 iso_pu_bacteria 2599185314 2600010482 74
145 iso_pu_bacteria 2599185315 2600021405 74
146 iso_pu_bacteria 2599185316 2600026373 74
147 iso_pu_bacteria 2599185317 2600032471 74
148 iso_pu_bacteria 2599185318 2600036310 74
149 iso_pu_bacteria 2599185319 2600043607 74
150 iso_pu_bacteria 2599185320 2600049888 74
151 iso_pu_bacteria 2599185321 2600053531 74
152 iso_pu_bacteria 2599185322 2600061453 74
153 iso_pu_bacteria 2599185323 2600067377 74
154 iso_pu_bacteria 2599185324 2600070384 74
155 iso_pu_bacteria 2599185325 2600080211 74
156 iso_pu_bacteria 2600254930 2600362033 74
157 iso_pu_bacteria 2600255296 2601689511 74
158 iso_pu_bacteria 2600255318 2601799973 74
159 iso_pu_bacteria 2603880185 2606074228 74
160 iso_pu_bacteria 2603880199 2606127090 74
161 iso_pu_bacteria 2623620443 2624479263 74
162 iso_pu_bacteria 2623620446 2624493745 74
163 iso_pu_bacteria 2643221650 2644283642 74
164 iso_pu_bacteria 2651869719 2652546598 74
165 iso_pu_bacteria 2667528170 2671090415 74
166 iso_pu_bacteria 2667528176 2671130387 74
167 iso_pu_bacteria 2675903420 2677900018 74
168 iso_pu_bacteria 2675903515 2678262389 74
169 iso_pu_bacteria 2713897148 2715751799 74
170 iso_pu_bacteria 2713897149 2715759654 74
171 iso_pu_bacteria 2718217725 2718633119 74
172 iso_pu_bacteria 2721755607 2723249989 74
173 iso_pu_bacteria 2738541294 2738808335 74
174 iso_pu_bacteria 2738541309 2738895695 74
175 iso_pu_bacteria 2738543025 2739314277 74
176 iso_pu_bacteria 2744054620 2745008735 74
177 iso_pu_bacteria 2791355520 2794596185 74
178 iso_pu_bacteria 2808606361 2808858219 74
179 iso_pu_bacteria 2808606376 2808924158 74
180 iso_pu_bacteria 2808606377 2808929969 74
181 iso_pu_bacteria 2808606378 2808938392 74
182 iso_pu_bacteria 2808606380 2808946099 74
183 iso_pu_bacteria 2808606381 2808951955 74
184 iso_pu_bacteria 2808606383 2808966704 74
185 iso_pu_bacteria 2808606385 2808977942 74
186 iso_pu_bacteria 2808606388 2808993422 74
187 iso_pu_bacteria 2808606389 2809001534 74
188 iso_pu_bacteria 2818991456 2819654494 74
189 iso_pu_bacteria 2842832357 2842832916 74
190 iso_pu_bacteria 2842843487 2842848467 74
191 iso_pu_bacteria 2852612431 2852612985 74
192 iso_pu_bacteria 2852667396 2852669280 74
193 iso_pu_bacteria 2860339153 2860340203 74
194 iso_pu_bacteria 2878029506 2878031272 74
195 iso_pu_bacteria 2913036834 2913038361 74
196 iso_pu_bacteria 2919063839 2919064258 74
197 iso_pu_bacteria 2919385768 2919386242 74
198 iso_pu_bacteria 2919456309 2919461935 74
199 iso_pu_bacteria 2919481497 2919481628 74
200 iso_pu_bacteria 2919487758 2919491670 74
201 iso_pu_bacteria 2919697872 2919700346 74
202 iso_pu_bacteria 2923586266 2923587515 74
203 iso_pu_bacteria 2929144301 2929145805 74
204 iso_pu_bacteria 2931369376 2931370854 74
205 iso_pu_bacteria 2931390751 2931395106 74
206 iso_pu_bacteria 2931396565 2931399899 74
207 iso_pu_bacteria 2945928738 2945932209 74
208 iso_pu_bacteria 2969304461 2969306043 74
209 iso_pu_bacteria 2974289157 2974292292 74
210 iso_pu_bacteria 2988728565 2988733340 74
211 iso_pu_bacteria 2998139840 2998141454 74
212 iso_pu_bacteria 3007614139 3007616293 74
213 iso_pu_bacteria 3007718800 3007719658 74
214 iso_pu_bacteria 8019775933 8019777001 74
215 iso_pu_bacteria 8029995093 8029999296 74
216 iso_pu_bacteria 8054285046 8054288530 74
217 iso_pu_bacteria 8054347763 8054350643 74
218 iso_pu_bacteria 8055817908 8055822544 74
219 iso_pu_bacteria 8056148874 8056150322 74
220 iso_pu_bacteria 8056155041 8056159304 74
221 iso_pu_bacteria 8056161164 8056162215 74
222 iso_pu_bacteria 8056166840 8056169607 74
223 iso_pu_bacteria 8056172158 8056175724 74
224 3300002737 JGI25162J39368_1000085 JGI25162J39368_100008582 77
225 3300002771 JGI25163J39215_1000401 JGI25163J39215_10004019 77
226 3300002772 JGI25164J39214_1000063 JGI25164J39214_100006382 77
227 3300003214 JGI25165J46597_1000160 JGI25165J46597_100016082 77
228 3300003781 Ga0055536_1000041 Ga0055536_1000041115 77
229 3300003791 Ga0055530_10000290 Ga0055530_1000029034 77
230 3300003792 Ga0055540_1000584 Ga0055540_100058415 77
231 3300005289 Ga0065704_10157503 Ga0065704_101575033 77
232 3300005289 Ga0065704_10724502 Ga0065704_107245021 77
233 3300005331 Ga0070670_100001455 Ga0070670_1000014552 77
234 3300009011 Ga0105251_10005407 Ga0105251_100054074 77
235 3300009036 Ga0105244_10002540 Ga0105244_1000254010 77
236 3300009036 Ga0105244_10223117 Ga0105244_102231172 77
237 3300009036 Ga0105244_10436551 Ga0105244_104365511 77
238 3300009092 Ga0105250_10013656 Ga0105250_100136565 77
239 3300009092 Ga0105250_10188621 Ga0105250_101886212 77
240 3300009148 Ga0105243_10001489 Ga0105243_1000148920 77
241 3300009176 Ga0105242_11199979 Ga0105242_111999792 77
242 3300010375 Ga0105239_11945189 Ga0105239_119451892 77
243 3300011119 Ga0105246_10003399 Ga0105246_100033993 77
244 3300013100 Ga0157373_10057732 Ga0157373_100577322 77
245 3300013100 Ga0157373_10211115 Ga0157373_102111152 77
246 3300013100 Ga0157373_11193533 Ga0157373_111935331 77
247 3300013102 Ga0157371_10002025 Ga0157371_1000202515 77
248 3300013102 Ga0157371_11220898 Ga0157371_112208981 77
249 3300013104 Ga0157370_10233128 Ga0157370_102331282 77
250 3300013104 Ga0157370_11763240 Ga0157370_117632401 77
251 3300013306 Ga0163162_10083369 Ga0163162_100833695 77
252 3300013307 Ga0157372_10003301 Ga0157372_100033015 77
253 3300013308 Ga0157375_10002948 Ga0157375_1000294815 77
254 3300013308 Ga0157375_10401634 Ga0157375_104016342 77
255 3300014497 Ga0182008_10009051 Ga0182008_100090514 77
256 3300015265 Ga0182005_1109253 Ga0182005_11092531 77
257 3300017792 Ga0163161_10012220 Ga0163161_100122202 77
258 3300017792 Ga0163161_10054830 Ga0163161_100548303 77
259 3300025207 Ga0209760_100039 Ga0209760_10003994 77
260 3300025231 Ga0207427_100001 Ga0207427_100001768 77
261 3300025233 Ga0209437_100003 Ga0209437_100003604 77
262 3300025261 Ga0209233_1000007 Ga0209233_1000007768 77
263 3300025292 Ga0209676_1000021 Ga0209676_100002158 77
264 3300025298 Ga0209050_1000107 Ga0209050_100010757 77
265 3300025303 Ga0209051_1000090 Ga0209051_100009099 77
266 3300025304 Ga0209257_1044277 Ga0209257_10442772 77
267 3300025711 Ga0207696_1000158 Ga0207696_100015846 77
268 3300025711 Ga0207696_1031373 Ga0207696_10313733 77
269 3300025728 Ga0207655_1002953 Ga0207655_10029533 77
270 3300025728 Ga0207655_1076360 Ga0207655_10763602 77
271 3300025735 Ga0207713_1003857 Ga0207713_10038578 77
272 3300025735 Ga0207713_1009834 Ga0207713_10098345 77
273 3300025925 Ga0207650_10000212 Ga0207650_1000021214 77
274 3300025933 Ga0207706_10104110 Ga0207706_101041103 77
275 3300025935 Ga0207709_10000350 Ga0207709_1000035023 77
276 3300031344 Ga0265316_10130885 Ga0265316_101308853 77
277 3300041411 Ga0439466_0000210 Ga0439466_0000210_3504_3746 77
278 3300041498 Ga0451841_0896663 Ga0451841_0896663_466_699 77
279 3300042009 Ga0439451_051511 Ga0439451_051511_264_497 77
280 3300042013 Ga0439456_012542 Ga0439456_012542_783_1016 77
281 3300042016 Ga0439463_055798 Ga0439463_055798_750_983 77
282 3300042139 Ga0450904_016455 Ga0450904_016455_395_628 77
283 3300042461 Ga0439460_0145693 Ga0439460_0145693_314_547 77
284 3300042532 Ga0450893_0009120 Ga0450893_0009120_448_681 77
285 3300042993 Ga0439440_0021555 Ga0439440_0021555_500_733 77
286 3300046453 Ga0495627_004254 Ga0495627_004254_2788_3021 77
287 3300046458 Ga0495591_005439 Ga0495591_005439_4488_4721 77
288 3300046458 Ga0495591_021071 Ga0495591_021071_789_1022 77
289 3300046458 Ga0495591_033078 Ga0495591_033078_211_444 77
290 3300046460 Ga0495638_0014931 Ga0495638_0014931_4176_4409 77
291 3300046474 Ga0495605_0050225 Ga0495605_0050225_1324_1557 77
292 3300046492 Ga0495585_0053613 Ga0495585_0053613_637_870 77
293 3300046492 Ga0495585_0064713 Ga0495585_0064713_1138_1371 77
294 3300046501 Ga0495607_0044527 Ga0495607_0044527_2117_2350 77
295 3300046501 Ga0495607_0075018 Ga0495607_0075018_1470_1703 77
296 3300046507 Ga0495606_0003868 Ga0495606_0003868_8150_8383 77
297 3300046507 Ga0495606_0067682 Ga0495606_0067682_636_869 77
298 3300046507 Ga0495606_0081816 Ga0495606_0081816_446_679 77
299 3300046507 Ga0495606_0296678 Ga0495606_0296678_82_315 77
300 3300046507 Ga0495606_0511393 Ga0495606_0511393_310_543 77
301 3300046512 Ga0495610_0001544 Ga0495610_0001544_19117_19350 77
302 3300046512 Ga0495610_0004742 Ga0495610_0004742_1366_1599 77
303 3300046512 Ga0495610_0009200 Ga0495610_0009200_3285_3518 77
304 3300046512 Ga0495610_0117289 Ga0495610_0117289_156_389 77
305 3300046515 Ga0495620_0004800 Ga0495620_0004800_2784_3017 77
306 3300046519 Ga0495632_0011305 Ga0495632_0011305_3873_4106 77
307 3300046520 Ga0495637_0047575 Ga0495637_0047575_584_817 77
308 3300046522 Ga0495643_0048404 Ga0495643_0048404_2053_2286 77
309 3300046524 Ga0495648_0136790 Ga0495648_0136790_1011_1244 77
310 3300046530 Ga0495654_0141567 Ga0495654_0141567_349_582 77
311 3300046530 Ga0495654_0175149 Ga0495654_0175149_130_363 77
312 3300046616 Ga0495668_0039708 Ga0495668_0039708_923_1156 77
313 3300046648 Ga0495611_0025189 Ga0495611_0025189_335_568 77
314 3300046665 Ga0495661_0000773 Ga0495661_0000773_16895_17128 77
315 3300046692 Ga0495671_0000377 Ga0495671_0000377_29935_30168 77
316 3300046692 Ga0495671_0032755 Ga0495671_0032755_1398_1631 77
317 3300046692 Ga0495671_0229663 Ga0495671_0229663_186_419 77
318 3300046694 Ga0495649_0019441 Ga0495649_0019441_699_932 77
319 3300046694 Ga0495649_0043082 Ga0495649_0043082_584_817 77
320 3300046694 Ga0495649_0092334 Ga0495649_0092334_1130_1363 77
321 3300046794 Ga0495589_0003682 Ga0495589_0003682_3589_3822 77
322 3300046794 Ga0495589_0071159 Ga0495589_0071159_1041_1274 77
323 3300046810 Ga0495660_0070707 Ga0495660_0070707_514_747 77
324 3300047446 Ga0495679_005387 Ga0495679_005387_4183_4416 77
325 3300047446 Ga0495679_022757 Ga0495679_022757_532_765 77
326 3300047469 Ga0495673_0055171 Ga0495673_0055171_749_982 77
327 3300047469 Ga0495673_0070234 Ga0495673_0070234_67_300 77
328 3300047469 Ga0495673_0138546 Ga0495673_0138546_130_363 77
329 3300047470 Ga0495681_0015768 Ga0495681_0015768_3258_3491 77
330 3300047470 Ga0495681_0018369 Ga0495681_0018369_52_285 77
331 3300047470 Ga0495681_0033575 Ga0495681_0033575_1665_1898 77
332 3300047470 Ga0495681_0106388 Ga0495681_0106388_688_921 77
333 3300047472 Ga0495686_0080633 Ga0495686_0080633_1482_1715 77
334 3300048091 Ga0495626_0060331 Ga0495626_0060331_488_721 77
335 3300048919 Ga0496116_0000085 Ga0496116_0000085_18786_19019 77
336 3300048920 Ga0496117_0001620 Ga0496117_0001620_14932_15165 77
337 3300048920 Ga0496117_0011807 Ga0496117_0011807_4652_4885 77
338 3300048920 Ga0496117_0095409 Ga0496117_0095409_648_881 77
339 3300048921 Ga0496118_0112796 Ga0496118_0112796_425_658 77
340 3300048921 Ga0496118_0114349 Ga0496118_0114349_304_537 77
341 3300048922 Ga0496119_0025519 Ga0496119_0025519_759_992 77
342 3300048922 Ga0496119_0081228 Ga0496119_0081228_707_940 77
343 3300048923 Ga0496120_0009532 Ga0496120_0009532_3506_3739 77
344 3300048923 Ga0496120_0106524 Ga0496120_0106524_216_449 77
345 3300048924 Ga0496121_0000179 Ga0496121_0000179_22405_22638 77
346 3300048925 Ga0496122_0019724 Ga0496122_0019724_2929_3162 77
347 3300048925 Ga0496122_0265133 Ga0496122_0265133_424_657 77
348 3300048925 Ga0496122_0436645 Ga0496122_0436645_282_515 77
349 3300048926 Ga0496123_0006947 Ga0496123_0006947_1090_1323 77
350 3300048926 Ga0496123_0468191 Ga0496123_0468191_133_366 77
351 3300048927 Ga0496124_0001693 Ga0496124_0001693_16818_17051 77
352 3300048927 Ga0496124_0198005 Ga0496124_0198005_1199_1432 77
353 3300048927 Ga0496124_0515781 Ga0496124_0515781_75_308 77
354 3300048928 Ga0496125_0001691 Ga0496125_0001691_16218_16451 77
355 3300048928 Ga0496125_0036633 Ga0496125_0036633_3481_3714 77
356 3300048928 Ga0496125_0200182 Ga0496125_0200182_178_411 77
357 3300048929 Ga0496126_0037114 Ga0496126_0037114_1288_1521 77
358 3300049459 Ga0495678_023839 Ga0495678_023839_1436_1669 77
359 3300049459 Ga0495678_150381 Ga0495678_150381_124_357 77
360 3300053145 Ga0500586_199134 Ga0500586_199134_40_273 77
361 2124908027 MRS2a_Contig_449 MRS2a_00336440 78
362 2162886007 SwRhRL2b_contig_9416 SwRhRL2b_0433.00005010 78
363 3300002737 JGI25162J39368_1000100 JGI25162J39368_100010074 78
364 3300002738 JGI25154J39366_1010304 JGI25154J39366_10103042 78
365 3300002771 JGI25163J39215_1000366 JGI25163J39215_10003665 78
366 3300002772 JGI25164J39214_1000079 JGI25164J39214_100007974 78
367 3300003214 JGI25165J46597_1000183 JGI25165J46597_100018374 78
368 3300003323 rootH1_10159091 rootH1_101590913 78
369 3300003751 Ga0055538_1000027 Ga0055538_1000027147 78
370 3300003752 Ga0055539_1000036 Ga0055539_1000036147 78
371 3300003756 Ga0055533_1000046 Ga0055533_1000046147 78
372 3300003758 Ga0055532_1000032 Ga0055532_1000032147 78
373 3300003759 Ga0055525_1000217 Ga0055525_100021714 78
374 3300003759 Ga0055525_1009439 Ga0055525_10094391 78
375 3300003761 Ga0055535_1029868 Ga0055535_10298682 78
376 3300003781 Ga0055536_1000362 Ga0055536_100036222 78
377 3300003781 Ga0055536_1000391 Ga0055536_100039123 78
378 3300003781 Ga0055536_1041221 Ga0055536_10412211 78
379 3300003791 Ga0055530_10000113 Ga0055530_1000011356 78
380 3300003791 Ga0055530_10002005 Ga0055530_100020053 78
381 3300003791 Ga0055530_10003530 Ga0055530_100035304 78
382 3300003792 Ga0055540_1000154 Ga0055540_100015414 78
383 3300003792 Ga0055540_1000170 Ga0055540_100017014 78
384 3300003794 Ga0055531_10000842 Ga0055531_1000084216 78
385 3300003794 Ga0055531_10106302 Ga0055531_101063022 78
386 3300003841 Ga0055541_1000024 Ga0055541_1000024147 78
387 3300005288 Ga0065714_10003448 Ga0065714_100034484 78
388 3300005288 Ga0065714_10065086 Ga0065714_100650867 78
389 3300005288 Ga0065714_10065134 Ga0065714_100651343 78
390 3300005288 Ga0065714_10065524 Ga0065714_100655242 78
391 3300005288 Ga0065714_10065645 Ga0065714_100656455 78
392 3300005288 Ga0065714_10071128 Ga0065714_100711283 78
393 3300005288 Ga0065714_10151886 Ga0065714_101518861 78
394 3300005288 Ga0065714_10192218 Ga0065714_101922182 78
395 3300005288 Ga0065714_10248730 Ga0065714_102487302 78
396 3300005289 Ga0065704_10008790 Ga0065704_100087903 78
397 3300005289 Ga0065704_10070997 Ga0065704_100709973 78
398 3300005290 Ga0065712_10077776 Ga0065712_100777763 78
399 3300005293 Ga0065715_10463401 Ga0065715_104634011 78
400 3300005328 Ga0070676_10709116 Ga0070676_107091162 78
401 3300005331 Ga0070670_100022866 Ga0070670_1000228662 78
402 3300005344 Ga0070661_100000008 Ga0070661_100000008143 78
403 3300005353 Ga0070669_100000579 Ga0070669_10000057914 78
404 3300005353 Ga0070669_100301821 Ga0070669_1003018211 78
405 3300005353 Ga0070669_100418801 Ga0070669_1004188012 78
406 3300005353 Ga0070669_100594378 Ga0070669_1005943782 78
407 3300005366 Ga0070659_100630535 Ga0070659_1006305352 78
408 3300005457 Ga0070662_100000388 Ga0070662_10000038814 78
409 3300005548 Ga0070665_100189991 Ga0070665_1001899913 78
410 3300005548 Ga0070665_101315365 Ga0070665_1013153651 78
411 3300005564 Ga0070664_100000028 Ga0070664_10000002851 78
412 3300005577 Ga0068857_101147489 Ga0068857_1011474892 78
413 3300005578 Ga0068854_100025361 Ga0068854_1000253613 78
414 3300005834 Ga0068851_10000068 Ga0068851_1000006824 78
415 3300006028 Ga0070717_11548613 Ga0070717_115486132 78
416 3300006051 Ga0075364_10066979 Ga0075364_100669792 78
417 3300006051 Ga0075364_10084878 Ga0075364_100848782 78
418 3300006051 Ga0075364_10516479 Ga0075364_105164792 78
419 3300006058 Ga0075432_10006592 Ga0075432_100065924 78
420 3300006058 Ga0075432_10146805 Ga0075432_101468052 78
421 3300006058 Ga0075432_10403646 Ga0075432_104036461 78
422 3300006177 Ga0075362_10644463 Ga0075362_106444632 78
423 3300006914 Ga0075436_100903128 Ga0075436_1009031282 78
424 3300006946 Ga0079104_1000676 Ga0079104_100067616 78
425 3300006946 Ga0079104_1003227 Ga0079104_10032274 78
426 3300006946 Ga0079104_1086989 Ga0079104_10869892 78
427 3300006946 Ga0079104_1106266 Ga0079104_11062661 78
428 3300009011 Ga0105251_10002641 Ga0105251_100026413 78
429 3300009011 Ga0105251_10010986 Ga0105251_100109864 78
430 3300009011 Ga0105251_10037148 Ga0105251_100371482 78
431 3300009011 Ga0105251_10184456 Ga0105251_101844561 78
432 3300009011 Ga0105251_10203855 Ga0105251_102038552 78
433 3300009011 Ga0105251_10315213 Ga0105251_103152132 78
434 3300009011 Ga0105251_10496421 Ga0105251_104964211 78
435 3300009036 Ga0105244_10004871 Ga0105244_100048718 78
436 3300009036 Ga0105244_10005389 Ga0105244_100053893 78
437 3300009036 Ga0105244_10026118 Ga0105244_100261182 78
438 3300009036 Ga0105244_10065022 Ga0105244_100650223 78
439 3300009036 Ga0105244_10108077 Ga0105244_101080772 78
440 3300009036 Ga0105244_10210113 Ga0105244_102101132 78
441 3300009092 Ga0105250_10000180 Ga0105250_100001807 78
442 3300009092 Ga0105250_10003055 Ga0105250_100030555 78
443 3300009092 Ga0105250_10078404 Ga0105250_100784041 78
444 3300009092 Ga0105250_10179206 Ga0105250_101792062 78
445 3300009092 Ga0105250_10249086 Ga0105250_102490861 78
446 3300009148 Ga0105243_10000451 Ga0105243_1000045119 78
447 3300009148 Ga0105243_10605625 Ga0105243_106056252 78
448 3300009148 Ga0105243_12854837 Ga0105243_128548371 78
449 3300009176 Ga0105242_10000024 Ga0105242_1000002440 78
450 3300009177 Ga0105248_10306112 Ga0105248_103061122 78
451 3300009545 Ga0105237_10144455 Ga0105237_101444553 78
452 3300009545 Ga0105237_10245206 Ga0105237_102452062 78
453 3300011119 Ga0105246_10001574 Ga0105246_100015743 78
454 3300011119 Ga0105246_10344830 Ga0105246_103448302 78
455 3300012498 Ga0157345_1000081 Ga0157345_10000813 78
456 3300013100 Ga0157373_10000593 Ga0157373_1000059316 78
457 3300013100 Ga0157373_10005230 Ga0157373_100052303 78
458 3300013100 Ga0157373_10034426 Ga0157373_100344262 78
459 3300013100 Ga0157373_10075043 Ga0157373_100750432 78
460 3300013100 Ga0157373_11019802 Ga0157373_110198022 78
461 3300013100 Ga0157373_11435105 Ga0157373_114351051 78
462 3300013102 Ga0157371_10000583 Ga0157371_1000058315 78
463 3300013102 Ga0157371_10026343 Ga0157371_100263434 78
464 3300013102 Ga0157371_10029477 Ga0157371_100294773 78
465 3300013102 Ga0157371_10528442 Ga0157371_105284422 78
466 3300013104 Ga0157370_10025749 Ga0157370_100257494 78
467 3300013104 Ga0157370_10034132 Ga0157370_100341324 78
468 3300013104 Ga0157370_10116449 Ga0157370_101164492 78
469 3300013104 Ga0157370_10122454 Ga0157370_101224542 78
470 3300013104 Ga0157370_10139652 Ga0157370_101396523 78
471 3300013104 Ga0157370_10640182 Ga0157370_106401822 78
472 3300013104 Ga0157370_11699099 Ga0157370_116990991 78
473 3300013104 Ga0157370_11998981 Ga0157370_119989811 78
474 3300013105 Ga0157369_10007489 Ga0157369_100074895 78
475 3300013105 Ga0157369_10026040 Ga0157369_100260402 78
476 3300013105 Ga0157369_10124067 Ga0157369_101240672 78
477 3300013105 Ga0157369_10162310 Ga0157369_101623103 78
478 3300013105 Ga0157369_10237276 Ga0157369_102372763 78
479 3300013105 Ga0157369_10306275 Ga0157369_103062752 78
480 3300013105 Ga0157369_10546892 Ga0157369_105468922 78
481 3300013306 Ga0163162_10033464 Ga0163162_100334643 78
482 3300013308 Ga0157375_10011410 Ga0157375_100114103 78
483 3300013308 Ga0157375_10496052 Ga0157375_104960522 78
484 3300014497 Ga0182008_10002558 Ga0182008_1000255811 78
485 3300014497 Ga0182008_10003740 Ga0182008_100037408 78
486 3300014497 Ga0182008_10032174 Ga0182008_100321743 78
487 3300015261 Ga0182006_1000750 Ga0182006_100075010 78
488 3300015261 Ga0182006_1000997 Ga0182006_10009974 78
489 3300015261 Ga0182006_1010943 Ga0182006_10109433 78
490 3300015261 Ga0182006_1015982 Ga0182006_10159822 78
491 3300015261 Ga0182006_1121783 Ga0182006_11217831 78
492 3300015261 Ga0182006_1142881 Ga0182006_11428811 78
493 3300015262 Ga0182007_10000143 Ga0182007_1000014315 78
494 3300015262 Ga0182007_10028714 Ga0182007_100287142 78
495 3300015262 Ga0182007_10180095 Ga0182007_101800952 78
496 3300015262 Ga0182007_10182958 Ga0182007_101829582 78
497 3300015262 Ga0182007_10281916 Ga0182007_102819162 78
498 3300015265 Ga0182005_1000800 Ga0182005_10008002 78
499 3300015265 Ga0182005_1034772 Ga0182005_10347722 78
500 3300015265 Ga0182005_1056902 Ga0182005_10569022 78
501 3300017792 Ga0163161_10003088 Ga0163161_100030884 78
502 3300017792 Ga0163161_11107236 Ga0163161_111072361 78
503 3300017792 Ga0163161_11654599 Ga0163161_116545992 78
504 3300025206 Ga0209435_110293 Ga0209435_1102932 78
505 3300025207 Ga0209760_100052 Ga0209760_10005273 78
506 3300025224 Ga0209784_100017 Ga0209784_100017302 78
507 3300025225 Ga0209566_100014 Ga0209566_100014302 78
508 3300025226 Ga0209674_100028 Ga0209674_100028302 78
509 3300025229 Ga0209147_100038 Ga0209147_100038157 78
510 3300025230 Ga0209563_100032 Ga0209563_100032302 78
511 3300025230 Ga0209563_100193 Ga0209563_10019335 78
512 3300025231 Ga0207427_100029 Ga0207427_10002921 78
513 3300025233 Ga0209437_100009 Ga0209437_100009276 78
514 3300025242 Ga0209258_100197 Ga0209258_10019782 78
515 3300025246 Ga0209646_1000711 Ga0209646_10007116 78
516 3300025253 Ga0209677_100018 Ga0209677_100018302 78
517 3300025256 Ga0209759_1005073 Ga0209759_10050734 78
518 3300025256 Ga0209759_1022298 Ga0209759_10222982 78
519 3300025261 Ga0209233_1000032 Ga0209233_1000032276 78
520 3300025291 Ga0209675_1005911 Ga0209675_10059114 78
521 3300025292 Ga0209676_1000016 Ga0209676_1000016370 78
522 3300025292 Ga0209676_1000033 Ga0209676_1000033198 78
523 3300025292 Ga0209676_1002055 Ga0209676_10020559 78
524 3300025298 Ga0209050_1000009 Ga0209050_1000009137 78
525 3300025298 Ga0209050_1000036 Ga0209050_1000036188 78
526 3300025303 Ga0209051_1000043 Ga0209051_1000043260 78
527 3300025303 Ga0209051_1000053 Ga0209051_1000053137 78
528 3300025304 Ga0209257_1000098 Ga0209257_100009853 78
529 3300025304 Ga0209257_1010396 Ga0209257_10103962 78
530 3300025321 Ga0207656_10000089 Ga0207656_1000008918 78
531 3300025711 Ga0207696_1000043 Ga0207696_1000043243 78
532 3300025711 Ga0207696_1001093 Ga0207696_100109311 78
533 3300025711 Ga0207696_1015471 Ga0207696_10154713 78
534 3300025711 Ga0207696_1099842 Ga0207696_10998421 78
535 3300025728 Ga0207655_1000095 Ga0207655_1000095159 78
536 3300025728 Ga0207655_1001318 Ga0207655_10013189 78
537 3300025728 Ga0207655_1002702 Ga0207655_100270210 78
538 3300025728 Ga0207655_1008609 Ga0207655_10086096 78
539 3300025728 Ga0207655_1018148 Ga0207655_10181482 78
540 3300025735 Ga0207713_1001420 Ga0207713_10014205 78
541 3300025735 Ga0207713_1003434 Ga0207713_10034345 78
542 3300025735 Ga0207713_1005710 Ga0207713_10057105 78
543 3300025735 Ga0207713_1013374 Ga0207713_10133742 78
544 3300025735 Ga0207713_1053355 Ga0207713_10533552 78
545 3300025735 Ga0207713_1218481 Ga0207713_12184812 78
546 3300025907 Ga0207645_11081834 Ga0207645_110818341 78
547 3300025914 Ga0207671_10000035 Ga0207671_10000035147 78
548 3300025920 Ga0207649_10000017 Ga0207649_1000001718 78
549 3300025923 Ga0207681_10000835 Ga0207681_100008356 78
550 3300025923 Ga0207681_10027375 Ga0207681_100273752 78
551 3300025923 Ga0207681_10226781 Ga0207681_102267812 78
552 3300025925 Ga0207650_10001330 Ga0207650_100013302 78
553 3300025932 Ga0207690_11098812 Ga0207690_110988121 78
554 3300025933 Ga0207706_10000170 Ga0207706_1000017050 78
555 3300025934 Ga0207686_10037438 Ga0207686_100374383 78
556 3300025935 Ga0207709_10000036 Ga0207709_10000036233 78
557 3300025941 Ga0207711_10219890 Ga0207711_102198902 78
558 3300025945 Ga0207679_10000005 Ga0207679_10000005237 78
559 3300025945 Ga0207679_10112075 Ga0207679_101120752 78
560 3300025981 Ga0207640_10032869 Ga0207640_100328692 78
561 3300026116 Ga0207674_11685104 Ga0207674_116851041 78
562 3300027111 Ga0209281_1000172 Ga0209281_1000172120 78
563 3300027111 Ga0209281_1002499 Ga0209281_10024994 78
564 3300027111 Ga0209281_1008985 Ga0209281_10089853 78
565 3300027111 Ga0209281_1009557 Ga0209281_10095572 78
566 3300027111 Ga0209281_1059341 Ga0209281_10593411 78
567 3300027907 Ga0207428_10052129 Ga0207428_100521293 78
568 3300027907 Ga0207428_10379095 Ga0207428_103790952 78
569 3300028379 Ga0268266_10041099 Ga0268266_100410992 78
570 3300028379 Ga0268266_12041360 Ga0268266_120413601 78
571 3300028786 Ga0307517_10152648 Ga0307517_101526482 78
572 3300028786 Ga0307517_10380240 Ga0307517_103802401 78
573 3300030521 Ga0307511_10338628 Ga0307511_103386282 78
574 3300030521 Ga0307511_10355633 Ga0307511_103556331 78
575 3300030735 Ga0316178_1161793 Ga0316178_11617933 78
576 3300030744 Ga0316181_1076629 Ga0316181_10766293 78
577 3300031507 Ga0307509_10058296 Ga0307509_100582961 78
578 3300031548 Ga0307408_100003851 Ga0307408_1000038513 78
579 3300031548 Ga0307408_100052108 Ga0307408_1000521082 78
580 3300031548 Ga0307408_100168745 Ga0307408_1001687452 78
581 3300031730 Ga0307516_10194640 Ga0307516_101946401 78
582 3300031730 Ga0307516_10207335 Ga0307516_102073352 78
583 3300031731 Ga0307405_10000148 Ga0307405_1000014818 78
584 3300031901 Ga0307406_10590351 Ga0307406_105903511 78
585 3300031903 Ga0307407_10110702 Ga0307407_101107022 78
586 3300031903 Ga0307407_10248612 Ga0307407_102486122 78
587 3300031911 Ga0307412_10092885 Ga0307412_100928853 78
588 3300031911 Ga0307412_10530125 Ga0307412_105301252 78
589 3300031911 Ga0307412_10555070 Ga0307412_105550702 78
590 3300031911 Ga0307412_10799667 Ga0307412_107996672 78
591 3300032002 Ga0307416_100724355 Ga0307416_1007243552 78
592 3300032002 Ga0307416_101574603 Ga0307416_1015746032 78
593 3300032004 Ga0307414_10152903 Ga0307414_101529033 78
594 3300032004 Ga0307414_10477821 Ga0307414_104778211 78
595 3300032005 Ga0307411_10073133 Ga0307411_100731331 78
596 3300032005 Ga0307411_11568955 Ga0307411_115689552 78
597 3300038705 Ga0237819_04361 Ga0237819_04361_1275_1511 78
598 3300041405 Ga0439438_001947 Ga0439438_001947_7911_8147 78
599 3300041405 Ga0439438_013399 Ga0439438_013399_663_899 78
600 3300041405 Ga0439438_108813 Ga0439438_108813_419_658 78
601 3300041405 Ga0439438_133340 Ga0439438_133340_12_251 78
602 3300041405 Ga0439438_176169 Ga0439438_176169_262_498 78
603 3300041407 Ga0439447_001682 Ga0439447_001682_6671_6907 78
604 3300041407 Ga0439447_018880 Ga0439447_018880_423_659 78
605 3300041407 Ga0439447_026416 Ga0439447_026416_139_375 78
606 3300041407 Ga0439447_029934 Ga0439447_029934_137_382 78
607 3300041407 Ga0439447_059499 Ga0439447_059499_392_631 78
608 3300041411 Ga0439466_0004698 Ga0439466_0004698_1730_1966 78
609 3300041411 Ga0439466_0033490 Ga0439466_0033490_1081_1317 78
610 3300041411 Ga0439466_0038598 Ga0439466_0038598_1160_1396 78
611 3300041411 Ga0439466_0044783 Ga0439466_0044783_794_1030 78
612 3300041413 Ga0439465_0006255 Ga0439465_0006255_2122_2358 78
613 3300041498 Ga0451841_0215041 Ga0451841_0215041_374_610 78
614 3300041509 Ga0451843_0380463 Ga0451843_0380463_170_409 78
615 3300041997 Ga0439431_0000893 Ga0439431_0000893_3333_3569 78
616 3300042004 Ga0439445_0067994 Ga0439445_0067994_315_554 78
617 3300042004 Ga0439445_0143953 Ga0439445_0143953_405_644 78
618 3300042004 Ga0439445_0220782 Ga0439445_0220782_284_520 78
619 3300042006 Ga0439432_003985 Ga0439432_003985_4757_4993 78
620 3300042006 Ga0439432_004679 Ga0439432_004679_2584_2820 78
621 3300042006 Ga0439432_009861 Ga0439432_009861_1356_1601 78
622 3300042009 Ga0439451_000899 Ga0439451_000899_2115_2351 78
623 3300042009 Ga0439451_002691 Ga0439451_002691_2207_2443 78
624 3300042009 Ga0439451_005962 Ga0439451_005962_1624_1860 78
625 3300042009 Ga0439451_015645 Ga0439451_015645_720_956 78
626 3300042009 Ga0439451_041973 Ga0439451_041973_264_500 78
627 3300042009 Ga0439451_046382 Ga0439451_046382_97_333 78
628 3300042009 Ga0439451_058159 Ga0439451_058159_29_265 78
629 3300042010 Ga0439452_019397 Ga0439452_019397_370_606 78
630 3300042010 Ga0439452_025198 Ga0439452_025198_1077_1313 78
631 3300042010 Ga0439452_025626 Ga0439452_025626_418_657 78
632 3300042010 Ga0439452_126262 Ga0439452_126262_37_273 78
633 3300042013 Ga0439456_001820 Ga0439456_001820_1658_1894 78
634 3300042013 Ga0439456_069164 Ga0439456_069164_209_445 78
635 3300042013 Ga0439456_099842 Ga0439456_099842_73_309 78
636 3300042013 Ga0439456_124594 Ga0439456_124594_102_338 78
637 3300042016 Ga0439463_021112 Ga0439463_021112_596_832 78
638 3300042115 Ga0450911_005477 Ga0450911_005477_861_1097 78
639 3300042116 Ga0450912_007723 Ga0450912_007723_502_738 78
640 3300042121 Ga0450919_002405 Ga0450919_002405_1076_1312 78
641 3300042124 Ga0450922_007365 Ga0450922_007365_337_573 78
642 3300042127 Ga0450890_000610 Ga0450890_000610_1184_1420 78
643 3300042130 Ga0450892_011333 Ga0450892_011333_272_508 78
644 3300042136 Ga0450900_068521 Ga0450900_068521_114_353 78
645 3300042137 Ga0450902_015108 Ga0450902_015108_938_1174 78
646 3300042138 Ga0450903_001584 Ga0450903_001584_3045_3281 78
647 3300042139 Ga0450904_008178 Ga0450904_008178_542_781 78
648 3300042142 Ga0450905_003100 Ga0450905_003100_391_627 78
649 3300042145 Ga0450906_007238 Ga0450906_007238_916_1152 78
650 3300042146 Ga0450907_001013 Ga0450907_001013_5580_5816 78
651 3300042146 Ga0450907_010936 Ga0450907_010936_786_1025 78
652 3300042147 Ga0450910_000904 Ga0450910_000904_3118_3354 78
653 3300042147 Ga0450910_015437 Ga0450910_015437_580_816 78
654 3300042156 Ga0439446_0018280 Ga0439446_0018280_1076_1312 78
655 3300042184 Ga0450908_006686 Ga0450908_006686_723_959 78
656 3300042185 Ga0450909_003084 Ga0450909_003084_697_933 78
657 3300042435 Ga0439434_0085923 Ga0439434_0085923_562_798 78
658 3300042461 Ga0439460_0015510 Ga0439460_0015510_727_963 78
659 3300042532 Ga0450893_0006743 Ga0450893_0006743_1020_1256 78
660 3300042532 Ga0450893_0013634 Ga0450893_0013634_1051_1287 78
661 3300042993 Ga0439440_0008787 Ga0439440_0008787_692_928 78
662 3300046452 Ga0495617_000327 Ga0495617_000327_25893_26129 78
663 3300046452 Ga0495617_010431 Ga0495617_010431_551_787 78
664 3300046452 Ga0495617_019467 Ga0495617_019467_1778_2017 78
665 3300046452 Ga0495617_020302 Ga0495617_020302_514_750 78
666 3300046452 Ga0495617_058620 Ga0495617_058620_664_900 78
667 3300046452 Ga0495617_063705 Ga0495617_063705_62_298 78
668 3300046452 Ga0495617_079901 Ga0495617_079901_428_664 78
669 3300046452 Ga0495617_122471 Ga0495617_122471_435_671 78
670 3300046453 Ga0495627_020332 Ga0495627_020332_1443_1682 78
671 3300046453 Ga0495627_026027 Ga0495627_026027_592_828 78
672 3300046454 Ga0495592_0104335 Ga0495592_0104335_836_1072 78
673 3300046455 Ga0495603_0321448 Ga0495603_0321448_118_354 78
674 3300046455 Ga0495603_0717352 Ga0495603_0717352_162_398 78
675 3300046457 Ga0495590_0032831 Ga0495590_0032831_1019_1255 78
676 3300046457 Ga0495590_0034403 Ga0495590_0034403_464_700 78
677 3300046457 Ga0495590_0044000 Ga0495590_0044000_259_495 78
678 3300046457 Ga0495590_0044874 Ga0495590_0044874_77_313 78
679 3300046458 Ga0495591_012253 Ga0495591_012253_889_1125 78
680 3300046458 Ga0495591_014139 Ga0495591_014139_1831_2067 78
681 3300046458 Ga0495591_014821 Ga0495591_014821_786_1025 78
682 3300046458 Ga0495591_021448 Ga0495591_021448_691_930 78
683 3300046458 Ga0495591_068473 Ga0495591_068473_589_825 78
684 3300046460 Ga0495638_0063478 Ga0495638_0063478_1433_1669 78
685 3300046460 Ga0495638_0254095 Ga0495638_0254095_21_257 78
686 3300046463 Ga0495653_0006548 Ga0495653_0006548_2944_3180 78
687 3300046463 Ga0495653_0019975 Ga0495653_0019975_3774_4010 78
688 3300046463 Ga0495653_0143755 Ga0495653_0143755_701_937 78
689 3300046471 Ga0495650_0038016 Ga0495650_0038016_792_1028 78
690 3300046471 Ga0495650_0043624 Ga0495650_0043624_1238_1474 78
691 3300046471 Ga0495650_0043909 Ga0495650_0043909_867_1103 78
692 3300046471 Ga0495650_0141147 Ga0495650_0141147_313_549 78
693 3300046471 Ga0495650_0287459 Ga0495650_0287459_23_262 78
694 3300046472 Ga0495580_0249009 Ga0495580_0249009_106_342 78
695 3300046474 Ga0495605_0001320 Ga0495605_0001320_11506_11742 78
696 3300046474 Ga0495605_0016458 Ga0495605_0016458_632_871 78
697 3300046474 Ga0495605_0039196 Ga0495605_0039196_1297_1533 78
698 3300046474 Ga0495605_0050933 Ga0495605_0050933_801_1037 78
699 3300046474 Ga0495605_0059732 Ga0495605_0059732_921_1157 78
700 3300046474 Ga0495605_0069676 Ga0495605_0069676_181_417 78
701 3300046474 Ga0495605_0094212 Ga0495605_0094212_991_1227 78
702 3300046475 Ga0495639_0000714 Ga0495639_0000714_14453_14689 78
703 3300046475 Ga0495639_0328600 Ga0495639_0328600_59_295 78
704 3300046491 Ga0495584_0001356 Ga0495584_0001356_185_421 78
705 3300046491 Ga0495584_0003392 Ga0495584_0003392_5995_6231 78
706 3300046491 Ga0495584_0041130 Ga0495584_0041130_1488_1724 78
707 3300046491 Ga0495584_0087031 Ga0495584_0087031_549_785 78
708 3300046491 Ga0495584_0091666 Ga0495584_0091666_993_1229 78
709 3300046491 Ga0495584_0173416 Ga0495584_0173416_357_596 78
710 3300046491 Ga0495584_0643750 Ga0495584_0643750_224_460 78
711 3300046492 Ga0495585_0010554 Ga0495585_0010554_4153_4389 78
712 3300046492 Ga0495585_0287265 Ga0495585_0287265_458_694 78
713 3300046492 Ga0495585_0479708 Ga0495585_0479708_288_524 78
714 3300046492 Ga0495585_0504896 Ga0495585_0504896_154_390 78
715 3300046499 Ga0495594_0085319 Ga0495594_0085319_1062_1298 78
716 3300046499 Ga0495594_0517572 Ga0495594_0517572_101_337 78
717 3300046500 Ga0495596_0446655 Ga0495596_0446655_106_345 78
718 3300046501 Ga0495607_0000655 Ga0495607_0000655_32431_32667 78
719 3300046501 Ga0495607_0001755 Ga0495607_0001755_18162_18398 78
720 3300046501 Ga0495607_0004203 Ga0495607_0004203_1405_1641 78
721 3300046501 Ga0495607_0014936 Ga0495607_0014936_347_583 78
722 3300046501 Ga0495607_0020561 Ga0495607_0020561_1012_1248 78
723 3300046501 Ga0495607_0106195 Ga0495607_0106195_707_943 78
724 3300046501 Ga0495607_0151363 Ga0495607_0151363_120_359 78
725 3300046501 Ga0495607_0199120 Ga0495607_0199120_50_286 78
726 3300046501 Ga0495607_0312059 Ga0495607_0312059_444_680 78
727 3300046501 Ga0495607_0317932 Ga0495607_0317932_241_477 78
728 3300046506 Ga0495583_0001561 Ga0495583_0001561_6511_6756 78
729 3300046506 Ga0495583_0108766 Ga0495583_0108766_412_648 78
730 3300046507 Ga0495606_0075214 Ga0495606_0075214_598_834 78
731 3300046507 Ga0495606_0078217 Ga0495606_0078217_1089_1325 78
732 3300046507 Ga0495606_0083878 Ga0495606_0083878_517_753 78
733 3300046507 Ga0495606_0190858 Ga0495606_0190858_41_277 78
734 3300046512 Ga0495610_0022244 Ga0495610_0022244_883_1119 78
735 3300046512 Ga0495610_0032277 Ga0495610_0032277_985_1221 78
736 3300046512 Ga0495610_0047577 Ga0495610_0047577_1229_1465 78
737 3300046512 Ga0495610_0083075 Ga0495610_0083075_474_710 78
738 3300046512 Ga0495610_0148770 Ga0495610_0148770_55_300 78
739 3300046512 Ga0495610_0213867 Ga0495610_0213867_352_588 78
740 3300046512 Ga0495610_0277251 Ga0495610_0277251_378_623 78
741 3300046513 Ga0495616_0029743 Ga0495616_0029743_638_877 78
742 3300046513 Ga0495616_0042041 Ga0495616_0042041_1137_1373 78
743 3300046513 Ga0495616_0043788 Ga0495616_0043788_1139_1375 78
744 3300046513 Ga0495616_0057902 Ga0495616_0057902_1112_1348 78
745 3300046513 Ga0495616_0156734 Ga0495616_0156734_571_807 78
746 3300046515 Ga0495620_0004858 Ga0495620_0004858_989_1225 78
747 3300046515 Ga0495620_0013240 Ga0495620_0013240_914_1150 78
748 3300046515 Ga0495620_0037976 Ga0495620_0037976_1447_1686 78
749 3300046515 Ga0495620_0041416 Ga0495620_0041416_470_706 78
750 3300046515 Ga0495620_0059262 Ga0495620_0059262_988_1224 78
751 3300046516 Ga0495628_0102425 Ga0495628_0102425_189_425 78
752 3300046517 Ga0495630_0265401 Ga0495630_0265401_570_806 78
753 3300046518 Ga0495631_0001232 Ga0495631_0001232_1339_1575 78
754 3300046518 Ga0495631_0039064 Ga0495631_0039064_1287_1523 78
755 3300046518 Ga0495631_0239117 Ga0495631_0239117_438_683 78
756 3300046518 Ga0495631_0239911 Ga0495631_0239911_251_487 78
757 3300046518 Ga0495631_0348172 Ga0495631_0348172_320_556 78
758 3300046519 Ga0495632_0002507 Ga0495632_0002507_534_770 78
759 3300046519 Ga0495632_0051933 Ga0495632_0051933_1153_1389 78
760 3300046519 Ga0495632_0064247 Ga0495632_0064247_1012_1251 78
761 3300046519 Ga0495632_0237552 Ga0495632_0237552_571_807 78
762 3300046519 Ga0495632_0400428 Ga0495632_0400428_93_329 78
763 3300046520 Ga0495637_0000187 Ga0495637_0000187_45612_45848 78
764 3300046520 Ga0495637_0010404 Ga0495637_0010404_3132_3368 78
765 3300046520 Ga0495637_0048558 Ga0495637_0048558_474_710 78
766 3300046520 Ga0495637_0049009 Ga0495637_0049009_497_736 78
767 3300046520 Ga0495637_0177451 Ga0495637_0177451_154_390 78
768 3300046522 Ga0495643_0073847 Ga0495643_0073847_1374_1610 78
769 3300046522 Ga0495643_0078686 Ga0495643_0078686_582_818 78
770 3300046522 Ga0495643_0131300 Ga0495643_0131300_143_379 78
771 3300046523 Ga0495644_0064015 Ga0495644_0064015_980_1216 78
772 3300046523 Ga0495644_0079041 Ga0495644_0079041_691_927 78
773 3300046524 Ga0495648_0046293 Ga0495648_0046293_1830_2066 78
774 3300046524 Ga0495648_0054086 Ga0495648_0054086_1035_1271 78
775 3300046524 Ga0495648_0058470 Ga0495648_0058470_599_838 78
776 3300046524 Ga0495648_0074960 Ga0495648_0074960_600_836 78
777 3300046524 Ga0495648_0079298 Ga0495648_0079298_489_725 78
778 3300046524 Ga0495648_0149432 Ga0495648_0149432_302_538 78
779 3300046524 Ga0495648_0203652 Ga0495648_0203652_466_702 78
780 3300046526 Ga0495666_0019502 Ga0495666_0019502_1414_1650 78
781 3300046526 Ga0495666_0079701 Ga0495666_0079701_375_611 78
782 3300046528 Ga0495642_0031860 Ga0495642_0031860_535_771 78
783 3300046530 Ga0495654_0000870 Ga0495654_0000870_6497_6742 78
784 3300046530 Ga0495654_0009384 Ga0495654_0009384_475_711 78
785 3300046530 Ga0495654_0010391 Ga0495654_0010391_3818_4054 78
786 3300046530 Ga0495654_0018271 Ga0495654_0018271_2418_2654 78
787 3300046530 Ga0495654_0027452 Ga0495654_0027452_2582_2818 78
788 3300046530 Ga0495654_0027896 Ga0495654_0027896_800_1039 78
789 3300046530 Ga0495654_0036713 Ga0495654_0036713_488_724 78
790 3300046530 Ga0495654_0079991 Ga0495654_0079991_1094_1330 78
791 3300046530 Ga0495654_0106309 Ga0495654_0106309_878_1114 78
792 3300046530 Ga0495654_0180117 Ga0495654_0180117_180_416 78
793 3300046530 Ga0495654_0297653 Ga0495654_0297653_19_255 78
794 3300046536 Ga0495587_0018188 Ga0495587_0018188_2534_2770 78
795 3300046536 Ga0495587_0324178 Ga0495587_0324178_609_845 78
796 3300046538 Ga0495609_0005792 Ga0495609_0005792_5584_5820 78
797 3300046538 Ga0495609_0007937 Ga0495609_0007937_2097_2333 78
798 3300046538 Ga0495609_0015538 Ga0495609_0015538_2344_2580 78
799 3300046538 Ga0495609_0043026 Ga0495609_0043026_1408_1647 78
800 3300046538 Ga0495609_0063818 Ga0495609_0063818_443_679 78
801 3300046542 Ga0495597_0043614 Ga0495597_0043614_1158_1394 78
802 3300046542 Ga0495597_0082283 Ga0495597_0082283_554_790 78
803 3300046542 Ga0495597_0206888 Ga0495597_0206888_406_642 78
804 3300046542 Ga0495597_0229701 Ga0495597_0229701_36_275 78
805 3300046557 Ga0495622_0002066 Ga0495622_0002066_8800_9036 78
806 3300046557 Ga0495622_0014065 Ga0495622_0014065_1333_1569 78
807 3300046557 Ga0495622_0046259 Ga0495622_0046259_609_845 78
808 3300046557 Ga0495622_0445457 Ga0495622_0445457_280_516 78
809 3300046558 Ga0495633_0015447 Ga0495633_0015447_1164_1400 78
810 3300046558 Ga0495633_0049604 Ga0495633_0049604_598_834 78
811 3300046558 Ga0495633_0159357 Ga0495633_0159357_112_348 78
812 3300046615 Ga0495656_0152179 Ga0495656_0152179_184_420 78
813 3300046615 Ga0495656_0715316 Ga0495656_0715316_163_399 78
814 3300046616 Ga0495668_0127672 Ga0495668_0127672_321_557 78
815 3300046642 Ga0495634_0012245 Ga0495634_0012245_1173_1409 78
816 3300046642 Ga0495634_0065442 Ga0495634_0065442_766_1002 78
817 3300046648 Ga0495611_0060264 Ga0495611_0060264_1208_1444 78
818 3300046648 Ga0495611_0078271 Ga0495611_0078271_420_656 78
819 3300046660 Ga0495625_0031997 Ga0495625_0031997_1090_1326 78
820 3300046660 Ga0495625_0063823 Ga0495625_0063823_1791_2030 78
821 3300046660 Ga0495625_0154226 Ga0495625_0154226_484_720 78
822 3300046660 Ga0495625_0155893 Ga0495625_0155893_428_664 78
823 3300046660 Ga0495625_0195570 Ga0495625_0195570_240_476 78
824 3300046660 Ga0495625_0368138 Ga0495625_0368138_475_711 78
825 3300046663 Ga0495635_0014016 Ga0495635_0014016_1333_1569 78
826 3300046664 Ga0495659_0026538 Ga0495659_0026538_553_789 78
827 3300046664 Ga0495659_0035214 Ga0495659_0035214_400_636 78
828 3300046664 Ga0495659_0349806 Ga0495659_0349806_381_617 78
829 3300046665 Ga0495661_0008915 Ga0495661_0008915_6379_6624 78
830 3300046665 Ga0495661_0027284 Ga0495661_0027284_820_1056 78
831 3300046665 Ga0495661_0118140 Ga0495661_0118140_499_735 78
832 3300046665 Ga0495661_0301024 Ga0495661_0301024_145_381 78
833 3300046665 Ga0495661_0311730 Ga0495661_0311730_121_360 78
834 3300046665 Ga0495661_0577250 Ga0495661_0577250_122_358 78
835 3300046674 Ga0495588_0173183 Ga0495588_0173183_20_256 78
836 3300046679 Ga0495623_0009827 Ga0495623_0009827_4763_4999 78
837 3300046680 Ga0495646_0012643 Ga0495646_0012643_2489_2725 78
838 3300046680 Ga0495646_0045300 Ga0495646_0045300_1396_1632 78
839 3300046689 Ga0495613_0065131 Ga0495613_0065131_1013_1249 78
840 3300046689 Ga0495613_0092377 Ga0495613_0092377_1031_1267 78
841 3300046689 Ga0495613_0161253 Ga0495613_0161253_943_1179 78
842 3300046689 Ga0495613_0747323 Ga0495613_0747323_93_329 78
843 3300046690 Ga0495624_0001003 Ga0495624_0001003_17138_17374 78
844 3300046691 Ga0495670_0000389 Ga0495670_0000389_18171_18407 78
845 3300046691 Ga0495670_0013878 Ga0495670_0013878_1353_1589 78
846 3300046691 Ga0495670_0084657 Ga0495670_0084657_1120_1356 78
847 3300046691 Ga0495670_0147650 Ga0495670_0147650_124_360 78
848 3300046691 Ga0495670_0152544 Ga0495670_0152544_37_273 78
849 3300046691 Ga0495670_0682514 Ga0495670_0682514_214_450 78
850 3300046692 Ga0495671_0000307 Ga0495671_0000307_39624_39860 78
851 3300046692 Ga0495671_0041495 Ga0495671_0041495_611_850 78
852 3300046692 Ga0495671_0055115 Ga0495671_0055115_1159_1395 78
853 3300046692 Ga0495671_0140344 Ga0495671_0140344_668_904 78
854 3300046692 Ga0495671_0195145 Ga0495671_0195145_177_413 78
855 3300046692 Ga0495671_0339607 Ga0495671_0339607_58_294 78
856 3300046694 Ga0495649_0001633 Ga0495649_0001633_4877_5113 78
857 3300046694 Ga0495649_0024279 Ga0495649_0024279_2452_2688 78
858 3300046694 Ga0495649_0036297 Ga0495649_0036297_570_809 78
859 3300046694 Ga0495649_0036768 Ga0495649_0036768_1096_1341 78
860 3300046694 Ga0495649_0067292 Ga0495649_0067292_1369_1605 78
861 3300046694 Ga0495649_0086894 Ga0495649_0086894_302_538 78
862 3300046794 Ga0495589_0000194 Ga0495589_0000194_4607_4843 78
863 3300046794 Ga0495589_0002053 Ga0495589_0002053_880_1116 78
864 3300046794 Ga0495589_0257392 Ga0495589_0257392_102_338 78
865 3300046794 Ga0495589_0266236 Ga0495589_0266236_461_697 78
866 3300046809 Ga0495600_0089290 Ga0495600_0089290_668_904 78
867 3300046810 Ga0495660_0003352 Ga0495660_0003352_4579_4824 78
868 3300046810 Ga0495660_0035438 Ga0495660_0035438_687_923 78
869 3300046810 Ga0495660_0042076 Ga0495660_0042076_397_636 78
870 3300046810 Ga0495660_0044608 Ga0495660_0044608_1284_1520 78
871 3300046810 Ga0495660_0054628 Ga0495660_0054628_110_346 78
872 3300046810 Ga0495660_0065101 Ga0495660_0065101_1149_1385 78
873 3300046810 Ga0495660_0067034 Ga0495660_0067034_576_812 78
874 3300046810 Ga0495660_0329094 Ga0495660_0329094_414_650 78
875 3300047315 Ga0495581_0095470 Ga0495581_0095470_417_653 78
876 3300047317 Ga0495604_0053907 Ga0495604_0053907_698_934 78
877 3300047317 Ga0495604_0065469 Ga0495604_0065469_1112_1348 78
878 3300047318 Ga0495636_0044292 Ga0495636_0044292_606_842 78
879 3300047319 Ga0495674_0027872 Ga0495674_0027872_1078_1314 78
880 3300047320 Ga0495672_0004930 Ga0495672_0004930_1489_1725 78
881 3300047320 Ga0495672_0015161 Ga0495672_0015161_173_409 78
882 3300047320 Ga0495672_0021422 Ga0495672_0021422_1418_1654 78
883 3300047320 Ga0495672_0064656 Ga0495672_0064656_619_855 78
884 3300047320 Ga0495672_0105399 Ga0495672_0105399_173_409 78
885 3300047321 Ga0495676_0110851 Ga0495676_0110851_562_798 78
886 3300047322 Ga0495680_0026473 Ga0495680_0026473_1198_1434 78
887 3300047322 Ga0495680_0090594 Ga0495680_0090594_2035_2271 78
888 3300047323 Ga0495683_0002776 Ga0495683_0002776_8974_9210 78
889 3300047323 Ga0495683_0006216 Ga0495683_0006216_5885_6121 78
890 3300047323 Ga0495683_0080317 Ga0495683_0080317_915_1151 78
891 3300047323 Ga0495683_0100217 Ga0495683_0100217_718_957 78
892 3300047323 Ga0495683_0110107 Ga0495683_0110107_734_970 78
893 3300047323 Ga0495683_0271858 Ga0495683_0271858_126_362 78
894 3300047443 Ga0495687_044216 Ga0495687_044216_1315_1551 78
895 3300047443 Ga0495687_115414 Ga0495687_115414_602_838 78
896 3300047446 Ga0495679_001372 Ga0495679_001372_13211_13456 78
897 3300047446 Ga0495679_001589 Ga0495679_001589_5478_5723 78
898 3300047446 Ga0495679_015499 Ga0495679_015499_544_783 78
899 3300047446 Ga0495679_030605 Ga0495679_030605_1050_1289 78
900 3300047469 Ga0495673_0003020 Ga0495673_0003020_667_903 78
901 3300047469 Ga0495673_0026774 Ga0495673_0026774_577_816 78
902 3300047469 Ga0495673_0046008 Ga0495673_0046008_1047_1283 78
903 3300047469 Ga0495673_0065731 Ga0495673_0065731_1143_1379 78
904 3300047469 Ga0495673_0068698 Ga0495673_0068698_894_1133 78
905 3300047470 Ga0495681_0005323 Ga0495681_0005323_5705_5941 78
906 3300047470 Ga0495681_0021062 Ga0495681_0021062_1160_1396 78
907 3300047470 Ga0495681_0037051 Ga0495681_0037051_853_1089 78
908 3300047470 Ga0495681_0038988 Ga0495681_0038988_1194_1430 78
909 3300047470 Ga0495681_0058247 Ga0495681_0058247_947_1186 78
910 3300047470 Ga0495681_0077921 Ga0495681_0077921_770_1006 78
911 3300047470 Ga0495681_0201669 Ga0495681_0201669_194_433 78
912 3300047471 Ga0495684_0069061 Ga0495684_0069061_1417_1653 78
913 3300047472 Ga0495686_0083666 Ga0495686_0083666_546_782 78
914 3300047472 Ga0495686_0088430 Ga0495686_0088430_651_887 78
915 3300047673 Ga0495593_0070990 Ga0495593_0070990_694_930 78
916 3300047673 Ga0495593_0071140 Ga0495593_0071140_277_513 78
917 3300047673 Ga0495593_0200653 Ga0495593_0200653_753_989 78
918 3300048088 Ga0495602_0031550 Ga0495602_0031550_3359_3595 78
919 3300048091 Ga0495626_0003523 Ga0495626_0003523_8555_8791 78
920 3300048091 Ga0495626_0009007 Ga0495626_0009007_489_725 78
921 3300048091 Ga0495626_0037662 Ga0495626_0037662_544_783 78
922 3300048091 Ga0495626_0065354 Ga0495626_0065354_125_361 78
923 3300048091 Ga0495626_0068377 Ga0495626_0068377_605_841 78
924 3300048091 Ga0495626_0073819 Ga0495626_0073819_296_532 78
925 3300048091 Ga0495626_0241831 Ga0495626_0241831_375_611 78
926 3300048091 Ga0495626_0356101 Ga0495626_0356101_71_307 78
927 3300048905 Ga0496102_0004455 Ga0496102_0004455_1612_1848 78
928 3300048906 Ga0496103_0021772 Ga0496103_0021772_2558_2794 78
929 3300048908 Ga0496105_0704587 Ga0496105_0704587_527_763 78
930 3300048909 Ga0496106_0198099 Ga0496106_0198099_175_411 78
931 3300048910 Ga0496107_1099274 Ga0496107_1099274_93_329 78
932 3300048913 Ga0496110_0494573 Ga0496110_0494573_384_620 78
933 3300048915 Ga0496112_0221243 Ga0496112_0221243_895_1131 78
934 3300048917 Ga0496114_0353194 Ga0496114_0353194_155_391 78
935 3300048918 Ga0496115_0172523 Ga0496115_0172523_1338_1574 78
936 3300048919 Ga0496116_0001088 Ga0496116_0001088_30963_31199 78
937 3300048919 Ga0496116_0002312 Ga0496116_0002312_19151_19387 78
938 3300048919 Ga0496116_0032645 Ga0496116_0032645_1015_1251 78
939 3300048919 Ga0496116_0061978 Ga0496116_0061978_953_1192 78
940 3300048919 Ga0496116_0074368 Ga0496116_0074368_761_1000 78
941 3300048920 Ga0496117_0032234 Ga0496117_0032234_1196_1432 78
942 3300048920 Ga0496117_0055410 Ga0496117_0055410_1960_2205 78
943 3300048920 Ga0496117_0088609 Ga0496117_0088609_618_857 78
944 3300048920 Ga0496117_0092318 Ga0496117_0092318_917_1165 78
945 3300048920 Ga0496117_0161415 Ga0496117_0161415_969_1208 78
946 3300048920 Ga0496117_0276673 Ga0496117_0276673_305_541 78
947 3300048921 Ga0496118_0018066 Ga0496118_0018066_5018_5257 78
948 3300048921 Ga0496118_0034843 Ga0496118_0034843_2716_2952 78
949 3300048921 Ga0496118_0051681 Ga0496118_0051681_409_654 78
950 3300048921 Ga0496118_0097736 Ga0496118_0097736_1120_1359 78
951 3300048921 Ga0496118_0230431 Ga0496118_0230431_771_1007 78
952 3300048921 Ga0496118_0578922 Ga0496118_0578922_265_501 78
953 3300048922 Ga0496119_0137789 Ga0496119_0137789_186_425 78
954 3300048922 Ga0496119_0226100 Ga0496119_0226100_23_259 78
955 3300048923 Ga0496120_0149119 Ga0496120_0149119_737_976 78
956 3300048924 Ga0496121_0022604 Ga0496121_0022604_1214_1450 78
957 3300048924 Ga0496121_0039080 Ga0496121_0039080_334_579 78
958 3300048924 Ga0496121_0042923 Ga0496121_0042923_1009_1245 78
959 3300048924 Ga0496121_0116747 Ga0496121_0116747_1105_1344 78
960 3300048924 Ga0496121_0670547 Ga0496121_0670547_347_583 78
961 3300048925 Ga0496122_0025135 Ga0496122_0025135_400_636 78
962 3300048925 Ga0496122_0048380 Ga0496122_0048380_2946_3191 78
963 3300048925 Ga0496122_0104123 Ga0496122_0104123_1135_1374 78
964 3300048925 Ga0496122_0143541 Ga0496122_0143541_264_503 78
965 3300048925 Ga0496122_0420285 Ga0496122_0420285_284_523 78
966 3300048926 Ga0496123_0082998 Ga0496123_0082998_1292_1531 78
967 3300048926 Ga0496123_0099233 Ga0496123_0099233_1307_1552 78
968 3300048926 Ga0496123_0107324 Ga0496123_0107324_724_963 78
969 3300048926 Ga0496123_0171370 Ga0496123_0171370_86_331 78
970 3300048926 Ga0496123_0374622 Ga0496123_0374622_354_590 78
971 3300048927 Ga0496124_0025284 Ga0496124_0025284_1323_1568 78
972 3300048927 Ga0496124_0072809 Ga0496124_0072809_1972_2217 78
973 3300048927 Ga0496124_0076738 Ga0496124_0076738_1170_1415 78
974 3300048927 Ga0496124_0119923 Ga0496124_0119923_918_1157 78
975 3300048927 Ga0496124_0280459 Ga0496124_0280459_344_580 78
976 3300048927 Ga0496124_0288474 Ga0496124_0288474_43_288 78
977 3300048928 Ga0496125_0005335 Ga0496125_0005335_136_381 78
978 3300048928 Ga0496125_0037228 Ga0496125_0037228_180_416 78
979 3300048928 Ga0496125_0073871 Ga0496125_0073871_1960_2205 78
980 3300048928 Ga0496125_0128524 Ga0496125_0128524_110_346 78
981 3300048929 Ga0496126_0009164 Ga0496126_0009164_9693_9938 78
982 3300048929 Ga0496126_0133460 Ga0496126_0133460_1394_1630 78
983 3300049459 Ga0495678_001578 Ga0495678_001578_2188_2424 78
984 3300049459 Ga0495678_019547 Ga0495678_019547_2239_2475 78
985 3300049459 Ga0495678_030472 Ga0495678_030472_1268_1504 78
986 3300049459 Ga0495678_039602 Ga0495678_039602_567_806 78
987 3300049459 Ga0495678_041527 Ga0495678_041527_458_694 78
988 3300049459 Ga0495678_047779 Ga0495678_047779_581_817 78
989 3300049459 Ga0495678_152370 Ga0495678_152370_180_416 78
990 3300049460 Ga0495682_0024472 Ga0495682_0024472_918_1154 78
991 3300049460 Ga0495682_0033100 Ga0495682_0033100_1086_1322 78
992 3300049460 Ga0495682_0194055 Ga0495682_0194055_378_614 78
993 3300049460 Ga0495682_0223264 Ga0495682_0223264_117_353 78
994 3300049758 Ga0501241_008359 Ga0501241_008359_1138_1374 78
995 3300053111 Ga0500572_018857 Ga0500572_018857_1038_1277 78
996 3300053126 Ga0500621_181547 Ga0500621_181547_142_378 78
997 3300053161 Ga0500634_0003648 Ga0500634_0003648_265_510 78

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

4

38

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.7164 8 59
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.6942 8 68
5wur-assembly1.cif.gz_C crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form 0.6769 5 67
2z2s-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.6724 9 70
2z2s-assembly2.cif.gz_D crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.6709 9 70
ID Description Score Start End Superfamily
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.7164 8 59 1.10.10.1320
2z2sB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.7033 9 66 1.10.10.1320
2z2sD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.687 9 66 1.10.10.1320
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6617 8 59 1.10.10.1320
3hugL00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.652 7 67 1.10.10.1320
ID Description Score Start End GO Terms
AF-A0A4R6YKZ8-F1-model_v4 Anti-sigma-K factor RskA 0.9352 3 59
AF-A0A2N2NJG7-F1-model_v4 Zinc-finger domain-containing protein 0.9042 1 59 GO:0016020
AF-A0A7C3GNG7-F1-model_v4 Zinc-finger domain-containing protein 0.83 2 61 GO:0016020
AF-A0A547P9W6-F1-model_v4 Zinc-finger domain-containing protein 0.8293 1 62
AF-A0A7C2U771-F1-model_v4 Putative zinc-finger domain-containing protein 0.8127 2 59

Feature Viewer

pLDDT pTM Quality
86.37 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map